F495158

General Info

Members Datasets Scaffolds Average Seq Length
1638 493 1635 344

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10090627|Ga0265330_100906272
Length 343
Sequence MSTETNGTQATNGFRQNDDIGEPKRLELYRSQVRLREAEQRAFDLFLQNLVKGTSHLSLGQEAVAAGFAEAMKPGDLSFCTYRGHAHTLARGVSVEKVLGELMQRDNGLMRGKGGSMHLTSVEHGVMGSYAIIGAHLPIACGAALRAQYKGQDVTVCFFGDGTTNIGAFHEALNFAAVWKLPVIFVCENNLYMEYTPIGDVTAVPSPAGDRASAYGLDKIVVDGNDADVVYRTAQAAYKKARAGGGPSLIECLTYRHSGHSRADPAKYRPEGELDRWKERDPIKIYRERLRQFGVSDDVISGIDAGVRKEVDDATEACKAAPNPPMDIITTDVYADGGWAWRN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
4 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
168 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
252 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
255 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
260 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
261 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
267 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
268 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
269 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
270 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
271 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
275 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
278 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
279 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
280 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
281 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
282 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
283 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
284 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
285 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
286 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
287 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
288 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
289 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
290 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
291 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
292 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
294 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
296 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
297 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
298 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
299 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
300 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
301 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
302 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
303 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
304 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
305 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
306 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
307 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
308 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
309 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
318 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
319 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
322 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
323 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
324 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
325 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
326 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
327 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
328 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
329 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
330 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
331 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
334 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
355 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
356 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
357 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
358 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
359 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
360 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
368 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
375 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
376 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
377 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
378 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
379 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
380 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
381 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
382 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
383 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
384 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
385 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
386 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
387 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
388 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
389 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
390 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
391 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
392 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
393 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
394 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
395 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
403 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
440 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
441 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
442 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
443 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
444 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
445 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
446 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
447 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
448 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
449 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
450 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
451 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
452 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
453 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
454 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
457 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
458 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
459 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
460 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
461 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
462 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
463 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
464 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
465 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
466 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
483 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
484 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
487 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
492 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
493 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0
Rhizoplane 8.49
Rhizosphere 87
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214572729 2209111006 Bacteria 5759
2 ARSoilYngRDRAFT_c00041 3300000042 Bacteria 20296
3 ARcpr5yngRDRAFT_c000026 3300000043 Bacteria 24110
4 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
5 ARCol0oldRDRAFT_c00711 3300000045 Bacteria 2870
6 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
7 JGI24032J14994_100057 3300001430 Bacteria 4564
8 JGI24741J21665_1000025 3300001915 Bacteria 35709
9 JGI24741J21665_1001465 3300001915 Bacteria 6757
10 JGI24741J21665_1006055 3300001915 Bacteria 2466
11 JGI24740J21852_10000407 3300001979 Bacteria 18479
12 JGI24740J21852_10001165 3300001979 Bacteria 11869
13 JGI24739J22299_10002982 3300001989 Bacteria 6484
14 JGI24737J22298_10000207 3300001990 Bacteria 19137
15 JGI24737J22298_10000999 3300001990 Bacteria 10023
16 JGI24750J21931_1000312 3300002070 Bacteria 8379
17 JGI24745J21846_1000356 3300002073 Bacteria 3970
18 JGI24745J21846_1002888 3300002073 Bacteria 1777
19 JGI24748J21848_1000458 3300002074 Bacteria 4527
20 JGI24738J21930_10000029 3300002075 Bacteria 26851
21 JGI24738J21930_10002072 3300002075 Bacteria 5371
22 JGI24749J21850_1000564 3300002076 Bacteria 5425
23 JGI24744J21845_10001388 3300002077 Bacteria 4793
24 JGI24744J21845_10002659 3300002077 Bacteria 3648
25 JGI24035J26624_1000100 3300002126 Bacteria 7313
26 JGI24742J22300_10010450 3300002244 Bacteria 1537
27 JGI25406J46586_10008875 3300003203 Bacteria 4524
28 JGI25405J52794_10009282 3300003911 Bacteria 1855
29 Ga0065717_1001978 3300005276 Bacteria 4328
30 Ga0065704_10004383 3300005289 Bacteria 8391
31 Ga0065704_10080437 3300005289 Bacteria 3934
32 Ga0065712_10001113 3300005290 Bacteria 8281
33 Ga0065715_10008397 3300005293 Bacteria 3132
34 Ga0070658_10000286 3300005327 Bacteria 44320
35 Ga0070658_10000287 3300005327 Bacteria 44279
36 Ga0070658_10010739 3300005327 Bacteria 7338
37 Ga0070658_10049596 3300005327 Bacteria 3401
38 Ga0070658_10077391 3300005327 Bacteria 2728
39 Ga0070676_10002748 3300005328 Bacteria 9084
40 Ga0070676_10076084 3300005328 Bacteria 2025
41 Ga0070676_10144012 3300005328 Bacteria 1520
42 Ga0070683_100001745 3300005329 Bacteria 16934
43 Ga0070683_100047446 3300005329 Bacteria 3969
44 Ga0070683_100192713 3300005329 Bacteria 1936
45 Ga0070683_100220620 3300005329 Bacteria 1802
46 Ga0070690_100016496 3300005330 Bacteria 4426
47 Ga0070690_100051122 3300005330 Bacteria 2637
48 Ga0070690_100151692 3300005330 Bacteria 1582
49 Ga0070690_100206401 3300005330 Bacteria 1370
50 Ga0070670_100010828 3300005331 Bacteria 7790
51 Ga0070670_100255999 3300005331 Bacteria 1525
52 Ga0070677_10002799 3300005333 Bacteria 5587
53 Ga0068869_100000687 3300005334 Bacteria 19110
54 Ga0068869_100049119 3300005334 Bacteria 3053
55 Ga0068869_100171780 3300005334 Bacteria 1694
56 Ga0070666_10004113 3300005335 Bacteria 8829
57 Ga0070666_10073992 3300005335 Bacteria 2321
58 Ga0070680_100012469 3300005336 Bacteria 6607
59 Ga0070680_100013123 3300005336 Bacteria 6448
60 Ga0070680_100051087 3300005336 Bacteria 3373
61 Ga0070680_100148616 3300005336 Bacteria 1967
62 Ga0070680_100197566 3300005336 Bacteria 1696
63 Ga0070682_100000995 3300005337 Bacteria 16400
64 Ga0070682_100070870 3300005337 Bacteria 2229
65 Ga0070682_100108667 3300005337 Bacteria 1844
66 Ga0070682_100111568 3300005337 Bacteria 1823
67 Ga0068868_100002252 3300005338 Bacteria 13345
68 Ga0068868_100008629 3300005338 Bacteria 7298
69 Ga0068868_100043180 3300005338 Bacteria 3521
70 Ga0070660_100003739 3300005339 Bacteria 10517
71 Ga0070660_100006704 3300005339 Bacteria 7989
72 Ga0070660_100007670 3300005339 Bacteria 7520
73 Ga0070660_100041053 3300005339 Bacteria 3525
74 Ga0070660_100042225 3300005339 Bacteria 3480
75 Ga0070660_100058459 3300005339 Bacteria 2988
76 Ga0070689_100006692 3300005340 Bacteria 8009
77 Ga0070689_100014402 3300005340 Bacteria 5744
78 Ga0070689_100061730 3300005340 Bacteria 2915
79 Ga0070689_100232523 3300005340 Bacteria 1516
80 Ga0070691_10002585 3300005341 Bacteria 8072
81 Ga0070691_10042496 3300005341 Bacteria 2151
82 Ga0070691_10070651 3300005341 Bacteria 1694
83 Ga0070687_100001763 3300005343 Bacteria 7805
84 Ga0070687_100044396 3300005343 Bacteria 2264
85 Ga0070687_100060553 3300005343 Bacteria 1997
86 Ga0070687_100121317 3300005343 Bacteria 1495
87 Ga0070687_100179631 3300005343 Bacteria 1267
88 Ga0070661_100000508 3300005344 Bacteria 29885
89 Ga0070661_100004343 3300005344 Bacteria 9783
90 Ga0070661_100116064 3300005344 Bacteria 2002
91 Ga0070668_100010188 3300005347 Bacteria 6971
92 Ga0070668_100024657 3300005347 Bacteria 4558
93 Ga0070668_100124529 3300005347 Bacteria 2064
94 Ga0070668_100205852 3300005347 Bacteria 1617
95 Ga0070669_100000634 3300005353 Bacteria 26021
96 Ga0070669_100063929 3300005353 Bacteria 2709
97 Ga0070669_100093907 3300005353 Bacteria 2253
98 Ga0070669_100110455 3300005353 Bacteria 2086
99 Ga0070669_100154471 3300005353 Bacteria 1779
100 Ga0070669_100169002 3300005353 Bacteria 1704
101 Ga0070675_100000240 3300005354 Bacteria 35499
102 Ga0070675_100018150 3300005354 Bacteria 5599
103 Ga0070675_100308582 3300005354 Bacteria 1395
104 Ga0070675_100463543 3300005354 Bacteria 1138
105 Ga0070671_100001584 3300005355 Bacteria 17103
106 Ga0070671_100002087 3300005355 Bacteria 15393
107 Ga0070671_100004330 3300005355 Bacteria 11229
108 Ga0070671_100016478 3300005355 Bacteria 5974
109 Ga0070671_100049560 3300005355 Bacteria 3494
110 Ga0070674_100021278 3300005356 Bacteria 4159
111 Ga0070674_100036239 3300005356 Bacteria 3309
112 Ga0070674_100042512 3300005356 Bacteria 3088
113 Ga0070674_100069635 3300005356 Bacteria 2482
114 Ga0070673_100000366 3300005364 Bacteria 23666
115 Ga0070673_100004762 3300005364 Bacteria 8625
116 Ga0070673_100090998 3300005364 Bacteria 2493
117 Ga0070673_100132727 3300005364 Bacteria 2092
118 Ga0070688_100004173 3300005365 Bacteria 7499
119 Ga0070688_100004277 3300005365 Bacteria 7422
120 Ga0070688_100025604 3300005365 Bacteria 3494
121 Ga0070688_100055393 3300005365 Bacteria 2487
122 Ga0070688_100069375 3300005365 Bacteria 2250
123 Ga0070659_100002882 3300005366 Bacteria 12244
124 Ga0070659_100006478 3300005366 Bacteria 8451
125 Ga0070659_100007010 3300005366 Bacteria 8162
126 Ga0070659_100039631 3300005366 Bacteria 3678
127 Ga0070667_100023647 3300005367 Bacteria 5100
128 Ga0070703_10004429 3300005406 Bacteria 3953
129 Ga0070703_10040929 3300005406 Bacteria 1443
130 Ga0070709_10001838 3300005434 Bacteria 11515
131 Ga0070709_10004638 3300005434 Bacteria 7419
132 Ga0070709_10046273 3300005434 Bacteria 2704
133 Ga0070709_10051907 3300005434 Bacteria 2575
134 Ga0070709_10304177 3300005434 Bacteria 1165
135 Ga0070714_100023305 3300005435 Bacteria 5083
136 Ga0070714_100034036 3300005435 Bacteria 4266
137 Ga0070714_100106381 3300005435 Bacteria 2479
138 Ga0070713_100002022 3300005436 Bacteria 13099
139 Ga0070713_100008099 3300005436 Bacteria 7431
140 Ga0070713_100008135 3300005436 Bacteria 7422
141 Ga0070713_100329193 3300005436 Bacteria 1413
142 Ga0070710_10019867 3300005437 Bacteria 3478
143 Ga0070710_10020272 3300005437 Bacteria 3447
144 Ga0070710_10024257 3300005437 Bacteria 3197
145 Ga0070710_10033835 3300005437 Bacteria 2777
146 Ga0070701_10000039 3300005438 Bacteria 32727
147 Ga0070701_10014385 3300005438 Bacteria 3627
148 Ga0070701_10014594 3300005438 Bacteria 3606
149 Ga0070711_100028452 3300005439 Bacteria 3678
150 Ga0070711_100028663 3300005439 Bacteria 3666
151 Ga0070711_100065085 3300005439 Bacteria 2548
152 Ga0070705_100000495 3300005440 Bacteria 22727
153 Ga0070705_100000768 3300005440 Bacteria 18121
154 Ga0070705_100011472 3300005440 Bacteria 4470
155 Ga0070700_100000735 3300005441 Bacteria 16194
156 Ga0070694_100011335 3300005444 Bacteria 5520
157 Ga0070694_100015470 3300005444 Bacteria 4794
158 Ga0070694_100046026 3300005444 Bacteria 2926
159 Ga0070708_100003217 3300005445 Bacteria 12740
160 Ga0070708_100016195 3300005445 Bacteria 6180
161 Ga0070708_100253126 3300005445 Bacteria 1655
162 Ga0070663_100005862 3300005455 Bacteria 7344
163 Ga0070663_100008786 3300005455 Bacteria 6232
164 Ga0070663_100097831 3300005455 Bacteria 2185
165 Ga0070663_100220571 3300005455 Bacteria 1488
166 Ga0070678_100007345 3300005456 Bacteria 6528
167 Ga0070678_100030522 3300005456 Bacteria 3706
168 Ga0070678_100057336 3300005456 Bacteria 2853
169 Ga0070678_100072044 3300005456 Bacteria 2589
170 Ga0070678_100146122 3300005456 Bacteria 1898
171 Ga0070662_100013401 3300005457 Bacteria 5456
172 Ga0070662_100072656 3300005457 Bacteria 2540
173 Ga0070662_100176282 3300005457 Bacteria 1682
174 Ga0070681_10014286 3300005458 Bacteria 7901
175 Ga0070681_10025727 3300005458 Bacteria 5917
176 Ga0070681_10302665 3300005458 Bacteria 1508
177 Ga0068867_100015200 3300005459 Bacteria 5458
178 Ga0068867_100055791 3300005459 Bacteria 2921
179 Ga0068867_100096766 3300005459 Bacteria 2248
180 Ga0070685_10010154 3300005466 Bacteria 4888
181 Ga0070685_10012727 3300005466 Bacteria 4426
182 Ga0070706_100000079 3300005467 Bacteria 111752
183 Ga0070706_100076142 3300005467 Bacteria 3106
184 Ga0070698_100206265 3300005471 Bacteria 1901
185 Ga0070699_100000158 3300005518 Bacteria 64029
186 Ga0070699_100006196 3300005518 Bacteria 10452
187 Ga0070679_100071918 3300005530 Bacteria 3450
188 Ga0070679_100151436 3300005530 Bacteria 2296
189 Ga0070679_100242700 3300005530 Bacteria 1759
190 Ga0070679_100249981 3300005530 Bacteria 1729
191 Ga0070679_100355882 3300005530 Bacteria 1411
192 Ga0070684_100000334 3300005535 Bacteria 32646
193 Ga0070684_100109348 3300005535 Bacteria 2477
194 Ga0070684_100153473 3300005535 Bacteria 2087
195 Ga0070697_100041288 3300005536 Bacteria 3733
196 Ga0070697_100119776 3300005536 Bacteria 2201
197 Ga0070697_100126520 3300005536 Bacteria 2141
198 Ga0070697_100206548 3300005536 Bacteria 1671
199 Ga0068853_100000437 3300005539 Bacteria 28499
200 Ga0068853_100007315 3300005539 Bacteria 8836
201 Ga0068853_100025076 3300005539 Bacteria 5003
202 Ga0068853_100165587 3300005539 Bacteria 1997
203 Ga0068853_100166347 3300005539 Bacteria 1993
204 Ga0068853_100193311 3300005539 Bacteria 1850
205 Ga0070672_100000261 3300005543 Bacteria 29848
206 Ga0070672_100001595 3300005543 Bacteria 14069
207 Ga0070672_100290221 3300005543 Bacteria 1385
208 Ga0070686_100026701 3300005544 Bacteria 3487
209 Ga0070686_100057569 3300005544 Bacteria 2497
210 Ga0070686_100105663 3300005544 Bacteria 1909
211 Ga0070686_100168629 3300005544 Bacteria 1547
212 Ga0070695_100028468 3300005545 Bacteria 3467
213 Ga0070695_100041793 3300005545 Bacteria 2907
214 Ga0070696_100115734 3300005546 Bacteria 1935
215 Ga0070693_100005605 3300005547 Bacteria 6052
216 Ga0070693_100014546 3300005547 Bacteria 4035
217 Ga0070665_100081554 3300005548 Bacteria 3240
218 Ga0070665_100103652 3300005548 Bacteria 2848
219 Ga0070665_100343267 3300005548 Bacteria 1498
220 Ga0070704_100000257 3300005549 Bacteria 23020
221 Ga0070704_100031525 3300005549 Bacteria 3567
222 Ga0068855_100000036 3300005563 Bacteria 162849
223 Ga0068855_100014384 3300005563 Bacteria 9527
224 Ga0068855_100071737 3300005563 Bacteria 4026
225 Ga0068855_100077710 3300005563 Bacteria 3851
226 Ga0068855_100110210 3300005563 Bacteria 3160
227 Ga0068855_100132341 3300005563 Bacteria 2847
228 Ga0068855_100262014 3300005563 Bacteria 1925
229 Ga0068855_100329994 3300005563 Bacteria 1684
230 Ga0070664_100033970 3300005564 Bacteria 4276
231 Ga0070664_100046121 3300005564 Bacteria 3681
232 Ga0070664_100097474 3300005564 Bacteria 2553
233 Ga0070664_100106928 3300005564 Bacteria 2438
234 Ga0068857_100001153 3300005577 Bacteria 20626
235 Ga0068857_100002886 3300005577 Bacteria 14148
236 Ga0068857_100046231 3300005577 Bacteria 3863
237 Ga0068857_100056825 3300005577 Bacteria 3473
238 Ga0068857_100056849 3300005577 Bacteria 3472
239 Ga0068857_100246785 3300005577 Bacteria 1636
240 Ga0068857_100254955 3300005577 Bacteria 1609
241 Ga0068854_100002010 3300005578 Bacteria 12456
242 Ga0068854_100015614 3300005578 Bacteria 5036
243 Ga0068854_100055290 3300005578 Bacteria 2857
244 Ga0068854_100067011 3300005578 Bacteria 2614
245 Ga0068854_100321681 3300005578 Bacteria 1257
246 Ga0068856_100000589 3300005614 Bacteria 39780
247 Ga0068856_100164649 3300005614 Bacteria 2229
248 Ga0068856_100248595 3300005614 Bacteria 1793
249 Ga0068856_100288264 3300005614 Bacteria 1659
250 Ga0070702_100000645 3300005615 Bacteria 12963
251 Ga0070702_100140066 3300005615 Bacteria 1540
252 Ga0068852_100000781 3300005616 Bacteria 20893
253 Ga0068852_100002348 3300005616 Bacteria 13029
254 Ga0068852_100006940 3300005616 Bacteria 8240
255 Ga0068852_100017537 3300005616 Bacteria 5620
256 Ga0068852_100102532 3300005616 Bacteria 2586
257 Ga0068852_100175059 3300005616 Bacteria 2014
258 Ga0068852_100183398 3300005616 Bacteria 1970
259 Ga0068859_100002511 3300005617 Bacteria 18638
260 Ga0068859_100019542 3300005617 Bacteria 6806
261 Ga0068864_100001792 3300005618 Bacteria 17623
262 Ga0068864_100022084 3300005618 Bacteria 5334
263 Ga0068864_100026460 3300005618 Bacteria 4892
264 Ga0068864_100115565 3300005618 Bacteria 2394
265 Ga0068864_100125788 3300005618 Bacteria 2297
266 Ga0068864_100172364 3300005618 Bacteria 1974
267 Ga0068866_10020626 3300005718 Bacteria 3022
268 Ga0068866_10066469 3300005718 Bacteria 1889
269 Ga0068866_10195415 3300005718 Bacteria 1205
270 Ga0068861_100000051 3300005719 Bacteria 54909
271 Ga0068861_100000248 3300005719 Bacteria 29792
272 Ga0068861_100066532 3300005719 Bacteria 2778
273 Ga0068861_100208182 3300005719 Bacteria 1646
274 Ga0068851_10004860 3300005834 Bacteria 6083
275 Ga0068851_10021358 3300005834 Bacteria 3142
276 Ga0068870_10000157 3300005840 Bacteria 23872
277 Ga0068863_100051551 3300005841 Bacteria 3900
278 Ga0068863_100403626 3300005841 Bacteria 1337
279 Ga0068858_100049977 3300005842 Bacteria 3871
280 Ga0068858_100220049 3300005842 Bacteria 1798
281 Ga0068858_100239069 3300005842 Bacteria 1723
282 Ga0068858_100420989 3300005842 Bacteria 1284
283 Ga0068860_100005729 3300005843 Bacteria 12528
284 Ga0068860_100029337 3300005843 Bacteria 5290
285 Ga0068860_100047355 3300005843 Bacteria 4098
286 Ga0068862_100001649 3300005844 Bacteria 20295
287 Ga0068862_100004004 3300005844 Bacteria 12493
288 Ga0068862_100016995 3300005844 Bacteria 6054
289 Ga0081455_10000059 3300005937 Bacteria 119148
290 Ga0081455_10002427 3300005937 Bacteria 22238
291 Ga0081455_10070465 3300005937 Bacteria 2903
292 Ga0081538_10004000 3300005981 Bacteria 13727
293 Ga0081538_10079951 3300005981 Bacteria 1746
294 Ga0081540_1012817 3300005983 Bacteria 5485
295 Ga0081540_1014080 3300005983 Bacteria 5152
296 Ga0081540_1030650 3300005983 Bacteria 2975
297 Ga0081540_1038962 3300005983 Bacteria 2497
298 Ga0081539_10002801 3300005985 Bacteria 23305
299 Ga0081539_10041780 3300005985 Bacteria 2677
300 Ga0070717_10000161 3300006028 Bacteria 50633
301 Ga0070717_10027405 3300006028 Bacteria 4554
302 Ga0070717_10261367 3300006028 Bacteria 1532
303 Ga0070717_10275905 3300006028 Bacteria 1490
304 Ga0075365_10003616 3300006038 Bacteria 8004
305 Ga0075365_10007764 3300006038 Bacteria 6041
306 Ga0075365_10129110 3300006038 Bacteria 1748
307 Ga0075365_10178284 3300006038 Bacteria 1485
308 Ga0075368_10020861 3300006042 Bacteria 2484
309 Ga0075368_10032981 3300006042 Bacteria 2013
310 Ga0075363_100018353 3300006048 Bacteria 3485
311 Ga0075432_10027866 3300006058 Bacteria 1947
312 Ga0070715_10001029 3300006163 Bacteria 7873
313 Ga0070715_10002418 3300006163 Bacteria 5728
314 Ga0070715_10011895 3300006163 Bacteria 3147
315 Ga0070716_100014114 3300006173 Bacteria 4087
316 Ga0070712_100000205 3300006175 Bacteria 33282
317 Ga0070712_100002872 3300006175 Bacteria 10671
318 Ga0070712_100004319 3300006175 Bacteria 8752
319 Ga0070712_100012564 3300006175 Bacteria 5385
320 Ga0070712_100106824 3300006175 Bacteria 2081
321 Ga0070712_100226411 3300006175 Bacteria 1483
322 Ga0075362_10001107 3300006177 Bacteria 8361
323 Ga0075367_10037538 3300006178 Bacteria 2816
324 Ga0075367_10056375 3300006178 Bacteria 2334
325 Ga0075367_10199100 3300006178 Bacteria 1251
326 Ga0075367_10243423 3300006178 Bacteria 1127
327 Ga0075369_10013491 3300006186 Bacteria 3245
328 Ga0075366_10008250 3300006195 Bacteria 5782
329 Ga0075366_10047706 3300006195 Bacteria 2539
330 Ga0075366_10076291 3300006195 Bacteria 2000
331 Ga0097621_100012511 3300006237 Bacteria 6295
332 Ga0097621_100019187 3300006237 Bacteria 5244
333 Ga0097621_100027090 3300006237 Bacteria 4503
334 Ga0097621_100046146 3300006237 Bacteria 3524
335 Ga0068871_100023462 3300006358 Bacteria 4774
336 Ga0068871_100037454 3300006358 Bacteria 3868
337 Ga0068871_100368486 3300006358 Bacteria 1274
338 Ga0075428_100000129 3300006844 Bacteria 65954
339 Ga0075428_100028381 3300006844 Bacteria 6190
340 Ga0075428_100116804 3300006844 Bacteria 2906
341 Ga0075428_100252902 3300006844 Bacteria 1898
342 Ga0075428_100300821 3300006844 Bacteria 1725
343 Ga0075430_100000070 3300006846 Bacteria 55805
344 Ga0075430_100001391 3300006846 Bacteria 19638
345 Ga0075430_100121987 3300006846 Bacteria 2173
346 Ga0075431_100000235 3300006847 Bacteria 41569
347 Ga0075431_100001221 3300006847 Bacteria 23276
348 Ga0075431_100007118 3300006847 Bacteria 11115
349 Ga0075431_100266723 3300006847 Bacteria 1736
350 Ga0075433_10000867 3300006852 Bacteria 21175
351 Ga0075433_10044445 3300006852 Bacteria 3859
352 Ga0075434_100000212 3300006871 Bacteria 39628
353 Ga0075434_100011470 3300006871 Bacteria 8363
354 Ga0075434_100019151 3300006871 Bacteria 6619
355 Ga0075434_100242874 3300006871 Bacteria 1821
356 Ga0075434_100281503 3300006871 Bacteria 1683
357 Ga0075434_100325016 3300006871 Bacteria 1559
358 Ga0075434_100394635 3300006871 Bacteria 1404
359 Ga0075429_100000347 3300006880 Bacteria 33776
360 Ga0075429_100000514 3300006880 Bacteria 29300
361 Ga0075429_100024317 3300006880 Bacteria 5256
362 Ga0068865_100000131 3300006881 Bacteria 38862
363 Ga0068865_100066778 3300006881 Bacteria 2538
364 Ga0068865_100116680 3300006881 Bacteria 1978
365 Ga0068865_100183147 3300006881 Bacteria 1614
366 Ga0075436_100002520 3300006914 Bacteria 12602
367 Ga0075436_100171117 3300006914 Bacteria 1534
368 Ga0075436_100180101 3300006914 Bacteria 1493
369 Ga0097620_100002511 3300006931 Bacteria 18638
370 Ga0097620_100019543 3300006931 Bacteria 6806
371 Ga0075435_100159150 3300007076 Bacteria 1901
372 Ga0075435_100159943 3300007076 Bacteria 1896
373 Ga0075435_100327341 3300007076 Bacteria 1312
374 Ga0099794_10000104 3300007265 Bacteria 31247
375 Ga0105251_10005093 3300009011 Bacteria 8699
376 Ga0105251_10078812 3300009011 Bacteria 1525
377 Ga0105240_10001330 3300009093 Bacteria 42531
378 Ga0105240_10007716 3300009093 Bacteria 15569
379 Ga0105240_10012388 3300009093 Bacteria 11777
380 Ga0105240_10018367 3300009093 Bacteria 9393
381 Ga0105240_10035904 3300009093 Bacteria 6382
382 Ga0105240_10087796 3300009093 Bacteria 3807
383 Ga0105240_10125616 3300009093 Bacteria 3083
384 Ga0105240_10248802 3300009093 Bacteria 2057
385 Ga0105240_10394102 3300009093 Bacteria 1561
386 Ga0105240_10463024 3300009093 Bacteria 1416
387 Ga0111539_10000138 3300009094 Bacteria 82968
388 Ga0111539_10002172 3300009094 Bacteria 26225
389 Ga0111539_10005247 3300009094 Bacteria 16787
390 Ga0111539_10020603 3300009094 Bacteria 8121
391 Ga0111539_10039131 3300009094 Bacteria 5717
392 Ga0111539_10041626 3300009094 Bacteria 5521
393 Ga0111539_10287330 3300009094 Bacteria 1914
394 Ga0105245_10006956 3300009098 Bacteria 9921
395 Ga0105245_10026321 3300009098 Bacteria 5120
396 Ga0105245_10029390 3300009098 Bacteria 4854
397 Ga0105245_10050776 3300009098 Bacteria 3718
398 Ga0105245_10188627 3300009098 Bacteria 1974
399 Ga0105247_10052546 3300009101 Bacteria 2513
400 Ga0114129_10001559 3300009147 Bacteria 31121
401 Ga0114129_10010376 3300009147 Bacteria 13285
402 Ga0114129_10011994 3300009147 Bacteria 12325
403 Ga0114129_10086220 3300009147 Bacteria 4355
404 Ga0114129_10215521 3300009147 Bacteria 2593
405 Ga0105243_10005115 3300009148 Bacteria 10287
406 Ga0105243_10061048 3300009148 Bacteria 3013
407 Ga0105243_10098179 3300009148 Bacteria 2426
408 Ga0105243_10392054 3300009148 Bacteria 1287
409 Ga0105241_10001689 3300009174 Bacteria 16773
410 Ga0105241_10002993 3300009174 Bacteria 12618
411 Ga0105241_10023432 3300009174 Bacteria 4578
412 Ga0105241_10059318 3300009174 Bacteria 2942
413 Ga0105242_10000876 3300009176 Bacteria 23373
414 Ga0105242_10003073 3300009176 Bacteria 13031
415 Ga0105242_10015139 3300009176 Bacteria 5987
416 Ga0105242_10024033 3300009176 Bacteria 4810
417 Ga0105242_10133655 3300009176 Bacteria 2145
418 Ga0105248_10000324 3300009177 Bacteria 56570
419 Ga0105248_10020817 3300009177 Bacteria 7266
420 Ga0105248_10039924 3300009177 Bacteria 5261
421 Ga0105248_10328805 3300009177 Bacteria 1722
422 Ga0105248_10646959 3300009177 Bacteria 1193
423 Ga0105237_10009803 3300009545 Bacteria 10240
424 Ga0105237_10011026 3300009545 Bacteria 9589
425 Ga0105237_10014642 3300009545 Bacteria 8190
426 Ga0105237_10128931 3300009545 Bacteria 2524
427 Ga0105237_10377943 3300009545 Bacteria 1421
428 Ga0105238_10014770 3300009551 Bacteria 7897
429 Ga0105238_10016698 3300009551 Bacteria 7438
430 Ga0105238_10087181 3300009551 Bacteria 3108
431 Ga0105238_10093856 3300009551 Bacteria 2988
432 Ga0105238_10120036 3300009551 Bacteria 2609
433 Ga0105238_10172821 3300009551 Bacteria 2137
434 Ga0105238_10210975 3300009551 Bacteria 1918
435 Ga0105249_10000475 3300009553 Bacteria 37277
436 Ga0105249_10011981 3300009553 Bacteria 7627
437 Ga0105249_10021249 3300009553 Bacteria 5811
438 Ga0105249_10069550 3300009553 Bacteria 3249
439 Ga0105148_100041 3300009978 Bacteria 18876
440 Ga0099796_10003147 3300010159 Bacteria 3770
441 Ga0105239_10007843 3300010375 Bacteria 12211
442 Ga0105239_10028994 3300010375 Bacteria 6084
443 Ga0105239_10049307 3300010375 Bacteria 4617
444 Ga0105239_10066457 3300010375 Bacteria 3961
445 Ga0105239_10159882 3300010375 Bacteria 2516
446 Ga0105239_10663913 3300010375 Bacteria 1191
447 Ga0105246_10000658 3300011119 Bacteria 19348
448 Ga0105246_10012606 3300011119 Bacteria 5280
449 Ga0157316_1003265 3300012510 Bacteria 1158
450 Ga0157373_10011374 3300013100 Bacteria 6544
451 Ga0157371_10000347 3300013102 Bacteria 59480
452 Ga0157370_10000047 3300013104 Bacteria 124911
453 Ga0157370_10003270 3300013104 Bacteria 19098
454 Ga0157370_10031568 3300013104 Bacteria 5180
455 Ga0157370_10043714 3300013104 Bacteria 4310
456 Ga0157370_10106369 3300013104 Bacteria 2625
457 Ga0157369_10000342 3300013105 Bacteria 61773
458 Ga0157369_10052363 3300013105 Bacteria 4417
459 Ga0157369_10120270 3300013105 Bacteria 2787
460 Ga0157374_10000671 3300013296 Bacteria 30150
461 Ga0157374_10014782 3300013296 Bacteria 6836
462 Ga0157374_10022077 3300013296 Bacteria 5673
463 Ga0157374_10023203 3300013296 Bacteria 5545
464 Ga0157374_10458819 3300013296 Bacteria 1276
465 Ga0157374_10533353 3300013296 Bacteria 1180
466 Ga0157378_10013283 3300013297 Bacteria 7201
467 Ga0157378_10066434 3300013297 Bacteria 3230
468 Ga0163162_10002947 3300013306 Bacteria 16240
469 Ga0163162_10003419 3300013306 Bacteria 15152
470 Ga0163162_10131050 3300013306 Bacteria 2616
471 Ga0157372_10003476 3300013307 Bacteria 16979
472 Ga0157372_10007553 3300013307 Bacteria 11558
473 Ga0157372_10025315 3300013307 Bacteria 6450
474 Ga0157375_10001420 3300013308 Bacteria 20603
475 Ga0157375_10230558 3300013308 Bacteria 2011
476 Ga0157375_10757972 3300013308 Bacteria 1121
477 Ga0157375_10758974 3300013308 Bacteria 1121
478 Ga0163163_10080840 3300014325 Bacteria 3251
479 Ga0163163_10141198 3300014325 Bacteria 2451
480 Ga0163163_10155801 3300014325 Bacteria 2329
481 Ga0157380_10000678 3300014326 Bacteria 21096
482 Ga0157380_10003447 3300014326 Bacteria 10866
483 Ga0157380_10085590 3300014326 Bacteria 2588
484 Ga0157380_10123281 3300014326 Bacteria 2198
485 Ga0157377_10000275 3300014745 Bacteria 24793
486 Ga0157377_10009768 3300014745 Bacteria 4723
487 Ga0157379_10000345 3300014968 Bacteria 37352
488 Ga0157379_10135502 3300014968 Bacteria 2218
489 Ga0157379_10138117 3300014968 Bacteria 2197
490 Ga0157376_10005716 3300014969 Bacteria 8711
491 Ga0157376_10231630 3300014969 Bacteria 1716
492 Ga0163161_10002164 3300017792 Bacteria 14174
493 Ga0163161_10007158 3300017792 Bacteria 7713
494 Ga0206353_10434420 3300020082 Bacteria 2126
495 Ga0213876_10060622 3300021384 Bacteria 1996
496 Ga0213876_10094220 3300021384 Bacteria 1586
497 Ga0213875_10000046 3300021388 Bacteria 149850
498 Ga0224572_1007631 3300024225 Bacteria 1986
499 Ga0228598_1003796 3300024227 Bacteria 3224
500 Ga0209233_1010321 3300025261 Bacteria 2804
501 Ga0207666_1000035 3300025271 Bacteria 27333
502 Ga0207666_1000998 3300025271 Bacteria 3359
503 Ga0207673_1000303 3300025290 Bacteria 4961
504 Ga0209758_1000244 3300025297 Bacteria 112497
505 Ga0207697_10001229 3300025315 Bacteria 14026
506 Ga0207697_10026509 3300025315 Bacteria 2370
507 Ga0207656_10000752 3300025321 Bacteria 10609
508 Ga0207656_10033577 3300025321 Bacteria 2138
509 Ga0207656_10035134 3300025321 Bacteria 2097
510 Ga0207713_1017546 3300025735 Bacteria 3582
511 Ga0207653_10002111 3300025885 Bacteria 6335
512 Ga0207653_10011499 3300025885 Bacteria 2761
513 Ga0207653_10042733 3300025885 Bacteria 1491
514 Ga0207682_10000048 3300025893 Bacteria 50998
515 Ga0207682_10000375 3300025893 Bacteria 20659
516 Ga0207692_10008590 3300025898 Bacteria 4235
517 Ga0207642_10015144 3300025899 Bacteria 2865
518 Ga0207642_10037202 3300025899 Bacteria 2095
519 Ga0207710_10005171 3300025900 Bacteria 5640
520 Ga0207710_10008040 3300025900 Bacteria 4459
521 Ga0207710_10083142 3300025900 Bacteria 1488
522 Ga0207688_10001064 3300025901 Bacteria 14048
523 Ga0207688_10004400 3300025901 Bacteria 7669
524 Ga0207688_10013944 3300025901 Bacteria 4369
525 Ga0207688_10067240 3300025901 Bacteria 2028
526 Ga0207688_10079122 3300025901 Bacteria 1875
527 Ga0207680_10006663 3300025903 Bacteria 5603
528 Ga0207680_10039354 3300025903 Bacteria 2743
529 Ga0207680_10129922 3300025903 Bacteria 1659
530 Ga0207680_10181794 3300025903 Bacteria 1422
531 Ga0207647_10001033 3300025904 Bacteria 21556
532 Ga0207647_10003833 3300025904 Bacteria 11250
533 Ga0207647_10034785 3300025904 Bacteria 3213
534 Ga0207647_10056432 3300025904 Bacteria 2410
535 Ga0207685_10010113 3300025905 Bacteria 2770
536 Ga0207699_10000944 3300025906 Bacteria 13851
537 Ga0207699_10022706 3300025906 Bacteria 3405
538 Ga0207699_10031167 3300025906 Bacteria 2991
539 Ga0207645_10000528 3300025907 Bacteria 31825
540 Ga0207645_10013908 3300025907 Bacteria 5397
541 Ga0207645_10027707 3300025907 Bacteria 3658
542 Ga0207645_10040271 3300025907 Bacteria 2993
543 Ga0207645_10166388 3300025907 Bacteria 1444
544 Ga0207643_10001399 3300025908 Bacteria 13828
545 Ga0207643_10002110 3300025908 Bacteria 10953
546 Ga0207705_10000014 3300025909 Bacteria 434286
547 Ga0207705_10000282 3300025909 Bacteria 48349
548 Ga0207705_10173634 3300025909 Bacteria 1624
549 Ga0207684_10000068 3300025910 Bacteria 191048
550 Ga0207684_10240228 3300025910 Bacteria 1563
551 Ga0207654_10017052 3300025911 Bacteria 3791
552 Ga0207654_10022628 3300025911 Bacteria 3355
553 Ga0207654_10047698 3300025911 Bacteria 2448
554 Ga0207654_10083139 3300025911 Bacteria 1932
555 Ga0207654_10193833 3300025911 Bacteria 1334
556 Ga0207707_10014096 3300025912 Bacteria 6968
557 Ga0207695_10001715 3300025913 Bacteria 35105
558 Ga0207695_10002674 3300025913 Bacteria 26036
559 Ga0207695_10021087 3300025913 Bacteria 7442
560 Ga0207695_10080587 3300025913 Bacteria 3296
561 Ga0207695_10092597 3300025913 Bacteria 3033
562 Ga0207695_10139755 3300025913 Bacteria 2372
563 Ga0207695_10140473 3300025913 Bacteria 2364
564 Ga0207695_10386884 3300025913 Bacteria 1284
565 Ga0207671_10003066 3300025914 Bacteria 17081
566 Ga0207671_10012757 3300025914 Bacteria 6739
567 Ga0207671_10052529 3300025914 Bacteria 3020
568 Ga0207693_10000988 3300025915 Bacteria 25527
569 Ga0207693_10005773 3300025915 Bacteria 10265
570 Ga0207693_10006970 3300025915 Bacteria 9334
571 Ga0207693_10007963 3300025915 Bacteria 8703
572 Ga0207693_10014858 3300025915 Bacteria 6254
573 Ga0207693_10024106 3300025915 Bacteria 4831
574 Ga0207693_10033629 3300025915 Bacteria 4045
575 Ga0207693_10056234 3300025915 Bacteria 3085
576 Ga0207663_10018467 3300025916 Bacteria 3908
577 Ga0207663_10047344 3300025916 Bacteria 2654
578 Ga0207663_10090652 3300025916 Bacteria 2027
579 Ga0207663_10243044 3300025916 Bacteria 1321
580 Ga0207660_10000104 3300025917 Bacteria 47254
581 Ga0207660_10030811 3300025917 Bacteria 3688
582 Ga0207660_10174289 3300025917 Bacteria 1667
583 Ga0207660_10263247 3300025917 Bacteria 1364
584 Ga0207662_10003322 3300025918 Bacteria 8255
585 Ga0207662_10044933 3300025918 Bacteria 2610
586 Ga0207662_10079705 3300025918 Bacteria 1995
587 Ga0207657_10001210 3300025919 Bacteria 27503
588 Ga0207657_10003518 3300025919 Bacteria 16733
589 Ga0207657_10003591 3300025919 Bacteria 16550
590 Ga0207657_10011458 3300025919 Bacteria 8804
591 Ga0207657_10023774 3300025919 Bacteria 5698
592 Ga0207657_10039754 3300025919 Bacteria 4176
593 Ga0207649_10000141 3300025920 Bacteria 60047
594 Ga0207649_10001058 3300025920 Bacteria 16875
595 Ga0207649_10003604 3300025920 Bacteria 8460
596 Ga0207649_10059063 3300025920 Bacteria 2405
597 Ga0207649_10080617 3300025920 Bacteria 2105
598 Ga0207652_10001526 3300025921 Bacteria 20428
599 Ga0207652_10047331 3300025921 Bacteria 3673
600 Ga0207652_10113150 3300025921 Bacteria 2409
601 Ga0207652_10131092 3300025921 Bacteria 2236
602 Ga0207652_10187655 3300025921 Bacteria 1859
603 Ga0207652_10250694 3300025921 Bacteria 1596
604 Ga0207646_10028008 3300025922 Bacteria 5134
605 Ga0207681_10018331 3300025923 Bacteria 4410
606 Ga0207681_10041137 3300025923 Bacteria 3080
607 Ga0207694_10001546 3300025924 Bacteria 19539
608 Ga0207694_10009156 3300025924 Bacteria 7474
609 Ga0207694_10202298 3300025924 Bacteria 1616
610 Ga0207694_10346294 3300025924 Bacteria 1229
611 Ga0207650_10002081 3300025925 Bacteria 13987
612 Ga0207650_10002462 3300025925 Bacteria 12882
613 Ga0207650_10009736 3300025925 Bacteria 6572
614 Ga0207650_10186084 3300025925 Bacteria 1657
615 Ga0207659_10000052 3300025926 Bacteria 79692
616 Ga0207659_10040646 3300025926 Bacteria 3253
617 Ga0207659_10061654 3300025926 Bacteria 2704
618 Ga0207659_10189568 3300025926 Bacteria 1635
619 Ga0207659_10202473 3300025926 Bacteria 1586
620 Ga0207687_10000097 3300025927 Bacteria 64441
621 Ga0207687_10021450 3300025927 Bacteria 4293
622 Ga0207687_10051799 3300025927 Bacteria 2862
623 Ga0207687_10081569 3300025927 Bacteria 2338
624 Ga0207700_10000673 3300025928 Bacteria 19951
625 Ga0207700_10018469 3300025928 Bacteria 4686
626 Ga0207700_10057899 3300025928 Bacteria 2924
627 Ga0207700_10082218 3300025928 Bacteria 2518
628 Ga0207700_10119768 3300025928 Bacteria 2132
629 Ga0207700_10160177 3300025928 Bacteria 1868
630 Ga0207700_10352842 3300025928 Bacteria 1281
631 Ga0207664_10047877 3300025929 Bacteria 3360
632 Ga0207664_10117021 3300025929 Bacteria 2224
633 Ga0207664_10129442 3300025929 Bacteria 2123
634 Ga0207664_10218975 3300025929 Bacteria 1650
635 Ga0207644_10001455 3300025931 Bacteria 15267
636 Ga0207644_10097375 3300025931 Bacteria 2203
637 Ga0207644_10148631 3300025931 Bacteria 1811
638 Ga0207690_10000554 3300025932 Bacteria 24427
639 Ga0207690_10005681 3300025932 Bacteria 7375
640 Ga0207690_10115971 3300025932 Bacteria 1936
641 Ga0207706_10003081 3300025933 Bacteria 16020
642 Ga0207706_10003951 3300025933 Bacteria 14048
643 Ga0207706_10027742 3300025933 Bacteria 5062
644 Ga0207706_10028004 3300025933 Bacteria 5035
645 Ga0207706_10038789 3300025933 Bacteria 4225
646 Ga0207706_10046405 3300025933 Bacteria 3846
647 Ga0207706_10051232 3300025933 Bacteria 3646
648 Ga0207686_10006458 3300025934 Bacteria 6312
649 Ga0207686_10063585 3300025934 Bacteria 2347
650 Ga0207686_10072424 3300025934 Bacteria 2220
651 Ga0207709_10000349 3300025935 Bacteria 47453
652 Ga0207709_10029633 3300025935 Bacteria 3177
653 Ga0207709_10105661 3300025935 Bacteria 1871
654 Ga0207670_10001179 3300025936 Bacteria 13801
655 Ga0207670_10004597 3300025936 Bacteria 7462
656 Ga0207670_10023343 3300025936 Bacteria 3849
657 Ga0207670_10031718 3300025936 Bacteria 3390
658 Ga0207670_10054762 3300025936 Bacteria 2693
659 Ga0207670_10164810 3300025936 Bacteria 1657
660 Ga0207670_10224981 3300025936 Bacteria 1438
661 Ga0207669_10000168 3300025937 Bacteria 30867
662 Ga0207669_10023099 3300025937 Bacteria 3315
663 Ga0207669_10048999 3300025937 Bacteria 2514
664 Ga0207669_10071033 3300025937 Bacteria 2185
665 Ga0207669_10153452 3300025937 Bacteria 1616
666 Ga0207704_10000156 3300025938 Bacteria 36588
667 Ga0207704_10012042 3300025938 Bacteria 4281
668 Ga0207704_10068404 3300025938 Bacteria 2239
669 Ga0207665_10000248 3300025939 Bacteria 37228
670 Ga0207665_10003664 3300025939 Bacteria 10262
671 Ga0207665_10041791 3300025939 Bacteria 3063
672 Ga0207691_10005749 3300025940 Bacteria 12000
673 Ga0207691_10010480 3300025940 Bacteria 8892
674 Ga0207691_10053994 3300025940 Bacteria 3666
675 Ga0207691_10139708 3300025940 Bacteria 2135
676 Ga0207711_10001438 3300025941 Bacteria 22264
677 Ga0207711_10003359 3300025941 Bacteria 13863
678 Ga0207711_10003367 3300025941 Bacteria 13852
679 Ga0207711_10010413 3300025941 Bacteria 7721
680 Ga0207711_10012335 3300025941 Bacteria 7103
681 Ga0207711_10047792 3300025941 Bacteria 3660
682 Ga0207711_10088707 3300025941 Bacteria 2716
683 Ga0207711_10140479 3300025941 Bacteria 2172
684 Ga0207711_10157475 3300025941 Bacteria 2054
685 Ga0207689_10021978 3300025942 Bacteria 5364
686 Ga0207689_10023923 3300025942 Bacteria 5124
687 Ga0207689_10197858 3300025942 Bacteria 1659
688 Ga0207661_10000143 3300025944 Bacteria 45329
689 Ga0207661_10099392 3300025944 Bacteria 2440
690 Ga0207661_10172844 3300025944 Bacteria 1882
691 Ga0207661_10186702 3300025944 Bacteria 1815
692 Ga0207679_10000035 3300025945 Bacteria 144173
693 Ga0207679_10047223 3300025945 Bacteria 3127
694 Ga0207679_10311150 3300025945 Bacteria 1361
695 Ga0207679_10337763 3300025945 Bacteria 1309
696 Ga0207667_10000004 3300025949 Bacteria 737718
697 Ga0207667_10000007 3300025949 Bacteria 630590
698 Ga0207667_10120968 3300025949 Bacteria 2698
699 Ga0207667_10122326 3300025949 Bacteria 2681
700 Ga0207667_10183001 3300025949 Bacteria 2151
701 Ga0207667_10365418 3300025949 Bacteria 1471
702 Ga0207651_10001071 3300025960 Bacteria 12157
703 Ga0207651_10037376 3300025960 Bacteria 3180
704 Ga0207712_10001127 3300025961 Bacteria 18629
705 Ga0207712_10001185 3300025961 Bacteria 18034
706 Ga0207712_10013141 3300025961 Bacteria 5305
707 Ga0207712_10414489 3300025961 Bacteria 1135
708 Ga0207668_10000354 3300025972 Bacteria 29853
709 Ga0207668_10117013 3300025972 Bacteria 2011
710 Ga0207668_10137344 3300025972 Bacteria 1875
711 Ga0207668_10310016 3300025972 Bacteria 1306
712 Ga0207640_10000360 3300025981 Bacteria 29534
713 Ga0207640_10000591 3300025981 Bacteria 21606
714 Ga0207640_10027258 3300025981 Bacteria 3479
715 Ga0207640_10067852 3300025981 Bacteria 2388
716 Ga0207640_10329303 3300025981 Bacteria 1219
717 Ga0207658_10004208 3300025986 Bacteria 10025
718 Ga0207658_10117446 3300025986 Bacteria 2114
719 Ga0207658_10180688 3300025986 Bacteria 1746
720 Ga0207658_10342912 3300025986 Bacteria 1299
721 Ga0207677_10000614 3300026023 Bacteria 21876
722 Ga0207677_10048336 3300026023 Bacteria 2864
723 Ga0207703_10059555 3300026035 Bacteria 3119
724 Ga0207703_10079513 3300026035 Bacteria 2728
725 Ga0207703_10112029 3300026035 Bacteria 2330
726 Ga0207703_10146228 3300026035 Bacteria 2056
727 Ga0207703_10162630 3300026035 Bacteria 1956
728 Ga0207703_10176451 3300026035 Bacteria 1883
729 Ga0207639_10000283 3300026041 Bacteria 36325
730 Ga0207639_10044011 3300026041 Bacteria 3355
731 Ga0207639_10051194 3300026041 Bacteria 3140
732 Ga0207639_10088973 3300026041 Bacteria 2466
733 Ga0207639_10115029 3300026041 Bacteria 2199
734 Ga0207639_10209562 3300026041 Bacteria 1677
735 Ga0207678_10000553 3300026067 Bacteria 34126
736 Ga0207678_10005470 3300026067 Bacteria 11361
737 Ga0207678_10006944 3300026067 Bacteria 10050
738 Ga0207678_10012842 3300026067 Bacteria 7352
739 Ga0207678_10026751 3300026067 Bacteria 5032
740 Ga0207678_10028560 3300026067 Bacteria 4869
741 Ga0207678_10038884 3300026067 Bacteria 4131
742 Ga0207678_10263467 3300026067 Bacteria 1477
743 Ga0207708_10001353 3300026075 Bacteria 18401
744 Ga0207708_10001504 3300026075 Bacteria 17372
745 Ga0207702_10000466 3300026078 Bacteria 45933
746 Ga0207702_10000602 3300026078 Bacteria 39740
747 Ga0207702_10001956 3300026078 Bacteria 20052
748 Ga0207702_10040505 3300026078 Bacteria 3905
749 Ga0207702_10054132 3300026078 Bacteria 3399
750 Ga0207702_10076569 3300026078 Bacteria 2892
751 Ga0207702_10138984 3300026078 Bacteria 2196
752 Ga0207641_10005992 3300026088 Bacteria 10300
753 Ga0207641_10170979 3300026088 Bacteria 1983
754 Ga0207641_10260123 3300026088 Bacteria 1624
755 Ga0207641_10390073 3300026088 Bacteria 1335
756 Ga0207648_10015184 3300026089 Bacteria 7088
757 Ga0207648_10017690 3300026089 Bacteria 6475
758 Ga0207648_10031802 3300026089 Bacteria 4663
759 Ga0207648_10117030 3300026089 Bacteria 2342
760 Ga0207676_10000540 3300026095 Bacteria 31519
761 Ga0207676_10014354 3300026095 Bacteria 5698
762 Ga0207676_10032741 3300026095 Bacteria 3921
763 Ga0207676_10046205 3300026095 Bacteria 3368
764 Ga0207676_10079875 3300026095 Bacteria 2653
765 Ga0207676_10220104 3300026095 Bacteria 1690
766 Ga0207674_10001436 3300026116 Bacteria 30766
767 Ga0207674_10002710 3300026116 Bacteria 22111
768 Ga0207674_10004831 3300026116 Bacteria 16142
769 Ga0207674_10035067 3300026116 Bacteria 5237
770 Ga0207674_10062214 3300026116 Bacteria 3770
771 Ga0207674_10081378 3300026116 Bacteria 3241
772 Ga0207674_10127951 3300026116 Bacteria 2504
773 Ga0207674_10182069 3300026116 Bacteria 2053
774 Ga0207675_100000066 3300026118 Bacteria 78979
775 Ga0207675_100002948 3300026118 Bacteria 16733
776 Ga0207675_100033326 3300026118 Bacteria 4800
777 Ga0207675_100044150 3300026118 Bacteria 4164
778 Ga0207675_100112992 3300026118 Bacteria 2564
779 Ga0207675_100179983 3300026118 Bacteria 2024
780 Ga0207683_10000755 3300026121 Bacteria 29385
781 Ga0207683_10002276 3300026121 Bacteria 16828
782 Ga0207683_10006188 3300026121 Bacteria 10256
783 Ga0207683_10009461 3300026121 Bacteria 8303
784 Ga0207683_10012771 3300026121 Bacteria 7168
785 Ga0207683_10021344 3300026121 Bacteria 5542
786 Ga0207683_10341032 3300026121 Bacteria 1374
787 Ga0207698_10001628 3300026142 Bacteria 13081
788 Ga0207698_10002579 3300026142 Bacteria 10764
789 Ga0207698_10012018 3300026142 Bacteria 5643
790 Ga0207698_10027362 3300026142 Bacteria 4047
791 Ga0207698_10053466 3300026142 Bacteria 3100
792 Ga0207698_10089358 3300026142 Bacteria 2515
793 Ga0207698_10257267 3300026142 Bacteria 1602
794 Ga0209970_1012446 3300027614 Bacteria 1406
795 Ga0209588_1000009 3300027671 Bacteria 174900
796 Ga0209588_1037814 3300027671 Bacteria 1554
797 Ga0209971_1002832 3300027682 Bacteria 4143
798 Ga0209998_10001795 3300027717 Bacteria 5080
799 Ga0209998_10002845 3300027717 Bacteria 3888
800 Ga0209974_10001695 3300027876 Bacteria 7983
801 Ga0209974_10019641 3300027876 Bacteria 2240
802 Ga0207428_10000075 3300027907 Bacteria 137887
803 Ga0207428_10000428 3300027907 Bacteria 51964
804 Ga0207428_10005693 3300027907 Bacteria 11583
805 Ga0207428_10019811 3300027907 Bacteria 5730
806 Ga0207428_10062020 3300027907 Bacteria 2957
807 Ga0268266_10039778 3300028379 Bacteria 4005
808 Ga0268265_10001944 3300028380 Bacteria 16407
809 Ga0268265_10002854 3300028380 Bacteria 12709
810 Ga0268264_10001145 3300028381 Bacteria 25934
811 Ga0268264_10009120 3300028381 Bacteria 8226
812 Ga0268264_10040002 3300028381 Bacteria 3874
813 Ga0268264_10043024 3300028381 Bacteria 3741
814 Ga0268264_10303900 3300028381 Bacteria 1503
815 Ga0265337_1000182 3300028556 Bacteria 33103
816 Ga0265318_10006701 3300028577 Bacteria 5277
817 Ga0307515_10104872 3300028794 Bacteria 3372
818 Ga0265338_10018977 3300028800 Bacteria 7327
819 Ga0265762_1003180 3300030760 Bacteria 2936
820 Ga0265760_10020371 3300031090 Bacteria 1914
821 Ga0265330_10090627 3300031235 Bacteria 1313
822 Ga0265332_10000310 3300031238 Bacteria 37390
823 Ga0265332_10006777 3300031238 Bacteria 5191
824 Ga0265320_10033117 3300031240 Bacteria 2640
825 Ga0265325_10000034 3300031241 Bacteria 99371
826 Ga0265325_10000675 3300031241 Bacteria 24875
827 Ga0265325_10001027 3300031241 Bacteria 20100
828 Ga0265325_10004584 3300031241 Bacteria 8685
829 Ga0265325_10006109 3300031241 Bacteria 7355
830 Ga0265325_10109337 3300031241 Bacteria 1345
831 Ga0265329_10018730 3300031242 Bacteria 2362
832 Ga0265340_10006782 3300031247 Bacteria 6268
833 Ga0265340_10011819 3300031247 Bacteria 4627
834 Ga0265340_10022478 3300031247 Bacteria 3223
835 Ga0265340_10043475 3300031247 Bacteria 2202
836 Ga0265339_10000091 3300031249 Bacteria 75937
837 Ga0265339_10001481 3300031249 Bacteria 17344
838 Ga0265339_10001918 3300031249 Bacteria 15257
839 Ga0307408_100009183 3300031548 Bacteria 6519
840 Ga0307408_100109091 3300031548 Bacteria 2123
841 Ga0265313_10000260 3300031595 Bacteria 57581
842 Ga0265313_10001257 3300031595 Bacteria 24112
843 Ga0265313_10004172 3300031595 Bacteria 11221
844 Ga0265313_10005011 3300031595 Bacteria 9890
845 Ga0265313_10035545 3300031595 Bacteria 2509
846 Ga0265313_10053296 3300031595 Bacteria 1926
847 Ga0265313_10089696 3300031595 Bacteria 1382
848 Ga0307508_10005393 3300031616 Bacteria 12174
849 Ga0316575_10017923 3300031665 Bacteria 2695
850 Ga0316579_10033433 3300031691 Bacteria 2361
851 Ga0265314_10001108 3300031711 Bacteria 31108
852 Ga0265314_10001386 3300031711 Bacteria 27202
853 Ga0265314_10005031 3300031711 Bacteria 12046
854 Ga0265314_10172492 3300031711 Bacteria 1304
855 Ga0265342_10000175 3300031712 Bacteria 71083
856 Ga0265342_10023337 3300031712 Bacteria 3918
857 Ga0265342_10129677 3300031712 Bacteria 1414
858 Ga0307516_10002086 3300031730 Bacteria 27199
859 Ga0307516_10084832 3300031730 Bacteria 3006
860 Ga0307405_10026036 3300031731 Bacteria 3368
861 Ga0307413_10049639 3300031824 Bacteria 2516
862 Ga0307406_10022104 3300031901 Bacteria 3771
863 Ga0307406_10184256 3300031901 Bacteria 1523
864 Ga0307412_10017358 3300031911 Bacteria 4307
865 Ga0307416_100063255 3300032002 Bacteria 3029
866 Ga0316583_10004059 3300032133 Bacteria 5202
867 Ga0373930_0001737 3300034816 Bacteria 3304
868 Ga0373948_0001105 3300034817 Bacteria 3656
869 Ga0373948_0007498 3300034817 Bacteria 1837
870 Ga0373950_0000384 3300034818 Bacteria 5459
871 Ga0373950_0004205 3300034818 Bacteria 2097
872 Ga0373958_0000739 3300034819 Bacteria 4166
873 Ga0373958_0002601 3300034819 Bacteria 2542
874 Ga0373958_0007241 3300034819 Bacteria 1760
875 Ga0373938_0004188 3300034957 Bacteria 2395
876 Ga0373926_0000245 3300035083 Bacteria 12993
877 Ga0373926_0007126 3300035083 Bacteria 3723
878 Ga0373928_0000892 3300035084 Bacteria 5858
879 Ga0373928_0003713 3300035084 Bacteria 2908
880 Ga0373928_0013180 3300035084 Bacteria 1657
881 Ga0373929_0000155 3300035085 Bacteria 11924
882 Ga0373929_0012011 3300035085 Bacteria 1640
883 Ga0373934_0018540 3300035086 Bacteria 2664
884 Ga0373940_0012027 3300035088 Bacteria 2068
885 Ga0373944_0000108 3300035089 Bacteria 15141
886 Ga0373944_0001541 3300035089 Bacteria 5840
887 Ga0373944_0003215 3300035089 Bacteria 4195
888 Ga0373944_0019626 3300035089 Bacteria 1941
889 Ga0373949_0000245 3300035090 Bacteria 20357
890 Ga0373949_0005373 3300035090 Bacteria 2859
891 Ga0373949_0008276 3300035090 Bacteria 2278
892 Ga0373949_0025298 3300035090 Bacteria 1384
893 Ga0373951_0000948 3300035091 Bacteria 7794
894 Ga0373952_0001774 3300035092 Bacteria 3927
895 Ga0373952_0011663 3300035092 Bacteria 1717
896 Ga0373923_0000157 3300035111 Bacteria 13326
897 Ga0373923_0005962 3300035111 Bacteria 4173
898 Ga0373923_0032038 3300035111 Bacteria 2122
899 Ga0373932_0000029 3300035112 Bacteria 39605
900 Ga0373932_0001819 3300035112 Bacteria 5735
901 Ga0373932_0014334 3300035112 Bacteria 1991
902 Ga0373936_0000484 3300035113 Bacteria 13457
903 Ga0373936_0095881 3300035113 Bacteria 1248
904 Ga0373939_0000723 3300035114 Bacteria 8168
905 Ga0373941_0001399 3300035115 Bacteria 5082
906 Ga0373941_0003448 3300035115 Bacteria 3580
907 Ga0373941_0007218 3300035115 Bacteria 2712
908 Ga0373945_0000045 3300035116 Bacteria 26286
909 Ga0373945_0004209 3300035116 Bacteria 4561
910 Ga0373945_0010461 3300035116 Bacteria 3055
911 Ga0373945_0016161 3300035116 Bacteria 2514
912 Ga0373945_0060977 3300035116 Bacteria 1408
913 Ga0373953_0009266 3300035117 Bacteria 3380
914 Ga0373953_0033109 3300035117 Bacteria 2020
915 Ga0373953_0041428 3300035117 Bacteria 1832
916 Ga0373953_0045111 3300035117 Bacteria 1765
917 Ga0373954_0000462 3300035118 Bacteria 15213
918 Ga0373954_0008707 3300035118 Bacteria 4460
919 Ga0373954_0021831 3300035118 Bacteria 2900
920 Ga0373956_0001576 3300035119 Bacteria 9393
921 Ga0373956_0006700 3300035119 Bacteria 4621
922 Ga0373957_0002629 3300035120 Bacteria 5153
923 Ga0373957_0005928 3300035120 Bacteria 3821
924 Ga0373957_0105292 3300035120 Bacteria 1132
925 Ga0373960_0000009 3300035121 Bacteria 26216
926 Ga0373960_0006175 3300035121 Bacteria 2801
927 Ga0373943_0001586 3300035170 Bacteria 10296
928 Ga0373943_0005432 3300035170 Bacteria 5732
929 Ga0373943_0020922 3300035170 Bacteria 3020
930 Ga0373943_0033745 3300035170 Bacteria 2440
931 Ga0373943_0057315 3300035170 Bacteria 1935
932 Ga0373943_0058786 3300035170 Bacteria 1915
933 Ga0373943_0079753 3300035170 Bacteria 1676
934 Ga0373943_0169274 3300035170 Bacteria 1194
935 Ga0373946_0001305 3300035171 Bacteria 8621
936 Ga0373946_0001925 3300035171 Bacteria 7245
937 Ga0373946_0003086 3300035171 Bacteria 5900
938 Ga0373946_0023486 3300035171 Bacteria 2409
939 Ga0373946_0147565 3300035171 Bacteria 1095
940 Ga0373955_0000562 3300035172 Bacteria 15770
941 Ga0373955_0002480 3300035172 Bacteria 8064
942 Ga0373955_0006659 3300035172 Bacteria 5270
943 Ga0373955_0095514 3300035172 Bacteria 1700
944 Ga0373955_0172563 3300035172 Bacteria 1280
945 Ga0373942_0000486 3300035207 Bacteria 11285
946 Ga0373942_0013003 3300035207 Bacteria 1996
947 Ga0373961_0001880 3300035241 Bacteria 5718
948 Ga0373961_0008408 3300035241 Bacteria 2509
949 Ga0373962_0000214 3300035242 Bacteria 12209
950 Ga0373962_0001524 3300035242 Bacteria 5477
951 Ga0373924_0004637 3300035410 Bacteria 4818
952 Ga0373924_0010027 3300035410 Bacteria 3487
953 Ga0373924_0012179 3300035410 Bacteria 3210
954 Ga0373931_0000409 3300035691 Bacteria 17588
955 Ga0373931_0009456 3300035691 Bacteria 4662
956 Ga0373931_0028914 3300035691 Bacteria 2841
957 Ga0373931_0182193 3300035691 Bacteria 1244
958 Ga0373935_0009509 3300035692 Bacteria 5816
959 Ga0373935_0019036 3300035692 Bacteria 4186
960 Ga0373935_0028625 3300035692 Bacteria 3443
961 Ga0373935_0036864 3300035692 Bacteria 3059
962 Ga0373935_0044046 3300035692 Bacteria 2811
963 Ga0373935_0275448 3300035692 Bacteria 1183
964 Ga0373935_0296127 3300035692 Bacteria 1142
965 Ga0373927_0000956 3300035695 Bacteria 22017
966 Ga0373927_0006481 3300035695 Bacteria 7971
967 Ga0373927_0030734 3300035695 Bacteria 3503
968 Ga0373927_0071673 3300035695 Bacteria 2242
969 Ga0373927_0116881 3300035695 Bacteria 1739
970 Ga0373927_0126964 3300035695 Bacteria 1665
971 Ga0373927_0187347 3300035695 Bacteria 1357
972 Ga0373933_0001364 3300035724 Bacteria 14379
973 Ga0373933_0001461 3300035724 Bacteria 13837
974 Ga0373933_0002783 3300035724 Bacteria 9760
975 Ga0373933_0006680 3300035724 Bacteria 6286
976 Ga0373947_0000476 3300035725 Bacteria 22980
977 Ga0373947_0000731 3300035725 Bacteria 19641
978 Ga0373947_0004520 3300035725 Bacteria 8156
979 Ga0373947_0041290 3300035725 Bacteria 2750
980 Ga0373947_0059951 3300035725 Bacteria 2309
981 Ga0373947_0077354 3300035725 Bacteria 2052
982 Ga0373947_0158218 3300035725 Bacteria 1463
983 Ga0373937_0000009 3300036401 Bacteria 169521
984 Ga0373937_0000414 3300036401 Bacteria 39843
985 Ga0373937_0002001 3300036401 Bacteria 17037
986 Ga0373937_0002191 3300036401 Bacteria 16332
987 Ga0373937_0002423 3300036401 Bacteria 15512
988 Ga0373937_0010217 3300036401 Bacteria 8189
989 Ga0373937_0022700 3300036401 Bacteria 5645
990 Ga0373937_0092486 3300036401 Bacteria 2803
991 Ga0373937_0106280 3300036401 Bacteria 2609
992 Ga0373937_0563913 3300036401 Bacteria 1082
993 Ga0373925_0000194 3300037068 Bacteria 66124
994 Ga0373925_0000957 3300037068 Bacteria 26248
995 Ga0373925_0004700 3300037068 Bacteria 10303
996 Ga0373925_0007047 3300037068 Bacteria 8213
997 Ga0373925_0012957 3300037068 Bacteria 6040
998 Ga0373925_0023501 3300037068 Bacteria 4498
999 Ga0373925_0080518 3300037068 Bacteria 2475
1000 Ga0373925_0144274 3300037068 Bacteria 1865
1001 Ga0373925_0290045 3300037068 Bacteria 1319
1002 Ga0395899_0187816 3300037312 Bacteria 1447
1003 Ga0395900_0004702 3300037418 Bacteria 14395
1004 Ga0395900_0303864 3300037418 Bacteria 1581
1005 Ga0436364_0402761 3300037853 Bacteria 14147
1006 Ga0436364_0770319 3300037853 Bacteria 3501
1007 Ga0436364_0920866 3300037853 Bacteria 3415
1008 Ga0436364_1100316 3300037853 Bacteria 1987
1009 Ga0436364_1255394 3300037853 Bacteria 1545
1010 Ga0395901_0037913 3300038443 Bacteria 4984
1011 Ga0395901_0187336 3300038443 Bacteria 2170
1012 Ga0395901_0237563 3300038443 Bacteria 1901
1013 Ga0436365_0189918 3300039437 Bacteria 2095
1014 Ga0436365_0401858 3300039437 Bacteria 2507
1015 Ga0436365_0521195 3300039437 Bacteria 3518
1016 Ga0436365_1211815 3300039437 Bacteria 4123
1017 Ga0436365_1396550 3300039437 Bacteria 2075
1018 Ga0436365_1548569 3300039437 Bacteria 2219
1019 Ga0436365_1613453 3300039437 Bacteria 24235
1020 Ga0436365_1728475 3300039437 Bacteria 9610
1021 Ga0436365_1900328 3300039437 Bacteria 2059
1022 Ga0436361_0668552 3300039447 Bacteria 2982
1023 Ga0436363_0049442 3300039450 Bacteria 1248
1024 Ga0436362_0732063 3300039453 Bacteria 2029
1025 Ga0439453_0003236 3300041408 Bacteria 2326
1026 Ga0439443_000206 3300042003 Bacteria 4412
1027 Ga0439448_0019475 3300042005 Bacteria 2090
1028 Ga0439446_0011140 3300042156 Bacteria 2437
1029 Ga0439435_0000853 3300042436 Bacteria 5221
1030 Ga0439459_0015748 3300042438 Bacteria 1389
1031 Ga0453683_0090960 3300044673 Bacteria 1913
1032 Ga0466961_0028605 3300044693 Bacteria 3584
1033 Ga0466963_0005781 3300044694 Bacteria 7275
1034 Ga0466963_0017561 3300044694 Bacteria 4462
1035 Ga0466963_0051343 3300044694 Bacteria 2733
1036 Ga0466963_0167287 3300044694 Bacteria 1532
1037 Ga0466968_0076178 3300044735 Bacteria 1468
1038 Ga0466957_0082460 3300044842 Bacteria 2004
1039 Ga0466957_0296962 3300044842 Bacteria 1085
1040 Ga0466960_0110834 3300044901 Bacteria 1426
1041 Ga0466959_0032363 3300045049 Bacteria 3871
1042 Ga0451576_0083606 3300045051 Bacteria 3320
1043 Ga0466958_0037631 3300045836 Bacteria 2899
1044 Ga0466967_0007381 3300045976 Bacteria 7922
1045 Ga0466967_0133602 3300045976 Bacteria 2306
1046 Ga0495617_002591 3300046452 Bacteria 7096
1047 Ga0495592_0000018 3300046454 Bacteria 140962
1048 Ga0495592_0001607 3300046454 Bacteria 15832
1049 Ga0495592_0008175 3300046454 Bacteria 7860
1050 Ga0495592_0021305 3300046454 Bacteria 4930
1051 Ga0495592_0025948 3300046454 Bacteria 4445
1052 Ga0495592_0045358 3300046454 Bacteria 3280
1053 Ga0495603_0005044 3300046455 Bacteria 7889
1054 Ga0495603_0036468 3300046455 Bacteria 2952
1055 Ga0495591_024948 3300046458 Bacteria 1884
1056 Ga0495629_0005894 3300046459 Bacteria 9132
1057 Ga0495629_0015067 3300046459 Bacteria 5557
1058 Ga0495629_0063803 3300046459 Bacteria 2572
1059 Ga0495629_0158807 3300046459 Bacteria 1570
1060 Ga0495638_0007358 3300046460 Bacteria 7903
1061 Ga0495638_0094312 3300046460 Bacteria 1799
1062 Ga0495638_0180329 3300046460 Bacteria 1205
1063 Ga0495641_0005322 3300046461 Bacteria 8732
1064 Ga0495641_0014825 3300046461 Bacteria 4200
1065 Ga0495641_0058246 3300046461 Bacteria 1748
1066 Ga0495651_0000540 3300046462 Bacteria 29195
1067 Ga0495651_0002271 3300046462 Bacteria 14833
1068 Ga0495651_0008752 3300046462 Bacteria 7763
1069 Ga0495651_0028798 3300046462 Bacteria 4329
1070 Ga0495651_0028910 3300046462 Bacteria 4322
1071 Ga0495653_0000032 3300046463 Bacteria 132763
1072 Ga0495653_0000672 3300046463 Bacteria 26113
1073 Ga0495653_0001530 3300046463 Bacteria 18079
1074 Ga0495653_0004359 3300046463 Bacteria 11449
1075 Ga0495653_0021490 3300046463 Bacteria 5229
1076 Ga0495653_0087387 3300046463 Bacteria 2290
1077 Ga0495580_0004480 3300046472 Bacteria 11735
1078 Ga0495580_0212618 3300046472 Bacteria 1330
1079 Ga0495582_0001217 3300046473 Bacteria 14494
1080 Ga0495582_0003978 3300046473 Bacteria 8305
1081 Ga0495582_0105338 3300046473 Bacteria 1581
1082 Ga0495605_0117590 3300046474 Bacteria 1208
1083 Ga0495639_0001072 3300046475 Bacteria 12330
1084 Ga0495639_0028692 3300046475 Bacteria 2466
1085 Ga0495662_0000280 3300046476 Bacteria 21964
1086 Ga0495664_0000010 3300046477 Bacteria 268381
1087 Ga0495664_0000112 3300046477 Bacteria 40522
1088 Ga0495664_0000178 3300046477 Bacteria 31382
1089 Ga0495664_0003517 3300046477 Bacteria 8538
1090 Ga0495664_0039826 3300046477 Bacteria 2777
1091 Ga0495664_0134144 3300046477 Bacteria 1500
1092 Ga0495584_0006334 3300046491 Bacteria 6201
1093 Ga0495584_0015933 3300046491 Bacteria 3836
1094 Ga0495585_0003781 3300046492 Bacteria 10097
1095 Ga0495594_0004663 3300046499 Bacteria 7064
1096 Ga0495594_0025139 3300046499 Bacteria 3201
1097 Ga0495607_0004311 3300046501 Bacteria 10497
1098 Ga0495583_0112427 3300046506 Bacteria 1153
1099 Ga0495608_0000008 3300046511 Bacteria 268629
1100 Ga0495608_0000556 3300046511 Bacteria 25760
1101 Ga0495608_0002294 3300046511 Bacteria 13805
1102 Ga0495608_0003241 3300046511 Bacteria 11639
1103 Ga0495608_0024005 3300046511 Bacteria 4173
1104 Ga0495608_0105039 3300046511 Bacteria 1819
1105 Ga0495618_0000002 3300046514 Bacteria 271353
1106 Ga0495618_0001092 3300046514 Bacteria 18392
1107 Ga0495618_0004674 3300046514 Bacteria 8375
1108 Ga0495618_0011040 3300046514 Bacteria 5475
1109 Ga0495618_0045073 3300046514 Bacteria 2782
1110 Ga0495628_0000009 3300046516 Bacteria 237611
1111 Ga0495628_0003281 3300046516 Bacteria 14470
1112 Ga0495628_0029511 3300046516 Bacteria 4445
1113 Ga0495628_0030684 3300046516 Bacteria 4351
1114 Ga0495628_0256188 3300046516 Bacteria 1305
1115 Ga0495630_0002263 3300046517 Bacteria 13405
1116 Ga0495630_0002719 3300046517 Bacteria 12264
1117 Ga0495630_0005324 3300046517 Bacteria 9079
1118 Ga0495630_0015052 3300046517 Bacteria 5643
1119 Ga0495630_0168118 3300046517 Bacteria 1670
1120 Ga0495631_0053511 3300046518 Bacteria 1762
1121 Ga0495644_0002445 3300046523 Bacteria 7415
1122 Ga0495666_0000187 3300046526 Bacteria 26576
1123 Ga0495642_0026933 3300046528 Bacteria 2286
1124 Ga0495652_0000011 3300046529 Bacteria 255329
1125 Ga0495652_0005932 3300046529 Bacteria 11427
1126 Ga0495652_0006336 3300046529 Bacteria 11021
1127 Ga0495652_0012696 3300046529 Bacteria 7589
1128 Ga0495652_0055898 3300046529 Bacteria 3354
1129 Ga0495665_0001094 3300046531 Bacteria 14318
1130 Ga0495640_0000009 3300046533 Bacteria 217086
1131 Ga0495640_0000871 3300046533 Bacteria 23106
1132 Ga0495640_0055489 3300046533 Bacteria 2710
1133 Ga0495640_0123696 3300046533 Bacteria 1679
1134 Ga0495640_0150028 3300046533 Bacteria 1498
1135 Ga0495586_0008351 3300046535 Bacteria 5511
1136 Ga0495586_0011893 3300046535 Bacteria 4624
1137 Ga0495587_0000006 3300046536 Bacteria 310070
1138 Ga0495587_0002681 3300046536 Bacteria 11893
1139 Ga0495587_0012769 3300046536 Bacteria 5284
1140 Ga0495587_0078694 3300046536 Bacteria 1912
1141 Ga0495587_0081275 3300046536 Bacteria 1878
1142 Ga0495587_0146639 3300046536 Bacteria 1346
1143 Ga0495598_0000824 3300046537 Bacteria 5943
1144 Ga0495598_0002327 3300046537 Bacteria 3911
1145 Ga0495621_0006458 3300046539 Bacteria 3424
1146 Ga0495597_0080372 3300046542 Bacteria 1395
1147 Ga0495645_0000010 3300046543 Bacteria 238337
1148 Ga0495645_0001913 3300046543 Bacteria 14146
1149 Ga0495645_0019242 3300046543 Bacteria 4915
1150 Ga0495645_0065293 3300046543 Bacteria 2632
1151 Ga0495645_0086340 3300046543 Bacteria 2245
1152 Ga0495645_0105132 3300046543 Bacteria 2003
1153 Ga0495622_0068988 3300046557 Bacteria 1633
1154 Ga0495667_0000005 3300046559 Bacteria 268252
1155 Ga0495667_0000821 3300046559 Bacteria 20039
1156 Ga0495667_0001489 3300046559 Bacteria 15430
1157 Ga0495667_0003140 3300046559 Bacteria 11081
1158 Ga0495667_0008437 3300046559 Bacteria 6993
1159 Ga0495667_0014951 3300046559 Bacteria 5244
1160 Ga0495667_0017616 3300046559 Bacteria 4825
1161 Ga0495667_0141171 3300046559 Bacteria 1552
1162 Ga0495656_0000534 3300046615 Bacteria 12388
1163 Ga0495656_0106454 3300046615 Bacteria 1305
1164 Ga0495668_0088113 3300046616 Bacteria 1702
1165 Ga0495634_0000223 3300046642 Bacteria 53103
1166 Ga0495634_0002257 3300046642 Bacteria 16158
1167 Ga0495634_0008488 3300046642 Bacteria 7641
1168 Ga0495634_0052337 3300046642 Bacteria 2737
1169 Ga0495634_0076840 3300046642 Bacteria 2191
1170 Ga0495634_0155740 3300046642 Bacteria 1442
1171 Ga0495634_0161339 3300046642 Bacteria 1413
1172 Ga0495611_0007184 3300046648 Bacteria 4734
1173 Ga0495635_0000008 3300046663 Bacteria 268349
1174 Ga0495635_0000538 3300046663 Bacteria 24090
1175 Ga0495635_0006959 3300046663 Bacteria 7900
1176 Ga0495635_0013620 3300046663 Bacteria 5692
1177 Ga0495635_0131667 3300046663 Bacteria 1705
1178 Ga0495635_0167213 3300046663 Bacteria 1496
1179 Ga0495635_0283278 3300046663 Bacteria 1113
1180 Ga0495659_0001716 3300046664 Bacteria 7306
1181 Ga0495588_0000479 3300046674 Bacteria 19844
1182 Ga0495588_0031067 3300046674 Bacteria 2687
1183 Ga0495588_0151166 3300046674 Bacteria 1227
1184 Ga0495657_0000058 3300046675 Bacteria 97827
1185 Ga0495657_0003740 3300046675 Bacteria 12316
1186 Ga0495657_0008345 3300046675 Bacteria 7936
1187 Ga0495657_0083979 3300046675 Bacteria 2055
1188 Ga0495599_0000007 3300046678 Bacteria 236638
1189 Ga0495599_0000806 3300046678 Bacteria 17617
1190 Ga0495599_0005439 3300046678 Bacteria 7613
1191 Ga0495599_0005900 3300046678 Bacteria 7359
1192 Ga0495599_0009668 3300046678 Bacteria 5903
1193 Ga0495599_0111629 3300046678 Bacteria 1702
1194 Ga0495623_0000085 3300046679 Bacteria 55527
1195 Ga0495623_0003115 3300046679 Bacteria 10926
1196 Ga0495623_0003572 3300046679 Bacteria 10270
1197 Ga0495623_0010639 3300046679 Bacteria 5955
1198 Ga0495623_0090986 3300046679 Bacteria 1873
1199 Ga0495646_0000021 3300046680 Bacteria 115358
1200 Ga0495646_0000677 3300046680 Bacteria 18724
1201 Ga0495646_0000853 3300046680 Bacteria 17265
1202 Ga0495646_0001276 3300046680 Bacteria 14824
1203 Ga0495647_0000390 3300046681 Bacteria 12521
1204 Ga0495658_0002133 3300046683 Bacteria 10012
1205 Ga0495658_0005922 3300046683 Bacteria 6003
1206 Ga0495658_0024304 3300046683 Bacteria 3225
1207 Ga0495613_0001786 3300046689 Bacteria 16344
1208 Ga0495613_0003295 3300046689 Bacteria 12080
1209 Ga0495613_0016426 3300046689 Bacteria 5513
1210 Ga0495613_0017573 3300046689 Bacteria 5327
1211 Ga0495613_0098610 3300046689 Bacteria 2111
1212 Ga0495624_0001093 3300046690 Bacteria 21434
1213 Ga0495624_0001411 3300046690 Bacteria 18734
1214 Ga0495624_0111090 3300046690 Bacteria 1685
1215 Ga0495670_0002271 3300046691 Bacteria 9478
1216 Ga0495600_0000001 3300046809 Bacteria 214870
1217 Ga0495600_0000186 3300046809 Bacteria 36306
1218 Ga0495600_0000208 3300046809 Bacteria 33755
1219 Ga0495600_0009495 3300046809 Bacteria 6012
1220 Ga0495600_0028111 3300046809 Bacteria 3638
1221 Ga0495581_0013297 3300047315 Bacteria 4771
1222 Ga0495581_0027102 3300047315 Bacteria 3323
1223 Ga0495581_0033015 3300047315 Bacteria 2996
1224 Ga0495581_0059022 3300047315 Bacteria 2216
1225 Ga0495581_0109564 3300047315 Bacteria 1606
1226 Ga0495604_0000012 3300047317 Bacteria 268341
1227 Ga0495604_0000150 3300047317 Bacteria 60582
1228 Ga0495604_0001423 3300047317 Bacteria 19641
1229 Ga0495604_0002978 3300047317 Bacteria 13558
1230 Ga0495604_0008875 3300047317 Bacteria 7944
1231 Ga0495674_0000011 3300047319 Bacteria 270911
1232 Ga0495674_0003957 3300047319 Bacteria 14367
1233 Ga0495674_0005281 3300047319 Bacteria 12386
1234 Ga0495674_0043490 3300047319 Bacteria 3997
1235 Ga0495674_0050002 3300047319 Bacteria 3690
1236 Ga0495674_0115182 3300047319 Bacteria 2275
1237 Ga0495674_0167697 3300047319 Bacteria 1834
1238 Ga0495676_0036232 3300047321 Bacteria 4122
1239 Ga0495676_0140222 3300047321 Bacteria 1733
1240 Ga0495676_0198179 3300047321 Bacteria 1397
1241 Ga0495680_0000429 3300047322 Bacteria 47078
1242 Ga0495680_0001281 3300047322 Bacteria 27427
1243 Ga0495680_0002844 3300047322 Bacteria 17397
1244 Ga0495680_0002940 3300047322 Bacteria 17053
1245 Ga0495680_0009960 3300047322 Bacteria 8508
1246 Ga0495680_0025178 3300047322 Bacteria 4929
1247 Ga0495675_0000096 3300047444 Bacteria 62617
1248 Ga0495675_0001218 3300047444 Bacteria 15578
1249 Ga0495675_0108750 3300047444 Bacteria 1731
1250 Ga0495679_036733 3300047446 Bacteria 1546
1251 Ga0495684_0000084 3300047471 Bacteria 65600
1252 Ga0495684_0002579 3300047471 Bacteria 14402
1253 Ga0495684_0007113 3300047471 Bacteria 8687
1254 Ga0495684_0039613 3300047471 Bacteria 3612
1255 Ga0495684_0223215 3300047471 Bacteria 1381
1256 Ga0495593_0000372 3300047673 Bacteria 24728
1257 Ga0495593_0040237 3300047673 Bacteria 2517
1258 Ga0495593_0047953 3300047673 Bacteria 2271
1259 Ga0495602_0000073 3300048088 Bacteria 98745
1260 Ga0495602_0002793 3300048088 Bacteria 17851
1261 Ga0495602_0041319 3300048088 Bacteria 4214
1262 Ga0495614_0003505 3300048089 Bacteria 7027
1263 Ga0496100_0015237 3300048903 Bacteria 4486
1264 Ga0496100_0018859 3300048903 Bacteria 4103
1265 Ga0496100_0033095 3300048903 Bacteria 3232
1266 Ga0496100_0034198 3300048903 Bacteria 3187
1267 Ga0496100_0044906 3300048903 Bacteria 2833
1268 Ga0496100_0102436 3300048903 Bacteria 1975
1269 Ga0496100_0123410 3300048903 Bacteria 1815
1270 Ga0496100_0177801 3300048903 Bacteria 1537
1271 Ga0496101_0000218 3300048904 Bacteria 42932
1272 Ga0496101_0010578 3300048904 Bacteria 6095
1273 Ga0496101_0014939 3300048904 Bacteria 5224
1274 Ga0496101_0015869 3300048904 Bacteria 5083
1275 Ga0496101_0019217 3300048904 Bacteria 4661
1276 Ga0496101_0177393 3300048904 Bacteria 1639
1277 Ga0496101_0265935 3300048904 Bacteria 1338
1278 Ga0496102_0019120 3300048905 Bacteria 6030
1279 Ga0496102_0028797 3300048905 Bacteria 4965
1280 Ga0496102_0031355 3300048905 Bacteria 4768
1281 Ga0496102_0035330 3300048905 Bacteria 4498
1282 Ga0496102_0060892 3300048905 Bacteria 3453
1283 Ga0496102_0080917 3300048905 Bacteria 2994
1284 Ga0496102_0084901 3300048905 Bacteria 2923
1285 Ga0496102_0102976 3300048905 Bacteria 2654
1286 Ga0496102_0132438 3300048905 Bacteria 2334
1287 Ga0496102_0153596 3300048905 Bacteria 2164
1288 Ga0496102_0169890 3300048905 Bacteria 2053
1289 Ga0496103_0014890 3300048906 Bacteria 4623
1290 Ga0496103_0018479 3300048906 Bacteria 4181
1291 Ga0496103_0018520 3300048906 Bacteria 4177
1292 Ga0496103_0025384 3300048906 Bacteria 3581
1293 Ga0496103_0061743 3300048906 Bacteria 2331
1294 Ga0496103_0100361 3300048906 Bacteria 1831
1295 Ga0496104_0000079 3300048907 Bacteria 98874
1296 Ga0496104_0000445 3300048907 Bacteria 35921
1297 Ga0496104_0001219 3300048907 Bacteria 22114
1298 Ga0496104_0002378 3300048907 Bacteria 16215
1299 Ga0496104_0008094 3300048907 Bacteria 9326
1300 Ga0496104_0009255 3300048907 Bacteria 8760
1301 Ga0496104_0019341 3300048907 Bacteria 6228
1302 Ga0496104_0043032 3300048907 Bacteria 4240
1303 Ga0496104_0059832 3300048907 Bacteria 3607
1304 Ga0496104_0077142 3300048907 Bacteria 3174
1305 Ga0496104_0078754 3300048907 Bacteria 3141
1306 Ga0496104_0147636 3300048907 Bacteria 2258
1307 Ga0496104_0299073 3300048907 Bacteria 1521
1308 Ga0496105_0014286 3300048908 Bacteria 6319
1309 Ga0496105_0023784 3300048908 Bacteria 4974
1310 Ga0496105_0035352 3300048908 Bacteria 4112
1311 Ga0496105_0046477 3300048908 Bacteria 3583
1312 Ga0496105_0052860 3300048908 Bacteria 3355
1313 Ga0496105_0087389 3300048908 Bacteria 2575
1314 Ga0496105_0087845 3300048908 Bacteria 2568
1315 Ga0496105_0118820 3300048908 Bacteria 2181
1316 Ga0496105_0284685 3300048908 Bacteria 1332
1317 Ga0496106_0000388 3300048909 Bacteria 31323
1318 Ga0496106_0002724 3300048909 Bacteria 13094
1319 Ga0496106_0004954 3300048909 Bacteria 9851
1320 Ga0496106_0052106 3300048909 Bacteria 3086
1321 Ga0496106_0072204 3300048909 Bacteria 2639
1322 Ga0496106_0099309 3300048909 Bacteria 2256
1323 Ga0496106_0204402 3300048909 Bacteria 1572
1324 Ga0496107_0001097 3300048910 Bacteria 16270
1325 Ga0496107_0004447 3300048910 Bacteria 9503
1326 Ga0496107_0017055 3300048910 Bacteria 5106
1327 Ga0496107_0017547 3300048910 Bacteria 5033
1328 Ga0496107_0029064 3300048910 Bacteria 3930
1329 Ga0496107_0066503 3300048910 Bacteria 2613
1330 Ga0496107_0092897 3300048910 Bacteria 2206
1331 Ga0496107_0147255 3300048910 Bacteria 1741
1332 Ga0496107_0217624 3300048910 Bacteria 1420
1333 Ga0496107_0320830 3300048910 Bacteria 1153
1334 Ga0496108_0003673 3300048911 Bacteria 12302
1335 Ga0496108_0004728 3300048911 Bacteria 10980
1336 Ga0496108_0007963 3300048911 Bacteria 8595
1337 Ga0496108_0009785 3300048911 Bacteria 7767
1338 Ga0496108_0018762 3300048911 Bacteria 5670
1339 Ga0496108_0053576 3300048911 Bacteria 3383
1340 Ga0496108_0062491 3300048911 Bacteria 3135
1341 Ga0496108_0079336 3300048911 Bacteria 2779
1342 Ga0496108_0164976 3300048911 Bacteria 1915
1343 Ga0496108_0229663 3300048911 Bacteria 1613
1344 Ga0496109_0001327 3300048912 Bacteria 20396
1345 Ga0496109_0001694 3300048912 Bacteria 18370
1346 Ga0496109_0004263 3300048912 Bacteria 11944
1347 Ga0496109_0004289 3300048912 Bacteria 11907
1348 Ga0496109_0022164 3300048912 Bacteria 5623
1349 Ga0496109_0054246 3300048912 Bacteria 3656
1350 Ga0496109_0062240 3300048912 Bacteria 3412
1351 Ga0496109_0093940 3300048912 Bacteria 2776
1352 Ga0496109_0118233 3300048912 Bacteria 2467
1353 Ga0496109_0147396 3300048912 Bacteria 2202
1354 Ga0496110_0002379 3300048913 Bacteria 14095
1355 Ga0496110_0003013 3300048913 Bacteria 12777
1356 Ga0496110_0033305 3300048913 Bacteria 4456
1357 Ga0496110_0079303 3300048913 Bacteria 2923
1358 Ga0496110_0129443 3300048913 Bacteria 2278
1359 Ga0496110_0183584 3300048913 Bacteria 1899
1360 Ga0496110_0290846 3300048913 Bacteria 1488
1361 Ga0496111_0000375 3300048914 Bacteria 22279
1362 Ga0496111_0000761 3300048914 Bacteria 17211
1363 Ga0496111_0045936 3300048914 Bacteria 3144
1364 Ga0496111_0046746 3300048914 Bacteria 3116
1365 Ga0496111_0080317 3300048914 Bacteria 2379
1366 Ga0496111_0164936 3300048914 Bacteria 1645
1367 Ga0496111_0361944 3300048914 Bacteria 1073
1368 Ga0496112_0009605 3300048915 Bacteria 8726
1369 Ga0496112_0012331 3300048915 Bacteria 7851
1370 Ga0496112_0034516 3300048915 Bacteria 4923
1371 Ga0496112_0080341 3300048915 Bacteria 3224
1372 Ga0496112_0100138 3300048915 Bacteria 2867
1373 Ga0496112_0102391 3300048915 Bacteria 2833
1374 Ga0496112_0108034 3300048915 Bacteria 2752
1375 Ga0496112_0131148 3300048915 Bacteria 2477
1376 Ga0496112_0145441 3300048915 Bacteria 2339
1377 Ga0496112_0482171 3300048915 Bacteria 1176
1378 Ga0496113_0008990 3300048916 Bacteria 6541
1379 Ga0496113_0014110 3300048916 Bacteria 5438
1380 Ga0496113_0027637 3300048916 Bacteria 4070
1381 Ga0496113_0059945 3300048916 Bacteria 2867
1382 Ga0496113_0078402 3300048916 Bacteria 2527
1383 Ga0496113_0158846 3300048916 Bacteria 1786
1384 Ga0496113_0320027 3300048916 Bacteria 1243
1385 Ga0496114_0038690 3300048917 Bacteria 3947
1386 Ga0496114_0046511 3300048917 Bacteria 3606
1387 Ga0496114_0051484 3300048917 Bacteria 3428
1388 Ga0496114_0052250 3300048917 Bacteria 3404
1389 Ga0496114_0119001 3300048917 Bacteria 2270
1390 Ga0496114_0198312 3300048917 Bacteria 1757
1391 Ga0496114_0428427 3300048917 Bacteria 1172
1392 Ga0496115_0017851 3300048918 Bacteria 5434
1393 Ga0496115_0020631 3300048918 Bacteria 5084
1394 Ga0496115_0027677 3300048918 Bacteria 4436
1395 Ga0496115_0053170 3300048918 Bacteria 3250
1396 Ga0496115_0065774 3300048918 Bacteria 2929
1397 Ga0496115_0113604 3300048918 Bacteria 2225
1398 Ga0496115_0117926 3300048918 Bacteria 2183
1399 Ga0496115_0120178 3300048918 Bacteria 2161
1400 Ga0496115_0233806 3300048918 Bacteria 1515
1401 Ga0496115_0315060 3300048918 Bacteria 1280
1402 Ga0496126_0114950 3300048929 Bacteria 2341
1403 Ga0501031_0001202 3300049568 Bacteria 15788
1404 Ga0501032_0003544 3300049569 Bacteria 11911
1405 Ga0501033_0002722 3300049570 Bacteria 14822
1406 Ga0501033_0010042 3300049570 Bacteria 7268
1407 Ga0501033_0039922 3300049570 Bacteria 3505
1408 Ga0501033_0056700 3300049570 Bacteria 2895
1409 Ga0501033_0138211 3300049570 Bacteria 1762
1410 Ga0501034_0001160 3300049571 Bacteria 36511
1411 Ga0501034_0004413 3300049571 Bacteria 15657
1412 Ga0501034_0005371 3300049571 Bacteria 14024
1413 Ga0501034_0008354 3300049571 Bacteria 10949
1414 Ga0501034_0009885 3300049571 Bacteria 9972
1415 Ga0501034_0014752 3300049571 Bacteria 8042
1416 Ga0501034_0076181 3300049571 Bacteria 3361
1417 Ga0501034_0166135 3300049571 Bacteria 2175
1418 Ga0501034_0176046 3300049571 Bacteria 2105
1419 Ga0501036_0000559 3300049572 Bacteria 26726
1420 Ga0501036_0008108 3300049572 Bacteria 8608
1421 Ga0501036_0014214 3300049572 Bacteria 6623
1422 Ga0501036_0058459 3300049572 Bacteria 3266
1423 Ga0501036_0070599 3300049572 Bacteria 2953
1424 Ga0501037_0002178 3300049573 Bacteria 14167
1425 Ga0501037_0007486 3300049573 Bacteria 7989
1426 Ga0501037_0023157 3300049573 Bacteria 4593
1427 Ga0501037_0041732 3300049573 Bacteria 3373
1428 Ga0501037_0288688 3300049573 Bacteria 1141
1429 Ga0501038_0003386 3300049574 Bacteria 14866
1430 Ga0501038_0039834 3300049574 Bacteria 4109
1431 Ga0501038_0067164 3300049574 Bacteria 3051
1432 Ga0501038_0073413 3300049574 Bacteria 2897
1433 Ga0501038_0130260 3300049574 Bacteria 2066
1434 Ga0501038_0145721 3300049574 Bacteria 1933
1435 Ga0501039_0006912 3300049575 Bacteria 8634
1436 Ga0501039_0107918 3300049575 Bacteria 2176
1437 Ga0501039_0154177 3300049575 Bacteria 1805
1438 Ga0501040_0213038 3300049576 Bacteria 1374
1439 Ga0501042_0148236 3300049578 Bacteria 1692
1440 Ga0501042_0165075 3300049578 Bacteria 1598
1441 Ga0501043_0002821 3300049579 Bacteria 14532
1442 Ga0501043_0004264 3300049579 Bacteria 11645
1443 Ga0501043_0007305 3300049579 Bacteria 8770
1444 Ga0501043_0009163 3300049579 Bacteria 7783
1445 Ga0501043_0083769 3300049579 Bacteria 2507
1446 Ga0501043_0114090 3300049579 Bacteria 2121
1447 Ga0501046_0066291 3300049580 Bacteria 2814
1448 Ga0501046_0122974 3300049580 Bacteria 1973
1449 Ga0501046_0153834 3300049580 Bacteria 1734
1450 Ga0501047_0001508 3300049581 Bacteria 22710
1451 Ga0501047_0003796 3300049581 Bacteria 14208
1452 Ga0501047_0011344 3300049581 Bacteria 8437
1453 Ga0501047_0013392 3300049581 Bacteria 7774
1454 Ga0501047_0032228 3300049581 Bacteria 5058
1455 Ga0501047_0062021 3300049581 Bacteria 3607
1456 Ga0501047_0076431 3300049581 Bacteria 3222
1457 Ga0501047_0084327 3300049581 Bacteria 3054
1458 Ga0501047_0120113 3300049581 Bacteria 2510
1459 Ga0501047_0170943 3300049581 Bacteria 2042
1460 Ga0501048_0000151 3300049582 Bacteria 42561
1461 Ga0501048_0158297 3300049582 Bacteria 1602
1462 Ga0501048_0182294 3300049582 Bacteria 1488
1463 Ga0501067_0053355 3300049583 Bacteria 2240
1464 Ga0501068_0010972 3300049584 Bacteria 5100
1465 Ga0501069_0008356 3300049585 Bacteria 5437
1466 Ga0501069_0063640 3300049585 Bacteria 2060
1467 Ga0501069_0223398 3300049585 Bacteria 1095
1468 Ga0501070_0003459 3300049586 Bacteria 13696
1469 Ga0501070_0004589 3300049586 Bacteria 11839
1470 Ga0501070_0006477 3300049586 Bacteria 9967
1471 Ga0501070_0054383 3300049586 Bacteria 3320
1472 Ga0501070_0114361 3300049586 Bacteria 2229
1473 Ga0501070_0118670 3300049586 Bacteria 2186
1474 Ga0501070_0168517 3300049586 Bacteria 1804
1475 Ga0501071_0157996 3300049587 Bacteria 1693
1476 Ga0501071_0223544 3300049587 Bacteria 1417
1477 Ga0501072_0015871 3300049588 Bacteria 5773
1478 Ga0501072_0121944 3300049588 Bacteria 2077
1479 Ga0501072_0155165 3300049588 Bacteria 1826
1480 Ga0501072_0175834 3300049588 Bacteria 1708
1481 Ga0501072_0332593 3300049588 Bacteria 1207
1482 Ga0501073_0040941 3300049589 Bacteria 3275
1483 Ga0501073_0070556 3300049589 Bacteria 2434
1484 Ga0501073_0083503 3300049589 Bacteria 2222
1485 Ga0501074_0019723 3300049590 Bacteria 4896
1486 Ga0501074_0101743 3300049590 Bacteria 2057
1487 Ga0501074_0141060 3300049590 Bacteria 1724
1488 Ga0501074_0193306 3300049590 Bacteria 1451
1489 Ga0501075_0335555 3300049591 Bacteria 1152
1490 Ga0501076_0012864 3300049592 Bacteria 6262
1491 Ga0501076_0030845 3300049592 Bacteria 4177
1492 Ga0501076_0207627 3300049592 Bacteria 1600
1493 Ga0501077_0009725 3300049593 Bacteria 5978
1494 Ga0501077_0028754 3300049593 Bacteria 3533
1495 Ga0501079_0005682 3300049741 Bacteria 9314
1496 Ga0501079_0088797 3300049741 Bacteria 2394
1497 Ga0501080_0000130 3300049742 Bacteria 53465
1498 Ga0501080_0004495 3300049742 Bacteria 12429
1499 Ga0501080_0013629 3300049742 Bacteria 7486
1500 Ga0501080_0101033 3300049742 Bacteria 2675
1501 Ga0501081_0005195 3300049743 Bacteria 8382
1502 Ga0501081_0027372 3300049743 Bacteria 3846
1503 Ga0501081_0147304 3300049743 Bacteria 1690
1504 Ga0501083_0002779 3300049744 Bacteria 12096
1505 Ga0501083_0087641 3300049744 Bacteria 2058
1506 Ga0501083_0089202 3300049744 Bacteria 2038
1507 Ga0501083_0187205 3300049744 Bacteria 1351
1508 Ga0501035_0000127 3300049822 Bacteria 92397
1509 Ga0501035_0003212 3300049822 Bacteria 15662
1510 Ga0501035_0018873 3300049822 Bacteria 6354
1511 Ga0501035_0184682 3300049822 Bacteria 1795
1512 Ga0501044_0000636 3300049823 Bacteria 42394
1513 Ga0501044_0006768 3300049823 Bacteria 12633
1514 Ga0501044_0006986 3300049823 Bacteria 12419
1515 Ga0501044_0072220 3300049823 Bacteria 3509
1516 Ga0501044_0081073 3300049823 Bacteria 3285
1517 Ga0501044_0083869 3300049823 Bacteria 3221
1518 Ga0501044_0173688 3300049823 Bacteria 2125
1519 Ga0501044_0204983 3300049823 Bacteria 1929
1520 Ga0501044_0389244 3300049823 Bacteria 1308
1521 Ga0501045_0210092 3300049824 Bacteria 1450
1522 nmdc:mga03683_12449_c1 3300050489 Bacteria 3108
1523 nmdc:mga03n38_11343_c1 3300050490 Bacteria 3316
1524 nmdc:mga00v17_21110_c1 3300050491 Bacteria 3740
1525 nmdc:mga00v17_49244_c1 3300050491 Bacteria 2556
1526 nmdc:mga0yw44_12424_c1 3300050492 Bacteria 4438
1527 nmdc:mga0yw44_3606_c1 3300050492 Bacteria 6907
1528 nmdc:mga0yw44_7591_c1 3300050492 Bacteria 5347
1529 nmdc:mga0k408_7030_c1 3300050493 Bacteria 6007
1530 nmdc:mga0k408_75248_c1 3300050493 Bacteria 1973
1531 nmdc:mga06z11_27288_c1 3300050494 Bacteria 2728
1532 nmdc:mga06z11_45959_c1 3300050494 Bacteria 2210
1533 nmdc:mga04h51_11079_c1 3300050495 Bacteria 2494
1534 nmdc:mga07m45_111151_c1 3300050496 Bacteria 1578
1535 nmdc:mga07m45_180469_c1 3300050496 Bacteria 1228
1536 nmdc:mga07m45_33536_c2 3300050496 Bacteria 2280
1537 nmdc:mga05p37_138805_c1 3300050507 Bacteria 2979
1538 nmdc:mga05p37_1895_c1 3300050507 Bacteria 24373
1539 nmdc:mga05p37_27674_c1 3300050507 Bacteria 6905
1540 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
1541 nmdc:mga05p37_41079_c1 3300050507 Bacteria 5679
1542 nmdc:mga05p37_700088_c1 3300050507 Bacteria 1126
1543 nmdc:mga09592_194685_c1 3300050508 Bacteria 1755
1544 nmdc:mga09592_2778_c1 3300050508 Bacteria 14177
1545 nmdc:mga09592_44949_c1 3300050508 Bacteria 3719
1546 nmdc:mga09592_4679_c1 3300050508 Bacteria 11075
1547 nmdc:mga0qj67_168729_c1 3300050509 Bacteria 1777
1548 nmdc:mga0qj67_355_c1 3300050509 Bacteria 31660
1549 nmdc:mga0qj67_54571_c1 3300050509 Bacteria 3165
1550 nmdc:mga06r32_15693_c1 3300050510 Bacteria 6883
1551 nmdc:mga06r32_16982_c1 3300050510 Bacteria 6641
1552 nmdc:mga06r32_249086_c1 3300050510 Bacteria 1764
1553 nmdc:mga06r32_30535_c1 3300050510 Bacteria 5057
1554 nmdc:mga06r32_448_c1 3300050510 Bacteria 34999
1555 nmdc:mga08y16_1424_c1 3300050511 Bacteria 23997
1556 nmdc:mga08y16_171647_c1 3300050511 Bacteria 2252
1557 nmdc:mga08y16_2557_c1 3300050511 Bacteria 18712
1558 nmdc:mga08y16_35657_c1 3300050511 Bacteria 5224
1559 nmdc:mga08y16_407_c1 3300050511 Bacteria 39530
1560 nmdc:mga0n895_280414_c1 3300050512 Bacteria 1690
1561 nmdc:mga0n895_36549_c1 3300050512 Bacteria 4743
1562 nmdc:mga0n895_4084_c1 3300050512 Bacteria 11888
1563 nmdc:mga0n895_54718_c1 3300050512 Bacteria 3926
1564 nmdc:mga0n895_568_c1 3300050512 Bacteria 25310
1565 nmdc:mga0n895_73249_c1 3300050512 Bacteria 3400
1566 nmdc:mga0rr50_384936_c1 3300050513 Bacteria 1183
1567 nmdc:mga0rr50_7539_c1 3300050513 Bacteria 6720
1568 nmdc:mga08x19_16986_c1 3300050514 Bacteria 4447
1569 nmdc:mga08x19_198059_c1 3300050514 Bacteria 1376
1570 nmdc:mga08x19_21691_c1 3300050514 Bacteria 3969
1571 nmdc:mga08x19_222927_c1 3300050514 Bacteria 1296
1572 nmdc:mga0a205_132790_c1 3300050515 Bacteria 2390
1573 nmdc:mga0a205_153250_c1 3300050515 Bacteria 2203
1574 nmdc:mga0a205_170838_c1 3300050515 Bacteria 2070
1575 nmdc:mga0a205_466_c1 3300050515 Bacteria 31480
1576 nmdc:mga0a205_59030_c1 3300050515 Bacteria 3706
1577 nmdc:mga0sz30_34668_c1 3300050516 Bacteria 2103
1578 Ga0495601_0000009 3300053077 Bacteria 270622
1579 Ga0495601_0004483 3300053077 Bacteria 8071
1580 Ga0495601_0007632 3300053077 Bacteria 6353
1581 Ga0495601_0011641 3300053077 Bacteria 5271
1582 Ga0495601_0012490 3300053077 Bacteria 5095
1583 Ga0495601_0049867 3300053077 Bacteria 2640
1584 Ga0495601_0058912 3300053077 Bacteria 2434
1585 Ga0495601_0114385 3300053077 Bacteria 1749
1586 Ga0495601_0171868 3300053077 Bacteria 1416
1587 Ga0495612_0000019 3300053078 Bacteria 137844
1588 Ga0495612_0001278 3300053078 Bacteria 10388
1589 Ga0495612_0001469 3300053078 Bacteria 9701
1590 Ga0495612_0001909 3300053078 Bacteria 8578
1591 Ga0495612_0011336 3300053078 Bacteria 3593
1592 Ga0495612_0037112 3300053078 Bacteria 1978
1593 Ga0495612_0073386 3300053078 Bacteria 1429
1594 Ga0495655_0033108 3300053083 Bacteria 1269
1595 Ga0495595_0000015 3300053084 Bacteria 144946
1596 Ga0495595_0000232 3300053084 Bacteria 22160
1597 Ga0495595_0000468 3300053084 Bacteria 15336
1598 Ga0495595_0005677 3300053084 Bacteria 5051
1599 Ga0495595_0027618 3300053084 Bacteria 2529
1600 Ga0495595_0077067 3300053084 Bacteria 1583
1601 Ga0495619_0000012 3300053085 Bacteria 268349
1602 Ga0495619_0000016 3300053085 Bacteria 231442
1603 Ga0495619_0004130 3300053085 Bacteria 9278
1604 Ga0495619_0004487 3300053085 Bacteria 8913
1605 Ga0495619_0008463 3300053085 Bacteria 6505
1606 Ga0495619_0015192 3300053085 Bacteria 4867
1607 Ga0495619_0020642 3300053085 Bacteria 4198
1608 Ga0495619_0031425 3300053085 Bacteria 3441
1609 Ga0495619_0135565 3300053085 Bacteria 1693
1610 Ga0500643_001883 3300053087 Bacteria 11406
1611 Ga0500644_0000219 3300053088 Bacteria 33083
1612 Ga0500654_078649 3300053099 Bacteria 1554
1613 Ga0500593_002797 3300053117 Bacteria 6468
1614 Ga0500595_000010 3300053119 Bacteria 275806
1615 Ga0500595_001729 3300053119 Bacteria 11391
1616 Ga0500595_015341 3300053119 Bacteria 2879
1617 Ga0500642_0052180 3300053130 Bacteria 1810
1618 Ga0500642_0062680 3300053130 Bacteria 1674
1619 Ga0500652_000067 3300053131 Bacteria 45577
1620 Ga0500652_054133 3300053131 Bacteria 1643
1621 Ga0500604_0007299 3300053151 Bacteria 2929
1622 Ga0500616_0000001 3300053153 Bacteria 1986011
1623 Ga0500616_0027257 3300053153 Bacteria 3155
1624 Ga0500622_0014669 3300053156 Bacteria 4200
1625 Ga0500645_000051 3300053730 Bacteria 98521
1626 Ga0501084_0011277 3300054114 Bacteria 7398
1627 Ga0501084_0039547 3300054114 Bacteria 3945
1628 Ga0501084_0150997 3300054114 Bacteria 1958
1629 Ga0501082_0008357 3300060353 Bacteria 8928
1630 Ga0501082_0039944 3300060353 Bacteria 4048
1631 Ga0501082_0175114 3300060353 Bacteria 1865
1632 Ga0501082_0203579 3300060353 Bacteria 1722
1633 Ga0501082_0290905 3300060353 Bacteria 1422
1634 Ga0530510_0106852 3300061734 Bacteria 2048
1635 Ga0530510_0297197 3300061734 Bacteria 1208

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0046746 Ga0496111_0046746_27_962 311
2 3300048914 Ga0496111_0361944 Ga0496111_0361944_112_1047 311
3 3300048915 Ga0496112_0100138 Ga0496112_0100138_1906_2841 311
4 3300048915 Ga0496112_0482171 Ga0496112_0482171_27_962 311
5 3300048916 Ga0496113_0059945 Ga0496113_0059945_1906_2841 311
6 3300009011 Ga0105251_10005093 Ga0105251_100050934 312
7 3300009553 Ga0105249_10011981 Ga0105249_100119815 312
8 3300009176 Ga0105242_10000876 Ga0105242_1000087619 317
9 3300035170 Ga0373943_0033745 Ga0373943_0033745_912_1892 325
10 3300035725 Ga0373947_0059951 Ga0373947_0059951_1001_1981 325
11 3300036401 Ga0373937_0563913 Ga0373937_0563913_72_1052 325
12 3300005336 Ga0070680_100148616 Ga0070680_1001486162 329
13 3300005343 Ga0070687_100121317 Ga0070687_1001213172 329
14 3300025918 Ga0207662_10044933 Ga0207662_100449332 329
15 3300007265 Ga0099794_10000104 Ga0099794_1000010420 330
16 3300009094 Ga0111539_10002172 Ga0111539_100021722 330
17 3300009147 Ga0114129_10011994 Ga0114129_100119944 330
18 3300027671 Ga0209588_1000009 Ga0209588_100000939 330
19 3300050507 nmdc:mga05p37_27674_c1 nmdc:mga05p37_27674_c1_2675_3667 330
20 3300050508 nmdc:mga09592_4679_c1 nmdc:mga09592_4679_c1_5531_6523 330
21 3300050509 nmdc:mga0qj67_168729_c1 nmdc:mga0qj67_168729_c1_773_1765 330
22 3300050510 nmdc:mga06r32_16982_c1 nmdc:mga06r32_16982_c1_5092_6084 330
23 3300050511 nmdc:mga08y16_407_c1 nmdc:mga08y16_407_c1_32831_33823 330
24 3300031238 Ga0265332_10006777 Ga0265332_100067773 331
25 3300037853 Ga0436364_1255394 Ga0436364_1255394_148_1149 331
26 3300005436 Ga0070713_100329193 Ga0070713_1003291932 332
27 3300035090 Ga0373949_0000245 Ga0373949_0000245_6370_7368 332
28 3300044694 Ga0466963_0051343 Ga0466963_0051343_1652_2716 332
29 3300005445 Ga0070708_100003217 Ga0070708_1000032179 333
30 3300005536 Ga0070697_100041288 Ga0070697_1000412884 333
31 3300035692 Ga0373935_0009509 Ga0373935_0009509_4324_5331 333
32 3300046533 Ga0495640_0055489 Ga0495640_0055489_782_1789 333
33 3300047315 Ga0495581_0109564 Ga0495581_0109564_270_1277 333
34 3300005340 Ga0070689_100014402 Ga0070689_1000144023 334
35 3300005614 Ga0068856_100248595 Ga0068856_1002485952 334
36 3300006914 Ga0075436_100002520 Ga0075436_1000025209 334
37 3300025936 Ga0207670_10054762 Ga0207670_100547622 334
38 3300025942 Ga0207689_10023923 Ga0207689_100239232 334
39 3300031247 Ga0265340_10011819 Ga0265340_100118193 334
40 3300049570 Ga0501033_0010042 Ga0501033_0010042_1109_2113 334
41 3300049570 Ga0501033_0138211 Ga0501033_0138211_473_1477 334
42 3300049571 Ga0501034_0005371 Ga0501034_0005371_7494_8498 334
43 3300049571 Ga0501034_0076181 Ga0501034_0076181_471_1475 334
44 3300049571 Ga0501034_0166135 Ga0501034_0166135_1019_2023 334
45 3300049572 Ga0501036_0008108 Ga0501036_0008108_742_1746 334
46 3300049572 Ga0501036_0014214 Ga0501036_0014214_4472_5476 334
47 3300049572 Ga0501036_0058459 Ga0501036_0058459_1985_2989 334
48 3300049573 Ga0501037_0002178 Ga0501037_0002178_11260_12264 334
49 3300049573 Ga0501037_0023157 Ga0501037_0023157_3215_4219 334
50 3300049573 Ga0501037_0288688 Ga0501037_0288688_69_1073 334
51 3300049574 Ga0501038_0039834 Ga0501038_0039834_2046_3050 334
52 3300049574 Ga0501038_0073413 Ga0501038_0073413_1465_2469 334
53 3300049574 Ga0501038_0145721 Ga0501038_0145721_25_1029 334
54 3300049575 Ga0501039_0107918 Ga0501039_0107918_788_1792 334
55 3300049578 Ga0501042_0165075 Ga0501042_0165075_118_1122 334
56 3300049579 Ga0501043_0004264 Ga0501043_0004264_7759_8763 334
57 3300049579 Ga0501043_0007305 Ga0501043_0007305_6251_7255 334
58 3300049580 Ga0501046_0066291 Ga0501046_0066291_1155_2159 334
59 3300049581 Ga0501047_0003796 Ga0501047_0003796_3264_4268 334
60 3300049581 Ga0501047_0032228 Ga0501047_0032228_579_1583 334
61 3300049581 Ga0501047_0076431 Ga0501047_0076431_69_1073 334
62 3300049582 Ga0501048_0158297 Ga0501048_0158297_554_1558 334
63 3300049582 Ga0501048_0182294 Ga0501048_0182294_287_1291 334
64 3300049583 Ga0501067_0053355 Ga0501067_0053355_120_1124 334
65 3300049584 Ga0501068_0010972 Ga0501068_0010972_16_1020 334
66 3300049585 Ga0501069_0063640 Ga0501069_0063640_68_1072 334
67 3300049586 Ga0501070_0054383 Ga0501070_0054383_1980_3014 334
68 3300049587 Ga0501071_0223544 Ga0501071_0223544_53_1057 334
69 3300049589 Ga0501073_0040941 Ga0501073_0040941_1159_2163 334
70 3300049589 Ga0501073_0083503 Ga0501073_0083503_765_1769 334
71 3300049742 Ga0501080_0004495 Ga0501080_0004495_3553_4557 334
72 3300049742 Ga0501080_0101033 Ga0501080_0101033_1325_2329 334
73 3300049744 Ga0501083_0089202 Ga0501083_0089202_309_1313 334
74 3300049822 Ga0501035_0018873 Ga0501035_0018873_1606_2610 334
75 3300049823 Ga0501044_0006986 Ga0501044_0006986_6011_7015 334
76 3300049823 Ga0501044_0072220 Ga0501044_0072220_666_1700 334
77 3300049823 Ga0501044_0081073 Ga0501044_0081073_2053_3057 334
78 3300050514 nmdc:mga08x19_21691_c1 nmdc:mga08x19_21691_c1_1554_2594 334
79 3300060353 Ga0501082_0203579 Ga0501082_0203579_375_1379 334
80 3300053119 Ga0500595_001729 Ga0500595_001729_7831_8844 335
81 3300006844 Ga0075428_100000129 Ga0075428_10000012932 336
82 3300006846 Ga0075430_100121987 Ga0075430_1001219872 336
83 3300006847 Ga0075431_100000235 Ga0075431_10000023532 336
84 3300006880 Ga0075429_100000514 Ga0075429_1000005146 336
85 3300025297 Ga0209758_1000244 Ga0209758_100024429 336
86 3300027907 Ga0207428_10019811 Ga0207428_100198114 336
87 3300031691 Ga0316579_10033433 Ga0316579_100334332 336
88 3300049578 Ga0501042_0148236 Ga0501042_0148236_471_1487 336
89 3300049588 Ga0501072_0332593 Ga0501072_0332593_78_1094 336
90 3300049823 Ga0501044_0389244 Ga0501044_0389244_96_1106 336
91 3300053131 Ga0500652_054133 Ga0500652_054133_107_1120 336
92 3300001915 JGI24741J21665_1000025 JGI24741J21665_100002517 337
93 3300001979 JGI24740J21852_10000407 JGI24740J21852_100004077 337
94 3300001990 JGI24737J22298_10000999 JGI24737J22298_100009992 337
95 3300005327 Ga0070658_10000286 Ga0070658_1000028616 337
96 3300005329 Ga0070683_100220620 Ga0070683_1002206202 337
97 3300005339 Ga0070660_100003739 Ga0070660_1000037397 337
98 3300005366 Ga0070659_100002882 Ga0070659_1000028828 337
99 3300005455 Ga0070663_100008786 Ga0070663_1000087863 337
100 3300005539 Ga0068853_100007315 Ga0068853_10000731510 337
101 3300005563 Ga0068855_100071737 Ga0068855_1000717371 337
102 3300005564 Ga0070664_100046121 Ga0070664_1000461213 337
103 3300005577 Ga0068857_100056825 Ga0068857_1000568253 337
104 3300005578 Ga0068854_100321681 Ga0068854_1003216811 337
105 3300005616 Ga0068852_100017537 Ga0068852_1000175374 337
106 3300005616 Ga0068852_100102532 Ga0068852_1001025322 337
107 3300005834 Ga0068851_10021358 Ga0068851_100213582 337
108 3300009093 Ga0105240_10125616 Ga0105240_101256163 337
109 3300009174 Ga0105241_10002993 Ga0105241_100029937 337
110 3300009545 Ga0105237_10009803 Ga0105237_100098035 337
111 3300009551 Ga0105238_10093856 Ga0105238_100938563 337
112 3300010375 Ga0105239_10049307 Ga0105239_100493075 337
113 3300010375 Ga0105239_10159882 Ga0105239_101598823 337
114 3300013100 Ga0157373_10011374 Ga0157373_100113747 337
115 3300013102 Ga0157371_10000347 Ga0157371_1000034727 337
116 3300013104 Ga0157370_10031568 Ga0157370_100315685 337
117 3300013105 Ga0157369_10052363 Ga0157369_100523635 337
118 3300013307 Ga0157372_10003476 Ga0157372_100034769 337
119 3300025321 Ga0207656_10000752 Ga0207656_100007527 337
120 3300025904 Ga0207647_10034785 Ga0207647_100347853 337
121 3300025909 Ga0207705_10000282 Ga0207705_1000028216 337
122 3300025911 Ga0207654_10193833 Ga0207654_101938331 337
123 3300025913 Ga0207695_10001715 Ga0207695_1000171510 337
124 3300025914 Ga0207671_10003066 Ga0207671_1000306610 337
125 3300025919 Ga0207657_10001210 Ga0207657_100012107 337
126 3300025920 Ga0207649_10001058 Ga0207649_1000105818 337
127 3300025924 Ga0207694_10001546 Ga0207694_100015467 337
128 3300025924 Ga0207694_10346294 Ga0207694_103462942 337
129 3300025932 Ga0207690_10000554 Ga0207690_1000055414 337
130 3300025935 Ga0207709_10105661 Ga0207709_101056611 337
131 3300025944 Ga0207661_10186702 Ga0207661_101867022 337
132 3300025945 Ga0207679_10311150 Ga0207679_103111502 337
133 3300025949 Ga0207667_10000004 Ga0207667_10000004471 337
134 3300025981 Ga0207640_10000360 Ga0207640_1000036025 337
135 3300026041 Ga0207639_10000283 Ga0207639_1000028325 337
136 3300026067 Ga0207678_10000553 Ga0207678_100005537 337
137 3300026078 Ga0207702_10000466 Ga0207702_1000046616 337
138 3300026116 Ga0207674_10001436 Ga0207674_1000143617 337
139 3300026118 Ga0207675_100179983 Ga0207675_1001799831 337
140 3300026142 Ga0207698_10002579 Ga0207698_100025797 337
141 3300026142 Ga0207698_10012018 Ga0207698_100120184 337
142 3300031548 Ga0307408_100009183 Ga0307408_1000091834 337
143 3300031731 Ga0307405_10026036 Ga0307405_100260363 337
144 3300031824 Ga0307413_10049639 Ga0307413_100496393 337
145 3300031901 Ga0307406_10022104 Ga0307406_100221042 337
146 3300031911 Ga0307412_10017358 Ga0307412_100173583 337
147 3300032002 Ga0307416_100063255 Ga0307416_1000632552 337
148 3300039453 Ga0436362_0732063 Ga0436362_0732063_887_1915 337
149 3300042438 Ga0439459_0015748 Ga0439459_0015748_334_1356 337
150 3300046506 Ga0495583_0112427 Ga0495583_0112427_129_1142 337
151 3300049588 Ga0501072_0155165 Ga0501072_0155165_383_1396 337
152 3300049592 Ga0501076_0030845 Ga0501076_0030845_1005_2018 337
153 3300049593 Ga0501077_0009725 Ga0501077_0009725_376_1389 337
154 3300049741 Ga0501079_0005682 Ga0501079_0005682_5186_6199 337
155 3300049743 Ga0501081_0005195 Ga0501081_0005195_5813_6826 337
156 3300049824 Ga0501045_0210092 Ga0501045_0210092_154_1173 337
157 3300053117 Ga0500593_002797 Ga0500593_002797_1862_2878 337
158 3300054114 Ga0501084_0011277 Ga0501084_0011277_4400_5413 337
159 3300060353 Ga0501082_0008357 Ga0501082_0008357_580_1593 337
160 3300061734 Ga0530510_0297197 Ga0530510_0297197_174_1187 337
161 iso_pu_bacteria 2889790730 2889792694 337
162 iso_pu_bacteria 2889914905 2889918910 337
163 3300005328 Ga0070676_10076084 Ga0070676_100760842 338
164 3300005330 Ga0070690_100016496 Ga0070690_1000164962 338
165 3300005340 Ga0070689_100006692 Ga0070689_1000066927 338
166 3300005347 Ga0070668_100205852 Ga0070668_1002058522 338
167 3300005355 Ga0070671_100016478 Ga0070671_1000164783 338
168 3300005356 Ga0070674_100069635 Ga0070674_1000696353 338
169 3300005364 Ga0070673_100132727 Ga0070673_1001327272 338
170 3300005365 Ga0070688_100004173 Ga0070688_1000041731 338
171 3300005436 Ga0070713_100008099 Ga0070713_1000080991 338
172 3300005543 Ga0070672_100290221 Ga0070672_1002902212 338
173 3300005618 Ga0068864_100026460 Ga0068864_1000264604 338
174 3300006038 Ga0075365_10178284 Ga0075365_101782841 338
175 3300006042 Ga0075368_10020861 Ga0075368_100208612 338
176 3300006178 Ga0075367_10199100 Ga0075367_101991002 338
177 3300006178 Ga0075367_10243423 Ga0075367_102434231 338
178 3300006195 Ga0075366_10047706 Ga0075366_100477062 338
179 3300006195 Ga0075366_10076291 Ga0075366_100762912 338
180 3300009093 Ga0105240_10463024 Ga0105240_104630242 338
181 3300009148 Ga0105243_10098179 Ga0105243_100981792 338
182 3300009176 Ga0105242_10133655 Ga0105242_101336552 338
183 3300025931 Ga0207644_10148631 Ga0207644_101486311 338
184 3300025936 Ga0207670_10001179 Ga0207670_1000117913 338
185 3300025937 Ga0207669_10023099 Ga0207669_100230992 338
186 3300025941 Ga0207711_10003367 Ga0207711_1000336710 338
187 3300025941 Ga0207711_10088707 Ga0207711_100887072 338
188 3300026035 Ga0207703_10146228 Ga0207703_101462282 338
189 3300026095 Ga0207676_10014354 Ga0207676_100143544 338
190 3300028381 Ga0268264_10303900 Ga0268264_103039002 338
191 3300028794 Ga0307515_10104872 Ga0307515_101048722 338
192 3300031241 Ga0265325_10001027 Ga0265325_1000102712 338
193 3300031616 Ga0307508_10005393 Ga0307508_100053933 338
194 3300035691 Ga0373931_0182193 Ga0373931_0182193_180_1199 338
195 3300035692 Ga0373935_0036864 Ga0373935_0036864_937_1956 338
196 3300035695 Ga0373927_0116881 Ga0373927_0116881_419_1438 338
197 3300035725 Ga0373947_0077354 Ga0373947_0077354_363_1385 338
198 3300046454 Ga0495592_0021305 Ga0495592_0021305_1103_2122 338
199 3300046536 Ga0495587_0146639 Ga0495587_0146639_312_1331 338
200 3300046543 Ga0495645_0105132 Ga0495645_0105132_939_1958 338
201 3300046615 Ga0495656_0106454 Ga0495656_0106454_235_1254 338
202 3300048903 Ga0496100_0102436 Ga0496100_0102436_904_1923 338
203 3300048903 Ga0496100_0123410 Ga0496100_0123410_164_1186 338
204 3300048904 Ga0496101_0177393 Ga0496101_0177393_338_1357 338
205 3300048905 Ga0496102_0031355 Ga0496102_0031355_515_1534 338
206 3300048905 Ga0496102_0169890 Ga0496102_0169890_381_1400 338
207 3300048907 Ga0496104_0078754 Ga0496104_0078754_235_1254 338
208 3300048908 Ga0496105_0087845 Ga0496105_0087845_697_1716 338
209 3300048909 Ga0496106_0072204 Ga0496106_0072204_26_1045 338
210 3300048910 Ga0496107_0092897 Ga0496107_0092897_934_1953 338
211 3300048911 Ga0496108_0053576 Ga0496108_0053576_1859_2878 338
212 3300048912 Ga0496109_0062240 Ga0496109_0062240_2110_3129 338
213 3300048914 Ga0496111_0045936 Ga0496111_0045936_1735_2754 338
214 3300048915 Ga0496112_0034516 Ga0496112_0034516_180_1199 338
215 3300048915 Ga0496112_0131148 Ga0496112_0131148_898_1917 338
216 3300048915 Ga0496112_0145441 Ga0496112_0145441_894_1913 338
217 3300048916 Ga0496113_0320027 Ga0496113_0320027_199_1218 338
218 3300048917 Ga0496114_0046511 Ga0496114_0046511_791_1810 338
219 3300048918 Ga0496115_0027677 Ga0496115_0027677_2607_3626 338
220 3300049588 Ga0501072_0015871 Ga0501072_0015871_460_1521 338
221 3300050491 nmdc:mga00v17_49244_c1 nmdc:mga00v17_49244_c1_69_1088 338
222 3300050493 nmdc:mga0k408_75248_c1 nmdc:mga0k408_75248_c1_910_1929 338
223 3300050494 nmdc:mga06z11_27288_c1 nmdc:mga06z11_27288_c1_818_1837 338
224 3300050496 nmdc:mga07m45_180469_c1 nmdc:mga07m45_180469_c1_36_1055 338
225 3300050496 nmdc:mga07m45_33536_c2 nmdc:mga07m45_33536_c2_638_1657 338
226 3300053077 Ga0495601_0012490 Ga0495601_0012490_1390_2409 338
227 3300053085 Ga0495619_0015192 Ga0495619_0015192_1315_2334 338
228 3300053130 Ga0500642_0052180 Ga0500642_0052180_50_1069 338
229 3300053130 Ga0500642_0062680 Ga0500642_0062680_253_1272 338
230 3300060353 Ga0501082_0175114 Ga0501082_0175114_555_1616 338
231 3300005577 Ga0068857_100002886 Ga0068857_10000288610 339
232 3300006914 Ga0075436_100171117 Ga0075436_1001711171 339
233 3300014325 Ga0163163_10141198 Ga0163163_101411981 339
234 3300025903 Ga0207680_10181794 Ga0207680_101817942 339
235 3300025941 Ga0207711_10140479 Ga0207711_101404793 339
236 3300025942 Ga0207689_10197858 Ga0207689_101978582 339
237 3300026116 Ga0207674_10002710 Ga0207674_100027109 339
238 3300031548 Ga0307408_100109091 Ga0307408_1001090912 339
239 3300035692 Ga0373935_0044046 Ga0373935_0044046_953_1975 339
240 3300048918 Ga0496115_0117926 Ga0496115_0117926_638_1660 339
241 3300049588 Ga0501072_0175834 Ga0501072_0175834_118_1140 339
242 3300049591 Ga0501075_0335555 Ga0501075_0335555_67_1092 339
243 3300049593 Ga0501077_0028754 Ga0501077_0028754_273_1295 339
244 3300050514 nmdc:mga08x19_222927_c1 nmdc:mga08x19_222927_c1_41_1060 339
245 3300061734 Ga0530510_0106852 Ga0530510_0106852_77_1099 339
246 iso_pu_bacteria 2643221547 2643758857 339
247 3300005535 Ga0070684_100153473 Ga0070684_1001534732 340
248 3300005539 Ga0068853_100166347 Ga0068853_1001663473 340
249 3300005548 Ga0070665_100103652 Ga0070665_1001036523 340
250 3300005563 Ga0068855_100014384 Ga0068855_1000143847 340
251 3300005563 Ga0068855_100262014 Ga0068855_1002620141 340
252 3300005614 Ga0068856_100288264 Ga0068856_1002882642 340
253 3300005842 Ga0068858_100049977 Ga0068858_1000499773 340
254 3300006028 Ga0070717_10275905 Ga0070717_102759052 340
255 3300006237 Ga0097621_100019187 Ga0097621_1000191873 340
256 3300006880 Ga0075429_100024317 Ga0075429_1000243173 340
257 3300009093 Ga0105240_10001330 Ga0105240_1000133015 340
258 3300009093 Ga0105240_10012388 Ga0105240_100123887 340
259 3300009093 Ga0105240_10018367 Ga0105240_100183677 340
260 3300009093 Ga0105240_10248802 Ga0105240_102488022 340
261 3300009093 Ga0105240_10394102 Ga0105240_103941022 340
262 3300009098 Ga0105245_10026321 Ga0105245_100263213 340
263 3300009098 Ga0105245_10029390 Ga0105245_100293902 340
264 3300009147 Ga0114129_10086220 Ga0114129_100862203 340
265 3300009551 Ga0105238_10014770 Ga0105238_1001477010 340
266 3300009551 Ga0105238_10210975 Ga0105238_102109753 340
267 3300010159 Ga0099796_10003147 Ga0099796_100031472 340
268 3300010375 Ga0105239_10663913 Ga0105239_106639132 340
269 3300013104 Ga0157370_10003270 Ga0157370_100032707 340
270 3300013105 Ga0157369_10120270 Ga0157369_101202702 340
271 3300014325 Ga0163163_10080840 Ga0163163_100808402 340
272 3300014969 Ga0157376_10231630 Ga0157376_102316302 340
273 3300021384 Ga0213876_10094220 Ga0213876_100942202 340
274 3300025903 Ga0207680_10039354 Ga0207680_100393542 340
275 3300025911 Ga0207654_10047698 Ga0207654_100476983 340
276 3300025913 Ga0207695_10002674 Ga0207695_1000267421 340
277 3300025913 Ga0207695_10092597 Ga0207695_100925973 340
278 3300025913 Ga0207695_10139755 Ga0207695_101397552 340
279 3300025913 Ga0207695_10140473 Ga0207695_101404732 340
280 3300025921 Ga0207652_10131092 Ga0207652_101310922 340
281 3300025927 Ga0207687_10021450 Ga0207687_100214504 340
282 3300025927 Ga0207687_10051799 Ga0207687_100517992 340
283 3300025934 Ga0207686_10072424 Ga0207686_100724242 340
284 3300025949 Ga0207667_10120968 Ga0207667_101209681 340
285 3300026041 Ga0207639_10088973 Ga0207639_100889732 340
286 3300026078 Ga0207702_10040505 Ga0207702_100405053 340
287 3300026116 Ga0207674_10182069 Ga0207674_101820693 340
288 3300027614 Ga0209970_1012446 Ga0209970_10124462 340
289 3300031711 Ga0265314_10001386 Ga0265314_1000138622 340
290 3300035170 Ga0373943_0058786 Ga0373943_0058786_31_1056 340
291 3300036401 Ga0373937_0002423 Ga0373937_0002423_2795_3823 340
292 3300037853 Ga0436364_0770319 Ga0436364_0770319_1871_2899 340
293 3300039437 Ga0436365_0521195 Ga0436365_0521195_1717_2745 340
294 3300039437 Ga0436365_1728475 Ga0436365_1728475_5628_6653 340
295 3300039437 Ga0436365_1900328 Ga0436365_1900328_187_1251 340
296 3300039450 Ga0436363_0049442 Ga0436363_0049442_44_1069 340
297 3300046514 Ga0495618_0045073 Ga0495618_0045073_443_1468 340
298 3300046533 Ga0495640_0123696 Ga0495640_0123696_141_1166 340
299 3300046559 Ga0495667_0141171 Ga0495667_0141171_192_1217 340
300 3300046642 Ga0495634_0076840 Ga0495634_0076840_423_1448 340
301 3300047319 Ga0495674_0050002 Ga0495674_0050002_2145_3170 340
302 3300047319 Ga0495674_0167697 Ga0495674_0167697_616_1641 340
303 3300048903 Ga0496100_0044906 Ga0496100_0044906_366_1391 340
304 3300048904 Ga0496101_0010578 Ga0496101_0010578_4802_5827 340
305 3300048905 Ga0496102_0019120 Ga0496102_0019120_4307_5332 340
306 3300048906 Ga0496103_0018479 Ga0496103_0018479_25_1050 340
307 3300048907 Ga0496104_0019341 Ga0496104_0019341_3833_4858 340
308 3300048908 Ga0496105_0118820 Ga0496105_0118820_60_1085 340
309 3300048909 Ga0496106_0099309 Ga0496106_0099309_733_1758 340
310 3300048911 Ga0496108_0018762 Ga0496108_0018762_4537_5562 340
311 3300048912 Ga0496109_0022164 Ga0496109_0022164_626_1651 340
312 3300048913 Ga0496110_0079303 Ga0496110_0079303_1162_2187 340
313 3300048915 Ga0496112_0012331 Ga0496112_0012331_880_1905 340
314 3300048916 Ga0496113_0158846 Ga0496113_0158846_644_1669 340
315 3300048918 Ga0496115_0065774 Ga0496115_0065774_1750_2775 340
316 3300049571 Ga0501034_0004413 Ga0501034_0004413_3156_4181 340
317 3300050508 nmdc:mga09592_44949_c1 nmdc:mga09592_44949_c1_1672_2697 340
318 3300050509 nmdc:mga0qj67_54571_c1 nmdc:mga0qj67_54571_c1_336_1361 340
319 3300050510 nmdc:mga06r32_30535_c1 nmdc:mga06r32_30535_c1_3220_4245 340
320 3300053077 Ga0495601_0114385 Ga0495601_0114385_336_1361 340
321 3300053078 Ga0495612_0011336 Ga0495612_0011336_1391_2416 340
322 3300053084 Ga0495595_0005677 Ga0495595_0005677_1700_2725 340
323 3300053085 Ga0495619_0008463 Ga0495619_0008463_4408_5433 340
324 3300001915 JGI24741J21665_1001465 JGI24741J21665_10014652 341
325 3300001979 JGI24740J21852_10001165 JGI24740J21852_1000116512 341
326 3300002075 JGI24738J21930_10002072 JGI24738J21930_100020724 341
327 3300002077 JGI24744J21845_10001388 JGI24744J21845_100013884 341
328 3300005289 Ga0065704_10004383 Ga0065704_100043833 341
329 3300005327 Ga0070658_10000287 Ga0070658_1000028723 341
330 3300005339 Ga0070660_100007670 Ga0070660_1000076708 341
331 3300005344 Ga0070661_100004343 Ga0070661_1000043433 341
332 3300005353 Ga0070669_100093907 Ga0070669_1000939072 341
333 3300005353 Ga0070669_100169002 Ga0070669_1001690022 341
334 3300005355 Ga0070671_100049560 Ga0070671_1000495603 341
335 3300005365 Ga0070688_100055393 Ga0070688_1000553933 341
336 3300005455 Ga0070663_100005862 Ga0070663_1000058622 341
337 3300005456 Ga0070678_100007345 Ga0070678_1000073456 341
338 3300005457 Ga0070662_100176282 Ga0070662_1001762822 341
339 3300005467 Ga0070706_100000079 Ga0070706_10000007945 341
340 3300005530 Ga0070679_100151436 Ga0070679_1001514362 341
341 3300005539 Ga0068853_100025076 Ga0068853_1000250763 341
342 3300005548 Ga0070665_100343267 Ga0070665_1003432672 341
343 3300005563 Ga0068855_100000036 Ga0068855_100000036144 341
344 3300005563 Ga0068855_100132341 Ga0068855_1001323411 341
345 3300005577 Ga0068857_100046231 Ga0068857_1000462313 341
346 3300005578 Ga0068854_100002010 Ga0068854_1000020106 341
347 3300005614 Ga0068856_100000589 Ga0068856_10000058922 341
348 3300005616 Ga0068852_100002348 Ga0068852_1000023486 341
349 3300005618 Ga0068864_100125788 Ga0068864_1001257883 341
350 3300005719 Ga0068861_100000051 Ga0068861_1000000519 341
351 3300005834 Ga0068851_10004860 Ga0068851_100048605 341
352 3300005841 Ga0068863_100403626 Ga0068863_1004036262 341
353 3300006237 Ga0097621_100046146 Ga0097621_1000461464 341
354 3300006358 Ga0068871_100037454 Ga0068871_1000374544 341
355 3300009093 Ga0105240_10035904 Ga0105240_100359043 341
356 3300009174 Ga0105241_10059318 Ga0105241_100593183 341
357 3300009177 Ga0105248_10000324 Ga0105248_1000032410 341
358 3300009545 Ga0105237_10014642 Ga0105237_100146422 341
359 3300009545 Ga0105237_10128931 Ga0105237_101289311 341
360 3300009551 Ga0105238_10016698 Ga0105238_100166982 341
361 3300009551 Ga0105238_10087181 Ga0105238_100871811 341
362 3300009978 Ga0105148_100041 Ga0105148_10004113 341
363 3300010375 Ga0105239_10007843 Ga0105239_100078436 341
364 3300013104 Ga0157370_10000047 Ga0157370_10000047103 341
365 3300013105 Ga0157369_10000342 Ga0157369_1000034216 341
366 3300013296 Ga0157374_10014782 Ga0157374_100147822 341
367 3300013296 Ga0157374_10458819 Ga0157374_104588191 341
368 3300013307 Ga0157372_10007553 Ga0157372_100075534 341
369 3300014326 Ga0157380_10003447 Ga0157380_100034474 341
370 3300014326 Ga0157380_10085590 Ga0157380_100855901 341
371 3300017792 Ga0163161_10007158 Ga0163161_100071582 341
372 3300025321 Ga0207656_10033577 Ga0207656_100335772 341
373 3300025735 Ga0207713_1017546 Ga0207713_10175463 341
374 3300025901 Ga0207688_10013944 Ga0207688_100139444 341
375 3300025904 Ga0207647_10001033 Ga0207647_100010336 341
376 3300025907 Ga0207645_10040271 Ga0207645_100402714 341
377 3300025909 Ga0207705_10000014 Ga0207705_10000014255 341
378 3300025910 Ga0207684_10000068 Ga0207684_10000068133 341
379 3300025911 Ga0207654_10022628 Ga0207654_100226283 341
380 3300025913 Ga0207695_10021087 Ga0207695_100210873 341
381 3300025913 Ga0207695_10386884 Ga0207695_103868841 341
382 3300025914 Ga0207671_10012757 Ga0207671_100127577 341
383 3300025919 Ga0207657_10003591 Ga0207657_100035919 341
384 3300025920 Ga0207649_10003604 Ga0207649_100036042 341
385 3300025921 Ga0207652_10113150 Ga0207652_101131502 341
386 3300025922 Ga0207646_10028008 Ga0207646_100280084 341
387 3300025924 Ga0207694_10009156 Ga0207694_100091562 341
388 3300025925 Ga0207650_10186084 Ga0207650_101860842 341
389 3300025926 Ga0207659_10189568 Ga0207659_101895682 341
390 3300025928 Ga0207700_10082218 Ga0207700_100822182 341
391 3300025933 Ga0207706_10028004 Ga0207706_100280044 341
392 3300025940 Ga0207691_10139708 Ga0207691_101397083 341
393 3300025941 Ga0207711_10001438 Ga0207711_1000143817 341
394 3300025941 Ga0207711_10010413 Ga0207711_100104137 341
395 3300025949 Ga0207667_10000007 Ga0207667_10000007388 341
396 3300025961 Ga0207712_10013141 Ga0207712_100131413 341
397 3300025981 Ga0207640_10000591 Ga0207640_1000059111 341
398 3300025986 Ga0207658_10342912 Ga0207658_103429121 341
399 3300026067 Ga0207678_10012842 Ga0207678_100128422 341
400 3300026067 Ga0207678_10028560 Ga0207678_100285603 341
401 3300026078 Ga0207702_10000602 Ga0207702_1000060216 341
402 3300026078 Ga0207702_10076569 Ga0207702_100765692 341
403 3300026095 Ga0207676_10220104 Ga0207676_102201042 341
404 3300026116 Ga0207674_10004831 Ga0207674_1000483112 341
405 3300026118 Ga0207675_100000066 Ga0207675_10000006631 341
406 3300026121 Ga0207683_10009461 Ga0207683_100094619 341
407 3300026142 Ga0207698_10001628 Ga0207698_100016286 341
408 3300027671 Ga0209588_1037814 Ga0209588_10378142 341
409 3300031730 Ga0307516_10002086 Ga0307516_100020867 341
410 3300037853 Ga0436364_0920866 Ga0436364_0920866_551_1582 341
411 3300039437 Ga0436365_1548569 Ga0436365_1548569_514_1539 341
412 3300048905 Ga0496102_0084901 Ga0496102_0084901_70_1095 341
413 3300048907 Ga0496104_0008094 Ga0496104_0008094_5632_6663 341
414 3300048908 Ga0496105_0035352 Ga0496105_0035352_275_1306 341
415 3300048912 Ga0496109_0093940 Ga0496109_0093940_436_1461 341
416 3300048917 Ga0496114_0119001 Ga0496114_0119001_423_1454 341
417 3300048917 Ga0496114_0428427 Ga0496114_0428427_126_1157 341
418 3300048918 Ga0496115_0053170 Ga0496115_0053170_965_1996 341
419 3300049579 Ga0501043_0083769 Ga0501043_0083769_1223_2260 341
420 3300049586 Ga0501070_0114361 Ga0501070_0114361_667_1704 341
421 3300049590 Ga0501074_0193306 Ga0501074_0193306_190_1224 341
422 3300053119 Ga0500595_015341 Ga0500595_015341_1780_2814 341
423 3300053131 Ga0500652_000067 Ga0500652_000067_38469_39503 341
424 3300053156 Ga0500622_0014669 Ga0500622_0014669_2044_3075 341
425 3300005327 Ga0070658_10077391 Ga0070658_100773913 342
426 3300005337 Ga0070682_100111568 Ga0070682_1001115682 342
427 3300005340 Ga0070689_100061730 Ga0070689_1000617301 342
428 3300005343 Ga0070687_100179631 Ga0070687_1001796312 342
429 3300005364 Ga0070673_100090998 Ga0070673_1000909983 342
430 3300005434 Ga0070709_10051907 Ga0070709_100519073 342
431 3300005434 Ga0070709_10304177 Ga0070709_103041771 342
432 3300005435 Ga0070714_100106381 Ga0070714_1001063812 342
433 3300005437 Ga0070710_10019867 Ga0070710_100198672 342
434 3300005439 Ga0070711_100028663 Ga0070711_1000286633 342
435 3300005467 Ga0070706_100076142 Ga0070706_1000761422 342
436 3300005471 Ga0070698_100206265 Ga0070698_1002062652 342
437 3300005518 Ga0070699_100006196 Ga0070699_1000061963 342
438 3300005530 Ga0070679_100355882 Ga0070679_1003558821 342
439 3300005536 Ga0070697_100126520 Ga0070697_1001265202 342
440 3300005544 Ga0070686_100105663 Ga0070686_1001056631 342
441 3300005563 Ga0068855_100110210 Ga0068855_1001102102 342
442 3300005563 Ga0068855_100329994 Ga0068855_1003299942 342
443 3300005616 Ga0068852_100006940 Ga0068852_1000069407 342
444 3300005618 Ga0068864_100172364 Ga0068864_1001723641 342
445 3300005842 Ga0068858_100239069 Ga0068858_1002390692 342
446 3300005985 Ga0081539_10041780 Ga0081539_100417803 342
447 3300006028 Ga0070717_10261367 Ga0070717_102613672 342
448 3300006038 Ga0075365_10129110 Ga0075365_101291102 342
449 3300006042 Ga0075368_10032981 Ga0075368_100329812 342
450 3300006048 Ga0075363_100018353 Ga0075363_1000183532 342
451 3300006163 Ga0070715_10011895 Ga0070715_100118953 342
452 3300006175 Ga0070712_100002872 Ga0070712_10000287210 342
453 3300006175 Ga0070712_100004319 Ga0070712_1000043193 342
454 3300006186 Ga0075369_10013491 Ga0075369_100134911 342
455 3300006844 Ga0075428_100116804 Ga0075428_1001168043 342
456 3300006847 Ga0075431_100007118 Ga0075431_1000071189 342
457 3300006871 Ga0075434_100281503 Ga0075434_1002815032 342
458 3300006871 Ga0075434_100325016 Ga0075434_1003250161 342
459 3300009093 Ga0105240_10087796 Ga0105240_100877963 342
460 3300009098 Ga0105245_10050776 Ga0105245_100507763 342
461 3300009551 Ga0105238_10120036 Ga0105238_101200363 342
462 3300013104 Ga0157370_10106369 Ga0157370_101063693 342
463 3300021384 Ga0213876_10060622 Ga0213876_100606222 342
464 3300021388 Ga0213875_10000046 Ga0213875_1000004682 342
465 3300025905 Ga0207685_10010113 Ga0207685_100101133 342
466 3300025909 Ga0207705_10173634 Ga0207705_101736342 342
467 3300025910 Ga0207684_10240228 Ga0207684_102402281 342
468 3300025915 Ga0207693_10005773 Ga0207693_100057733 342
469 3300025915 Ga0207693_10006970 Ga0207693_100069705 342
470 3300025916 Ga0207663_10047344 Ga0207663_100473442 342
471 3300025916 Ga0207663_10090652 Ga0207663_100906522 342
472 3300025916 Ga0207663_10243044 Ga0207663_102430442 342
473 3300025917 Ga0207660_10174289 Ga0207660_101742892 342
474 3300025928 Ga0207700_10018469 Ga0207700_100184693 342
475 3300025928 Ga0207700_10160177 Ga0207700_101601773 342
476 3300025929 Ga0207664_10117021 Ga0207664_101170212 342
477 3300025929 Ga0207664_10218975 Ga0207664_102189752 342
478 3300025939 Ga0207665_10041791 Ga0207665_100417913 342
479 3300025941 Ga0207711_10157475 Ga0207711_101574752 342
480 3300025949 Ga0207667_10122326 Ga0207667_101223262 342
481 3300025949 Ga0207667_10183001 Ga0207667_101830011 342
482 3300025961 Ga0207712_10414489 Ga0207712_104144891 342
483 3300026142 Ga0207698_10027362 Ga0207698_100273622 342
484 3300028800 Ga0265338_10018977 Ga0265338_100189774 342
485 3300030760 Ga0265762_1003180 Ga0265762_10031803 342
486 3300031090 Ga0265760_10020371 Ga0265760_100203712 342
487 3300031235 Ga0265330_10090627 Ga0265330_100906272 342
488 3300031241 Ga0265325_10004584 Ga0265325_100045847 342
489 3300031249 Ga0265339_10000091 Ga0265339_1000009137 342
490 3300031595 Ga0265313_10000260 Ga0265313_1000026043 342
491 3300031711 Ga0265314_10001108 Ga0265314_1000110817 342
492 3300031712 Ga0265342_10023337 Ga0265342_100233373 342
493 3300031730 Ga0307516_10084832 Ga0307516_100848321 342
494 3300034817 Ga0373948_0001105 Ga0373948_0001105_190_1218 342
495 3300035089 Ga0373944_0001541 Ga0373944_0001541_2204_3235 342
496 3300035114 Ga0373939_0000723 Ga0373939_0000723_6082_7110 342
497 3300035116 Ga0373945_0016161 Ga0373945_0016161_591_1622 342
498 3300035116 Ga0373945_0060977 Ga0373945_0060977_255_1283 342
499 3300035117 Ga0373953_0045111 Ga0373953_0045111_507_1535 342
500 3300035118 Ga0373954_0021831 Ga0373954_0021831_1802_2830 342
501 3300035170 Ga0373943_0057315 Ga0373943_0057315_444_1475 342
502 3300035170 Ga0373943_0079753 Ga0373943_0079753_595_1623 342
503 3300035171 Ga0373946_0001305 Ga0373946_0001305_1412_2443 342
504 3300035172 Ga0373955_0095514 Ga0373955_0095514_242_1270 342
505 3300035692 Ga0373935_0028625 Ga0373935_0028625_949_1980 342
506 3300035695 Ga0373927_0006481 Ga0373927_0006481_5477_6508 342
507 3300035695 Ga0373927_0030734 Ga0373927_0030734_859_1890 342
508 3300035724 Ga0373933_0001461 Ga0373933_0001461_8364_9392 342
509 3300035724 Ga0373933_0006680 Ga0373933_0006680_356_1384 342
510 3300035725 Ga0373947_0004520 Ga0373947_0004520_1503_2534 342
511 3300036401 Ga0373937_0000414 Ga0373937_0000414_18060_19088 342
512 3300036401 Ga0373937_0010217 Ga0373937_0010217_2434_3462 342
513 3300037068 Ga0373925_0000957 Ga0373925_0000957_19795_20826 342
514 3300037068 Ga0373925_0004700 Ga0373925_0004700_175_1206 342
515 3300037068 Ga0373925_0023501 Ga0373925_0023501_2236_3264 342
516 3300037312 Ga0395899_0187816 Ga0395899_0187816_266_1294 342
517 3300037418 Ga0395900_0004702 Ga0395900_0004702_8561_9589 342
518 3300037853 Ga0436364_0402761 Ga0436364_0402761_8506_9543 342
519 3300037853 Ga0436364_1100316 Ga0436364_1100316_571_1602 342
520 3300038443 Ga0395901_0037913 Ga0395901_0037913_3572_4600 342
521 3300038443 Ga0395901_0187336 Ga0395901_0187336_723_1751 342
522 3300038443 Ga0395901_0237563 Ga0395901_0237563_420_1448 342
523 3300039437 Ga0436365_0189918 Ga0436365_0189918_902_1930 342
524 3300039437 Ga0436365_1211815 Ga0436365_1211815_614_1651 342
525 3300039437 Ga0436365_1613453 Ga0436365_1613453_2638_3666 342
526 3300044693 Ga0466961_0028605 Ga0466961_0028605_1350_2378 342
527 3300044694 Ga0466963_0005781 Ga0466963_0005781_119_1147 342
528 3300044694 Ga0466963_0017561 Ga0466963_0017561_2628_3659 342
529 3300044694 Ga0466963_0167287 Ga0466963_0167287_279_1307 342
530 3300044735 Ga0466968_0076178 Ga0466968_0076178_55_1086 342
531 3300044842 Ga0466957_0082460 Ga0466957_0082460_371_1399 342
532 3300044842 Ga0466957_0296962 Ga0466957_0296962_10_1038 342
533 3300044901 Ga0466960_0110834 Ga0466960_0110834_239_1267 342
534 3300045049 Ga0466959_0032363 Ga0466959_0032363_1723_2751 342
535 3300045836 Ga0466958_0037631 Ga0466958_0037631_1002_2030 342
536 3300045976 Ga0466967_0007381 Ga0466967_0007381_6726_7754 342
537 3300045976 Ga0466967_0133602 Ga0466967_0133602_980_2008 342
538 3300046454 Ga0495592_0025948 Ga0495592_0025948_3163_4191 342
539 3300046459 Ga0495629_0015067 Ga0495629_0015067_621_1649 342
540 3300046460 Ga0495638_0007358 Ga0495638_0007358_5525_6571 342
541 3300046460 Ga0495638_0094312 Ga0495638_0094312_518_1546 342
542 3300046460 Ga0495638_0180329 Ga0495638_0180329_123_1169 342
543 3300046462 Ga0495651_0000540 Ga0495651_0000540_13575_14603 342
544 3300046463 Ga0495653_0001530 Ga0495653_0001530_5100_6128 342
545 3300046463 Ga0495653_0021490 Ga0495653_0021490_2354_3385 342
546 3300046475 Ga0495639_0028692 Ga0495639_0028692_888_1919 342
547 3300046476 Ga0495662_0000280 Ga0495662_0000280_190_1221 342
548 3300046477 Ga0495664_0000112 Ga0495664_0000112_12275_13306 342
549 3300046477 Ga0495664_0003517 Ga0495664_0003517_3034_4062 342
550 3300046511 Ga0495608_0000556 Ga0495608_0000556_10026_11054 342
551 3300046511 Ga0495608_0105039 Ga0495608_0105039_366_1394 342
552 3300046514 Ga0495618_0001092 Ga0495618_0001092_6584_7612 342
553 3300046514 Ga0495618_0004674 Ga0495618_0004674_1399_2430 342
554 3300046516 Ga0495628_0030684 Ga0495628_0030684_724_1752 342
555 3300046517 Ga0495630_0002719 Ga0495630_0002719_4364_5395 342
556 3300046517 Ga0495630_0015052 Ga0495630_0015052_1724_2755 342
557 3300046517 Ga0495630_0168118 Ga0495630_0168118_335_1363 342
558 3300046529 Ga0495652_0012696 Ga0495652_0012696_4589_5617 342
559 3300046533 Ga0495640_0000871 Ga0495640_0000871_4602_5633 342
560 3300046533 Ga0495640_0150028 Ga0495640_0150028_414_1445 342
561 3300046535 Ga0495586_0008351 Ga0495586_0008351_619_1650 342
562 3300046543 Ga0495645_0001913 Ga0495645_0001913_1780_2811 342
563 3300046559 Ga0495667_0014951 Ga0495667_0014951_2485_3513 342
564 3300046559 Ga0495667_0017616 Ga0495667_0017616_1500_2528 342
565 3300046616 Ga0495668_0088113 Ga0495668_0088113_437_1483 342
566 3300046642 Ga0495634_0002257 Ga0495634_0002257_532_1560 342
567 3300046642 Ga0495634_0008488 Ga0495634_0008488_6466_7497 342
568 3300046663 Ga0495635_0006959 Ga0495635_0006959_5418_6449 342
569 3300046675 Ga0495657_0008345 Ga0495657_0008345_6027_7055 342
570 3300046678 Ga0495599_0005900 Ga0495599_0005900_5032_6060 342
571 3300046679 Ga0495623_0003572 Ga0495623_0003572_7354_8382 342
572 3300046679 Ga0495623_0090986 Ga0495623_0090986_816_1844 342
573 3300046680 Ga0495646_0001276 Ga0495646_0001276_7799_8827 342
574 3300046689 Ga0495613_0017573 Ga0495613_0017573_4096_5124 342
575 3300046690 Ga0495624_0001093 Ga0495624_0001093_9435_10466 342
576 3300046690 Ga0495624_0111090 Ga0495624_0111090_265_1296 342
577 3300046809 Ga0495600_0000186 Ga0495600_0000186_30472_31500 342
578 3300047315 Ga0495581_0033015 Ga0495581_0033015_1464_2495 342
579 3300047317 Ga0495604_0000150 Ga0495604_0000150_13291_14319 342
580 3300047319 Ga0495674_0005281 Ga0495674_0005281_6856_7887 342
581 3300047321 Ga0495676_0036232 Ga0495676_0036232_3002_4033 342
582 3300047322 Ga0495680_0000429 Ga0495680_0000429_38174_39202 342
583 3300047444 Ga0495675_0108750 Ga0495675_0108750_26_1054 342
584 3300047471 Ga0495684_0007113 Ga0495684_0007113_1452_2483 342
585 3300047471 Ga0495684_0039613 Ga0495684_0039613_1118_2149 342
586 3300047471 Ga0495684_0223215 Ga0495684_0223215_268_1296 342
587 3300047673 Ga0495593_0047953 Ga0495593_0047953_1159_2190 342
588 3300048918 Ga0496115_0233806 Ga0496115_0233806_402_1430 342
589 3300049570 Ga0501033_0039922 Ga0501033_0039922_217_1245 342
590 3300049571 Ga0501034_0001160 Ga0501034_0001160_21734_22762 342
591 3300049571 Ga0501034_0008354 Ga0501034_0008354_9902_10930 342
592 3300049571 Ga0501034_0014752 Ga0501034_0014752_5175_6203 342
593 3300049572 Ga0501036_0070599 Ga0501036_0070599_1584_2612 342
594 3300049573 Ga0501037_0041732 Ga0501037_0041732_1001_2029 342
595 3300049579 Ga0501043_0002821 Ga0501043_0002821_5900_6928 342
596 3300049580 Ga0501046_0122974 Ga0501046_0122974_841_1869 342
597 3300049580 Ga0501046_0153834 Ga0501046_0153834_220_1251 342
598 3300049581 Ga0501047_0001508 Ga0501047_0001508_8881_9909 342
599 3300049581 Ga0501047_0062021 Ga0501047_0062021_1854_2882 342
600 3300049582 Ga0501048_0000151 Ga0501048_0000151_23838_24866 342
601 3300049585 Ga0501069_0008356 Ga0501069_0008356_876_1904 342
602 3300049585 Ga0501069_0223398 Ga0501069_0223398_22_1050 342
603 3300049586 Ga0501070_0004589 Ga0501070_0004589_3246_4274 342
604 3300049586 Ga0501070_0006477 Ga0501070_0006477_8758_9786 342
605 3300049586 Ga0501070_0168517 Ga0501070_0168517_561_1589 342
606 3300049588 Ga0501072_0121944 Ga0501072_0121944_972_2003 342
607 3300049590 Ga0501074_0019723 Ga0501074_0019723_3657_4685 342
608 3300049590 Ga0501074_0101743 Ga0501074_0101743_627_1658 342
609 3300049590 Ga0501074_0141060 Ga0501074_0141060_302_1333 342
610 3300049592 Ga0501076_0207627 Ga0501076_0207627_62_1093 342
611 3300049742 Ga0501080_0000130 Ga0501080_0000130_39170_40198 342
612 3300049742 Ga0501080_0013629 Ga0501080_0013629_1154_2182 342
613 3300049743 Ga0501081_0027372 Ga0501081_0027372_1830_2861 342
614 3300049744 Ga0501083_0002779 Ga0501083_0002779_5729_6757 342
615 3300049744 Ga0501083_0187205 Ga0501083_0187205_301_1329 342
616 3300049822 Ga0501035_0000127 Ga0501035_0000127_73712_74740 342
617 3300049823 Ga0501044_0000636 Ga0501044_0000636_23866_24894 342
618 3300050490 nmdc:mga03n38_11343_c1 nmdc:mga03n38_11343_c1_593_1627 342
619 3300050495 nmdc:mga04h51_11079_c1 nmdc:mga04h51_11079_c1_315_1349 342
620 3300050507 nmdc:mga05p37_41079_c1 nmdc:mga05p37_41079_c1_4541_5599 342
621 3300050508 nmdc:mga09592_194685_c1 nmdc:mga09592_194685_c1_433_1491 342
622 3300050510 nmdc:mga06r32_15693_c1 nmdc:mga06r32_15693_c1_5217_6248 342
623 3300050513 nmdc:mga0rr50_384936_c1 nmdc:mga0rr50_384936_c1_19_1053 342
624 3300050516 nmdc:mga0sz30_34668_c1 nmdc:mga0sz30_34668_c1_315_1349 342
625 3300053077 Ga0495601_0011641 Ga0495601_0011641_166_1194 342
626 3300053078 Ga0495612_0001469 Ga0495612_0001469_8379_9407 342
627 3300053078 Ga0495612_0073386 Ga0495612_0073386_349_1380 342
628 3300053084 Ga0495595_0000232 Ga0495595_0000232_17850_18878 342
629 3300053085 Ga0495619_0004487 Ga0495619_0004487_7260_8288 342
630 3300053085 Ga0495619_0020642 Ga0495619_0020642_1716_2747 342
631 3300053085 Ga0495619_0135565 Ga0495619_0135565_436_1464 342
632 3300053087 Ga0500643_001883 Ga0500643_001883_1646_2674 342
633 3300053088 Ga0500644_0000219 Ga0500644_0000219_31283_32311 342
634 3300053099 Ga0500654_078649 Ga0500654_078649_310_1356 342
635 3300053119 Ga0500595_000010 Ga0500595_000010_99677_100705 342
636 3300053151 Ga0500604_0007299 Ga0500604_0007299_467_1513 342
637 3300053153 Ga0500616_0000001 Ga0500616_0000001_720664_721692 342
638 3300053730 Ga0500645_000051 Ga0500645_000051_30032_31060 342
639 3300054114 Ga0501084_0150997 Ga0501084_0150997_344_1375 342
640 3300060353 Ga0501082_0039944 Ga0501082_0039944_1012_2043 342
641 3300060353 Ga0501082_0290905 Ga0501082_0290905_241_1272 342
642 3300002073 JGI24745J21846_1002888 JGI24745J21846_10028881 343
643 3300002244 JGI24742J22300_10010450 JGI24742J22300_100104502 343
644 3300003203 JGI25406J46586_10008875 JGI25406J46586_100088752 343
645 3300003911 JGI25405J52794_10009282 JGI25405J52794_100092822 343
646 3300005329 Ga0070683_100047446 Ga0070683_1000474463 343
647 3300005330 Ga0070690_100151692 Ga0070690_1001516921 343
648 3300005330 Ga0070690_100206401 Ga0070690_1002064011 343
649 3300005331 Ga0070670_100010828 Ga0070670_1000108281 343
650 3300005331 Ga0070670_100255999 Ga0070670_1002559992 343
651 3300005334 Ga0068869_100049119 Ga0068869_1000491192 343
652 3300005337 Ga0070682_100108667 Ga0070682_1001086672 343
653 3300005338 Ga0068868_100043180 Ga0068868_1000431803 343
654 3300005339 Ga0070660_100058459 Ga0070660_1000584592 343
655 3300005340 Ga0070689_100232523 Ga0070689_1002325231 343
656 3300005341 Ga0070691_10042496 Ga0070691_100424962 343
657 3300005343 Ga0070687_100044396 Ga0070687_1000443962 343
658 3300005347 Ga0070668_100024657 Ga0070668_1000246572 343
659 3300005353 Ga0070669_100063929 Ga0070669_1000639293 343
660 3300005353 Ga0070669_100154471 Ga0070669_1001544712 343
661 3300005354 Ga0070675_100018150 Ga0070675_1000181502 343
662 3300005354 Ga0070675_100463543 Ga0070675_1004635431 343
663 3300005355 Ga0070671_100001584 Ga0070671_1000015842 343
664 3300005356 Ga0070674_100021278 Ga0070674_1000212781 343
665 3300005364 Ga0070673_100004762 Ga0070673_1000047626 343
666 3300005366 Ga0070659_100039631 Ga0070659_1000396313 343
667 3300005434 Ga0070709_10001838 Ga0070709_100018384 343
668 3300005435 Ga0070714_100023305 Ga0070714_1000233054 343
669 3300005436 Ga0070713_100008135 Ga0070713_1000081354 343
670 3300005437 Ga0070710_10020272 Ga0070710_100202724 343
671 3300005439 Ga0070711_100028452 Ga0070711_1000284524 343
672 3300005439 Ga0070711_100065085 Ga0070711_1000650852 343
673 3300005455 Ga0070663_100097831 Ga0070663_1000978312 343
674 3300005456 Ga0070678_100146122 Ga0070678_1001461222 343
675 3300005457 Ga0070662_100072656 Ga0070662_1000726563 343
676 3300005459 Ga0068867_100055791 Ga0068867_1000557912 343
677 3300005466 Ga0070685_10010154 Ga0070685_100101542 343
678 3300005539 Ga0068853_100165587 Ga0068853_1001655872 343
679 3300005543 Ga0070672_100001595 Ga0070672_10000159512 343
680 3300005564 Ga0070664_100106928 Ga0070664_1001069282 343
681 3300005577 Ga0068857_100246785 Ga0068857_1002467852 343
682 3300005578 Ga0068854_100015614 Ga0068854_1000156145 343
683 3300005615 Ga0070702_100140066 Ga0070702_1001400661 343
684 3300005616 Ga0068852_100175059 Ga0068852_1001750592 343
685 3300005718 Ga0068866_10066469 Ga0068866_100664692 343
686 3300005719 Ga0068861_100066532 Ga0068861_1000665323 343
687 3300005842 Ga0068858_100220049 Ga0068858_1002200492 343
688 3300005842 Ga0068858_100420989 Ga0068858_1004209892 343
689 3300005937 Ga0081455_10070465 Ga0081455_100704652 343
690 3300005981 Ga0081538_10004000 Ga0081538_100040002 343
691 3300005981 Ga0081538_10079951 Ga0081538_100799512 343
692 3300005983 Ga0081540_1012817 Ga0081540_10128172 343
693 3300005983 Ga0081540_1014080 Ga0081540_10140803 343
694 3300005983 Ga0081540_1030650 Ga0081540_10306502 343
695 3300005985 Ga0081539_10002801 Ga0081539_100028013 343
696 3300006028 Ga0070717_10027405 Ga0070717_100274053 343
697 3300006038 Ga0075365_10003616 Ga0075365_100036169 343
698 3300006038 Ga0075365_10007764 Ga0075365_100077646 343
699 3300006163 Ga0070715_10001029 Ga0070715_100010294 343
700 3300006175 Ga0070712_100000205 Ga0070712_10000020527 343
701 3300006175 Ga0070712_100012564 Ga0070712_1000125644 343
702 3300006175 Ga0070712_100226411 Ga0070712_1002264112 343
703 3300006177 Ga0075362_10001107 Ga0075362_100011078 343
704 3300006178 Ga0075367_10037538 Ga0075367_100375383 343
705 3300006178 Ga0075367_10056375 Ga0075367_100563751 343
706 3300006195 Ga0075366_10008250 Ga0075366_100082503 343
707 3300006358 Ga0068871_100368486 Ga0068871_1003684861 343
708 3300006844 Ga0075428_100252902 Ga0075428_1002529022 343
709 3300006844 Ga0075428_100300821 Ga0075428_1003008212 343
710 3300006846 Ga0075430_100001391 Ga0075430_10000139117 343
711 3300006847 Ga0075431_100266723 Ga0075431_1002667232 343
712 3300006871 Ga0075434_100019151 Ga0075434_1000191517 343
713 3300006871 Ga0075434_100394635 Ga0075434_1003946352 343
714 3300006881 Ga0068865_100183147 Ga0068865_1001831472 343
715 3300007076 Ga0075435_100159150 Ga0075435_1001591502 343
716 3300009094 Ga0111539_10041626 Ga0111539_100416265 343
717 3300009098 Ga0105245_10188627 Ga0105245_101886272 343
718 3300009147 Ga0114129_10215521 Ga0114129_102155212 343
719 3300009148 Ga0105243_10392054 Ga0105243_103920541 343
720 3300009177 Ga0105248_10646959 Ga0105248_106469591 343
721 3300012510 Ga0157316_1003265 Ga0157316_10032652 343
722 3300013296 Ga0157374_10022077 Ga0157374_100220776 343
723 3300013306 Ga0163162_10131050 Ga0163162_101310502 343
724 3300014325 Ga0163163_10155801 Ga0163163_101558012 343
725 3300014326 Ga0157380_10123281 Ga0157380_101232812 343
726 3300014745 Ga0157377_10009768 Ga0157377_100097683 343
727 3300014968 Ga0157379_10138117 Ga0157379_101381172 343
728 3300024225 Ga0224572_1007631 Ga0224572_10076313 343
729 3300024227 Ga0228598_1003796 Ga0228598_10037963 343
730 3300025321 Ga0207656_10035134 Ga0207656_100351341 343
731 3300025893 Ga0207682_10000375 Ga0207682_100003752 343
732 3300025900 Ga0207710_10083142 Ga0207710_100831422 343
733 3300025901 Ga0207688_10004400 Ga0207688_100044003 343
734 3300025901 Ga0207688_10079122 Ga0207688_100791222 343
735 3300025906 Ga0207699_10031167 Ga0207699_100311673 343
736 3300025907 Ga0207645_10013908 Ga0207645_100139086 343
737 3300025908 Ga0207643_10002110 Ga0207643_100021103 343
738 3300025915 Ga0207693_10000988 Ga0207693_100009886 343
739 3300025915 Ga0207693_10014858 Ga0207693_100148584 343
740 3300025915 Ga0207693_10024106 Ga0207693_100241063 343
741 3300025915 Ga0207693_10056234 Ga0207693_100562344 343
742 3300025916 Ga0207663_10018467 Ga0207663_100184674 343
743 3300025918 Ga0207662_10079705 Ga0207662_100797052 343
744 3300025919 Ga0207657_10039754 Ga0207657_100397542 343
745 3300025920 Ga0207649_10059063 Ga0207649_100590632 343
746 3300025923 Ga0207681_10041137 Ga0207681_100411373 343
747 3300025925 Ga0207650_10002081 Ga0207650_100020811 343
748 3300025925 Ga0207650_10009736 Ga0207650_100097366 343
749 3300025926 Ga0207659_10040646 Ga0207659_100406462 343
750 3300025926 Ga0207659_10061654 Ga0207659_100616542 343
751 3300025928 Ga0207700_10057899 Ga0207700_100578993 343
752 3300025928 Ga0207700_10119768 Ga0207700_101197682 343
753 3300025929 Ga0207664_10047877 Ga0207664_100478772 343
754 3300025933 Ga0207706_10003081 Ga0207706_100030817 343
755 3300025933 Ga0207706_10046405 Ga0207706_100464054 343
756 3300025936 Ga0207670_10164810 Ga0207670_101648102 343
757 3300025936 Ga0207670_10224981 Ga0207670_102249812 343
758 3300025937 Ga0207669_10048999 Ga0207669_100489992 343
759 3300025937 Ga0207669_10153452 Ga0207669_101534522 343
760 3300025939 Ga0207665_10003664 Ga0207665_100036643 343
761 3300025940 Ga0207691_10010480 Ga0207691_100104809 343
762 3300025940 Ga0207691_10053994 Ga0207691_100539943 343
763 3300025941 Ga0207711_10012335 Ga0207711_100123357 343
764 3300025944 Ga0207661_10099392 Ga0207661_100993922 343
765 3300025945 Ga0207679_10047223 Ga0207679_100472232 343
766 3300025945 Ga0207679_10337763 Ga0207679_103377632 343
767 3300025960 Ga0207651_10037376 Ga0207651_100373763 343
768 3300025972 Ga0207668_10310016 Ga0207668_103100162 343
769 3300025981 Ga0207640_10027258 Ga0207640_100272582 343
770 3300025986 Ga0207658_10117446 Ga0207658_101174462 343
771 3300025986 Ga0207658_10180688 Ga0207658_101806882 343
772 3300026035 Ga0207703_10059555 Ga0207703_100595552 343
773 3300026035 Ga0207703_10162630 Ga0207703_101626302 343
774 3300026041 Ga0207639_10115029 Ga0207639_101150292 343
775 3300026041 Ga0207639_10209562 Ga0207639_102095621 343
776 3300026067 Ga0207678_10005470 Ga0207678_100054703 343
777 3300026067 Ga0207678_10038884 Ga0207678_100388842 343
778 3300026075 Ga0207708_10001504 Ga0207708_1000150421 343
779 3300026078 Ga0207702_10138984 Ga0207702_101389841 343
780 3300026088 Ga0207641_10170979 Ga0207641_101709792 343
781 3300026089 Ga0207648_10015184 Ga0207648_100151845 343
782 3300026089 Ga0207648_10031802 Ga0207648_100318023 343
783 3300026095 Ga0207676_10046205 Ga0207676_100462053 343
784 3300026116 Ga0207674_10081378 Ga0207674_100813783 343
785 3300026118 Ga0207675_100044150 Ga0207675_1000441503 343
786 3300026121 Ga0207683_10000755 Ga0207683_1000075528 343
787 3300026121 Ga0207683_10021344 Ga0207683_100213444 343
788 3300026121 Ga0207683_10341032 Ga0207683_103410322 343
789 3300026142 Ga0207698_10053466 Ga0207698_100534663 343
790 3300027907 Ga0207428_10062020 Ga0207428_100620202 343
791 3300028577 Ga0265318_10006701 Ga0265318_100067014 343
792 3300031240 Ga0265320_10033117 Ga0265320_100331172 343
793 3300031241 Ga0265325_10006109 Ga0265325_100061095 343
794 3300031241 Ga0265325_10109337 Ga0265325_101093371 343
795 3300031247 Ga0265340_10022478 Ga0265340_100224782 343
796 3300031247 Ga0265340_10043475 Ga0265340_100434752 343
797 3300031249 Ga0265339_10001918 Ga0265339_100019185 343
798 3300031595 Ga0265313_10035545 Ga0265313_100355452 343
799 3300031711 Ga0265314_10172492 Ga0265314_101724922 343
800 3300031712 Ga0265342_10129677 Ga0265342_101296771 343
801 3300031901 Ga0307406_10184256 Ga0307406_101842561 343
802 3300035089 Ga0373944_0003215 Ga0373944_0003215_410_1444 343
803 3300035111 Ga0373923_0000157 Ga0373923_0000157_282_1319 343
804 3300035111 Ga0373923_0032038 Ga0373923_0032038_846_1880 343
805 3300035113 Ga0373936_0095881 Ga0373936_0095881_190_1227 343
806 3300035116 Ga0373945_0004209 Ga0373945_0004209_3415_4452 343
807 3300035116 Ga0373945_0010461 Ga0373945_0010461_633_1667 343
808 3300035120 Ga0373957_0005928 Ga0373957_0005928_1955_2992 343
809 3300035170 Ga0373943_0001586 Ga0373943_0001586_4343_5380 343
810 3300035171 Ga0373946_0003086 Ga0373946_0003086_2597_3634 343
811 3300035171 Ga0373946_0023486 Ga0373946_0023486_531_1565 343
812 3300035172 Ga0373955_0000562 Ga0373955_0000562_7414_8451 343
813 3300035410 Ga0373924_0010027 Ga0373924_0010027_2002_3033 343
814 3300035692 Ga0373935_0019036 Ga0373935_0019036_2678_3715 343
815 3300035692 Ga0373935_0296127 Ga0373935_0296127_73_1107 343
816 3300035695 Ga0373927_0071673 Ga0373927_0071673_703_1740 343
817 3300035695 Ga0373927_0126964 Ga0373927_0126964_470_1501 343
818 3300035725 Ga0373947_0000476 Ga0373947_0000476_21564_22601 343
819 3300036401 Ga0373937_0000009 Ga0373937_0000009_77103_78140 343
820 3300036401 Ga0373937_0022700 Ga0373937_0022700_262_1293 343
821 3300036401 Ga0373937_0092486 Ga0373937_0092486_259_1290 343
822 3300037068 Ga0373925_0000194 Ga0373925_0000194_34058_35095 343
823 3300037068 Ga0373925_0007047 Ga0373925_0007047_2053_3087 343
824 3300037068 Ga0373925_0290045 Ga0373925_0290045_192_1223 343
825 3300037418 Ga0395900_0303864 Ga0395900_0303864_514_1548 343
826 3300039437 Ga0436365_0401858 Ga0436365_0401858_1378_2424 343
827 3300039437 Ga0436365_1396550 Ga0436365_1396550_788_1819 343
828 3300039447 Ga0436361_0668552 Ga0436361_0668552_1922_2956 343
829 3300041408 Ga0439453_0003236 Ga0439453_0003236_340_1383 343
830 3300042003 Ga0439443_000206 Ga0439443_000206_633_1676 343
831 3300042156 Ga0439446_0011140 Ga0439446_0011140_509_1546 343
832 3300042436 Ga0439435_0000853 Ga0439435_0000853_827_1870 343
833 3300046454 Ga0495592_0000018 Ga0495592_0000018_14194_15231 343
834 3300046455 Ga0495603_0036468 Ga0495603_0036468_1380_2414 343
835 3300046458 Ga0495591_024948 Ga0495591_024948_14_1048 343
836 3300046459 Ga0495629_0005894 Ga0495629_0005894_3179_4216 343
837 3300046462 Ga0495651_0002271 Ga0495651_0002271_8965_10002 343
838 3300046462 Ga0495651_0028798 Ga0495651_0028798_1894_2925 343
839 3300046463 Ga0495653_0000032 Ga0495653_0000032_46304_47341 343
840 3300046472 Ga0495580_0212618 Ga0495580_0212618_221_1255 343
841 3300046474 Ga0495605_0117590 Ga0495605_0117590_64_1101 343
842 3300046477 Ga0495664_0000010 Ga0495664_0000010_190371_191408 343
843 3300046499 Ga0495594_0004663 Ga0495594_0004663_72_1106 343
844 3300046511 Ga0495608_0000008 Ga0495608_0000008_77241_78278 343
845 3300046514 Ga0495618_0000002 Ga0495618_0000002_192644_193681 343
846 3300046516 Ga0495628_0000009 Ga0495628_0000009_190399_191436 343
847 3300046517 Ga0495630_0005324 Ga0495630_0005324_7288_8325 343
848 3300046528 Ga0495642_0026933 Ga0495642_0026933_1164_2198 343
849 3300046529 Ga0495652_0000011 Ga0495652_0000011_76931_77968 343
850 3300046533 Ga0495640_0000009 Ga0495640_0000009_25683_26720 343
851 3300046536 Ga0495587_0000006 Ga0495587_0000006_304117_305154 343
852 3300046536 Ga0495587_0078694 Ga0495587_0078694_632_1663 343
853 3300046537 Ga0495598_0002327 Ga0495598_0002327_2347_3384 343
854 3300046539 Ga0495621_0006458 Ga0495621_0006458_695_1732 343
855 3300046542 Ga0495597_0080372 Ga0495597_0080372_21_1193 343
856 3300046543 Ga0495645_0000010 Ga0495645_0000010_46304_47341 343
857 3300046543 Ga0495645_0086340 Ga0495645_0086340_748_1779 343
858 3300046557 Ga0495622_0068988 Ga0495622_0068988_137_1171 343
859 3300046559 Ga0495667_0000005 Ga0495667_0000005_190399_191436 343
860 3300046642 Ga0495634_0000223 Ga0495634_0000223_32573_33610 343
861 3300046642 Ga0495634_0052337 Ga0495634_0052337_276_1310 343
862 3300046642 Ga0495634_0161339 Ga0495634_0161339_356_1387 343
863 3300046663 Ga0495635_0000008 Ga0495635_0000008_76914_77951 343
864 3300046663 Ga0495635_0167213 Ga0495635_0167213_275_1309 343
865 3300046674 Ga0495588_0031067 Ga0495588_0031067_1300_2334 343
866 3300046675 Ga0495657_0000058 Ga0495657_0000058_31667_32704 343
867 3300046675 Ga0495657_0083979 Ga0495657_0083979_628_1659 343
868 3300046678 Ga0495599_0000007 Ga0495599_0000007_76931_77968 343
869 3300046678 Ga0495599_0009668 Ga0495599_0009668_3121_4152 343
870 3300046679 Ga0495623_0000085 Ga0495623_0000085_11471_12508 343
871 3300046679 Ga0495623_0010639 Ga0495623_0010639_852_1883 343
872 3300046680 Ga0495646_0000021 Ga0495646_0000021_76886_77923 343
873 3300046689 Ga0495613_0016426 Ga0495613_0016426_1482_2519 343
874 3300046689 Ga0495613_0098610 Ga0495613_0098610_598_1632 343
875 3300046809 Ga0495600_0000001 Ga0495600_0000001_76931_77968 343
876 3300047315 Ga0495581_0059022 Ga0495581_0059022_249_1286 343
877 3300047317 Ga0495604_0000012 Ga0495604_0000012_190386_191423 343
878 3300047319 Ga0495674_0000011 Ga0495674_0000011_192672_193709 343
879 3300047319 Ga0495674_0115182 Ga0495674_0115182_910_1941 343
880 3300047321 Ga0495676_0140222 Ga0495676_0140222_153_1187 343
881 3300047322 Ga0495680_0001281 Ga0495680_0001281_21414_22451 343
882 3300047444 Ga0495675_0000096 Ga0495675_0000096_36856_37893 343
883 3300047446 Ga0495679_036733 Ga0495679_036733_141_1175 343
884 3300047471 Ga0495684_0000084 Ga0495684_0000084_18260_19297 343
885 3300048088 Ga0495602_0000073 Ga0495602_0000073_76914_77951 343
886 3300048903 Ga0496100_0015237 Ga0496100_0015237_2574_3611 343
887 3300048903 Ga0496100_0033095 Ga0496100_0033095_147_1178 343
888 3300048904 Ga0496101_0014939 Ga0496101_0014939_741_1775 343
889 3300048904 Ga0496101_0015869 Ga0496101_0015869_3841_5013 343
890 3300048904 Ga0496101_0265935 Ga0496101_0265935_292_1326 343
891 3300048905 Ga0496102_0080917 Ga0496102_0080917_15_1154 343
892 3300048905 Ga0496102_0132438 Ga0496102_0132438_709_1743 343
893 3300048905 Ga0496102_0153596 Ga0496102_0153596_58_1089 343
894 3300048906 Ga0496103_0014890 Ga0496103_0014890_3077_4111 343
895 3300048906 Ga0496103_0100361 Ga0496103_0100361_530_1702 343
896 3300048907 Ga0496104_0001219 Ga0496104_0001219_13827_14861 343
897 3300048907 Ga0496104_0077142 Ga0496104_0077142_1969_3141 343
898 3300048907 Ga0496104_0147636 Ga0496104_0147636_742_1776 343
899 3300048907 Ga0496104_0299073 Ga0496104_0299073_454_1485 343
900 3300048908 Ga0496105_0023784 Ga0496105_0023784_2965_3999 343
901 3300048908 Ga0496105_0087389 Ga0496105_0087389_630_1802 343
902 3300048909 Ga0496106_0004954 Ga0496106_0004954_7687_8859 343
903 3300048910 Ga0496107_0017547 Ga0496107_0017547_857_2029 343
904 3300048910 Ga0496107_0066503 Ga0496107_0066503_953_1987 343
905 3300048910 Ga0496107_0147255 Ga0496107_0147255_145_1179 343
906 3300048911 Ga0496108_0003673 Ga0496108_0003673_5363_6397 343
907 3300048911 Ga0496108_0004728 Ga0496108_0004728_6472_7506 343
908 3300048911 Ga0496108_0164976 Ga0496108_0164976_57_1088 343
909 3300048911 Ga0496108_0229663 Ga0496108_0229663_263_1435 343
910 3300048912 Ga0496109_0001694 Ga0496109_0001694_12671_13705 343
911 3300048912 Ga0496109_0004263 Ga0496109_0004263_7559_8593 343
912 3300048913 Ga0496110_0002379 Ga0496110_0002379_5464_6498 343
913 3300048913 Ga0496110_0003013 Ga0496110_0003013_10978_12012 343
914 3300048913 Ga0496110_0129443 Ga0496110_0129443_263_1435 343
915 3300048914 Ga0496111_0000375 Ga0496111_0000375_15327_16361 343
916 3300048914 Ga0496111_0000761 Ga0496111_0000761_15877_17049 343
917 3300048915 Ga0496112_0009605 Ga0496112_0009605_6677_7711 343
918 3300048915 Ga0496112_0080341 Ga0496112_0080341_1920_2951 343
919 3300048915 Ga0496112_0102391 Ga0496112_0102391_1207_2241 343
920 3300048915 Ga0496112_0108034 Ga0496112_0108034_1041_2213 343
921 3300048916 Ga0496113_0014110 Ga0496113_0014110_4129_5301 343
922 3300048917 Ga0496114_0052250 Ga0496114_0052250_993_2165 343
923 3300048918 Ga0496115_0113604 Ga0496115_0113604_13_1185 343
924 3300048918 Ga0496115_0120178 Ga0496115_0120178_395_1429 343
925 3300049571 Ga0501034_0176046 Ga0501034_0176046_551_1585 343
926 3300049575 Ga0501039_0154177 Ga0501039_0154177_270_1304 343
927 3300049576 Ga0501040_0213038 Ga0501040_0213038_263_1297 343
928 3300049586 Ga0501070_0118670 Ga0501070_0118670_283_1317 343
929 3300049744 Ga0501083_0087641 Ga0501083_0087641_974_2011 343
930 3300050489 nmdc:mga03683_12449_c1 nmdc:mga03683_12449_c1_1223_2284 343
931 3300050491 nmdc:mga00v17_21110_c1 nmdc:mga00v17_21110_c1_916_1977 343
932 3300050492 nmdc:mga0yw44_12424_c1 nmdc:mga0yw44_12424_c1_2424_3596 343
933 3300050492 nmdc:mga0yw44_3606_c1 nmdc:mga0yw44_3606_c1_4415_5449 343
934 3300050492 nmdc:mga0yw44_7591_c1 nmdc:mga0yw44_7591_c1_3298_4332 343
935 3300050493 nmdc:mga0k408_7030_c1 nmdc:mga0k408_7030_c1_1062_2123 343
936 3300050494 nmdc:mga06z11_45959_c1 nmdc:mga06z11_45959_c1_1101_2162 343
937 3300050496 nmdc:mga07m45_111151_c1 nmdc:mga07m45_111151_c1_210_1271 343
938 3300050507 nmdc:mga05p37_138805_c1 nmdc:mga05p37_138805_c1_771_1805 343
939 3300050510 nmdc:mga06r32_249086_c1 nmdc:mga06r32_249086_c1_366_1400 343
940 3300050511 nmdc:mga08y16_35657_c1 nmdc:mga08y16_35657_c1_2366_3400 343
941 3300050512 nmdc:mga0n895_280414_c1 nmdc:mga0n895_280414_c1_18_1052 343
942 3300050512 nmdc:mga0n895_73249_c1 nmdc:mga0n895_73249_c1_479_1555 343
943 3300050515 nmdc:mga0a205_153250_c1 nmdc:mga0a205_153250_c1_105_1139 343
944 3300053077 Ga0495601_0000009 Ga0495601_0000009_76914_77951 343
945 3300053077 Ga0495601_0049867 Ga0495601_0049867_78_1250 343
946 3300053078 Ga0495612_0000019 Ga0495612_0000019_59877_60914 343
947 3300053083 Ga0495655_0033108 Ga0495655_0033108_13_1185 343
948 3300053084 Ga0495595_0000015 Ga0495595_0000015_58169_59206 343
949 3300053085 Ga0495619_0000012 Ga0495619_0000012_76914_77951 343
950 3300053153 Ga0500616_0027257 Ga0500616_0027257_1075_2112 343
951 2209111006 2214572729 2213616074 344
952 3300000042 ARSoilYngRDRAFT_c00041 ARSoilYngRDRAFT_0004120 344
953 3300000043 ARcpr5yngRDRAFT_c000026 ARcpr5yngRDRAFT_0000265 344
954 3300000044 ARSoilOldRDRAFT_c000019 ARSoilOldRDRAFT_00001920 344
955 3300000045 ARCol0oldRDRAFT_c00711 ARCol0oldRDRAFT_007113 344
956 3300000652 ARCol0yngRDRAFT_1000004 ARCol0yngRDRAFT_100000425 344
957 3300001430 JGI24032J14994_100057 JGI24032J14994_1000573 344
958 3300001915 JGI24741J21665_1006055 JGI24741J21665_10060551 344
959 3300001989 JGI24739J22299_10002982 JGI24739J22299_100029822 344
960 3300001990 JGI24737J22298_10000207 JGI24737J22298_100002076 344
961 3300002070 JGI24750J21931_1000312 JGI24750J21931_10003127 344
962 3300002073 JGI24745J21846_1000356 JGI24745J21846_10003563 344
963 3300002074 JGI24748J21848_1000458 JGI24748J21848_10004582 344
964 3300002075 JGI24738J21930_10000029 JGI24738J21930_1000002915 344
965 3300002076 JGI24749J21850_1000564 JGI24749J21850_10005646 344
966 3300002077 JGI24744J21845_10002659 JGI24744J21845_100026594 344
967 3300002126 JGI24035J26624_1000100 JGI24035J26624_10001008 344
968 3300005276 Ga0065717_1001978 Ga0065717_10019782 344
969 3300005289 Ga0065704_10080437 Ga0065704_100804373 344
970 3300005290 Ga0065712_10001113 Ga0065712_100011133 344
971 3300005293 Ga0065715_10008397 Ga0065715_100083972 344
972 3300005327 Ga0070658_10010739 Ga0070658_100107395 344
973 3300005327 Ga0070658_10049596 Ga0070658_100495963 344
974 3300005328 Ga0070676_10002748 Ga0070676_100027488 344
975 3300005328 Ga0070676_10144012 Ga0070676_101440122 344
976 3300005329 Ga0070683_100001745 Ga0070683_10000174516 344
977 3300005329 Ga0070683_100192713 Ga0070683_1001927131 344
978 3300005330 Ga0070690_100051122 Ga0070690_1000511222 344
979 3300005333 Ga0070677_10002799 Ga0070677_100027992 344
980 3300005334 Ga0068869_100000687 Ga0068869_10000068713 344
981 3300005334 Ga0068869_100171780 Ga0068869_1001717802 344
982 3300005335 Ga0070666_10004113 Ga0070666_100041137 344
983 3300005335 Ga0070666_10073992 Ga0070666_100739922 344
984 3300005336 Ga0070680_100012469 Ga0070680_1000124695 344
985 3300005336 Ga0070680_100013123 Ga0070680_1000131236 344
986 3300005336 Ga0070680_100051087 Ga0070680_1000510873 344
987 3300005336 Ga0070680_100197566 Ga0070680_1001975662 344
988 3300005337 Ga0070682_100000995 Ga0070682_10000099513 344
989 3300005337 Ga0070682_100070870 Ga0070682_1000708702 344
990 3300005338 Ga0068868_100002252 Ga0068868_1000022529 344
991 3300005338 Ga0068868_100008629 Ga0068868_1000086296 344
992 3300005339 Ga0070660_100006704 Ga0070660_1000067042 344
993 3300005339 Ga0070660_100041053 Ga0070660_1000410534 344
994 3300005339 Ga0070660_100042225 Ga0070660_1000422253 344
995 3300005341 Ga0070691_10002585 Ga0070691_100025853 344
996 3300005341 Ga0070691_10070651 Ga0070691_100706512 344
997 3300005343 Ga0070687_100001763 Ga0070687_1000017634 344
998 3300005343 Ga0070687_100060553 Ga0070687_1000605532 344
999 3300005344 Ga0070661_100000508 Ga0070661_10000050820 344
1000 3300005344 Ga0070661_100116064 Ga0070661_1001160642 344
1001 3300005347 Ga0070668_100010188 Ga0070668_1000101882 344
1002 3300005347 Ga0070668_100124529 Ga0070668_1001245292 344
1003 3300005353 Ga0070669_100000634 Ga0070669_1000006342 344
1004 3300005353 Ga0070669_100110455 Ga0070669_1001104551 344
1005 3300005354 Ga0070675_100000240 Ga0070675_10000024032 344
1006 3300005354 Ga0070675_100308582 Ga0070675_1003085822 344
1007 3300005355 Ga0070671_100002087 Ga0070671_1000020876 344
1008 3300005355 Ga0070671_100004330 Ga0070671_1000043303 344
1009 3300005356 Ga0070674_100036239 Ga0070674_1000362393 344
1010 3300005356 Ga0070674_100042512 Ga0070674_1000425122 344
1011 3300005364 Ga0070673_100000366 Ga0070673_10000036620 344
1012 3300005365 Ga0070688_100004277 Ga0070688_1000042776 344
1013 3300005365 Ga0070688_100025604 Ga0070688_1000256042 344
1014 3300005365 Ga0070688_100069375 Ga0070688_1000693752 344
1015 3300005366 Ga0070659_100006478 Ga0070659_1000064788 344
1016 3300005366 Ga0070659_100007010 Ga0070659_1000070103 344
1017 3300005367 Ga0070667_100023647 Ga0070667_1000236473 344
1018 3300005406 Ga0070703_10004429 Ga0070703_100044292 344
1019 3300005406 Ga0070703_10040929 Ga0070703_100409292 344
1020 3300005434 Ga0070709_10004638 Ga0070709_100046381 344
1021 3300005434 Ga0070709_10046273 Ga0070709_100462733 344
1022 3300005435 Ga0070714_100034036 Ga0070714_1000340363 344
1023 3300005436 Ga0070713_100002022 Ga0070713_1000020229 344
1024 3300005437 Ga0070710_10024257 Ga0070710_100242573 344
1025 3300005437 Ga0070710_10033835 Ga0070710_100338352 344
1026 3300005438 Ga0070701_10000039 Ga0070701_1000003913 344
1027 3300005438 Ga0070701_10014385 Ga0070701_100143854 344
1028 3300005438 Ga0070701_10014594 Ga0070701_100145944 344
1029 3300005440 Ga0070705_100000495 Ga0070705_10000049516 344
1030 3300005440 Ga0070705_100000768 Ga0070705_1000007684 344
1031 3300005440 Ga0070705_100011472 Ga0070705_1000114723 344
1032 3300005441 Ga0070700_100000735 Ga0070700_10000073512 344
1033 3300005444 Ga0070694_100011335 Ga0070694_1000113353 344
1034 3300005444 Ga0070694_100015470 Ga0070694_1000154706 344
1035 3300005444 Ga0070694_100046026 Ga0070694_1000460263 344
1036 3300005445 Ga0070708_100016195 Ga0070708_1000161958 344
1037 3300005445 Ga0070708_100253126 Ga0070708_1002531262 344
1038 3300005455 Ga0070663_100220571 Ga0070663_1002205712 344
1039 3300005456 Ga0070678_100030522 Ga0070678_1000305223 344
1040 3300005456 Ga0070678_100057336 Ga0070678_1000573363 344
1041 3300005456 Ga0070678_100072044 Ga0070678_1000720442 344
1042 3300005457 Ga0070662_100013401 Ga0070662_1000134014 344
1043 3300005458 Ga0070681_10014286 Ga0070681_100142868 344
1044 3300005458 Ga0070681_10025727 Ga0070681_100257276 344
1045 3300005458 Ga0070681_10302665 Ga0070681_103026652 344
1046 3300005459 Ga0068867_100015200 Ga0068867_1000152002 344
1047 3300005459 Ga0068867_100096766 Ga0068867_1000967662 344
1048 3300005466 Ga0070685_10012727 Ga0070685_100127272 344
1049 3300005518 Ga0070699_100000158 Ga0070699_1000001589 344
1050 3300005530 Ga0070679_100071918 Ga0070679_1000719183 344
1051 3300005530 Ga0070679_100242700 Ga0070679_1002427002 344
1052 3300005530 Ga0070679_100249981 Ga0070679_1002499811 344
1053 3300005535 Ga0070684_100000334 Ga0070684_1000003344 344
1054 3300005535 Ga0070684_100109348 Ga0070684_1001093482 344
1055 3300005536 Ga0070697_100119776 Ga0070697_1001197762 344
1056 3300005536 Ga0070697_100206548 Ga0070697_1002065482 344
1057 3300005539 Ga0068853_100000437 Ga0068853_10000043716 344
1058 3300005539 Ga0068853_100193311 Ga0068853_1001933111 344
1059 3300005543 Ga0070672_100000261 Ga0070672_10000026125 344
1060 3300005544 Ga0070686_100026701 Ga0070686_1000267013 344
1061 3300005544 Ga0070686_100057569 Ga0070686_1000575693 344
1062 3300005544 Ga0070686_100168629 Ga0070686_1001686291 344
1063 3300005545 Ga0070695_100028468 Ga0070695_1000284682 344
1064 3300005545 Ga0070695_100041793 Ga0070695_1000417932 344
1065 3300005546 Ga0070696_100115734 Ga0070696_1001157342 344
1066 3300005547 Ga0070693_100005605 Ga0070693_1000056055 344
1067 3300005547 Ga0070693_100014546 Ga0070693_1000145465 344
1068 3300005548 Ga0070665_100081554 Ga0070665_1000815543 344
1069 3300005549 Ga0070704_100000257 Ga0070704_1000002574 344
1070 3300005549 Ga0070704_100031525 Ga0070704_1000315253 344
1071 3300005563 Ga0068855_100077710 Ga0068855_1000777104 344
1072 3300005564 Ga0070664_100033970 Ga0070664_1000339702 344
1073 3300005564 Ga0070664_100097474 Ga0070664_1000974742 344
1074 3300005577 Ga0068857_100001153 Ga0068857_1000011532 344
1075 3300005577 Ga0068857_100056849 Ga0068857_1000568494 344
1076 3300005577 Ga0068857_100254955 Ga0068857_1002549552 344
1077 3300005578 Ga0068854_100055290 Ga0068854_1000552902 344
1078 3300005578 Ga0068854_100067011 Ga0068854_1000670112 344
1079 3300005614 Ga0068856_100164649 Ga0068856_1001646492 344
1080 3300005615 Ga0070702_100000645 Ga0070702_1000006452 344
1081 3300005616 Ga0068852_100000781 Ga0068852_10000078120 344
1082 3300005616 Ga0068852_100183398 Ga0068852_1001833982 344
1083 3300005617 Ga0068859_100002511 Ga0068859_1000025112 344
1084 3300005617 Ga0068859_100019542 Ga0068859_1000195422 344
1085 3300005618 Ga0068864_100001792 Ga0068864_1000017924 344
1086 3300005618 Ga0068864_100022084 Ga0068864_1000220846 344
1087 3300005618 Ga0068864_100115565 Ga0068864_1001155652 344
1088 3300005718 Ga0068866_10020626 Ga0068866_100206263 344
1089 3300005718 Ga0068866_10195415 Ga0068866_101954151 344
1090 3300005719 Ga0068861_100000248 Ga0068861_10000024813 344
1091 3300005719 Ga0068861_100208182 Ga0068861_1002081822 344
1092 3300005840 Ga0068870_10000157 Ga0068870_100001573 344
1093 3300005841 Ga0068863_100051551 Ga0068863_1000515512 344
1094 3300005843 Ga0068860_100005729 Ga0068860_1000057293 344
1095 3300005843 Ga0068860_100029337 Ga0068860_1000293373 344
1096 3300005843 Ga0068860_100047355 Ga0068860_1000473553 344
1097 3300005844 Ga0068862_100001649 Ga0068862_10000164913 344
1098 3300005844 Ga0068862_100004004 Ga0068862_10000400411 344
1099 3300005844 Ga0068862_100016995 Ga0068862_1000169955 344
1100 3300005937 Ga0081455_10000059 Ga0081455_1000005924 344
1101 3300005937 Ga0081455_10002427 Ga0081455_1000242720 344
1102 3300005983 Ga0081540_1038962 Ga0081540_10389622 344
1103 3300006028 Ga0070717_10000161 Ga0070717_1000016117 344
1104 3300006058 Ga0075432_10027866 Ga0075432_100278662 344
1105 3300006163 Ga0070715_10002418 Ga0070715_100024183 344
1106 3300006173 Ga0070716_100014114 Ga0070716_1000141142 344
1107 3300006175 Ga0070712_100106824 Ga0070712_1001068242 344
1108 3300006237 Ga0097621_100012511 Ga0097621_1000125114 344
1109 3300006237 Ga0097621_100027090 Ga0097621_1000270903 344
1110 3300006358 Ga0068871_100023462 Ga0068871_1000234622 344
1111 3300006844 Ga0075428_100028381 Ga0075428_1000283815 344
1112 3300006846 Ga0075430_100000070 Ga0075430_10000007048 344
1113 3300006847 Ga0075431_100001221 Ga0075431_1000012217 344
1114 3300006852 Ga0075433_10000867 Ga0075433_1000086711 344
1115 3300006852 Ga0075433_10044445 Ga0075433_100444454 344
1116 3300006871 Ga0075434_100000212 Ga0075434_10000021219 344
1117 3300006871 Ga0075434_100011470 Ga0075434_1000114706 344
1118 3300006871 Ga0075434_100242874 Ga0075434_1002428742 344
1119 3300006880 Ga0075429_100000347 Ga0075429_10000034724 344
1120 3300006881 Ga0068865_100000131 Ga0068865_10000013124 344
1121 3300006881 Ga0068865_100066778 Ga0068865_1000667783 344
1122 3300006881 Ga0068865_100116680 Ga0068865_1001166802 344
1123 3300006914 Ga0075436_100180101 Ga0075436_1001801011 344
1124 3300006931 Ga0097620_100002511 Ga0097620_10000251117 344
1125 3300006931 Ga0097620_100019543 Ga0097620_1000195432 344
1126 3300007076 Ga0075435_100159943 Ga0075435_1001599432 344
1127 3300007076 Ga0075435_100327341 Ga0075435_1003273412 344
1128 3300009011 Ga0105251_10078812 Ga0105251_100788122 344
1129 3300009093 Ga0105240_10007716 Ga0105240_1000771612 344
1130 3300009094 Ga0111539_10000138 Ga0111539_1000013841 344
1131 3300009094 Ga0111539_10005247 Ga0111539_1000524713 344
1132 3300009094 Ga0111539_10020603 Ga0111539_100206035 344
1133 3300009094 Ga0111539_10039131 Ga0111539_100391316 344
1134 3300009094 Ga0111539_10287330 Ga0111539_102873302 344
1135 3300009098 Ga0105245_10006956 Ga0105245_100069562 344
1136 3300009101 Ga0105247_10052546 Ga0105247_100525462 344
1137 3300009147 Ga0114129_10001559 Ga0114129_1000155920 344
1138 3300009147 Ga0114129_10010376 Ga0114129_100103764 344
1139 3300009148 Ga0105243_10005115 Ga0105243_100051155 344
1140 3300009148 Ga0105243_10061048 Ga0105243_100610483 344
1141 3300009174 Ga0105241_10001689 Ga0105241_1000168915 344
1142 3300009174 Ga0105241_10023432 Ga0105241_100234323 344
1143 3300009176 Ga0105242_10003073 Ga0105242_1000307310 344
1144 3300009176 Ga0105242_10015139 Ga0105242_100151396 344
1145 3300009176 Ga0105242_10024033 Ga0105242_100240334 344
1146 3300009177 Ga0105248_10020817 Ga0105248_100208176 344
1147 3300009177 Ga0105248_10039924 Ga0105248_100399243 344
1148 3300009177 Ga0105248_10328805 Ga0105248_103288052 344
1149 3300009545 Ga0105237_10011026 Ga0105237_100110268 344
1150 3300009545 Ga0105237_10377943 Ga0105237_103779432 344
1151 3300009551 Ga0105238_10172821 Ga0105238_101728212 344
1152 3300009553 Ga0105249_10000475 Ga0105249_1000047532 344
1153 3300009553 Ga0105249_10021249 Ga0105249_100212495 344
1154 3300009553 Ga0105249_10069550 Ga0105249_100695502 344
1155 3300010375 Ga0105239_10028994 Ga0105239_100289942 344
1156 3300010375 Ga0105239_10066457 Ga0105239_100664573 344
1157 3300011119 Ga0105246_10000658 Ga0105246_1000065819 344
1158 3300011119 Ga0105246_10012606 Ga0105246_100126066 344
1159 3300013104 Ga0157370_10043714 Ga0157370_100437143 344
1160 3300013296 Ga0157374_10000671 Ga0157374_1000067126 344
1161 3300013296 Ga0157374_10023203 Ga0157374_100232032 344
1162 3300013296 Ga0157374_10533353 Ga0157374_105333532 344
1163 3300013297 Ga0157378_10013283 Ga0157378_100132836 344
1164 3300013297 Ga0157378_10066434 Ga0157378_100664342 344
1165 3300013306 Ga0163162_10002947 Ga0163162_100029479 344
1166 3300013306 Ga0163162_10003419 Ga0163162_100034193 344
1167 3300013307 Ga0157372_10025315 Ga0157372_100253152 344
1168 3300013308 Ga0157375_10001420 Ga0157375_1000142016 344
1169 3300013308 Ga0157375_10230558 Ga0157375_102305582 344
1170 3300013308 Ga0157375_10757972 Ga0157375_107579721 344
1171 3300013308 Ga0157375_10758974 Ga0157375_107589741 344
1172 3300014326 Ga0157380_10000678 Ga0157380_1000067816 344
1173 3300014745 Ga0157377_10000275 Ga0157377_100002754 344
1174 3300014968 Ga0157379_10000345 Ga0157379_1000034533 344
1175 3300014968 Ga0157379_10135502 Ga0157379_101355022 344
1176 3300014969 Ga0157376_10005716 Ga0157376_100057163 344
1177 3300017792 Ga0163161_10002164 Ga0163161_1000216415 344
1178 3300020082 Ga0206353_10434420 Ga0206353_104344201 344
1179 3300025261 Ga0209233_1010321 Ga0209233_10103213 344
1180 3300025271 Ga0207666_1000035 Ga0207666_10000354 344
1181 3300025271 Ga0207666_1000998 Ga0207666_10009982 344
1182 3300025290 Ga0207673_1000303 Ga0207673_10003032 344
1183 3300025315 Ga0207697_10001229 Ga0207697_100012296 344
1184 3300025315 Ga0207697_10026509 Ga0207697_100265092 344
1185 3300025885 Ga0207653_10002111 Ga0207653_100021112 344
1186 3300025885 Ga0207653_10011499 Ga0207653_100114993 344
1187 3300025885 Ga0207653_10042733 Ga0207653_100427332 344
1188 3300025893 Ga0207682_10000048 Ga0207682_1000004824 344
1189 3300025898 Ga0207692_10008590 Ga0207692_100085904 344
1190 3300025899 Ga0207642_10015144 Ga0207642_100151443 344
1191 3300025899 Ga0207642_10037202 Ga0207642_100372022 344
1192 3300025900 Ga0207710_10005171 Ga0207710_100051712 344
1193 3300025900 Ga0207710_10008040 Ga0207710_100080402 344
1194 3300025901 Ga0207688_10001064 Ga0207688_1000106410 344
1195 3300025901 Ga0207688_10067240 Ga0207688_100672402 344
1196 3300025903 Ga0207680_10006663 Ga0207680_100066632 344
1197 3300025903 Ga0207680_10129922 Ga0207680_101299222 344
1198 3300025904 Ga0207647_10003833 Ga0207647_100038334 344
1199 3300025904 Ga0207647_10056432 Ga0207647_100564321 344
1200 3300025906 Ga0207699_10000944 Ga0207699_1000094414 344
1201 3300025906 Ga0207699_10022706 Ga0207699_100227062 344
1202 3300025907 Ga0207645_10000528 Ga0207645_100005285 344
1203 3300025907 Ga0207645_10027707 Ga0207645_100277073 344
1204 3300025907 Ga0207645_10166388 Ga0207645_101663881 344
1205 3300025908 Ga0207643_10001399 Ga0207643_1000139913 344
1206 3300025911 Ga0207654_10017052 Ga0207654_100170522 344
1207 3300025911 Ga0207654_10083139 Ga0207654_100831392 344
1208 3300025912 Ga0207707_10014096 Ga0207707_100140964 344
1209 3300025913 Ga0207695_10080587 Ga0207695_100805872 344
1210 3300025914 Ga0207671_10052529 Ga0207671_100525292 344
1211 3300025915 Ga0207693_10007963 Ga0207693_100079634 344
1212 3300025915 Ga0207693_10033629 Ga0207693_100336292 344
1213 3300025917 Ga0207660_10000104 Ga0207660_1000010411 344
1214 3300025917 Ga0207660_10030811 Ga0207660_100308112 344
1215 3300025917 Ga0207660_10263247 Ga0207660_102632472 344
1216 3300025918 Ga0207662_10003322 Ga0207662_100033224 344
1217 3300025919 Ga0207657_10003518 Ga0207657_1000351813 344
1218 3300025919 Ga0207657_10011458 Ga0207657_100114582 344
1219 3300025919 Ga0207657_10023774 Ga0207657_100237743 344
1220 3300025920 Ga0207649_10000141 Ga0207649_1000014132 344
1221 3300025920 Ga0207649_10080617 Ga0207649_100806172 344
1222 3300025921 Ga0207652_10001526 Ga0207652_100015266 344
1223 3300025921 Ga0207652_10047331 Ga0207652_100473311 344
1224 3300025921 Ga0207652_10187655 Ga0207652_101876552 344
1225 3300025921 Ga0207652_10250694 Ga0207652_102506941 344
1226 3300025923 Ga0207681_10018331 Ga0207681_100183314 344
1227 3300025924 Ga0207694_10202298 Ga0207694_102022982 344
1228 3300025925 Ga0207650_10002462 Ga0207650_100024624 344
1229 3300025926 Ga0207659_10000052 Ga0207659_1000005250 344
1230 3300025926 Ga0207659_10202473 Ga0207659_102024732 344
1231 3300025927 Ga0207687_10000097 Ga0207687_1000009725 344
1232 3300025927 Ga0207687_10081569 Ga0207687_100815693 344
1233 3300025928 Ga0207700_10000673 Ga0207700_100006735 344
1234 3300025928 Ga0207700_10352842 Ga0207700_103528422 344
1235 3300025929 Ga0207664_10129442 Ga0207664_101294422 344
1236 3300025931 Ga0207644_10001455 Ga0207644_100014556 344
1237 3300025931 Ga0207644_10097375 Ga0207644_100973752 344
1238 3300025932 Ga0207690_10005681 Ga0207690_100056818 344
1239 3300025932 Ga0207690_10115971 Ga0207690_101159712 344
1240 3300025933 Ga0207706_10003951 Ga0207706_1000395110 344
1241 3300025933 Ga0207706_10027742 Ga0207706_100277424 344
1242 3300025933 Ga0207706_10038789 Ga0207706_100387894 344
1243 3300025933 Ga0207706_10051232 Ga0207706_100512322 344
1244 3300025934 Ga0207686_10006458 Ga0207686_100064583 344
1245 3300025934 Ga0207686_10063585 Ga0207686_100635853 344
1246 3300025935 Ga0207709_10000349 Ga0207709_1000034920 344
1247 3300025935 Ga0207709_10029633 Ga0207709_100296333 344
1248 3300025936 Ga0207670_10004597 Ga0207670_100045972 344
1249 3300025936 Ga0207670_10023343 Ga0207670_100233433 344
1250 3300025936 Ga0207670_10031718 Ga0207670_100317182 344
1251 3300025937 Ga0207669_10000168 Ga0207669_100001688 344
1252 3300025937 Ga0207669_10071033 Ga0207669_100710332 344
1253 3300025938 Ga0207704_10000156 Ga0207704_1000015625 344
1254 3300025938 Ga0207704_10012042 Ga0207704_100120422 344
1255 3300025938 Ga0207704_10068404 Ga0207704_100684042 344
1256 3300025939 Ga0207665_10000248 Ga0207665_1000024829 344
1257 3300025940 Ga0207691_10005749 Ga0207691_100057497 344
1258 3300025941 Ga0207711_10003359 Ga0207711_1000335912 344
1259 3300025941 Ga0207711_10047792 Ga0207711_100477923 344
1260 3300025942 Ga0207689_10021978 Ga0207689_100219782 344
1261 3300025944 Ga0207661_10000143 Ga0207661_1000014332 344
1262 3300025944 Ga0207661_10172844 Ga0207661_101728441 344
1263 3300025945 Ga0207679_10000035 Ga0207679_1000003526 344
1264 3300025949 Ga0207667_10365418 Ga0207667_103654182 344
1265 3300025960 Ga0207651_10001071 Ga0207651_100010716 344
1266 3300025961 Ga0207712_10001127 Ga0207712_100011277 344
1267 3300025961 Ga0207712_10001185 Ga0207712_1000118512 344
1268 3300025972 Ga0207668_10000354 Ga0207668_1000035425 344
1269 3300025972 Ga0207668_10117013 Ga0207668_101170132 344
1270 3300025972 Ga0207668_10137344 Ga0207668_101373441 344
1271 3300025981 Ga0207640_10067852 Ga0207640_100678523 344
1272 3300025981 Ga0207640_10329303 Ga0207640_103293031 344
1273 3300025986 Ga0207658_10004208 Ga0207658_100042084 344
1274 3300026023 Ga0207677_10000614 Ga0207677_100006145 344
1275 3300026023 Ga0207677_10048336 Ga0207677_100483363 344
1276 3300026035 Ga0207703_10079513 Ga0207703_100795133 344
1277 3300026035 Ga0207703_10112029 Ga0207703_101120292 344
1278 3300026035 Ga0207703_10176451 Ga0207703_101764512 344
1279 3300026041 Ga0207639_10044011 Ga0207639_100440113 344
1280 3300026041 Ga0207639_10051194 Ga0207639_100511942 344
1281 3300026067 Ga0207678_10006944 Ga0207678_100069447 344
1282 3300026067 Ga0207678_10026751 Ga0207678_100267512 344
1283 3300026067 Ga0207678_10263467 Ga0207678_102634672 344
1284 3300026075 Ga0207708_10001353 Ga0207708_1000135313 344
1285 3300026078 Ga0207702_10001956 Ga0207702_1000195621 344
1286 3300026078 Ga0207702_10054132 Ga0207702_100541323 344
1287 3300026088 Ga0207641_10005992 Ga0207641_100059926 344
1288 3300026088 Ga0207641_10260123 Ga0207641_102601232 344
1289 3300026088 Ga0207641_10390073 Ga0207641_103900732 344
1290 3300026089 Ga0207648_10017690 Ga0207648_100176903 344
1291 3300026089 Ga0207648_10117030 Ga0207648_101170303 344
1292 3300026095 Ga0207676_10000540 Ga0207676_100005403 344
1293 3300026095 Ga0207676_10032741 Ga0207676_100327412 344
1294 3300026095 Ga0207676_10079875 Ga0207676_100798752 344
1295 3300026116 Ga0207674_10035067 Ga0207674_100350672 344
1296 3300026116 Ga0207674_10062214 Ga0207674_100622142 344
1297 3300026116 Ga0207674_10127951 Ga0207674_101279513 344
1298 3300026118 Ga0207675_100002948 Ga0207675_10000294813 344
1299 3300026118 Ga0207675_100033326 Ga0207675_1000333264 344
1300 3300026118 Ga0207675_100112992 Ga0207675_1001129922 344
1301 3300026121 Ga0207683_10002276 Ga0207683_1000227615 344
1302 3300026121 Ga0207683_10006188 Ga0207683_1000618811 344
1303 3300026121 Ga0207683_10012771 Ga0207683_100127716 344
1304 3300026142 Ga0207698_10089358 Ga0207698_100893582 344
1305 3300026142 Ga0207698_10257267 Ga0207698_102572672 344
1306 3300027682 Ga0209971_1002832 Ga0209971_10028322 344
1307 3300027717 Ga0209998_10001795 Ga0209998_100017956 344
1308 3300027717 Ga0209998_10002845 Ga0209998_100028452 344
1309 3300027876 Ga0209974_10001695 Ga0209974_100016955 344
1310 3300027876 Ga0209974_10019641 Ga0209974_100196412 344
1311 3300027907 Ga0207428_10000075 Ga0207428_1000007579 344
1312 3300027907 Ga0207428_10000428 Ga0207428_1000042825 344
1313 3300027907 Ga0207428_10005693 Ga0207428_100056932 344
1314 3300028379 Ga0268266_10039778 Ga0268266_100397783 344
1315 3300028380 Ga0268265_10001944 Ga0268265_100019448 344
1316 3300028380 Ga0268265_10002854 Ga0268265_100028548 344
1317 3300028381 Ga0268264_10001145 Ga0268264_1000114524 344
1318 3300028381 Ga0268264_10009120 Ga0268264_100091208 344
1319 3300028381 Ga0268264_10040002 Ga0268264_100400022 344
1320 3300028381 Ga0268264_10043024 Ga0268264_100430242 344
1321 3300028556 Ga0265337_1000182 Ga0265337_100018222 344
1322 3300031238 Ga0265332_10000310 Ga0265332_1000031022 344
1323 3300031241 Ga0265325_10000034 Ga0265325_1000003456 344
1324 3300031241 Ga0265325_10000675 Ga0265325_1000067513 344
1325 3300031242 Ga0265329_10018730 Ga0265329_100187301 344
1326 3300031247 Ga0265340_10006782 Ga0265340_100067825 344
1327 3300031249 Ga0265339_10001481 Ga0265339_1000148111 344
1328 3300031595 Ga0265313_10001257 Ga0265313_100012576 344
1329 3300031595 Ga0265313_10004172 Ga0265313_100041724 344
1330 3300031595 Ga0265313_10005011 Ga0265313_100050114 344
1331 3300031595 Ga0265313_10053296 Ga0265313_100532962 344
1332 3300031595 Ga0265313_10089696 Ga0265313_100896961 344
1333 3300031665 Ga0316575_10017923 Ga0316575_100179233 344
1334 3300031711 Ga0265314_10005031 Ga0265314_100050319 344
1335 3300031712 Ga0265342_10000175 Ga0265342_1000017545 344
1336 3300032133 Ga0316583_10004059 Ga0316583_100040595 344
1337 3300034816 Ga0373930_0001737 Ga0373930_0001737_1513_2547 344
1338 3300034817 Ga0373948_0007498 Ga0373948_0007498_583_1617 344
1339 3300034818 Ga0373950_0000384 Ga0373950_0000384_2981_4015 344
1340 3300034818 Ga0373950_0004205 Ga0373950_0004205_761_1858 344
1341 3300034819 Ga0373958_0000739 Ga0373958_0000739_986_2083 344
1342 3300034819 Ga0373958_0002601 Ga0373958_0002601_669_1703 344
1343 3300034819 Ga0373958_0007241 Ga0373958_0007241_600_1640 344
1344 3300034957 Ga0373938_0004188 Ga0373938_0004188_49_1146 344
1345 3300035083 Ga0373926_0000245 Ga0373926_0000245_6135_7169 344
1346 3300035083 Ga0373926_0007126 Ga0373926_0007126_339_1373 344
1347 3300035084 Ga0373928_0000892 Ga0373928_0000892_4233_5267 344
1348 3300035084 Ga0373928_0003713 Ga0373928_0003713_691_1788 344
1349 3300035084 Ga0373928_0013180 Ga0373928_0013180_500_1534 344
1350 3300035085 Ga0373929_0000155 Ga0373929_0000155_10138_11172 344
1351 3300035085 Ga0373929_0012011 Ga0373929_0012011_204_1301 344
1352 3300035086 Ga0373934_0018540 Ga0373934_0018540_1165_2199 344
1353 3300035088 Ga0373940_0012027 Ga0373940_0012027_153_1250 344
1354 3300035089 Ga0373944_0000108 Ga0373944_0000108_2867_3901 344
1355 3300035089 Ga0373944_0019626 Ga0373944_0019626_170_1204 344
1356 3300035090 Ga0373949_0005373 Ga0373949_0005373_936_1970 344
1357 3300035090 Ga0373949_0008276 Ga0373949_0008276_757_1791 344
1358 3300035090 Ga0373949_0025298 Ga0373949_0025298_201_1298 344
1359 3300035091 Ga0373951_0000948 Ga0373951_0000948_4293_5327 344
1360 3300035092 Ga0373952_0001774 Ga0373952_0001774_2118_3215 344
1361 3300035092 Ga0373952_0011663 Ga0373952_0011663_441_1475 344
1362 3300035111 Ga0373923_0005962 Ga0373923_0005962_3070_4104 344
1363 3300035112 Ga0373932_0000029 Ga0373932_0000029_24867_25901 344
1364 3300035112 Ga0373932_0001819 Ga0373932_0001819_1694_2791 344
1365 3300035112 Ga0373932_0014334 Ga0373932_0014334_43_1077 344
1366 3300035113 Ga0373936_0000484 Ga0373936_0000484_1657_2691 344
1367 3300035115 Ga0373941_0001399 Ga0373941_0001399_2520_3554 344
1368 3300035115 Ga0373941_0003448 Ga0373941_0003448_2272_3306 344
1369 3300035115 Ga0373941_0007218 Ga0373941_0007218_431_1528 344
1370 3300035116 Ga0373945_0000045 Ga0373945_0000045_17640_18674 344
1371 3300035117 Ga0373953_0009266 Ga0373953_0009266_448_1482 344
1372 3300035117 Ga0373953_0033109 Ga0373953_0033109_510_1544 344
1373 3300035117 Ga0373953_0041428 Ga0373953_0041428_238_1272 344
1374 3300035118 Ga0373954_0000462 Ga0373954_0000462_6141_7175 344
1375 3300035118 Ga0373954_0008707 Ga0373954_0008707_2893_3927 344
1376 3300035119 Ga0373956_0001576 Ga0373956_0001576_6391_7425 344
1377 3300035119 Ga0373956_0006700 Ga0373956_0006700_2741_3775 344
1378 3300035120 Ga0373957_0002629 Ga0373957_0002629_630_1664 344
1379 3300035120 Ga0373957_0105292 Ga0373957_0105292_84_1118 344
1380 3300035121 Ga0373960_0000009 Ga0373960_0000009_11126_12160 344
1381 3300035121 Ga0373960_0006175 Ga0373960_0006175_837_1934 344
1382 3300035170 Ga0373943_0005432 Ga0373943_0005432_1007_2041 344
1383 3300035170 Ga0373943_0020922 Ga0373943_0020922_1943_2977 344
1384 3300035170 Ga0373943_0169274 Ga0373943_0169274_70_1104 344
1385 3300035171 Ga0373946_0001925 Ga0373946_0001925_91_1125 344
1386 3300035171 Ga0373946_0147565 Ga0373946_0147565_44_1078 344
1387 3300035172 Ga0373955_0002480 Ga0373955_0002480_747_1781 344
1388 3300035172 Ga0373955_0006659 Ga0373955_0006659_3507_4541 344
1389 3300035172 Ga0373955_0172563 Ga0373955_0172563_229_1263 344
1390 3300035207 Ga0373942_0000486 Ga0373942_0000486_671_1705 344
1391 3300035207 Ga0373942_0013003 Ga0373942_0013003_864_1961 344
1392 3300035241 Ga0373961_0001880 Ga0373961_0001880_3930_4964 344
1393 3300035241 Ga0373961_0008408 Ga0373961_0008408_677_1774 344
1394 3300035242 Ga0373962_0000214 Ga0373962_0000214_1212_2246 344
1395 3300035242 Ga0373962_0001524 Ga0373962_0001524_811_1908 344
1396 3300035410 Ga0373924_0004637 Ga0373924_0004637_3416_4450 344
1397 3300035410 Ga0373924_0012179 Ga0373924_0012179_299_1333 344
1398 3300035691 Ga0373931_0000409 Ga0373931_0000409_11650_12747 344
1399 3300035691 Ga0373931_0009456 Ga0373931_0009456_1121_2155 344
1400 3300035691 Ga0373931_0028914 Ga0373931_0028914_1653_2687 344
1401 3300035692 Ga0373935_0275448 Ga0373935_0275448_91_1125 344
1402 3300035695 Ga0373927_0000956 Ga0373927_0000956_10861_11895 344
1403 3300035695 Ga0373927_0187347 Ga0373927_0187347_62_1096 344
1404 3300035724 Ga0373933_0001364 Ga0373933_0001364_12354_13388 344
1405 3300035724 Ga0373933_0002783 Ga0373933_0002783_4033_5067 344
1406 3300035725 Ga0373947_0000731 Ga0373947_0000731_7332_8366 344
1407 3300035725 Ga0373947_0041290 Ga0373947_0041290_567_1601 344
1408 3300035725 Ga0373947_0158218 Ga0373947_0158218_72_1106 344
1409 3300036401 Ga0373937_0002001 Ga0373937_0002001_765_1799 344
1410 3300036401 Ga0373937_0002191 Ga0373937_0002191_8101_9135 344
1411 3300036401 Ga0373937_0106280 Ga0373937_0106280_964_1998 344
1412 3300037068 Ga0373925_0012957 Ga0373925_0012957_3914_4948 344
1413 3300037068 Ga0373925_0080518 Ga0373925_0080518_1306_2346 344
1414 3300037068 Ga0373925_0144274 Ga0373925_0144274_760_1794 344
1415 3300042005 Ga0439448_0019475 Ga0439448_0019475_744_1778 344
1416 3300044673 Ga0453683_0090960 Ga0453683_0090960_645_1679 344
1417 3300045051 Ga0451576_0083606 Ga0451576_0083606_589_1623 344
1418 3300046452 Ga0495617_002591 Ga0495617_002591_3020_4054 344
1419 3300046454 Ga0495592_0001607 Ga0495592_0001607_6006_7040 344
1420 3300046454 Ga0495592_0008175 Ga0495592_0008175_3489_4523 344
1421 3300046454 Ga0495592_0045358 Ga0495592_0045358_2068_3102 344
1422 3300046455 Ga0495603_0005044 Ga0495603_0005044_478_1512 344
1423 3300046459 Ga0495629_0063803 Ga0495629_0063803_759_1793 344
1424 3300046459 Ga0495629_0158807 Ga0495629_0158807_59_1093 344
1425 3300046461 Ga0495641_0005322 Ga0495641_0005322_91_1125 344
1426 3300046461 Ga0495641_0014825 Ga0495641_0014825_2808_3842 344
1427 3300046461 Ga0495641_0058246 Ga0495641_0058246_49_1083 344
1428 3300046462 Ga0495651_0008752 Ga0495651_0008752_1857_2891 344
1429 3300046462 Ga0495651_0028910 Ga0495651_0028910_2121_3155 344
1430 3300046463 Ga0495653_0000672 Ga0495653_0000672_22466_23500 344
1431 3300046463 Ga0495653_0004359 Ga0495653_0004359_3376_4410 344
1432 3300046463 Ga0495653_0087387 Ga0495653_0087387_309_1343 344
1433 3300046472 Ga0495580_0004480 Ga0495580_0004480_10631_11665 344
1434 3300046473 Ga0495582_0001217 Ga0495582_0001217_247_1281 344
1435 3300046473 Ga0495582_0003978 Ga0495582_0003978_51_1085 344
1436 3300046473 Ga0495582_0105338 Ga0495582_0105338_10_1044 344
1437 3300046475 Ga0495639_0001072 Ga0495639_0001072_4811_5845 344
1438 3300046477 Ga0495664_0000178 Ga0495664_0000178_7519_8553 344
1439 3300046477 Ga0495664_0039826 Ga0495664_0039826_725_1759 344
1440 3300046477 Ga0495664_0134144 Ga0495664_0134144_291_1325 344
1441 3300046491 Ga0495584_0006334 Ga0495584_0006334_3949_4983 344
1442 3300046491 Ga0495584_0015933 Ga0495584_0015933_1248_2345 344
1443 3300046492 Ga0495585_0003781 Ga0495585_0003781_5037_6071 344
1444 3300046499 Ga0495594_0025139 Ga0495594_0025139_1096_2130 344
1445 3300046501 Ga0495607_0004311 Ga0495607_0004311_3722_4756 344
1446 3300046511 Ga0495608_0002294 Ga0495608_0002294_6485_7519 344
1447 3300046511 Ga0495608_0003241 Ga0495608_0003241_8538_9572 344
1448 3300046511 Ga0495608_0024005 Ga0495608_0024005_2520_3554 344
1449 3300046514 Ga0495618_0011040 Ga0495618_0011040_647_1681 344
1450 3300046516 Ga0495628_0003281 Ga0495628_0003281_8692_9726 344
1451 3300046516 Ga0495628_0029511 Ga0495628_0029511_3166_4200 344
1452 3300046516 Ga0495628_0256188 Ga0495628_0256188_16_1050 344
1453 3300046517 Ga0495630_0002263 Ga0495630_0002263_3795_4829 344
1454 3300046518 Ga0495631_0053511 Ga0495631_0053511_34_1068 344
1455 3300046523 Ga0495644_0002445 Ga0495644_0002445_669_1703 344
1456 3300046526 Ga0495666_0000187 Ga0495666_0000187_8935_9969 344
1457 3300046529 Ga0495652_0005932 Ga0495652_0005932_4067_5101 344
1458 3300046529 Ga0495652_0006336 Ga0495652_0006336_3619_4653 344
1459 3300046529 Ga0495652_0055898 Ga0495652_0055898_1140_2174 344
1460 3300046531 Ga0495665_0001094 Ga0495665_0001094_6081_7115 344
1461 3300046535 Ga0495586_0011893 Ga0495586_0011893_2866_3900 344
1462 3300046536 Ga0495587_0002681 Ga0495587_0002681_10600_11634 344
1463 3300046536 Ga0495587_0012769 Ga0495587_0012769_4004_5038 344
1464 3300046536 Ga0495587_0081275 Ga0495587_0081275_35_1069 344
1465 3300046537 Ga0495598_0000824 Ga0495598_0000824_2489_3523 344
1466 3300046543 Ga0495645_0019242 Ga0495645_0019242_2983_4017 344
1467 3300046543 Ga0495645_0065293 Ga0495645_0065293_1385_2419 344
1468 3300046559 Ga0495667_0000821 Ga0495667_0000821_11847_12881 344
1469 3300046559 Ga0495667_0001489 Ga0495667_0001489_8206_9240 344
1470 3300046559 Ga0495667_0003140 Ga0495667_0003140_9185_10219 344
1471 3300046559 Ga0495667_0008437 Ga0495667_0008437_3966_5000 344
1472 3300046615 Ga0495656_0000534 Ga0495656_0000534_506_1540 344
1473 3300046642 Ga0495634_0155740 Ga0495634_0155740_59_1093 344
1474 3300046648 Ga0495611_0007184 Ga0495611_0007184_505_1539 344
1475 3300046663 Ga0495635_0000538 Ga0495635_0000538_8280_9314 344
1476 3300046663 Ga0495635_0013620 Ga0495635_0013620_766_1800 344
1477 3300046663 Ga0495635_0131667 Ga0495635_0131667_18_1052 344
1478 3300046663 Ga0495635_0283278 Ga0495635_0283278_55_1089 344
1479 3300046664 Ga0495659_0001716 Ga0495659_0001716_5839_6873 344
1480 3300046674 Ga0495588_0000479 Ga0495588_0000479_18669_19703 344
1481 3300046674 Ga0495588_0151166 Ga0495588_0151166_139_1173 344
1482 3300046675 Ga0495657_0003740 Ga0495657_0003740_7778_8812 344
1483 3300046678 Ga0495599_0000806 Ga0495599_0000806_774_1808 344
1484 3300046678 Ga0495599_0005439 Ga0495599_0005439_1835_2869 344
1485 3300046678 Ga0495599_0111629 Ga0495599_0111629_89_1123 344
1486 3300046679 Ga0495623_0003115 Ga0495623_0003115_2796_3830 344
1487 3300046680 Ga0495646_0000677 Ga0495646_0000677_7048_8082 344
1488 3300046680 Ga0495646_0000853 Ga0495646_0000853_9135_10169 344
1489 3300046681 Ga0495647_0000390 Ga0495647_0000390_8874_9908 344
1490 3300046683 Ga0495658_0002133 Ga0495658_0002133_51_1085 344
1491 3300046683 Ga0495658_0005922 Ga0495658_0005922_4879_5913 344
1492 3300046683 Ga0495658_0024304 Ga0495658_0024304_1563_2597 344
1493 3300046689 Ga0495613_0001786 Ga0495613_0001786_6005_7039 344
1494 3300046689 Ga0495613_0003295 Ga0495613_0003295_7299_8333 344
1495 3300046690 Ga0495624_0001411 Ga0495624_0001411_11519_12553 344
1496 3300046691 Ga0495670_0002271 Ga0495670_0002271_2703_3737 344
1497 3300046809 Ga0495600_0000208 Ga0495600_0000208_21225_22259 344
1498 3300046809 Ga0495600_0009495 Ga0495600_0009495_2513_3547 344
1499 3300046809 Ga0495600_0028111 Ga0495600_0028111_883_1917 344
1500 3300047315 Ga0495581_0013297 Ga0495581_0013297_247_1281 344
1501 3300047315 Ga0495581_0027102 Ga0495581_0027102_1446_2480 344
1502 3300047317 Ga0495604_0001423 Ga0495604_0001423_415_1449 344
1503 3300047317 Ga0495604_0002978 Ga0495604_0002978_6730_7764 344
1504 3300047317 Ga0495604_0008875 Ga0495604_0008875_922_1956 344
1505 3300047319 Ga0495674_0003957 Ga0495674_0003957_91_1125 344
1506 3300047319 Ga0495674_0043490 Ga0495674_0043490_2614_3648 344
1507 3300047321 Ga0495676_0198179 Ga0495676_0198179_292_1326 344
1508 3300047322 Ga0495680_0002844 Ga0495680_0002844_2976_4010 344
1509 3300047322 Ga0495680_0002940 Ga0495680_0002940_9030_10064 344
1510 3300047322 Ga0495680_0009960 Ga0495680_0009960_91_1125 344
1511 3300047322 Ga0495680_0025178 Ga0495680_0025178_628_1662 344
1512 3300047444 Ga0495675_0001218 Ga0495675_0001218_7071_8105 344
1513 3300047471 Ga0495684_0002579 Ga0495684_0002579_5985_7019 344
1514 3300047673 Ga0495593_0000372 Ga0495593_0000372_11338_12372 344
1515 3300047673 Ga0495593_0040237 Ga0495593_0040237_1044_2078 344
1516 3300048088 Ga0495602_0002793 Ga0495602_0002793_8101_9135 344
1517 3300048088 Ga0495602_0041319 Ga0495602_0041319_2988_4022 344
1518 3300048089 Ga0495614_0003505 Ga0495614_0003505_3194_4228 344
1519 3300048903 Ga0496100_0018859 Ga0496100_0018859_2933_3967 344
1520 3300048903 Ga0496100_0034198 Ga0496100_0034198_1200_2297 344
1521 3300048903 Ga0496100_0177801 Ga0496100_0177801_254_1294 344
1522 3300048904 Ga0496101_0000218 Ga0496101_0000218_8765_9862 344
1523 3300048904 Ga0496101_0019217 Ga0496101_0019217_3122_4156 344
1524 3300048905 Ga0496102_0028797 Ga0496102_0028797_2373_3413 344
1525 3300048905 Ga0496102_0035330 Ga0496102_0035330_2867_3901 344
1526 3300048905 Ga0496102_0060892 Ga0496102_0060892_1472_2569 344
1527 3300048905 Ga0496102_0102976 Ga0496102_0102976_60_1094 344
1528 3300048906 Ga0496103_0018520 Ga0496103_0018520_1328_2425 344
1529 3300048906 Ga0496103_0025384 Ga0496103_0025384_675_1709 344
1530 3300048906 Ga0496103_0061743 Ga0496103_0061743_460_1494 344
1531 3300048907 Ga0496104_0000079 Ga0496104_0000079_3582_4616 344
1532 3300048907 Ga0496104_0000445 Ga0496104_0000445_18756_19802 344
1533 3300048907 Ga0496104_0002378 Ga0496104_0002378_785_1831 344
1534 3300048907 Ga0496104_0009255 Ga0496104_0009255_4301_5335 344
1535 3300048907 Ga0496104_0043032 Ga0496104_0043032_2544_3578 344
1536 3300048907 Ga0496104_0059832 Ga0496104_0059832_2191_3225 344
1537 3300048908 Ga0496105_0014286 Ga0496105_0014286_1274_2308 344
1538 3300048908 Ga0496105_0046477 Ga0496105_0046477_1871_2917 344
1539 3300048908 Ga0496105_0052860 Ga0496105_0052860_86_1120 344
1540 3300048908 Ga0496105_0284685 Ga0496105_0284685_117_1157 344
1541 3300048909 Ga0496106_0000388 Ga0496106_0000388_22499_23539 344
1542 3300048909 Ga0496106_0002724 Ga0496106_0002724_6092_7189 344
1543 3300048909 Ga0496106_0052106 Ga0496106_0052106_1916_2950 344
1544 3300048909 Ga0496106_0204402 Ga0496106_0204402_61_1095 344
1545 3300048910 Ga0496107_0001097 Ga0496107_0001097_5906_7003 344
1546 3300048910 Ga0496107_0004447 Ga0496107_0004447_5566_6606 344
1547 3300048910 Ga0496107_0017055 Ga0496107_0017055_3848_4882 344
1548 3300048910 Ga0496107_0029064 Ga0496107_0029064_2760_3794 344
1549 3300048910 Ga0496107_0217624 Ga0496107_0217624_170_1204 344
1550 3300048910 Ga0496107_0320830 Ga0496107_0320830_82_1119 344
1551 3300048911 Ga0496108_0007963 Ga0496108_0007963_2322_3356 344
1552 3300048911 Ga0496108_0009785 Ga0496108_0009785_915_2012 344
1553 3300048911 Ga0496108_0062491 Ga0496108_0062491_1167_2201 344
1554 3300048911 Ga0496108_0079336 Ga0496108_0079336_1079_2113 344
1555 3300048912 Ga0496109_0001327 Ga0496109_0001327_3510_4544 344
1556 3300048912 Ga0496109_0004289 Ga0496109_0004289_2608_3705 344
1557 3300048912 Ga0496109_0054246 Ga0496109_0054246_2366_3400 344
1558 3300048912 Ga0496109_0118233 Ga0496109_0118233_1110_2144 344
1559 3300048912 Ga0496109_0147396 Ga0496109_0147396_685_1719 344
1560 3300048913 Ga0496110_0033305 Ga0496110_0033305_737_1834 344
1561 3300048913 Ga0496110_0183584 Ga0496110_0183584_642_1676 344
1562 3300048913 Ga0496110_0290846 Ga0496110_0290846_366_1412 344
1563 3300048914 Ga0496111_0080317 Ga0496111_0080317_114_1148 344
1564 3300048914 Ga0496111_0164936 Ga0496111_0164936_342_1376 344
1565 3300048916 Ga0496113_0008990 Ga0496113_0008990_3790_4887 344
1566 3300048916 Ga0496113_0027637 Ga0496113_0027637_2434_3468 344
1567 3300048916 Ga0496113_0078402 Ga0496113_0078402_973_2007 344
1568 3300048917 Ga0496114_0038690 Ga0496114_0038690_1947_2984 344
1569 3300048917 Ga0496114_0051484 Ga0496114_0051484_2149_3183 344
1570 3300048917 Ga0496114_0198312 Ga0496114_0198312_311_1408 344
1571 3300048918 Ga0496115_0017851 Ga0496115_0017851_3912_5009 344
1572 3300048918 Ga0496115_0020631 Ga0496115_0020631_3962_4996 344
1573 3300048918 Ga0496115_0315060 Ga0496115_0315060_110_1144 344
1574 3300048929 Ga0496126_0114950 Ga0496126_0114950_1062_2096 344
1575 3300049568 Ga0501031_0001202 Ga0501031_0001202_12920_13954 344
1576 3300049569 Ga0501032_0003544 Ga0501032_0003544_996_2030 344
1577 3300049570 Ga0501033_0002722 Ga0501033_0002722_10123_11157 344
1578 3300049570 Ga0501033_0056700 Ga0501033_0056700_579_1619 344
1579 3300049571 Ga0501034_0009885 Ga0501034_0009885_7382_8416 344
1580 3300049572 Ga0501036_0000559 Ga0501036_0000559_12408_13442 344
1581 3300049573 Ga0501037_0007486 Ga0501037_0007486_6578_7612 344
1582 3300049574 Ga0501038_0003386 Ga0501038_0003386_9376_10410 344
1583 3300049574 Ga0501038_0067164 Ga0501038_0067164_903_1937 344
1584 3300049574 Ga0501038_0130260 Ga0501038_0130260_763_1797 344
1585 3300049575 Ga0501039_0006912 Ga0501039_0006912_6684_7718 344
1586 3300049579 Ga0501043_0009163 Ga0501043_0009163_3390_4424 344
1587 3300049579 Ga0501043_0114090 Ga0501043_0114090_678_1712 344
1588 3300049581 Ga0501047_0011344 Ga0501047_0011344_5227_6261 344
1589 3300049581 Ga0501047_0013392 Ga0501047_0013392_2127_3167 344
1590 3300049581 Ga0501047_0084327 Ga0501047_0084327_10_1044 344
1591 3300049581 Ga0501047_0120113 Ga0501047_0120113_1291_2325 344
1592 3300049581 Ga0501047_0170943 Ga0501047_0170943_426_1460 344
1593 3300049586 Ga0501070_0003459 Ga0501070_0003459_8881_9915 344
1594 3300049587 Ga0501071_0157996 Ga0501071_0157996_254_1294 344
1595 3300049589 Ga0501073_0070556 Ga0501073_0070556_1010_2044 344
1596 3300049592 Ga0501076_0012864 Ga0501076_0012864_615_1655 344
1597 3300049741 Ga0501079_0088797 Ga0501079_0088797_290_1330 344
1598 3300049743 Ga0501081_0147304 Ga0501081_0147304_79_1119 344
1599 3300049822 Ga0501035_0003212 Ga0501035_0003212_5227_6261 344
1600 3300049822 Ga0501035_0184682 Ga0501035_0184682_190_1230 344
1601 3300049823 Ga0501044_0006768 Ga0501044_0006768_2839_3873 344
1602 3300049823 Ga0501044_0083869 Ga0501044_0083869_1852_2886 344
1603 3300049823 Ga0501044_0173688 Ga0501044_0173688_772_1806 344
1604 3300049823 Ga0501044_0204983 Ga0501044_0204983_656_1690 344
1605 3300050507 nmdc:mga05p37_1895_c1 nmdc:mga05p37_1895_c1_6391_7431 344
1606 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_40407_41441 344
1607 3300050507 nmdc:mga05p37_700088_c1 nmdc:mga05p37_700088_c1_31_1065 344
1608 3300050508 nmdc:mga09592_2778_c1 nmdc:mga09592_2778_c1_7340_8374 344
1609 3300050509 nmdc:mga0qj67_355_c1 nmdc:mga0qj67_355_c1_18433_19467 344
1610 3300050510 nmdc:mga06r32_448_c1 nmdc:mga06r32_448_c1_28481_29515 344
1611 3300050511 nmdc:mga08y16_1424_c1 nmdc:mga08y16_1424_c1_7264_8361 344
1612 3300050511 nmdc:mga08y16_171647_c1 nmdc:mga08y16_171647_c1_279_1313 344
1613 3300050511 nmdc:mga08y16_2557_c1 nmdc:mga08y16_2557_c1_5485_6519 344
1614 3300050512 nmdc:mga0n895_36549_c1 nmdc:mga0n895_36549_c1_2048_3082 344
1615 3300050512 nmdc:mga0n895_4084_c1 nmdc:mga0n895_4084_c1_8641_9738 344
1616 3300050512 nmdc:mga0n895_54718_c1 nmdc:mga0n895_54718_c1_1152_2192 344
1617 3300050512 nmdc:mga0n895_568_c1 nmdc:mga0n895_568_c1_21583_22617 344
1618 3300050513 nmdc:mga0rr50_7539_c1 nmdc:mga0rr50_7539_c1_2544_3578 344
1619 3300050514 nmdc:mga08x19_16986_c1 nmdc:mga08x19_16986_c1_1148_2182 344
1620 3300050514 nmdc:mga08x19_198059_c1 nmdc:mga08x19_198059_c1_254_1288 344
1621 3300050515 nmdc:mga0a205_132790_c1 nmdc:mga0a205_132790_c1_1247_2344 344
1622 3300050515 nmdc:mga0a205_170838_c1 nmdc:mga0a205_170838_c1_984_2018 344
1623 3300050515 nmdc:mga0a205_466_c1 nmdc:mga0a205_466_c1_7500_8534 344
1624 3300050515 nmdc:mga0a205_59030_c1 nmdc:mga0a205_59030_c1_598_1638 344
1625 3300053077 Ga0495601_0004483 Ga0495601_0004483_59_1093 344
1626 3300053077 Ga0495601_0007632 Ga0495601_0007632_3712_4746 344
1627 3300053077 Ga0495601_0058912 Ga0495601_0058912_853_1887 344
1628 3300053077 Ga0495601_0171868 Ga0495601_0171868_188_1222 344
1629 3300053078 Ga0495612_0001278 Ga0495612_0001278_6613_7647 344
1630 3300053078 Ga0495612_0001909 Ga0495612_0001909_2404_3438 344
1631 3300053078 Ga0495612_0037112 Ga0495612_0037112_731_1765 344
1632 3300053084 Ga0495595_0000468 Ga0495595_0000468_3667_4701 344
1633 3300053084 Ga0495595_0027618 Ga0495595_0027618_690_1724 344
1634 3300053084 Ga0495595_0077067 Ga0495595_0077067_340_1377 344
1635 3300053085 Ga0495619_0000016 Ga0495619_0000016_85553_86587 344
1636 3300053085 Ga0495619_0004130 Ga0495619_0004130_1169_2203 344
1637 3300053085 Ga0495619_0031425 Ga0495619_0031425_1978_3015 344
1638 3300054114 Ga0501084_0039547 Ga0501084_0039547_2363_3403 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

30

327

0.94

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

115

252

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cer-assembly2.cif.gz_G human pyruvate dehydrogenase complex e1 component v138m mutation 0.9491 22 331
6cer-assembly1.cif.gz_C human pyruvate dehydrogenase complex e1 component v138m mutation 0.941 22 331
3exi-assembly1.cif.gz_A-2 crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density 0.9403 22 328
3exh-assembly2.cif.gz_E crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9362 22 328
6cer-assembly1.cif.gz_A human pyruvate dehydrogenase complex e1 component v138m mutation 0.9286 22 331
ID Description Score Start End Superfamily
af_A4HY08_15_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9156 22 337 3.40.50.970
1ni4C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9139 22 328 3.40.50.970
af_Q2FY52_1_330_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9118 19 339 3.40.50.970
af_B4FGJ4_23_381_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9068 24 338 3.40.50.970
af_I1KHP5_58_413_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9038 13 341 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A354EU71-F1-model_v4 Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha 0.9544 90 186 GO:0004739
GO:0006086
AF-A0A540V9A5-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9511 29 335 GO:0004739
GO:0006086
AF-A0A7W0U1G3-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9503 35 227 GO:0000287
GO:0004739
GO:0006086
AF-A0A534AF21-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9489 26 328 GO:0004739
GO:0006086
AF-A0A3L7VQD5-F1-model_v4 Dehydrogenase 0.9486 22 337 GO:0016624

Feature Viewer

pLDDT pTM Quality
84.89 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map