F495162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1639 | 526 | 3278 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0132472|Ga0501072_0132472_28_1149 |
| Length | 373 |
| Sequence | MLPKESAFRPWSSVVTGGATKRFAERGPGRAENGAQSMAAVSSEGIEKLEDAIVRAAEATAASVRAAKSVIGTVIFGQEKVVEQALITVLCGGHALLVGLPGLAKTKLVDTMGVALGLDARRIQFTPDLMPSDIVGSEVLEEDQAGRRNFRFIPGPVFTQLLMADEINRASPRTQSALLQAMQELHVTVAGARHEVPRPFHVLATQNPIEQEGTYSLPEAQLDRFLMQIDVDYPDRDAERRIVFDTTGAEESKPKQAMTADDLLAAQRLVRRLPVGESVVEAILTLVRSARPGPDGGELAQPIAWGPSPRASQALMLAVRARALLDGRLAPSIDDVHEMAEPVLKHRMALSFAARAEGETIGSVVGRLKARIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 127 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 165 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 167 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 245 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 258 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 268 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 269 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 270 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 271 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 272 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 273 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 274 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 275 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 276 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 277 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 278 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 279 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 280 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 282 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 288 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 298 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 305 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 306 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 307 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 308 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 310 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 311 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 315 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 316 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 317 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 318 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 319 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 320 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 321 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 322 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 323 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 324 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 325 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 404 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 405 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 406 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 407 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 417 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 418 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 419 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 420 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 457 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 473 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 474 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 475 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 476 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 477 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 481 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 482 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 483 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 485 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 486 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 487 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 489 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 491 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 492 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 493 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 494 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 495 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 496 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 497 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 498 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 499 | 2791355199 | |||
| 500 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 501 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 502 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 503 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 504 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 505 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 506 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 507 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 508 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 509 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 510 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 511 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 512 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 513 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 514 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 515 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 516 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 517 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 518 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 519 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 520 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 521 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 522 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 523 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 524 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 525 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 526 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0.43 |
| Isolates | 2.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 1.04 |
| Rhizoplane | 7.57 |
| Rhizosphere | 83.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501072_0132472 | 3300049588 | Bacteria | 1987 |
| 2 | 2214544914 | 2209111006 | Bacteria | 24470 |
| 3 | ARcpr5oldR_c000055 | 3300000041 | Bacteria | 20973 |
| 4 | ARSoilOldRDRAFT_c000092 | 3300000044 | Bacteria | 16845 |
| 5 | ARCol0oldRDRAFT_c00958 | 3300000045 | Bacteria | 2223 |
| 6 | ARCol0yngRDRAFT_1000049 | 3300000652 | Bacteria | 20970 |
| 7 | JGI24746J21847_1000660 | 3300001977 | Bacteria | 5285 |
| 8 | JGI24746J21847_1003668 | 3300001977 | Bacteria | 2422 |
| 9 | JGI24739J22299_10005070 | 3300001989 | Bacteria | 5015 |
| 10 | JGI24737J22298_10001725 | 3300001990 | Bacteria | 7790 |
| 11 | JGI24737J22298_10006539 | 3300001990 | Bacteria | 3974 |
| 12 | JGI24737J22298_10008869 | 3300001990 | Bacteria | 3357 |
| 13 | JGI24750J21931_1000201 | 3300002070 | Bacteria | 10078 |
| 14 | JGI24738J21930_10013666 | 3300002075 | Bacteria | 1751 |
| 15 | JGI24749J21850_1003715 | 3300002076 | Bacteria | 2136 |
| 16 | JGI24749J21850_1005688 | 3300002076 | Bacteria | 1741 |
| 17 | JGI24744J21845_10002186 | 3300002077 | Bacteria | 3978 |
| 18 | JGI24744J21845_10004285 | 3300002077 | Bacteria | 2944 |
| 19 | JGI24035J26624_1000855 | 3300002126 | Bacteria | 2865 |
| 20 | JGI24034J26672_10001663 | 3300002239 | Bacteria | 2983 |
| 21 | JGI24742J22300_10000548 | 3300002244 | Bacteria | 5621 |
| 22 | JGI25406J46586_10003809 | 3300003203 | Bacteria | 7048 |
| 23 | JGI25406J46586_10007133 | 3300003203 | Bacteria | 5117 |
| 24 | JGI25153J46596_10003847 | 3300003215 | Bacteria | 8260 |
| 25 | JGI26129J50193_1002302 | 3300003349 | Bacteria | 1340 |
| 26 | JGI25404J52841_10001785 | 3300003659 | Bacteria | 3898 |
| 27 | JGI25405J52794_10006511 | 3300003911 | Bacteria | 2134 |
| 28 | Ga0065712_10069289 | 3300005290 | Bacteria | 7569 |
| 29 | Ga0065715_10000947 | 3300005293 | Bacteria | 9826 |
| 30 | Ga0065715_10096595 | 3300005293 | Bacteria | 3846 |
| 31 | Ga0070658_10065700 | 3300005327 | Bacteria | 2962 |
| 32 | Ga0070658_10080543 | 3300005327 | Bacteria | 2675 |
| 33 | Ga0070676_10004291 | 3300005328 | Bacteria | 7488 |
| 34 | Ga0070676_10069735 | 3300005328 | Bacteria | 2107 |
| 35 | Ga0070676_10267144 | 3300005328 | Bacteria | 1148 |
| 36 | Ga0070683_100004677 | 3300005329 | Bacteria | 11310 |
| 37 | Ga0070683_100080091 | 3300005329 | Bacteria | 3057 |
| 38 | Ga0070683_100115011 | 3300005329 | Bacteria | 2539 |
| 39 | Ga0070690_100008757 | 3300005330 | Bacteria | 5842 |
| 40 | Ga0070690_100012125 | 3300005330 | Bacteria | 5066 |
| 41 | Ga0070690_100032348 | 3300005330 | Bacteria | 3266 |
| 42 | Ga0070690_100087661 | 3300005330 | Bacteria | 2044 |
| 43 | Ga0070690_100173921 | 3300005330 | Bacteria | 1484 |
| 44 | Ga0070670_100004378 | 3300005331 | Bacteria | 11820 |
| 45 | Ga0070670_100006765 | 3300005331 | Bacteria | 9714 |
| 46 | Ga0070670_100094117 | 3300005331 | Bacteria | 2577 |
| 47 | Ga0070670_100179502 | 3300005331 | Bacteria | 1838 |
| 48 | Ga0070677_10010687 | 3300005333 | Bacteria | 3145 |
| 49 | Ga0070677_10022125 | 3300005333 | Bacteria | 2338 |
| 50 | Ga0068869_100000546 | 3300005334 | Bacteria | 21018 |
| 51 | Ga0070666_10016324 | 3300005335 | Bacteria | 4749 |
| 52 | Ga0070680_100007445 | 3300005336 | Bacteria | 8352 |
| 53 | Ga0070680_100009775 | 3300005336 | Bacteria | 7384 |
| 54 | Ga0070680_100070058 | 3300005336 | Bacteria | 2880 |
| 55 | Ga0070682_100003445 | 3300005337 | Bacteria | 8766 |
| 56 | Ga0070682_100018516 | 3300005337 | Bacteria | 4073 |
| 57 | Ga0070682_100023757 | 3300005337 | Bacteria | 3642 |
| 58 | Ga0070682_100059999 | 3300005337 | Bacteria | 2404 |
| 59 | Ga0070682_100115164 | 3300005337 | Bacteria | 1797 |
| 60 | Ga0070682_100277844 | 3300005337 | Bacteria | 1219 |
| 61 | Ga0068868_100013168 | 3300005338 | Bacteria | 6058 |
| 62 | Ga0068868_100026486 | 3300005338 | Bacteria | 4420 |
| 63 | Ga0068868_100029085 | 3300005338 | Bacteria | 4231 |
| 64 | Ga0070660_100004111 | 3300005339 | Bacteria | 10041 |
| 65 | Ga0070660_100024866 | 3300005339 | Bacteria | 4448 |
| 66 | Ga0070660_100066748 | 3300005339 | Bacteria | 2802 |
| 67 | Ga0070689_100002392 | 3300005340 | Bacteria | 12238 |
| 68 | Ga0070689_100011343 | 3300005340 | Bacteria | 6380 |
| 69 | Ga0070689_100023636 | 3300005340 | Bacteria | 4603 |
| 70 | Ga0070689_100032975 | 3300005340 | Bacteria | 3943 |
| 71 | Ga0070691_10003723 | 3300005341 | Bacteria | 6886 |
| 72 | Ga0070691_10030403 | 3300005341 | Bacteria | 2530 |
| 73 | Ga0070691_10059641 | 3300005341 | Bacteria | 1834 |
| 74 | Ga0070691_10077486 | 3300005341 | Bacteria | 1623 |
| 75 | Ga0070687_100001017 | 3300005343 | Bacteria | 9561 |
| 76 | Ga0070687_100065224 | 3300005343 | Bacteria | 1937 |
| 77 | Ga0070687_100081880 | 3300005343 | Bacteria | 1764 |
| 78 | Ga0070661_100001763 | 3300005344 | Bacteria | 15010 |
| 79 | Ga0070661_100036019 | 3300005344 | Bacteria | 3597 |
| 80 | Ga0070661_100085189 | 3300005344 | Bacteria | 2335 |
| 81 | Ga0070661_100180667 | 3300005344 | Bacteria | 1605 |
| 82 | Ga0070661_100209699 | 3300005344 | Bacteria | 1491 |
| 83 | Ga0070692_10074200 | 3300005345 | Bacteria | 1819 |
| 84 | Ga0070692_10150731 | 3300005345 | Bacteria | 1324 |
| 85 | Ga0070668_100049439 | 3300005347 | Bacteria | 3235 |
| 86 | Ga0070668_100093478 | 3300005347 | Bacteria | 2373 |
| 87 | Ga0070668_100230623 | 3300005347 | Bacteria | 1530 |
| 88 | Ga0070669_100009976 | 3300005353 | Bacteria | 6754 |
| 89 | Ga0070669_100033750 | 3300005353 | Bacteria | 3703 |
| 90 | Ga0070669_100072827 | 3300005353 | Bacteria | 2544 |
| 91 | Ga0070669_100074273 | 3300005353 | Bacteria | 2521 |
| 92 | Ga0070669_100382860 | 3300005353 | Bacteria | 1147 |
| 93 | Ga0070675_100029783 | 3300005354 | Bacteria | 4404 |
| 94 | Ga0070675_100059157 | 3300005354 | Bacteria | 3160 |
| 95 | Ga0070671_100007031 | 3300005355 | Bacteria | 9015 |
| 96 | Ga0070671_100019747 | 3300005355 | Bacteria | 5488 |
| 97 | Ga0070671_100033007 | 3300005355 | Bacteria | 4279 |
| 98 | Ga0070671_100231059 | 3300005355 | Bacteria | 1569 |
| 99 | Ga0070674_100018657 | 3300005356 | Bacteria | 4392 |
| 100 | Ga0070674_100065444 | 3300005356 | Bacteria | 2551 |
| 101 | Ga0070674_100107752 | 3300005356 | Bacteria | 2040 |
| 102 | Ga0070674_100210462 | 3300005356 | Bacteria | 1507 |
| 103 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 104 | Ga0070673_100018483 | 3300005364 | Bacteria | 4981 |
| 105 | Ga0070673_100074967 | 3300005364 | Bacteria | 2727 |
| 106 | Ga0070673_100199892 | 3300005364 | Bacteria | 1721 |
| 107 | Ga0070688_100005098 | 3300005365 | Bacteria | 6886 |
| 108 | Ga0070688_100006605 | 3300005365 | Bacteria | 6209 |
| 109 | Ga0070688_100019351 | 3300005365 | Bacteria | 3943 |
| 110 | Ga0070688_100075812 | 3300005365 | Bacteria | 2163 |
| 111 | Ga0070659_100014541 | 3300005366 | Bacteria | 5882 |
| 112 | Ga0070659_100037328 | 3300005366 | Bacteria | 3787 |
| 113 | Ga0070659_100078543 | 3300005366 | Bacteria | 2633 |
| 114 | Ga0070659_100105397 | 3300005366 | Bacteria | 2272 |
| 115 | Ga0070659_100120676 | 3300005366 | Bacteria | 2123 |
| 116 | Ga0070659_100301430 | 3300005366 | Bacteria | 1336 |
| 117 | Ga0070667_100036040 | 3300005367 | Bacteria | 4146 |
| 118 | Ga0070667_100038413 | 3300005367 | Bacteria | 4013 |
| 119 | Ga0070667_100040047 | 3300005367 | Bacteria | 3929 |
| 120 | Ga0070667_100078274 | 3300005367 | Bacteria | 2824 |
| 121 | Ga0070667_100329792 | 3300005367 | Bacteria | 1378 |
| 122 | Ga0070667_100565331 | 3300005367 | Bacteria | 1046 |
| 123 | Ga0070709_10021978 | 3300005434 | Bacteria | 3725 |
| 124 | Ga0070709_10044047 | 3300005434 | Bacteria | 2762 |
| 125 | Ga0070709_10076338 | 3300005434 | Bacteria | 2176 |
| 126 | Ga0070709_10080285 | 3300005434 | Bacteria | 2126 |
| 127 | Ga0070714_100004606 | 3300005435 | Bacteria | 10396 |
| 128 | Ga0070714_100006031 | 3300005435 | Bacteria | 9304 |
| 129 | Ga0070714_100014175 | 3300005435 | Bacteria | 6399 |
| 130 | Ga0070714_100039953 | 3300005435 | Bacteria | 3953 |
| 131 | Ga0070714_100063186 | 3300005435 | Bacteria | 3183 |
| 132 | Ga0070714_100517564 | 3300005435 | Bacteria | 1139 |
| 133 | Ga0070713_100005289 | 3300005436 | Bacteria | 8803 |
| 134 | Ga0070713_100016906 | 3300005436 | Bacteria | 5497 |
| 135 | Ga0070713_100035887 | 3300005436 | Bacteria | 3996 |
| 136 | Ga0070713_100080357 | 3300005436 | Bacteria | 2780 |
| 137 | Ga0070713_100175149 | 3300005436 | Bacteria | 1924 |
| 138 | Ga0070713_100237268 | 3300005436 | Bacteria | 1659 |
| 139 | Ga0070713_100268197 | 3300005436 | Bacteria | 1562 |
| 140 | Ga0070710_10003313 | 3300005437 | Bacteria | 7639 |
| 141 | Ga0070710_10012715 | 3300005437 | Bacteria | 4188 |
| 142 | Ga0070710_10013665 | 3300005437 | Bacteria | 4073 |
| 143 | Ga0070710_10071448 | 3300005437 | Bacteria | 2001 |
| 144 | Ga0070701_10004186 | 3300005438 | Bacteria | 5806 |
| 145 | Ga0070701_10011632 | 3300005438 | Bacteria | 3943 |
| 146 | Ga0070711_100018457 | 3300005439 | Bacteria | 4455 |
| 147 | Ga0070711_100030906 | 3300005439 | Bacteria | 3550 |
| 148 | Ga0070711_100051890 | 3300005439 | Bacteria | 2820 |
| 149 | Ga0070711_100152483 | 3300005439 | Bacteria | 1744 |
| 150 | Ga0070705_100003118 | 3300005440 | Bacteria | 8153 |
| 151 | Ga0070705_100081563 | 3300005440 | Bacteria | 1988 |
| 152 | Ga0070705_100265069 | 3300005440 | Bacteria | 1214 |
| 153 | Ga0070700_100002692 | 3300005441 | Bacteria | 9079 |
| 154 | Ga0070700_100017552 | 3300005441 | Bacteria | 4096 |
| 155 | Ga0070700_100048053 | 3300005441 | Bacteria | 2644 |
| 156 | Ga0070700_100093787 | 3300005441 | Bacteria | 1964 |
| 157 | Ga0070694_100008052 | 3300005444 | Bacteria | 6437 |
| 158 | Ga0070694_100016432 | 3300005444 | Bacteria | 4658 |
| 159 | Ga0070694_100086665 | 3300005444 | Bacteria | 2189 |
| 160 | Ga0070708_100054884 | 3300005445 | Bacteria | 3541 |
| 161 | Ga0070708_100198445 | 3300005445 | Bacteria | 1878 |
| 162 | Ga0070663_100012871 | 3300005455 | Bacteria | 5311 |
| 163 | Ga0070663_100017187 | 3300005455 | Bacteria | 4715 |
| 164 | Ga0070663_100020225 | 3300005455 | Bacteria | 4404 |
| 165 | Ga0070663_100026662 | 3300005455 | Bacteria | 3916 |
| 166 | Ga0070663_100027275 | 3300005455 | Bacteria | 3877 |
| 167 | Ga0070663_100071052 | 3300005455 | Bacteria | 2532 |
| 168 | Ga0070678_100000518 | 3300005456 | Bacteria | 18676 |
| 169 | Ga0070678_100034284 | 3300005456 | Bacteria | 3533 |
| 170 | Ga0070678_100037451 | 3300005456 | Bacteria | 3406 |
| 171 | Ga0070678_100048040 | 3300005456 | Bacteria | 3070 |
| 172 | Ga0070678_100061509 | 3300005456 | Bacteria | 2768 |
| 173 | Ga0070662_100021515 | 3300005457 | Bacteria | 4404 |
| 174 | Ga0070662_100041959 | 3300005457 | Bacteria | 3266 |
| 175 | Ga0070662_100045316 | 3300005457 | Bacteria | 3154 |
| 176 | Ga0070662_100067761 | 3300005457 | Bacteria | 2622 |
| 177 | Ga0070662_100133529 | 3300005457 | Bacteria | 1917 |
| 178 | Ga0070662_100166872 | 3300005457 | Bacteria | 1726 |
| 179 | Ga0070662_100250256 | 3300005457 | Bacteria | 1424 |
| 180 | Ga0070681_10004661 | 3300005458 | Bacteria | 13105 |
| 181 | Ga0070681_10010419 | 3300005458 | Bacteria | 9183 |
| 182 | Ga0070681_10022966 | 3300005458 | Bacteria | 6268 |
| 183 | Ga0070681_10027987 | 3300005458 | Bacteria | 5666 |
| 184 | Ga0068867_100009022 | 3300005459 | Bacteria | 7035 |
| 185 | Ga0068867_100018958 | 3300005459 | Bacteria | 4897 |
| 186 | Ga0070685_10003674 | 3300005466 | Bacteria | 7777 |
| 187 | Ga0070685_10007039 | 3300005466 | Bacteria | 5742 |
| 188 | Ga0070707_100068310 | 3300005468 | Bacteria | 3420 |
| 189 | Ga0070698_100201019 | 3300005471 | Bacteria | 1929 |
| 190 | Ga0070699_100019495 | 3300005518 | Bacteria | 5841 |
| 191 | Ga0070699_100174679 | 3300005518 | Bacteria | 1904 |
| 192 | Ga0070679_100007667 | 3300005530 | Bacteria | 10102 |
| 193 | Ga0070679_100030975 | 3300005530 | Bacteria | 5284 |
| 194 | Ga0070679_100031240 | 3300005530 | Bacteria | 5260 |
| 195 | Ga0070679_100047919 | 3300005530 | Bacteria | 4258 |
| 196 | Ga0070679_100120399 | 3300005530 | Bacteria | 2610 |
| 197 | Ga0070679_100155979 | 3300005530 | Bacteria | 2258 |
| 198 | Ga0070679_100174109 | 3300005530 | Bacteria | 2125 |
| 199 | Ga0070684_100004205 | 3300005535 | Bacteria | 10907 |
| 200 | Ga0070684_100079903 | 3300005535 | Bacteria | 2892 |
| 201 | Ga0070684_100105562 | 3300005535 | Bacteria | 2521 |
| 202 | Ga0070684_100247283 | 3300005535 | Bacteria | 1630 |
| 203 | Ga0068853_100015280 | 3300005539 | Bacteria | 6309 |
| 204 | Ga0068853_100015701 | 3300005539 | Bacteria | 6221 |
| 205 | Ga0068853_100030067 | 3300005539 | Bacteria | 4585 |
| 206 | Ga0068853_100109958 | 3300005539 | Bacteria | 2447 |
| 207 | Ga0068853_100299184 | 3300005539 | Bacteria | 1487 |
| 208 | Ga0070672_100000643 | 3300005543 | Bacteria | 20456 |
| 209 | Ga0070672_100040098 | 3300005543 | Bacteria | 3591 |
| 210 | Ga0070672_100052229 | 3300005543 | Bacteria | 3191 |
| 211 | Ga0070672_100128143 | 3300005543 | Bacteria | 2084 |
| 212 | Ga0070686_100001304 | 3300005544 | Bacteria | 14085 |
| 213 | Ga0070686_100065299 | 3300005544 | Bacteria | 2364 |
| 214 | Ga0070695_100006337 | 3300005545 | Bacteria | 6992 |
| 215 | Ga0070695_100015500 | 3300005545 | Bacteria | 4603 |
| 216 | Ga0070695_100091458 | 3300005545 | Bacteria | 2032 |
| 217 | Ga0070696_100018798 | 3300005546 | Bacteria | 4677 |
| 218 | Ga0070696_100042306 | 3300005546 | Bacteria | 3150 |
| 219 | Ga0070696_100139500 | 3300005546 | Bacteria | 1770 |
| 220 | Ga0070693_100003235 | 3300005547 | Bacteria | 7563 |
| 221 | Ga0070693_100008992 | 3300005547 | Bacteria | 4957 |
| 222 | Ga0070693_100031899 | 3300005547 | Bacteria | 2892 |
| 223 | Ga0070665_100021396 | 3300005548 | Bacteria | 6505 |
| 224 | Ga0070665_100048596 | 3300005548 | Bacteria | 4258 |
| 225 | Ga0070665_100085466 | 3300005548 | Bacteria | 3160 |
| 226 | Ga0070665_100089171 | 3300005548 | Bacteria | 3090 |
| 227 | Ga0070665_100219998 | 3300005548 | Bacteria | 1899 |
| 228 | Ga0070665_100376162 | 3300005548 | Bacteria | 1427 |
| 229 | Ga0070665_100436574 | 3300005548 | Bacteria | 1318 |
| 230 | Ga0070704_100008125 | 3300005549 | Bacteria | 6273 |
| 231 | Ga0070704_100240733 | 3300005549 | Bacteria | 1481 |
| 232 | Ga0068855_100018496 | 3300005563 | Bacteria | 8376 |
| 233 | Ga0068855_100021441 | 3300005563 | Bacteria | 7748 |
| 234 | Ga0068855_100022276 | 3300005563 | Bacteria | 7592 |
| 235 | Ga0068855_100089123 | 3300005563 | Bacteria | 3563 |
| 236 | Ga0068855_100111695 | 3300005563 | Bacteria | 3137 |
| 237 | Ga0068855_100293033 | 3300005563 | Bacteria | 1803 |
| 238 | Ga0068855_100698323 | 3300005563 | Bacteria | 1086 |
| 239 | Ga0070664_100026948 | 3300005564 | Bacteria | 4773 |
| 240 | Ga0070664_100107252 | 3300005564 | Bacteria | 2435 |
| 241 | Ga0070664_100198361 | 3300005564 | Bacteria | 1790 |
| 242 | Ga0068857_100001038 | 3300005577 | Bacteria | 21487 |
| 243 | Ga0068857_100015943 | 3300005577 | Bacteria | 6581 |
| 244 | Ga0068854_100014606 | 3300005578 | Bacteria | 5181 |
| 245 | Ga0068854_100020860 | 3300005578 | Bacteria | 4439 |
| 246 | Ga0068854_100147355 | 3300005578 | Bacteria | 1812 |
| 247 | Ga0068854_100257987 | 3300005578 | Bacteria | 1395 |
| 248 | Ga0068856_100009104 | 3300005614 | Bacteria | 9654 |
| 249 | Ga0068856_100038924 | 3300005614 | Bacteria | 4668 |
| 250 | Ga0068856_100348432 | 3300005614 | Bacteria | 1499 |
| 251 | Ga0070702_100004502 | 3300005615 | Bacteria | 6373 |
| 252 | Ga0070702_100013098 | 3300005615 | Bacteria | 4178 |
| 253 | Ga0070702_100035132 | 3300005615 | Bacteria | 2767 |
| 254 | Ga0068852_100005996 | 3300005616 | Bacteria | 8755 |
| 255 | Ga0068852_100168942 | 3300005616 | Bacteria | 2048 |
| 256 | Ga0068859_100006706 | 3300005617 | Bacteria | 11694 |
| 257 | Ga0068859_100135022 | 3300005617 | Bacteria | 2540 |
| 258 | Ga0068859_100155044 | 3300005617 | Bacteria | 2367 |
| 259 | Ga0068859_100390827 | 3300005617 | Bacteria | 1487 |
| 260 | Ga0068864_100004096 | 3300005618 | Bacteria | 11968 |
| 261 | Ga0068864_100006391 | 3300005618 | Bacteria | 9654 |
| 262 | Ga0068864_100022271 | 3300005618 | Bacteria | 5312 |
| 263 | Ga0068864_100054797 | 3300005618 | Bacteria | 3442 |
| 264 | Ga0068866_10000791 | 3300005718 | Bacteria | 14174 |
| 265 | Ga0068866_10079221 | 3300005718 | Bacteria | 1759 |
| 266 | Ga0068866_10120115 | 3300005718 | Bacteria | 1480 |
| 267 | Ga0068861_100002491 | 3300005719 | Bacteria | 12008 |
| 268 | Ga0068861_100029004 | 3300005719 | Bacteria | 4042 |
| 269 | Ga0068861_100049835 | 3300005719 | Bacteria | 3172 |
| 270 | Ga0068861_100057052 | 3300005719 | Bacteria | 2982 |
| 271 | Ga0068870_10001431 | 3300005840 | Bacteria | 9645 |
| 272 | Ga0068870_10002318 | 3300005840 | Bacteria | 7910 |
| 273 | Ga0068870_10043749 | 3300005840 | Bacteria | 2337 |
| 274 | Ga0068870_10121272 | 3300005840 | Bacteria | 1506 |
| 275 | Ga0068863_100016752 | 3300005841 | Bacteria | 7031 |
| 276 | Ga0068863_100025687 | 3300005841 | Bacteria | 5618 |
| 277 | Ga0068863_100051180 | 3300005841 | Bacteria | 3915 |
| 278 | Ga0068858_100010247 | 3300005842 | Bacteria | 8893 |
| 279 | Ga0068858_100017836 | 3300005842 | Bacteria | 6647 |
| 280 | Ga0068858_100026083 | 3300005842 | Bacteria | 5433 |
| 281 | Ga0068858_100192934 | 3300005842 | Bacteria | 1925 |
| 282 | Ga0068860_100002530 | 3300005843 | Bacteria | 19153 |
| 283 | Ga0068860_100047790 | 3300005843 | Bacteria | 4078 |
| 284 | Ga0068860_100070139 | 3300005843 | Bacteria | 3332 |
| 285 | Ga0068860_100156188 | 3300005843 | Bacteria | 2198 |
| 286 | Ga0068862_100006671 | 3300005844 | Bacteria | 9577 |
| 287 | Ga0068862_100040884 | 3300005844 | Bacteria | 3943 |
| 288 | Ga0068862_100135610 | 3300005844 | Bacteria | 2181 |
| 289 | Ga0068862_100264977 | 3300005844 | Bacteria | 1570 |
| 290 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 291 | Ga0081455_10003729 | 3300005937 | Bacteria | 17413 |
| 292 | Ga0081455_10005438 | 3300005937 | Bacteria | 13976 |
| 293 | Ga0081455_10010814 | 3300005937 | Bacteria | 9222 |
| 294 | Ga0081455_10033699 | 3300005937 | Bacteria | 4598 |
| 295 | Ga0081538_10001580 | 3300005981 | Bacteria | 23375 |
| 296 | Ga0081538_10010111 | 3300005981 | Bacteria | 7763 |
| 297 | Ga0081538_10020370 | 3300005981 | Bacteria | 4883 |
| 298 | Ga0081538_10021466 | 3300005981 | Bacteria | 4713 |
| 299 | Ga0081540_1000027 | 3300005983 | Bacteria | 151880 |
| 300 | Ga0081540_1002386 | 3300005983 | Bacteria | 15324 |
| 301 | Ga0081540_1002765 | 3300005983 | Bacteria | 14238 |
| 302 | Ga0081540_1003265 | 3300005983 | Bacteria | 12889 |
| 303 | Ga0081540_1003527 | 3300005983 | Bacteria | 12331 |
| 304 | Ga0081540_1005126 | 3300005983 | Bacteria | 9820 |
| 305 | Ga0081540_1005516 | 3300005983 | Bacteria | 9433 |
| 306 | Ga0081540_1010700 | 3300005983 | Bacteria | 6183 |
| 307 | Ga0081540_1010849 | 3300005983 | Bacteria | 6124 |
| 308 | Ga0081540_1020053 | 3300005983 | Bacteria | 4036 |
| 309 | Ga0081540_1024836 | 3300005983 | Bacteria | 3467 |
| 310 | Ga0081540_1026792 | 3300005983 | Bacteria | 3281 |
| 311 | Ga0081539_10000306 | 3300005985 | Bacteria | 110402 |
| 312 | Ga0081539_10001260 | 3300005985 | Bacteria | 44845 |
| 313 | Ga0081539_10050522 | 3300005985 | Bacteria | 2352 |
| 314 | Ga0070717_10000485 | 3300006028 | Bacteria | 25249 |
| 315 | Ga0070717_10000980 | 3300006028 | Bacteria | 19102 |
| 316 | Ga0070717_10023003 | 3300006028 | Bacteria | 4932 |
| 317 | Ga0075365_10037037 | 3300006038 | Bacteria | 3165 |
| 318 | Ga0075365_10051214 | 3300006038 | Bacteria | 2726 |
| 319 | Ga0075365_10171024 | 3300006038 | Bacteria | 1516 |
| 320 | Ga0075368_10011758 | 3300006042 | Bacteria | 3191 |
| 321 | Ga0075368_10071075 | 3300006042 | Bacteria | 1405 |
| 322 | Ga0075363_100004615 | 3300006048 | Bacteria | 6051 |
| 323 | Ga0075363_100011319 | 3300006048 | Bacteria | 4268 |
| 324 | Ga0075363_100041849 | 3300006048 | Bacteria | 2417 |
| 325 | Ga0075364_10006344 | 3300006051 | Bacteria | 6948 |
| 326 | Ga0075364_10074566 | 3300006051 | Bacteria | 2237 |
| 327 | Ga0075432_10000954 | 3300006058 | Bacteria | 9136 |
| 328 | Ga0070715_10000289 | 3300006163 | Bacteria | 12366 |
| 329 | Ga0070715_10003295 | 3300006163 | Bacteria | 5105 |
| 330 | Ga0070715_10032333 | 3300006163 | Bacteria | 2131 |
| 331 | Ga0070715_10081041 | 3300006163 | Bacteria | 1473 |
| 332 | Ga0070716_100004147 | 3300006173 | Bacteria | 6883 |
| 333 | Ga0070716_100016874 | 3300006173 | Bacteria | 3776 |
| 334 | Ga0070716_100047513 | 3300006173 | Bacteria | 2422 |
| 335 | Ga0070712_100020910 | 3300006175 | Bacteria | 4289 |
| 336 | Ga0070712_100030045 | 3300006175 | Bacteria | 3648 |
| 337 | Ga0070712_100043123 | 3300006175 | Bacteria | 3104 |
| 338 | Ga0070712_100044021 | 3300006175 | Bacteria | 3076 |
| 339 | Ga0070712_100049815 | 3300006175 | Bacteria | 2910 |
| 340 | Ga0075362_10044483 | 3300006177 | Bacteria | 1969 |
| 341 | Ga0075367_10068408 | 3300006178 | Bacteria | 2130 |
| 342 | Ga0075369_10001806 | 3300006186 | Bacteria | 7454 |
| 343 | Ga0075369_10016448 | 3300006186 | Bacteria | 2985 |
| 344 | Ga0075366_10028015 | 3300006195 | Bacteria | 3305 |
| 345 | Ga0097621_100001425 | 3300006237 | Bacteria | 16408 |
| 346 | Ga0097621_100010536 | 3300006237 | Bacteria | 6771 |
| 347 | Ga0097621_100147348 | 3300006237 | Bacteria | 2016 |
| 348 | Ga0075370_10001231 | 3300006353 | Bacteria | 10859 |
| 349 | Ga0068871_100002394 | 3300006358 | Bacteria | 12790 |
| 350 | Ga0068871_100022579 | 3300006358 | Bacteria | 4853 |
| 351 | Ga0068871_100033578 | 3300006358 | Bacteria | 4065 |
| 352 | Ga0068871_100036707 | 3300006358 | Bacteria | 3903 |
| 353 | Ga0068871_100107955 | 3300006358 | Bacteria | 2338 |
| 354 | Ga0068871_100191120 | 3300006358 | Bacteria | 1764 |
| 355 | Ga0075428_100005241 | 3300006844 | Bacteria | 14417 |
| 356 | Ga0075428_100005805 | 3300006844 | Bacteria | 13709 |
| 357 | Ga0075428_100011791 | 3300006844 | Bacteria | 9730 |
| 358 | Ga0075428_100057524 | 3300006844 | Bacteria | 4256 |
| 359 | Ga0075428_100211000 | 3300006844 | Bacteria | 2098 |
| 360 | Ga0075430_100000424 | 3300006846 | Bacteria | 31568 |
| 361 | Ga0075430_100006792 | 3300006846 | Bacteria | 9643 |
| 362 | Ga0075430_100010396 | 3300006846 | Bacteria | 7882 |
| 363 | Ga0075430_100093633 | 3300006846 | Bacteria | 2512 |
| 364 | Ga0075431_100000105 | 3300006847 | Bacteria | 53256 |
| 365 | Ga0075431_100002258 | 3300006847 | Bacteria | 18482 |
| 366 | Ga0075431_100033491 | 3300006847 | Bacteria | 5294 |
| 367 | Ga0075431_100121846 | 3300006847 | Bacteria | 2691 |
| 368 | Ga0075431_100178116 | 3300006847 | Bacteria | 2182 |
| 369 | Ga0075431_100188585 | 3300006847 | Bacteria | 2113 |
| 370 | Ga0075431_100275949 | 3300006847 | Bacteria | 1702 |
| 371 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 372 | Ga0075434_100000310 | 3300006871 | Bacteria | 34771 |
| 373 | Ga0075434_100004560 | 3300006871 | Bacteria | 12511 |
| 374 | Ga0075434_100043177 | 3300006871 | Bacteria | 4471 |
| 375 | Ga0075434_100086930 | 3300006871 | Bacteria | 3127 |
| 376 | Ga0075434_100112131 | 3300006871 | Bacteria | 2738 |
| 377 | Ga0075434_100139878 | 3300006871 | Bacteria | 2440 |
| 378 | Ga0075434_100198536 | 3300006871 | Bacteria | 2026 |
| 379 | Ga0075434_100217751 | 3300006871 | Bacteria | 1929 |
| 380 | Ga0075434_100339222 | 3300006871 | Bacteria | 1524 |
| 381 | Ga0075429_100001610 | 3300006880 | Bacteria | 18632 |
| 382 | Ga0075429_100005372 | 3300006880 | Bacteria | 11021 |
| 383 | Ga0068865_100001097 | 3300006881 | Bacteria | 15622 |
| 384 | Ga0068865_100052560 | 3300006881 | Bacteria | 2824 |
| 385 | Ga0068865_100081222 | 3300006881 | Bacteria | 2327 |
| 386 | Ga0068865_100134544 | 3300006881 | Bacteria | 1856 |
| 387 | Ga0075436_100008403 | 3300006914 | Bacteria | 7059 |
| 388 | Ga0097620_100006706 | 3300006931 | Bacteria | 11694 |
| 389 | Ga0097620_100135019 | 3300006931 | Bacteria | 2540 |
| 390 | Ga0097620_100155037 | 3300006931 | Bacteria | 2367 |
| 391 | Ga0097620_100390819 | 3300006931 | Bacteria | 1487 |
| 392 | Ga0099824_1002861 | 3300006942 | Bacteria | 25261 |
| 393 | Ga0075435_100002697 | 3300007076 | Bacteria | 11855 |
| 394 | Ga0075435_100087604 | 3300007076 | Bacteria | 2565 |
| 395 | Ga0075435_100114450 | 3300007076 | Bacteria | 2245 |
| 396 | Ga0099794_10024802 | 3300007265 | Bacteria | 2756 |
| 397 | Ga0099794_10031739 | 3300007265 | Bacteria | 2475 |
| 398 | Ga0105244_10023607 | 3300009036 | Bacteria | 3369 |
| 399 | Ga0105240_10175140 | 3300009093 | Bacteria | 2537 |
| 400 | Ga0105240_10202808 | 3300009093 | Bacteria | 2323 |
| 401 | Ga0111539_10000792 | 3300009094 | Bacteria | 41176 |
| 402 | Ga0111539_10000842 | 3300009094 | Bacteria | 39938 |
| 403 | Ga0111539_10014117 | 3300009094 | Bacteria | 9982 |
| 404 | Ga0111539_10034470 | 3300009094 | Bacteria | 6137 |
| 405 | Ga0105245_10025559 | 3300009098 | Bacteria | 5194 |
| 406 | Ga0105245_10029815 | 3300009098 | Bacteria | 4823 |
| 407 | Ga0105245_10099722 | 3300009098 | Bacteria | 2686 |
| 408 | Ga0105245_10183751 | 3300009098 | Bacteria | 1999 |
| 409 | Ga0105247_10024258 | 3300009101 | Bacteria | 3653 |
| 410 | Ga0105247_10025129 | 3300009101 | Bacteria | 3594 |
| 411 | Ga0105247_10033339 | 3300009101 | Bacteria | 3132 |
| 412 | Ga0105247_10041196 | 3300009101 | Bacteria | 2825 |
| 413 | Ga0114129_10000803 | 3300009147 | Bacteria | 40282 |
| 414 | Ga0114129_10001669 | 3300009147 | Bacteria | 30222 |
| 415 | Ga0114129_10003927 | 3300009147 | Bacteria | 20989 |
| 416 | Ga0114129_10006740 | 3300009147 | Bacteria | 16309 |
| 417 | Ga0114129_10006854 | 3300009147 | Bacteria | 16194 |
| 418 | Ga0114129_10027094 | 3300009147 | Bacteria | 8115 |
| 419 | Ga0114129_10071921 | 3300009147 | Bacteria | 4822 |
| 420 | Ga0105243_10002400 | 3300009148 | Bacteria | 15707 |
| 421 | Ga0105243_10004402 | 3300009148 | Bacteria | 11139 |
| 422 | Ga0105243_10035105 | 3300009148 | Bacteria | 3886 |
| 423 | Ga0105243_10047415 | 3300009148 | Bacteria | 3382 |
| 424 | Ga0105243_10087524 | 3300009148 | Bacteria | 2557 |
| 425 | Ga0105243_10094329 | 3300009148 | Bacteria | 2471 |
| 426 | Ga0105241_10008636 | 3300009174 | Bacteria | 7488 |
| 427 | Ga0105241_10010427 | 3300009174 | Bacteria | 6819 |
| 428 | Ga0105241_10028300 | 3300009174 | Bacteria | 4176 |
| 429 | Ga0105241_10090184 | 3300009174 | Bacteria | 2417 |
| 430 | Ga0105241_10100074 | 3300009174 | Bacteria | 2303 |
| 431 | Ga0105241_10260979 | 3300009174 | Bacteria | 1472 |
| 432 | Ga0105242_10007578 | 3300009176 | Bacteria | 8356 |
| 433 | Ga0105242_10008734 | 3300009176 | Bacteria | 7775 |
| 434 | Ga0105242_10025583 | 3300009176 | Bacteria | 4672 |
| 435 | Ga0105248_10010839 | 3300009177 | Bacteria | 10064 |
| 436 | Ga0105248_10014218 | 3300009177 | Bacteria | 8762 |
| 437 | Ga0105248_10059364 | 3300009177 | Bacteria | 4296 |
| 438 | Ga0105248_10062156 | 3300009177 | Bacteria | 4194 |
| 439 | Ga0105248_10081366 | 3300009177 | Bacteria | 3640 |
| 440 | Ga0105237_10030610 | 3300009545 | Bacteria | 5465 |
| 441 | Ga0105237_10032300 | 3300009545 | Bacteria | 5300 |
| 442 | Ga0105237_10121260 | 3300009545 | Bacteria | 2609 |
| 443 | Ga0105238_10009678 | 3300009551 | Bacteria | 9647 |
| 444 | Ga0105238_10066536 | 3300009551 | Bacteria | 3605 |
| 445 | Ga0105238_10099304 | 3300009551 | Bacteria | 2894 |
| 446 | Ga0105238_10115780 | 3300009551 | Bacteria | 2660 |
| 447 | Ga0105249_10011450 | 3300009553 | Bacteria | 7790 |
| 448 | Ga0105249_10153117 | 3300009553 | Bacteria | 2222 |
| 449 | Ga0105249_10160851 | 3300009553 | Bacteria | 2170 |
| 450 | Ga0099796_10011799 | 3300010159 | Bacteria | 2450 |
| 451 | Ga0105239_10024088 | 3300010375 | Bacteria | 6704 |
| 452 | Ga0105239_10040214 | 3300010375 | Bacteria | 5123 |
| 453 | Ga0105239_10346225 | 3300010375 | Bacteria | 1678 |
| 454 | Ga0105246_10051104 | 3300011119 | Bacteria | 2837 |
| 455 | Ga0105246_10071651 | 3300011119 | Bacteria | 2441 |
| 456 | Ga0105246_10110265 | 3300011119 | Bacteria | 2021 |
| 457 | Ga0157342_1000436 | 3300012507 | Bacteria | 2516 |
| 458 | Ga0157373_10110086 | 3300013100 | Bacteria | 1936 |
| 459 | Ga0157371_10195899 | 3300013102 | Bacteria | 1447 |
| 460 | Ga0157370_10035641 | 3300013104 | Bacteria | 4833 |
| 461 | Ga0157370_10193977 | 3300013104 | Bacteria | 1885 |
| 462 | Ga0157369_10281738 | 3300013105 | Bacteria | 1731 |
| 463 | Ga0157374_10001167 | 3300013296 | Bacteria | 22404 |
| 464 | Ga0157374_10003779 | 3300013296 | Bacteria | 12738 |
| 465 | Ga0157374_10027828 | 3300013296 | Bacteria | 5103 |
| 466 | Ga0157378_10008023 | 3300013297 | Bacteria | 9217 |
| 467 | Ga0163162_10010853 | 3300013306 | Bacteria | 8866 |
| 468 | Ga0163162_10051562 | 3300013306 | Bacteria | 4129 |
| 469 | Ga0163162_10139260 | 3300013306 | Bacteria | 2539 |
| 470 | Ga0163162_10293571 | 3300013306 | Bacteria | 1757 |
| 471 | Ga0163162_10671224 | 3300013306 | Bacteria | 1159 |
| 472 | Ga0157372_10141014 | 3300013307 | Bacteria | 2776 |
| 473 | Ga0157372_10279647 | 3300013307 | Bacteria | 1940 |
| 474 | Ga0163163_10007288 | 3300014325 | Bacteria | 9756 |
| 475 | Ga0163163_10007753 | 3300014325 | Bacteria | 9488 |
| 476 | Ga0163163_10109647 | 3300014325 | Bacteria | 2788 |
| 477 | Ga0157380_10001551 | 3300014326 | Bacteria | 15111 |
| 478 | Ga0157380_10093514 | 3300014326 | Bacteria | 2486 |
| 479 | Ga0157380_10231041 | 3300014326 | Bacteria | 1661 |
| 480 | Ga0157377_10009300 | 3300014745 | Bacteria | 4814 |
| 481 | Ga0157379_10036937 | 3300014968 | Bacteria | 4356 |
| 482 | Ga0157376_10012121 | 3300014969 | Bacteria | 6386 |
| 483 | Ga0157376_10059766 | 3300014969 | Bacteria | 3197 |
| 484 | Ga0157376_10065769 | 3300014969 | Bacteria | 3063 |
| 485 | Ga0157376_10093163 | 3300014969 | Bacteria | 2615 |
| 486 | Ga0163161_10011103 | 3300017792 | Bacteria | 6240 |
| 487 | Ga0163161_10086928 | 3300017792 | Bacteria | 2308 |
| 488 | Ga0163161_10166223 | 3300017792 | Bacteria | 1685 |
| 489 | Ga0206356_11037165 | 3300020070 | Bacteria | 2624 |
| 490 | Ga0206350_10300830 | 3300020080 | Bacteria | 1629 |
| 491 | Ga0206354_10798601 | 3300020081 | Bacteria | 4257 |
| 492 | Ga0206353_11208914 | 3300020082 | Bacteria | 5004 |
| 493 | Ga0213874_10003167 | 3300021377 | Bacteria | 3626 |
| 494 | Ga0213876_10000514 | 3300021384 | Bacteria | 29913 |
| 495 | Ga0213876_10004037 | 3300021384 | Bacteria | 8258 |
| 496 | Ga0213875_10000122 | 3300021388 | Bacteria | 87195 |
| 497 | Ga0213875_10002043 | 3300021388 | Bacteria | 12397 |
| 498 | Ga0213875_10047189 | 3300021388 | Bacteria | 2021 |
| 499 | Ga0213875_10049374 | 3300021388 | Bacteria | 1972 |
| 500 | Ga0224712_10047026 | 3300022467 | Bacteria | 1659 |
| 501 | Ga0224572_1020299 | 3300024225 | Bacteria | 1276 |
| 502 | Ga0228598_1010870 | 3300024227 | Bacteria | 1813 |
| 503 | Ga0207666_1000153 | 3300025271 | Bacteria | 10663 |
| 504 | Ga0207666_1005029 | 3300025271 | Bacteria | 1679 |
| 505 | Ga0207673_1000206 | 3300025290 | Bacteria | 5940 |
| 506 | Ga0209758_1007275 | 3300025297 | Bacteria | 7604 |
| 507 | Ga0207697_10001059 | 3300025315 | Bacteria | 15198 |
| 508 | Ga0207653_10009860 | 3300025885 | Bacteria | 2978 |
| 509 | Ga0207653_10017060 | 3300025885 | Bacteria | 2283 |
| 510 | Ga0207682_10002553 | 3300025893 | Bacteria | 8126 |
| 511 | Ga0207682_10033509 | 3300025893 | Bacteria | 2069 |
| 512 | Ga0207692_10000282 | 3300025898 | Bacteria | 17493 |
| 513 | Ga0207642_10016582 | 3300025899 | Bacteria | 2779 |
| 514 | Ga0207642_10034683 | 3300025899 | Bacteria | 2148 |
| 515 | Ga0207710_10000382 | 3300025900 | Bacteria | 30360 |
| 516 | Ga0207688_10001640 | 3300025901 | Bacteria | 11816 |
| 517 | Ga0207688_10015245 | 3300025901 | Bacteria | 4171 |
| 518 | Ga0207680_10008936 | 3300025903 | Bacteria | 4943 |
| 519 | Ga0207680_10010916 | 3300025903 | Bacteria | 4566 |
| 520 | Ga0207680_10018703 | 3300025903 | Bacteria | 3690 |
| 521 | Ga0207680_10052411 | 3300025903 | Bacteria | 2445 |
| 522 | Ga0207647_10009706 | 3300025904 | Bacteria | 6828 |
| 523 | Ga0207647_10009987 | 3300025904 | Bacteria | 6722 |
| 524 | Ga0207647_10012209 | 3300025904 | Bacteria | 5988 |
| 525 | Ga0207685_10000164 | 3300025905 | Bacteria | 10037 |
| 526 | Ga0207685_10005449 | 3300025905 | Bacteria | 3361 |
| 527 | Ga0207685_10041022 | 3300025905 | Bacteria | 1729 |
| 528 | Ga0207685_10068246 | 3300025905 | Bacteria | 1432 |
| 529 | Ga0207699_10004201 | 3300025906 | Bacteria | 6891 |
| 530 | Ga0207699_10006008 | 3300025906 | Bacteria | 5843 |
| 531 | Ga0207699_10067023 | 3300025906 | Bacteria | 2181 |
| 532 | Ga0207699_10081032 | 3300025906 | Bacteria | 2012 |
| 533 | Ga0207645_10002745 | 3300025907 | Bacteria | 13711 |
| 534 | Ga0207645_10063850 | 3300025907 | Bacteria | 2353 |
| 535 | Ga0207645_10077131 | 3300025907 | Bacteria | 2135 |
| 536 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 537 | Ga0207643_10001769 | 3300025908 | Bacteria | 12048 |
| 538 | Ga0207643_10176573 | 3300025908 | Bacteria | 1291 |
| 539 | Ga0207643_10196526 | 3300025908 | Bacteria | 1226 |
| 540 | Ga0207705_10073895 | 3300025909 | Bacteria | 2474 |
| 541 | Ga0207705_10217915 | 3300025909 | Bacteria | 1449 |
| 542 | Ga0207684_10009569 | 3300025910 | Bacteria | 8549 |
| 543 | Ga0207654_10008032 | 3300025911 | Bacteria | 5318 |
| 544 | Ga0207654_10173227 | 3300025911 | Bacteria | 1403 |
| 545 | Ga0207707_10011019 | 3300025912 | Bacteria | 7866 |
| 546 | Ga0207707_10014644 | 3300025912 | Bacteria | 6833 |
| 547 | Ga0207707_10016719 | 3300025912 | Bacteria | 6393 |
| 548 | Ga0207707_10336335 | 3300025912 | Bacteria | 1302 |
| 549 | Ga0207695_10086365 | 3300025913 | Bacteria | 3164 |
| 550 | Ga0207671_10082682 | 3300025914 | Bacteria | 2410 |
| 551 | Ga0207671_10087943 | 3300025914 | Bacteria | 2337 |
| 552 | Ga0207671_10088536 | 3300025914 | Bacteria | 2329 |
| 553 | Ga0207671_10129201 | 3300025914 | Bacteria | 1938 |
| 554 | Ga0207671_10154096 | 3300025914 | Bacteria | 1777 |
| 555 | Ga0207671_10168615 | 3300025914 | Bacteria | 1699 |
| 556 | Ga0207693_10001038 | 3300025915 | Bacteria | 24865 |
| 557 | Ga0207693_10005387 | 3300025915 | Bacteria | 10692 |
| 558 | Ga0207693_10016176 | 3300025915 | Bacteria | 5966 |
| 559 | Ga0207693_10034641 | 3300025915 | Bacteria | 3983 |
| 560 | Ga0207693_10084937 | 3300025915 | Bacteria | 2480 |
| 561 | Ga0207693_10201344 | 3300025915 | Bacteria | 1566 |
| 562 | Ga0207663_10004587 | 3300025916 | Bacteria | 6885 |
| 563 | Ga0207663_10026312 | 3300025916 | Bacteria | 3375 |
| 564 | Ga0207663_10092326 | 3300025916 | Bacteria | 2012 |
| 565 | Ga0207663_10328751 | 3300025916 | Bacteria | 1151 |
| 566 | Ga0207660_10007217 | 3300025917 | Bacteria | 7193 |
| 567 | Ga0207660_10009992 | 3300025917 | Bacteria | 6148 |
| 568 | Ga0207660_10020495 | 3300025917 | Bacteria | 4437 |
| 569 | Ga0207660_10124432 | 3300025917 | Bacteria | 1957 |
| 570 | Ga0207662_10000392 | 3300025918 | Bacteria | 19588 |
| 571 | Ga0207662_10001199 | 3300025918 | Bacteria | 12365 |
| 572 | Ga0207662_10026540 | 3300025918 | Bacteria | 3341 |
| 573 | Ga0207657_10002007 | 3300025919 | Bacteria | 22003 |
| 574 | Ga0207657_10007818 | 3300025919 | Bacteria | 10913 |
| 575 | Ga0207657_10012563 | 3300025919 | Bacteria | 8349 |
| 576 | Ga0207657_10017247 | 3300025919 | Bacteria | 6932 |
| 577 | Ga0207657_10038806 | 3300025919 | Bacteria | 4236 |
| 578 | Ga0207657_10039060 | 3300025919 | Bacteria | 4220 |
| 579 | Ga0207657_10043860 | 3300025919 | Bacteria | 3936 |
| 580 | Ga0207657_10050813 | 3300025919 | Bacteria | 3605 |
| 581 | Ga0207649_10005404 | 3300025920 | Bacteria | 6918 |
| 582 | Ga0207652_10014772 | 3300025921 | Bacteria | 6329 |
| 583 | Ga0207652_10053069 | 3300025921 | Bacteria | 3482 |
| 584 | Ga0207652_10058342 | 3300025921 | Bacteria | 3326 |
| 585 | Ga0207652_10059011 | 3300025921 | Bacteria | 3307 |
| 586 | Ga0207652_10059737 | 3300025921 | Bacteria | 3287 |
| 587 | Ga0207652_10113505 | 3300025921 | Bacteria | 2405 |
| 588 | Ga0207652_10133288 | 3300025921 | Bacteria | 2217 |
| 589 | Ga0207652_10295507 | 3300025921 | Bacteria | 1462 |
| 590 | Ga0207646_10258077 | 3300025922 | Bacteria | 1575 |
| 591 | Ga0207681_10024530 | 3300025923 | Bacteria | 3871 |
| 592 | Ga0207681_10025222 | 3300025923 | Bacteria | 3822 |
| 593 | Ga0207681_10149905 | 3300025923 | Bacteria | 1746 |
| 594 | Ga0207694_10082893 | 3300025924 | Bacteria | 2521 |
| 595 | Ga0207694_10110698 | 3300025924 | Bacteria | 2185 |
| 596 | Ga0207650_10004542 | 3300025925 | Bacteria | 9492 |
| 597 | Ga0207650_10064045 | 3300025925 | Bacteria | 2751 |
| 598 | Ga0207650_10143039 | 3300025925 | Bacteria | 1882 |
| 599 | Ga0207659_10000374 | 3300025926 | Bacteria | 26976 |
| 600 | Ga0207659_10066883 | 3300025926 | Bacteria | 2609 |
| 601 | Ga0207687_10005411 | 3300025927 | Bacteria | 8442 |
| 602 | Ga0207687_10009764 | 3300025927 | Bacteria | 6279 |
| 603 | Ga0207687_10016412 | 3300025927 | Bacteria | 4864 |
| 604 | Ga0207687_10041692 | 3300025927 | Bacteria | 3153 |
| 605 | Ga0207687_10092929 | 3300025927 | Bacteria | 2204 |
| 606 | Ga0207700_10003347 | 3300025928 | Bacteria | 9298 |
| 607 | Ga0207700_10015515 | 3300025928 | Bacteria | 5028 |
| 608 | Ga0207700_10037965 | 3300025928 | Bacteria | 3493 |
| 609 | Ga0207700_10122533 | 3300025928 | Bacteria | 2110 |
| 610 | Ga0207700_10143551 | 3300025928 | Bacteria | 1964 |
| 611 | Ga0207700_10161996 | 3300025928 | Bacteria | 1858 |
| 612 | Ga0207700_10196238 | 3300025928 | Bacteria | 1699 |
| 613 | Ga0207664_10009763 | 3300025929 | Bacteria | 6751 |
| 614 | Ga0207664_10023358 | 3300025929 | Bacteria | 4631 |
| 615 | Ga0207664_10033414 | 3300025929 | Bacteria | 3951 |
| 616 | Ga0207664_10067954 | 3300025929 | Bacteria | 2861 |
| 617 | Ga0207664_10106776 | 3300025929 | Bacteria | 2322 |
| 618 | Ga0207664_10108798 | 3300025929 | Bacteria | 2302 |
| 619 | Ga0207664_10187014 | 3300025929 | Bacteria | 1781 |
| 620 | Ga0207664_10202086 | 3300025929 | Bacteria | 1716 |
| 621 | Ga0207644_10003380 | 3300025931 | Bacteria | 10298 |
| 622 | Ga0207644_10004888 | 3300025931 | Bacteria | 8732 |
| 623 | Ga0207644_10055390 | 3300025931 | Bacteria | 2858 |
| 624 | Ga0207690_10010819 | 3300025932 | Bacteria | 5436 |
| 625 | Ga0207690_10013825 | 3300025932 | Bacteria | 4862 |
| 626 | Ga0207690_10180370 | 3300025932 | Bacteria | 1589 |
| 627 | Ga0207690_10218354 | 3300025932 | Bacteria | 1457 |
| 628 | Ga0207706_10002819 | 3300025933 | Bacteria | 16867 |
| 629 | Ga0207706_10006974 | 3300025933 | Bacteria | 10444 |
| 630 | Ga0207706_10010623 | 3300025933 | Bacteria | 8409 |
| 631 | Ga0207706_10022546 | 3300025933 | Bacteria | 5651 |
| 632 | Ga0207706_10041500 | 3300025933 | Bacteria | 4079 |
| 633 | Ga0207706_10341120 | 3300025933 | Bacteria | 1303 |
| 634 | Ga0207686_10007542 | 3300025934 | Bacteria | 5858 |
| 635 | Ga0207686_10020413 | 3300025934 | Bacteria | 3785 |
| 636 | Ga0207686_10025932 | 3300025934 | Bacteria | 3416 |
| 637 | Ga0207686_10151512 | 3300025934 | Bacteria | 1615 |
| 638 | Ga0207709_10003882 | 3300025935 | Bacteria | 8742 |
| 639 | Ga0207709_10014845 | 3300025935 | Bacteria | 4308 |
| 640 | Ga0207709_10071979 | 3300025935 | Bacteria | 2197 |
| 641 | Ga0207709_10091098 | 3300025935 | Bacteria | 1993 |
| 642 | Ga0207709_10100149 | 3300025935 | Bacteria | 1914 |
| 643 | Ga0207670_10001845 | 3300025936 | Bacteria | 11059 |
| 644 | Ga0207670_10004902 | 3300025936 | Bacteria | 7280 |
| 645 | Ga0207670_10067403 | 3300025936 | Bacteria | 2462 |
| 646 | Ga0207669_10022356 | 3300025937 | Bacteria | 3358 |
| 647 | Ga0207669_10051158 | 3300025937 | Bacteria | 2473 |
| 648 | Ga0207669_10092832 | 3300025937 | Bacteria | 1970 |
| 649 | Ga0207669_10135589 | 3300025937 | Bacteria | 1699 |
| 650 | Ga0207704_10002620 | 3300025938 | Bacteria | 8124 |
| 651 | Ga0207704_10005816 | 3300025938 | Bacteria | 5705 |
| 652 | Ga0207704_10265795 | 3300025938 | Bacteria | 1296 |
| 653 | Ga0207665_10000541 | 3300025939 | Bacteria | 25458 |
| 654 | Ga0207665_10007581 | 3300025939 | Bacteria | 7171 |
| 655 | Ga0207665_10017261 | 3300025939 | Bacteria | 4742 |
| 656 | Ga0207665_10055563 | 3300025939 | Bacteria | 2671 |
| 657 | Ga0207691_10004396 | 3300025940 | Bacteria | 13666 |
| 658 | Ga0207691_10009932 | 3300025940 | Bacteria | 9139 |
| 659 | Ga0207691_10041812 | 3300025940 | Bacteria | 4228 |
| 660 | Ga0207691_10314525 | 3300025940 | Bacteria | 1343 |
| 661 | Ga0207711_10002645 | 3300025941 | Bacteria | 15844 |
| 662 | Ga0207711_10005696 | 3300025941 | Bacteria | 10522 |
| 663 | Ga0207711_10035642 | 3300025941 | Bacteria | 4219 |
| 664 | Ga0207711_10145854 | 3300025941 | Bacteria | 2132 |
| 665 | Ga0207711_10170653 | 3300025941 | Bacteria | 1974 |
| 666 | Ga0207711_10232888 | 3300025941 | Bacteria | 1687 |
| 667 | Ga0207711_10362901 | 3300025941 | Bacteria | 1342 |
| 668 | Ga0207689_10002724 | 3300025942 | Bacteria | 16345 |
| 669 | Ga0207689_10004730 | 3300025942 | Bacteria | 12274 |
| 670 | Ga0207661_10015256 | 3300025944 | Bacteria | 5649 |
| 671 | Ga0207661_10054406 | 3300025944 | Bacteria | 3206 |
| 672 | Ga0207679_10001617 | 3300025945 | Bacteria | 14034 |
| 673 | Ga0207679_10053172 | 3300025945 | Bacteria | 2974 |
| 674 | Ga0207679_10141139 | 3300025945 | Bacteria | 1947 |
| 675 | Ga0207667_10071955 | 3300025949 | Bacteria | 3594 |
| 676 | Ga0207667_10321136 | 3300025949 | Bacteria | 1581 |
| 677 | Ga0207667_10497494 | 3300025949 | Bacteria | 1237 |
| 678 | Ga0207651_10003064 | 3300025960 | Bacteria | 8113 |
| 679 | Ga0207651_10004195 | 3300025960 | Bacteria | 7218 |
| 680 | Ga0207651_10016908 | 3300025960 | Bacteria | 4292 |
| 681 | Ga0207651_10045351 | 3300025960 | Bacteria | 2948 |
| 682 | Ga0207712_10003120 | 3300025961 | Bacteria | 10571 |
| 683 | Ga0207712_10102162 | 3300025961 | Bacteria | 2134 |
| 684 | Ga0207668_10005763 | 3300025972 | Bacteria | 7301 |
| 685 | Ga0207668_10124678 | 3300025972 | Bacteria | 1956 |
| 686 | Ga0207668_10182291 | 3300025972 | Bacteria | 1657 |
| 687 | Ga0207668_10195487 | 3300025972 | Bacteria | 1607 |
| 688 | Ga0207640_10015642 | 3300025981 | Bacteria | 4396 |
| 689 | Ga0207640_10021910 | 3300025981 | Bacteria | 3816 |
| 690 | Ga0207640_10146331 | 3300025981 | Bacteria | 1729 |
| 691 | Ga0207640_10183600 | 3300025981 | Bacteria | 1570 |
| 692 | Ga0207658_10014919 | 3300025986 | Bacteria | 5325 |
| 693 | Ga0207658_10035286 | 3300025986 | Bacteria | 3580 |
| 694 | Ga0207658_10082393 | 3300025986 | Bacteria | 2470 |
| 695 | Ga0207658_10103806 | 3300025986 | Bacteria | 2232 |
| 696 | Ga0207658_10264958 | 3300025986 | Bacteria | 1466 |
| 697 | Ga0207677_10006418 | 3300026023 | Bacteria | 6450 |
| 698 | Ga0207677_10016744 | 3300026023 | Bacteria | 4351 |
| 699 | Ga0207677_10028083 | 3300026023 | Bacteria | 3554 |
| 700 | Ga0207677_10064470 | 3300026023 | Bacteria | 2552 |
| 701 | Ga0207703_10001822 | 3300026035 | Bacteria | 19007 |
| 702 | Ga0207703_10021203 | 3300026035 | Bacteria | 5086 |
| 703 | Ga0207703_10041983 | 3300026035 | Bacteria | 3666 |
| 704 | Ga0207703_10126942 | 3300026035 | Bacteria | 2197 |
| 705 | Ga0207639_10019446 | 3300026041 | Bacteria | 4844 |
| 706 | Ga0207639_10023621 | 3300026041 | Bacteria | 4440 |
| 707 | Ga0207639_10058770 | 3300026041 | Bacteria | 2959 |
| 708 | Ga0207678_10000414 | 3300026067 | Bacteria | 38612 |
| 709 | Ga0207678_10002471 | 3300026067 | Bacteria | 16791 |
| 710 | Ga0207678_10019865 | 3300026067 | Bacteria | 5905 |
| 711 | Ga0207678_10020641 | 3300026067 | Bacteria | 5775 |
| 712 | Ga0207678_10035698 | 3300026067 | Bacteria | 4328 |
| 713 | Ga0207678_10041442 | 3300026067 | Bacteria | 3993 |
| 714 | Ga0207678_10092328 | 3300026067 | Bacteria | 2588 |
| 715 | Ga0207708_10001992 | 3300026075 | Bacteria | 15035 |
| 716 | Ga0207708_10002001 | 3300026075 | Bacteria | 15007 |
| 717 | Ga0207708_10006744 | 3300026075 | Bacteria | 8497 |
| 718 | Ga0207708_10038352 | 3300026075 | Bacteria | 3650 |
| 719 | Ga0207702_10021444 | 3300026078 | Bacteria | 5349 |
| 720 | Ga0207702_10039899 | 3300026078 | Bacteria | 3936 |
| 721 | Ga0207702_10041530 | 3300026078 | Bacteria | 3857 |
| 722 | Ga0207702_10067064 | 3300026078 | Bacteria | 3079 |
| 723 | Ga0207702_10294721 | 3300026078 | Bacteria | 1538 |
| 724 | Ga0207641_10009850 | 3300026088 | Bacteria | 7868 |
| 725 | Ga0207641_10015249 | 3300026088 | Bacteria | 6297 |
| 726 | Ga0207641_10019509 | 3300026088 | Bacteria | 5565 |
| 727 | Ga0207648_10004767 | 3300026089 | Bacteria | 13850 |
| 728 | Ga0207648_10010273 | 3300026089 | Bacteria | 8889 |
| 729 | Ga0207648_10174941 | 3300026089 | Bacteria | 1898 |
| 730 | Ga0207676_10001979 | 3300026095 | Bacteria | 14919 |
| 731 | Ga0207676_10002246 | 3300026095 | Bacteria | 13878 |
| 732 | Ga0207676_10013708 | 3300026095 | Bacteria | 5821 |
| 733 | Ga0207676_10050786 | 3300026095 | Bacteria | 3235 |
| 734 | Ga0207674_10007733 | 3300026116 | Bacteria | 12510 |
| 735 | Ga0207674_10416934 | 3300026116 | Bacteria | 1297 |
| 736 | Ga0207675_100003883 | 3300026118 | Bacteria | 14527 |
| 737 | Ga0207675_100007986 | 3300026118 | Bacteria | 9973 |
| 738 | Ga0207675_100057031 | 3300026118 | Bacteria | 3644 |
| 739 | Ga0207683_10002044 | 3300026121 | Bacteria | 17862 |
| 740 | Ga0207683_10009279 | 3300026121 | Bacteria | 8382 |
| 741 | Ga0207683_10016334 | 3300026121 | Bacteria | 6319 |
| 742 | Ga0207698_10031944 | 3300026142 | Bacteria | 3808 |
| 743 | Ga0207698_10186189 | 3300026142 | Bacteria | 1844 |
| 744 | Ga0209967_1003782 | 3300027364 | Bacteria | 1998 |
| 745 | Ga0209179_1029109 | 3300027512 | Bacteria | 1122 |
| 746 | Ga0209983_1007836 | 3300027665 | Bacteria | 2185 |
| 747 | Ga0209971_1002807 | 3300027682 | Bacteria | 4163 |
| 748 | Ga0209966_1001490 | 3300027695 | Bacteria | 4070 |
| 749 | Ga0209998_10000888 | 3300027717 | Bacteria | 7667 |
| 750 | Ga0209998_10001985 | 3300027717 | Bacteria | 4800 |
| 751 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 752 | Ga0207428_10000501 | 3300027907 | Bacteria | 46798 |
| 753 | Ga0207428_10001016 | 3300027907 | Bacteria | 31079 |
| 754 | Ga0207428_10006625 | 3300027907 | Bacteria | 10652 |
| 755 | Ga0207428_10143993 | 3300027907 | Bacteria | 1817 |
| 756 | Ga0207428_10165874 | 3300027907 | Bacteria | 1675 |
| 757 | Ga0265357_1000343 | 3300028023 | Bacteria | 2536 |
| 758 | Ga0268266_10000446 | 3300028379 | Bacteria | 61283 |
| 759 | Ga0268266_10000670 | 3300028379 | Bacteria | 46181 |
| 760 | Ga0268266_10001262 | 3300028379 | Bacteria | 30924 |
| 761 | Ga0268266_10012528 | 3300028379 | Bacteria | 7328 |
| 762 | Ga0268266_10029942 | 3300028379 | Bacteria | 4626 |
| 763 | Ga0268266_10050610 | 3300028379 | Bacteria | 3565 |
| 764 | Ga0268266_10157018 | 3300028379 | Bacteria | 2056 |
| 765 | Ga0268265_10014556 | 3300028380 | Bacteria | 5361 |
| 766 | Ga0268265_10022589 | 3300028380 | Bacteria | 4422 |
| 767 | Ga0268265_10055116 | 3300028380 | Bacteria | 3019 |
| 768 | Ga0268265_10072977 | 3300028380 | Bacteria | 2678 |
| 769 | Ga0268264_10041889 | 3300028381 | Bacteria | 3788 |
| 770 | Ga0268264_10112900 | 3300028381 | Bacteria | 2383 |
| 771 | Ga0265337_1004042 | 3300028556 | Bacteria | 6193 |
| 772 | Ga0265337_1026650 | 3300028556 | Bacteria | 1749 |
| 773 | Ga0265318_10007102 | 3300028577 | Bacteria | 5094 |
| 774 | Ga0307517_10000512 | 3300028786 | Bacteria | 66501 |
| 775 | Ga0307517_10130606 | 3300028786 | Bacteria | 1810 |
| 776 | Ga0265338_10065426 | 3300028800 | Bacteria | 3154 |
| 777 | Ga0265338_10263042 | 3300028800 | Bacteria | 1267 |
| 778 | Ga0265770_1006025 | 3300030878 | Bacteria | 1679 |
| 779 | Ga0265760_10022505 | 3300031090 | Bacteria | 1826 |
| 780 | Ga0265330_10015179 | 3300031235 | Bacteria | 3566 |
| 781 | Ga0265332_10000839 | 3300031238 | Bacteria | 18678 |
| 782 | Ga0265332_10067620 | 3300031238 | Bacteria | 1523 |
| 783 | Ga0265328_10017174 | 3300031239 | Bacteria | 2805 |
| 784 | Ga0265320_10006407 | 3300031240 | Bacteria | 7422 |
| 785 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 786 | Ga0265325_10001135 | 3300031241 | Bacteria | 19104 |
| 787 | Ga0265325_10011811 | 3300031241 | Bacteria | 5010 |
| 788 | Ga0265325_10030916 | 3300031241 | Bacteria | 2869 |
| 789 | Ga0265329_10008929 | 3300031242 | Bacteria | 3772 |
| 790 | Ga0265340_10000382 | 3300031247 | Bacteria | 23632 |
| 791 | Ga0265340_10020821 | 3300031247 | Bacteria | 3365 |
| 792 | Ga0265339_10001051 | 3300031249 | Bacteria | 20994 |
| 793 | Ga0265339_10003487 | 3300031249 | Bacteria | 10996 |
| 794 | Ga0265339_10043806 | 3300031249 | Bacteria | 2472 |
| 795 | Ga0265339_10068642 | 3300031249 | Bacteria | 1893 |
| 796 | Ga0265331_10015018 | 3300031250 | Bacteria | 4104 |
| 797 | Ga0265331_10034057 | 3300031250 | Bacteria | 2515 |
| 798 | Ga0265331_10038656 | 3300031250 | Bacteria | 2331 |
| 799 | Ga0265316_10105375 | 3300031344 | Bacteria | 2139 |
| 800 | Ga0265316_10123065 | 3300031344 | Bacteria | 1958 |
| 801 | Ga0265313_10000716 | 3300031595 | Bacteria | 34149 |
| 802 | Ga0265313_10038079 | 3300031595 | Bacteria | 2398 |
| 803 | Ga0265313_10046363 | 3300031595 | Bacteria | 2110 |
| 804 | Ga0265314_10002492 | 3300031711 | Bacteria | 18802 |
| 805 | Ga0265314_10044370 | 3300031711 | Bacteria | 3152 |
| 806 | Ga0265342_10000179 | 3300031712 | Bacteria | 70615 |
| 807 | Ga0265342_10000308 | 3300031712 | Bacteria | 55378 |
| 808 | Ga0265342_10007369 | 3300031712 | Bacteria | 8067 |
| 809 | Ga0265342_10011726 | 3300031712 | Bacteria | 5980 |
| 810 | Ga0265342_10030537 | 3300031712 | Bacteria | 3338 |
| 811 | Ga0307516_10078953 | 3300031730 | Bacteria | 3136 |
| 812 | Ga0307405_10283945 | 3300031731 | Bacteria | 1247 |
| 813 | Ga0307409_100037914 | 3300031995 | Bacteria | 3558 |
| 814 | Ga0307416_100224479 | 3300032002 | Bacteria | 1805 |
| 815 | Ga0307415_100082198 | 3300032126 | Bacteria | 2304 |
| 816 | Ga0307415_100327245 | 3300032126 | Bacteria | 1280 |
| 817 | Ga0307510_10009215 | 3300033180 | Bacteria | 11759 |
| 818 | Ga0307510_10009742 | 3300033180 | Bacteria | 11434 |
| 819 | Ga0373948_0002227 | 3300034817 | Bacteria | 2832 |
| 820 | Ga0373948_0015021 | 3300034817 | Bacteria | 1417 |
| 821 | Ga0373950_0000796 | 3300034818 | Bacteria | 3944 |
| 822 | Ga0373958_0000398 | 3300034819 | Bacteria | 5260 |
| 823 | Ga0373958_0009846 | 3300034819 | Bacteria | 1582 |
| 824 | Ga0373959_0009242 | 3300034820 | Bacteria | 1695 |
| 825 | Ga0373938_0000726 | 3300034957 | Bacteria | 5330 |
| 826 | Ga0373938_0002589 | 3300034957 | Bacteria | 2917 |
| 827 | Ga0373926_0002344 | 3300035083 | Bacteria | 5996 |
| 828 | Ga0373926_0009236 | 3300035083 | Bacteria | 3291 |
| 829 | Ga0373926_0050832 | 3300035083 | Bacteria | 1494 |
| 830 | Ga0373928_0000779 | 3300035084 | Bacteria | 6200 |
| 831 | Ga0373928_0001267 | 3300035084 | Bacteria | 4972 |
| 832 | Ga0373929_0000064 | 3300035085 | Bacteria | 18387 |
| 833 | Ga0373929_0020662 | 3300035085 | Bacteria | 1329 |
| 834 | Ga0373934_0007860 | 3300035086 | Bacteria | 3966 |
| 835 | Ga0373934_0020314 | 3300035086 | Bacteria | 2552 |
| 836 | Ga0373940_0000195 | 3300035088 | Bacteria | 8348 |
| 837 | Ga0373944_0000648 | 3300035089 | Bacteria | 8271 |
| 838 | Ga0373944_0001561 | 3300035089 | Bacteria | 5790 |
| 839 | Ga0373944_0013726 | 3300035089 | Bacteria | 2252 |
| 840 | Ga0373949_0000532 | 3300035090 | Bacteria | 12548 |
| 841 | Ga0373949_0001783 | 3300035090 | Bacteria | 5906 |
| 842 | Ga0373949_0005307 | 3300035090 | Bacteria | 2881 |
| 843 | Ga0373951_0000849 | 3300035091 | Bacteria | 8284 |
| 844 | Ga0373951_0009362 | 3300035091 | Bacteria | 2207 |
| 845 | Ga0373952_0000213 | 3300035092 | Bacteria | 9154 |
| 846 | Ga0373952_0004534 | 3300035092 | Bacteria | 2521 |
| 847 | Ga0373952_0009378 | 3300035092 | Bacteria | 1872 |
| 848 | Ga0373923_0000903 | 3300035111 | Bacteria | 7919 |
| 849 | Ga0373923_0001215 | 3300035111 | Bacteria | 7223 |
| 850 | Ga0373923_0004217 | 3300035111 | Bacteria | 4747 |
| 851 | Ga0373923_0031169 | 3300035111 | Bacteria | 2148 |
| 852 | Ga0373932_0002875 | 3300035112 | Bacteria | 4252 |
| 853 | Ga0373932_0003090 | 3300035112 | Bacteria | 4057 |
| 854 | Ga0373936_0001539 | 3300035113 | Bacteria | 8398 |
| 855 | Ga0373936_0003882 | 3300035113 | Bacteria | 5634 |
| 856 | Ga0373936_0010131 | 3300035113 | Bacteria | 3559 |
| 857 | Ga0373939_0000619 | 3300035114 | Bacteria | 8812 |
| 858 | Ga0373939_0007187 | 3300035114 | Bacteria | 2701 |
| 859 | Ga0373939_0022601 | 3300035114 | Bacteria | 1734 |
| 860 | Ga0373941_0000027 | 3300035115 | Bacteria | 22089 |
| 861 | Ga0373941_0001078 | 3300035115 | Bacteria | 5676 |
| 862 | Ga0373945_0000024 | 3300035116 | Bacteria | 30607 |
| 863 | Ga0373945_0007150 | 3300035116 | Bacteria | 3614 |
| 864 | Ga0373953_0002197 | 3300035117 | Bacteria | 5844 |
| 865 | Ga0373953_0003448 | 3300035117 | Bacteria | 4928 |
| 866 | Ga0373953_0012954 | 3300035117 | Bacteria | 2967 |
| 867 | Ga0373953_0054980 | 3300035117 | Bacteria | 1615 |
| 868 | Ga0373953_0072680 | 3300035117 | Bacteria | 1421 |
| 869 | Ga0373954_0004597 | 3300035118 | Bacteria | 5947 |
| 870 | Ga0373954_0004676 | 3300035118 | Bacteria | 5902 |
| 871 | Ga0373954_0005155 | 3300035118 | Bacteria | 5642 |
| 872 | Ga0373954_0021313 | 3300035118 | Bacteria | 2933 |
| 873 | Ga0373954_0031272 | 3300035118 | Bacteria | 2457 |
| 874 | Ga0373956_0001142 | 3300035119 | Bacteria | 10971 |
| 875 | Ga0373956_0012890 | 3300035119 | Bacteria | 3472 |
| 876 | Ga0373956_0020290 | 3300035119 | Bacteria | 2826 |
| 877 | Ga0373956_0048050 | 3300035119 | Bacteria | 1910 |
| 878 | Ga0373957_0004186 | 3300035120 | Bacteria | 4365 |
| 879 | Ga0373957_0066681 | 3300035120 | Bacteria | 1402 |
| 880 | Ga0373960_0000904 | 3300035121 | Bacteria | 6305 |
| 881 | Ga0373960_0002618 | 3300035121 | Bacteria | 4069 |
| 882 | Ga0373943_0013643 | 3300035170 | Bacteria | 3673 |
| 883 | Ga0373943_0034830 | 3300035170 | Bacteria | 2403 |
| 884 | Ga0373943_0042435 | 3300035170 | Bacteria | 2205 |
| 885 | Ga0373943_0058552 | 3300035170 | Bacteria | 1918 |
| 886 | Ga0373943_0087942 | 3300035170 | Bacteria | 1604 |
| 887 | Ga0373943_0111838 | 3300035170 | Bacteria | 1441 |
| 888 | Ga0373946_0005953 | 3300035171 | Bacteria | 4419 |
| 889 | Ga0373946_0014935 | 3300035171 | Bacteria | 2936 |
| 890 | Ga0373946_0015890 | 3300035171 | Bacteria | 2861 |
| 891 | Ga0373946_0030578 | 3300035171 | Bacteria | 2150 |
| 892 | Ga0373946_0044776 | 3300035171 | Bacteria | 1828 |
| 893 | Ga0373946_0051134 | 3300035171 | Bacteria | 1728 |
| 894 | Ga0373955_0000172 | 3300035172 | Bacteria | 26530 |
| 895 | Ga0373955_0001767 | 3300035172 | Bacteria | 9270 |
| 896 | Ga0373955_0003013 | 3300035172 | Bacteria | 7382 |
| 897 | Ga0373955_0010601 | 3300035172 | Bacteria | 4359 |
| 898 | Ga0373955_0023058 | 3300035172 | Bacteria | 3166 |
| 899 | Ga0373955_0174344 | 3300035172 | Bacteria | 1274 |
| 900 | Ga0373942_0000012 | 3300035207 | Bacteria | 34288 |
| 901 | Ga0373942_0002310 | 3300035207 | Bacteria | 4661 |
| 902 | Ga0373961_0000800 | 3300035241 | Bacteria | 10745 |
| 903 | Ga0373961_0003565 | 3300035241 | Bacteria | 3831 |
| 904 | Ga0373961_0006335 | 3300035241 | Bacteria | 2845 |
| 905 | Ga0373961_0022769 | 3300035241 | Bacteria | 1679 |
| 906 | Ga0373962_0000193 | 3300035242 | Bacteria | 12928 |
| 907 | Ga0373962_0003472 | 3300035242 | Bacteria | 3785 |
| 908 | Ga0373962_0011022 | 3300035242 | Bacteria | 2261 |
| 909 | Ga0316574_0151975 | 3300035398 | Bacteria | 1492 |
| 910 | Ga0373924_0001803 | 3300035410 | Bacteria | 7079 |
| 911 | Ga0373924_0006937 | 3300035410 | Bacteria | 4077 |
| 912 | Ga0373924_0045414 | 3300035410 | Bacteria | 1807 |
| 913 | Ga0373931_0007554 | 3300035691 | Bacteria | 5120 |
| 914 | Ga0373931_0008043 | 3300035691 | Bacteria | 4989 |
| 915 | Ga0373931_0015883 | 3300035691 | Bacteria | 3697 |
| 916 | Ga0373931_0035730 | 3300035691 | Bacteria | 2585 |
| 917 | Ga0373931_0041914 | 3300035691 | Bacteria | 2406 |
| 918 | Ga0373931_0066399 | 3300035691 | Bacteria | 1957 |
| 919 | Ga0373931_0078912 | 3300035691 | Bacteria | 1812 |
| 920 | Ga0373931_0096327 | 3300035691 | Bacteria | 1657 |
| 921 | Ga0373931_0150578 | 3300035691 | Bacteria | 1356 |
| 922 | Ga0373935_0000038 | 3300035692 | Bacteria | 51446 |
| 923 | Ga0373935_0008124 | 3300035692 | Bacteria | 6291 |
| 924 | Ga0373935_0008653 | 3300035692 | Bacteria | 6095 |
| 925 | Ga0373935_0031453 | 3300035692 | Bacteria | 3294 |
| 926 | Ga0373935_0044826 | 3300035692 | Bacteria | 2789 |
| 927 | Ga0373935_0110469 | 3300035692 | Bacteria | 1824 |
| 928 | Ga0373935_0165642 | 3300035692 | Bacteria | 1509 |
| 929 | Ga0373927_0001618 | 3300035695 | Bacteria | 16878 |
| 930 | Ga0373927_0003867 | 3300035695 | Bacteria | 10616 |
| 931 | Ga0373927_0004343 | 3300035695 | Bacteria | 9943 |
| 932 | Ga0373927_0017582 | 3300035695 | Bacteria | 4705 |
| 933 | Ga0373927_0059755 | 3300035695 | Bacteria | 2466 |
| 934 | Ga0373927_0098966 | 3300035695 | Bacteria | 1896 |
| 935 | Ga0373927_0102646 | 3300035695 | Bacteria | 1860 |
| 936 | Ga0373927_0119317 | 3300035695 | Bacteria | 1721 |
| 937 | Ga0373927_0155327 | 3300035695 | Bacteria | 1498 |
| 938 | Ga0373927_0246921 | 3300035695 | Bacteria | 1173 |
| 939 | Ga0373933_0001050 | 3300035724 | Bacteria | 16724 |
| 940 | Ga0373933_0009485 | 3300035724 | Bacteria | 5315 |
| 941 | Ga0373933_0019818 | 3300035724 | Bacteria | 3806 |
| 942 | Ga0373933_0043041 | 3300035724 | Bacteria | 2670 |
| 943 | Ga0373933_0070438 | 3300035724 | Bacteria | 2127 |
| 944 | Ga0373947_0000229 | 3300035725 | Bacteria | 31423 |
| 945 | Ga0373947_0000581 | 3300035725 | Bacteria | 21444 |
| 946 | Ga0373947_0001717 | 3300035725 | Bacteria | 13399 |
| 947 | Ga0373947_0012283 | 3300035725 | Bacteria | 4906 |
| 948 | Ga0373947_0014863 | 3300035725 | Bacteria | 4467 |
| 949 | Ga0373947_0037899 | 3300035725 | Bacteria | 2861 |
| 950 | Ga0373947_0042744 | 3300035725 | Bacteria | 2705 |
| 951 | Ga0373947_0137024 | 3300035725 | Bacteria | 1567 |
| 952 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 953 | Ga0373937_0001194 | 3300036401 | Bacteria | 21805 |
| 954 | Ga0373937_0004490 | 3300036401 | Bacteria | 11855 |
| 955 | Ga0373937_0013915 | 3300036401 | Bacteria | 7093 |
| 956 | Ga0373937_0051666 | 3300036401 | Bacteria | 3767 |
| 957 | Ga0373937_0173638 | 3300036401 | Bacteria | 2022 |
| 958 | Ga0373925_0000424 | 3300037068 | Bacteria | 42803 |
| 959 | Ga0373925_0006642 | 3300037068 | Bacteria | 8493 |
| 960 | Ga0373925_0011259 | 3300037068 | Bacteria | 6488 |
| 961 | Ga0373925_0011691 | 3300037068 | Bacteria | 6348 |
| 962 | Ga0373925_0029290 | 3300037068 | Bacteria | 4039 |
| 963 | Ga0373925_0042290 | 3300037068 | Bacteria | 3380 |
| 964 | Ga0373925_0094879 | 3300037068 | Bacteria | 2284 |
| 965 | Ga0373925_0126885 | 3300037068 | Bacteria | 1986 |
| 966 | Ga0373925_0162556 | 3300037068 | Bacteria | 1759 |
| 967 | Ga0373925_0172627 | 3300037068 | Bacteria | 1707 |
| 968 | Ga0373925_0317423 | 3300037068 | Bacteria | 1260 |
| 969 | Ga0395898_0062352 | 3300037466 | Bacteria | 3621 |
| 970 | Ga0395898_0166629 | 3300037466 | Bacteria | 2107 |
| 971 | Ga0395898_0167403 | 3300037466 | Bacteria | 2101 |
| 972 | Ga0395905_0070001 | 3300037471 | Bacteria | 3287 |
| 973 | Ga0436364_0345988 | 3300037853 | Bacteria | 7115 |
| 974 | Ga0436364_0423755 | 3300037853 | Bacteria | 87339 |
| 975 | Ga0436364_1276955 | 3300037853 | Bacteria | 2218 |
| 976 | Ga0436364_1535918 | 3300037853 | Bacteria | 3968 |
| 977 | Ga0395901_0246201 | 3300038443 | Bacteria | 1863 |
| 978 | Ga0395901_0477365 | 3300038443 | Bacteria | 1272 |
| 979 | Ga0395901_0488820 | 3300038443 | Bacteria | 1254 |
| 980 | Ga0436365_0076921 | 3300039437 | Bacteria | 40502 |
| 981 | Ga0436365_0412636 | 3300039437 | Bacteria | 56608 |
| 982 | Ga0436365_0444168 | 3300039437 | Bacteria | 22362 |
| 983 | Ga0436365_0579618 | 3300039437 | Bacteria | 2875 |
| 984 | Ga0436365_0842200 | 3300039437 | Bacteria | 6262 |
| 985 | Ga0436365_1149508 | 3300039437 | Bacteria | 1345 |
| 986 | Ga0436365_1209982 | 3300039437 | Bacteria | 1327 |
| 987 | Ga0436365_1517019 | 3300039437 | Bacteria | 1289 |
| 988 | Ga0436365_1582991 | 3300039437 | Bacteria | 3489 |
| 989 | Ga0436365_1807266 | 3300039437 | Bacteria | 2762 |
| 990 | Ga0436361_0601490 | 3300039447 | Bacteria | 1978 |
| 991 | Ga0436361_1055020 | 3300039447 | Bacteria | 6935 |
| 992 | Ga0436361_1192122 | 3300039447 | Bacteria | 3932 |
| 993 | Ga0436363_0271626 | 3300039450 | Bacteria | 2497 |
| 994 | Ga0436363_0548238 | 3300039450 | Bacteria | 7729 |
| 995 | Ga0436363_1101874 | 3300039450 | Bacteria | 38864 |
| 996 | Ga0436363_1268862 | 3300039450 | Bacteria | 1888 |
| 997 | Ga0436363_1691760 | 3300039450 | Bacteria | 1300 |
| 998 | Ga0439448_0026459 | 3300042005 | Bacteria | 1824 |
| 999 | Ga0439455_0013241 | 3300042012 | Bacteria | 1865 |
| 1000 | Ga0466961_0061021 | 3300044693 | Bacteria | 2397 |
| 1001 | Ga0466961_0130400 | 3300044693 | Bacteria | 1576 |
| 1002 | Ga0466963_0153274 | 3300044694 | Bacteria | 1601 |
| 1003 | Ga0466957_0047540 | 3300044842 | Bacteria | 2607 |
| 1004 | Ga0451576_0020422 | 3300045051 | Bacteria | 7215 |
| 1005 | Ga0466967_0004180 | 3300045976 | Bacteria | 9663 |
| 1006 | Ga0466967_0050355 | 3300045976 | Bacteria | 3647 |
| 1007 | Ga0495617_017934 | 3300046452 | Bacteria | 2393 |
| 1008 | Ga0495592_0000032 | 3300046454 | Bacteria | 128274 |
| 1009 | Ga0495592_0009020 | 3300046454 | Bacteria | 7494 |
| 1010 | Ga0495592_0016478 | 3300046454 | Bacteria | 5607 |
| 1011 | Ga0495592_0016847 | 3300046454 | Bacteria | 5549 |
| 1012 | Ga0495603_0005155 | 3300046455 | Bacteria | 7806 |
| 1013 | Ga0495603_0013983 | 3300046455 | Bacteria | 4854 |
| 1014 | Ga0495603_0037151 | 3300046455 | Bacteria | 2922 |
| 1015 | Ga0495603_0061058 | 3300046455 | Bacteria | 2226 |
| 1016 | Ga0495603_0095239 | 3300046455 | Bacteria | 1739 |
| 1017 | Ga0495590_0040082 | 3300046457 | Bacteria | 1634 |
| 1018 | Ga0495629_0001232 | 3300046459 | Bacteria | 20103 |
| 1019 | Ga0495629_0001465 | 3300046459 | Bacteria | 18592 |
| 1020 | Ga0495629_0002050 | 3300046459 | Bacteria | 15663 |
| 1021 | Ga0495638_0008231 | 3300046460 | Bacteria | 7410 |
| 1022 | Ga0495638_0077106 | 3300046460 | Bacteria | 2030 |
| 1023 | Ga0495641_0006019 | 3300046461 | Bacteria | 7983 |
| 1024 | Ga0495641_0014796 | 3300046461 | Bacteria | 4204 |
| 1025 | Ga0495641_0026036 | 3300046461 | Bacteria | 2861 |
| 1026 | Ga0495641_0060393 | 3300046461 | Bacteria | 1713 |
| 1027 | Ga0495641_0075574 | 3300046461 | Bacteria | 1510 |
| 1028 | Ga0495651_0000799 | 3300046462 | Bacteria | 24378 |
| 1029 | Ga0495651_0001360 | 3300046462 | Bacteria | 18929 |
| 1030 | Ga0495651_0007731 | 3300046462 | Bacteria | 8226 |
| 1031 | Ga0495651_0013259 | 3300046462 | Bacteria | 6374 |
| 1032 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 1033 | Ga0495653_0001069 | 3300046463 | Bacteria | 21100 |
| 1034 | Ga0495653_0003134 | 3300046463 | Bacteria | 13253 |
| 1035 | Ga0495653_0018668 | 3300046463 | Bacteria | 5630 |
| 1036 | Ga0495580_0005009 | 3300046472 | Bacteria | 11048 |
| 1037 | Ga0495580_0017623 | 3300046472 | Bacteria | 5335 |
| 1038 | Ga0495580_0058785 | 3300046472 | Bacteria | 2703 |
| 1039 | Ga0495580_0302495 | 3300046472 | Bacteria | 1089 |
| 1040 | Ga0495582_0000570 | 3300046473 | Bacteria | 20403 |
| 1041 | Ga0495582_0004754 | 3300046473 | Bacteria | 7634 |
| 1042 | Ga0495582_0028921 | 3300046473 | Bacteria | 3043 |
| 1043 | Ga0495582_0034833 | 3300046473 | Bacteria | 2768 |
| 1044 | Ga0495582_0044708 | 3300046473 | Bacteria | 2439 |
| 1045 | Ga0495582_0102076 | 3300046473 | Bacteria | 1606 |
| 1046 | Ga0495639_0002103 | 3300046475 | Bacteria | 8793 |
| 1047 | Ga0495639_0014886 | 3300046475 | Bacteria | 3371 |
| 1048 | Ga0495639_0027206 | 3300046475 | Bacteria | 2530 |
| 1049 | Ga0495639_0050994 | 3300046475 | Bacteria | 1881 |
| 1050 | Ga0495639_0077878 | 3300046475 | Bacteria | 1540 |
| 1051 | Ga0495662_0000879 | 3300046476 | Bacteria | 14679 |
| 1052 | Ga0495662_0001012 | 3300046476 | Bacteria | 13797 |
| 1053 | Ga0495662_0002431 | 3300046476 | Bacteria | 9362 |
| 1054 | Ga0495662_0016111 | 3300046476 | Bacteria | 3625 |
| 1055 | Ga0495662_0025150 | 3300046476 | Bacteria | 2874 |
| 1056 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 1057 | Ga0495664_0000146 | 3300046477 | Bacteria | 35506 |
| 1058 | Ga0495664_0000563 | 3300046477 | Bacteria | 18692 |
| 1059 | Ga0495664_0126142 | 3300046477 | Bacteria | 1548 |
| 1060 | Ga0495584_0010718 | 3300046491 | Bacteria | 4708 |
| 1061 | Ga0495585_0002912 | 3300046492 | Bacteria | 11854 |
| 1062 | Ga0495585_0174701 | 3300046492 | Bacteria | 1107 |
| 1063 | Ga0495594_0026229 | 3300046499 | Bacteria | 3134 |
| 1064 | Ga0495594_0056365 | 3300046499 | Bacteria | 2168 |
| 1065 | Ga0495594_0101385 | 3300046499 | Bacteria | 1619 |
| 1066 | Ga0495607_0042874 | 3300046501 | Bacteria | 2679 |
| 1067 | Ga0495583_0087074 | 3300046506 | Bacteria | 1350 |
| 1068 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 1069 | Ga0495608_0002512 | 3300046511 | Bacteria | 13163 |
| 1070 | Ga0495608_0003432 | 3300046511 | Bacteria | 11348 |
| 1071 | Ga0495608_0015292 | 3300046511 | Bacteria | 5324 |
| 1072 | Ga0495608_0095690 | 3300046511 | Bacteria | 1918 |
| 1073 | Ga0495608_0099976 | 3300046511 | Bacteria | 1870 |
| 1074 | Ga0495608_0234590 | 3300046511 | Bacteria | 1148 |
| 1075 | Ga0495616_0067680 | 3300046513 | Bacteria | 1735 |
| 1076 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 1077 | Ga0495618_0000473 | 3300046514 | Bacteria | 28654 |
| 1078 | Ga0495618_0035358 | 3300046514 | Bacteria | 3135 |
| 1079 | Ga0495618_0091228 | 3300046514 | Bacteria | 1947 |
| 1080 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 1081 | Ga0495628_0004103 | 3300046516 | Bacteria | 12959 |
| 1082 | Ga0495628_0005499 | 3300046516 | Bacteria | 11090 |
| 1083 | Ga0495628_0011495 | 3300046516 | Bacteria | 7483 |
| 1084 | Ga0495630_0000422 | 3300046517 | Bacteria | 32636 |
| 1085 | Ga0495630_0007807 | 3300046517 | Bacteria | 7660 |
| 1086 | Ga0495630_0068325 | 3300046517 | Bacteria | 2672 |
| 1087 | Ga0495630_0139263 | 3300046517 | Bacteria | 1845 |
| 1088 | Ga0495630_0157466 | 3300046517 | Bacteria | 1729 |
| 1089 | Ga0495631_0113702 | 3300046518 | Bacteria | 1164 |
| 1090 | Ga0495637_0063129 | 3300046520 | Bacteria | 1514 |
| 1091 | Ga0495643_0052199 | 3300046522 | Bacteria | 2196 |
| 1092 | Ga0495644_0024172 | 3300046523 | Bacteria | 2311 |
| 1093 | Ga0495644_0043960 | 3300046523 | Bacteria | 1680 |
| 1094 | Ga0495648_0075844 | 3300046524 | Bacteria | 1932 |
| 1095 | Ga0495666_0010597 | 3300046526 | Bacteria | 4595 |
| 1096 | Ga0495666_0014995 | 3300046526 | Bacteria | 3857 |
| 1097 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 1098 | Ga0495652_0003864 | 3300046529 | Bacteria | 14606 |
| 1099 | Ga0495652_0047192 | 3300046529 | Bacteria | 3694 |
| 1100 | Ga0495652_0070621 | 3300046529 | Bacteria | 2918 |
| 1101 | Ga0495652_0330327 | 3300046529 | Bacteria | 1099 |
| 1102 | Ga0495665_0000227 | 3300046531 | Bacteria | 28192 |
| 1103 | Ga0495665_0084309 | 3300046531 | Bacteria | 1670 |
| 1104 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 1105 | Ga0495640_0001488 | 3300046533 | Bacteria | 18447 |
| 1106 | Ga0495640_0002833 | 3300046533 | Bacteria | 13941 |
| 1107 | Ga0495640_0024233 | 3300046533 | Bacteria | 4415 |
| 1108 | Ga0495640_0034413 | 3300046533 | Bacteria | 3592 |
| 1109 | Ga0495640_0059161 | 3300046533 | Bacteria | 2611 |
| 1110 | Ga0495640_0075095 | 3300046533 | Bacteria | 2258 |
| 1111 | Ga0495586_0012979 | 3300046535 | Bacteria | 4415 |
| 1112 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 1113 | Ga0495587_0003639 | 3300046536 | Bacteria | 10260 |
| 1114 | Ga0495587_0008368 | 3300046536 | Bacteria | 6655 |
| 1115 | Ga0495587_0012855 | 3300046536 | Bacteria | 5264 |
| 1116 | Ga0495598_0041403 | 3300046537 | Bacteria | 1347 |
| 1117 | Ga0495609_0065627 | 3300046538 | Bacteria | 1600 |
| 1118 | Ga0495609_0081439 | 3300046538 | Bacteria | 1415 |
| 1119 | Ga0495609_0100173 | 3300046538 | Bacteria | 1256 |
| 1120 | Ga0495621_0055834 | 3300046539 | Bacteria | 1422 |
| 1121 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 1122 | Ga0495645_0009348 | 3300046543 | Bacteria | 6854 |
| 1123 | Ga0495645_0023181 | 3300046543 | Bacteria | 4495 |
| 1124 | Ga0495645_0097739 | 3300046543 | Bacteria | 2090 |
| 1125 | Ga0495622_0000406 | 3300046557 | Bacteria | 28954 |
| 1126 | Ga0495633_0005373 | 3300046558 | Bacteria | 7855 |
| 1127 | Ga0495667_0000124 | 3300046559 | Bacteria | 55660 |
| 1128 | Ga0495667_0001092 | 3300046559 | Bacteria | 17609 |
| 1129 | Ga0495667_0011961 | 3300046559 | Bacteria | 5881 |
| 1130 | Ga0495667_0034171 | 3300046559 | Bacteria | 3399 |
| 1131 | Ga0495667_0037745 | 3300046559 | Bacteria | 3219 |
| 1132 | Ga0495667_0067913 | 3300046559 | Bacteria | 2329 |
| 1133 | Ga0495667_0082616 | 3300046559 | Bacteria | 2087 |
| 1134 | Ga0495667_0090432 | 3300046559 | Bacteria | 1983 |
| 1135 | Ga0495667_0090541 | 3300046559 | Bacteria | 1982 |
| 1136 | Ga0495656_0000554 | 3300046615 | Bacteria | 12229 |
| 1137 | Ga0495668_0077490 | 3300046616 | Bacteria | 1825 |
| 1138 | Ga0495668_0149001 | 3300046616 | Bacteria | 1281 |
| 1139 | Ga0495668_0157654 | 3300046616 | Bacteria | 1243 |
| 1140 | Ga0495634_0000003 | 3300046642 | Bacteria | 206222 |
| 1141 | Ga0495634_0004424 | 3300046642 | Bacteria | 11039 |
| 1142 | Ga0495634_0046635 | 3300046642 | Bacteria | 2924 |
| 1143 | Ga0495634_0109540 | 3300046642 | Bacteria | 1777 |
| 1144 | Ga0495634_0117121 | 3300046642 | Bacteria | 1708 |
| 1145 | Ga0495611_0034086 | 3300046648 | Bacteria | 2249 |
| 1146 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 1147 | Ga0495635_0002104 | 3300046663 | Bacteria | 13505 |
| 1148 | Ga0495635_0016723 | 3300046663 | Bacteria | 5125 |
| 1149 | Ga0495635_0022896 | 3300046663 | Bacteria | 4354 |
| 1150 | Ga0495635_0024301 | 3300046663 | Bacteria | 4224 |
| 1151 | Ga0495635_0031658 | 3300046663 | Bacteria | 3670 |
| 1152 | Ga0495635_0040864 | 3300046663 | Bacteria | 3204 |
| 1153 | Ga0495635_0128331 | 3300046663 | Bacteria | 1729 |
| 1154 | Ga0495635_0261668 | 3300046663 | Bacteria | 1165 |
| 1155 | Ga0495659_0016170 | 3300046664 | Bacteria | 2459 |
| 1156 | Ga0495659_0023703 | 3300046664 | Bacteria | 2087 |
| 1157 | Ga0495659_0035644 | 3300046664 | Bacteria | 1754 |
| 1158 | Ga0495588_0004978 | 3300046674 | Bacteria | 5900 |
| 1159 | Ga0495588_0127124 | 3300046674 | Bacteria | 1344 |
| 1160 | Ga0495657_0000054 | 3300046675 | Bacteria | 99620 |
| 1161 | Ga0495657_0008729 | 3300046675 | Bacteria | 7737 |
| 1162 | Ga0495657_0096183 | 3300046675 | Bacteria | 1892 |
| 1163 | Ga0495657_0158481 | 3300046675 | Bacteria | 1401 |
| 1164 | Ga0495599_0000005 | 3300046678 | Bacteria | 300169 |
| 1165 | Ga0495599_0020724 | 3300046678 | Bacteria | 4097 |
| 1166 | Ga0495599_0022366 | 3300046678 | Bacteria | 3946 |
| 1167 | Ga0495599_0035696 | 3300046678 | Bacteria | 3121 |
| 1168 | Ga0495599_0076139 | 3300046678 | Bacteria | 2095 |
| 1169 | Ga0495623_0000148 | 3300046679 | Bacteria | 43192 |
| 1170 | Ga0495623_0002021 | 3300046679 | Bacteria | 13614 |
| 1171 | Ga0495623_0027550 | 3300046679 | Bacteria | 3656 |
| 1172 | Ga0495623_0097234 | 3300046679 | Bacteria | 1798 |
| 1173 | Ga0495646_0000002 | 3300046680 | Bacteria | 310568 |
| 1174 | Ga0495646_0016750 | 3300046680 | Bacteria | 4653 |
| 1175 | Ga0495646_0035451 | 3300046680 | Bacteria | 3095 |
| 1176 | Ga0495646_0112055 | 3300046680 | Bacteria | 1552 |
| 1177 | Ga0495646_0155292 | 3300046680 | Bacteria | 1270 |
| 1178 | Ga0495647_0009539 | 3300046681 | Bacteria | 3290 |
| 1179 | Ga0495658_0000543 | 3300046683 | Bacteria | 20578 |
| 1180 | Ga0495658_0002466 | 3300046683 | Bacteria | 9317 |
| 1181 | Ga0495658_0034649 | 3300046683 | Bacteria | 2771 |
| 1182 | Ga0495658_0050889 | 3300046683 | Bacteria | 2345 |
| 1183 | Ga0495658_0135987 | 3300046683 | Bacteria | 1499 |
| 1184 | Ga0495613_0002489 | 3300046689 | Bacteria | 13900 |
| 1185 | Ga0495613_0168083 | 3300046689 | Bacteria | 1557 |
| 1186 | Ga0495613_0188279 | 3300046689 | Bacteria | 1459 |
| 1187 | Ga0495624_0001896 | 3300046690 | Bacteria | 15925 |
| 1188 | Ga0495624_0013382 | 3300046690 | Bacteria | 5595 |
| 1189 | Ga0495624_0027306 | 3300046690 | Bacteria | 3737 |
| 1190 | Ga0495624_0129200 | 3300046690 | Bacteria | 1550 |
| 1191 | Ga0495624_0168611 | 3300046690 | Bacteria | 1336 |
| 1192 | Ga0495670_0009745 | 3300046691 | Bacteria | 4721 |
| 1193 | Ga0495600_0000012 | 3300046809 | Bacteria | 119798 |
| 1194 | Ga0495600_0004562 | 3300046809 | Bacteria | 8305 |
| 1195 | Ga0495600_0006388 | 3300046809 | Bacteria | 7175 |
| 1196 | Ga0495600_0016042 | 3300046809 | Bacteria | 4749 |
| 1197 | Ga0495660_0114681 | 3300046810 | Bacteria | 1371 |
| 1198 | Ga0495660_0145528 | 3300046810 | Bacteria | 1175 |
| 1199 | Ga0495581_0003432 | 3300047315 | Bacteria | 9101 |
| 1200 | Ga0495581_0027818 | 3300047315 | Bacteria | 3279 |
| 1201 | Ga0495581_0058614 | 3300047315 | Bacteria | 2224 |
| 1202 | Ga0495581_0070554 | 3300047315 | Bacteria | 2021 |
| 1203 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 1204 | Ga0495604_0000422 | 3300047317 | Bacteria | 38179 |
| 1205 | Ga0495604_0013474 | 3300047317 | Bacteria | 6513 |
| 1206 | Ga0495604_0015408 | 3300047317 | Bacteria | 6101 |
| 1207 | Ga0495604_0057176 | 3300047317 | Bacteria | 2999 |
| 1208 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 1209 | Ga0495674_0000641 | 3300047319 | Bacteria | 32747 |
| 1210 | Ga0495674_0001683 | 3300047319 | Bacteria | 21746 |
| 1211 | Ga0495674_0026343 | 3300047319 | Bacteria | 5320 |
| 1212 | Ga0495674_0175444 | 3300047319 | Bacteria | 1786 |
| 1213 | Ga0495672_0030618 | 3300047320 | Bacteria | 3373 |
| 1214 | Ga0495676_0013899 | 3300047321 | Bacteria | 7217 |
| 1215 | Ga0495676_0014569 | 3300047321 | Bacteria | 7034 |
| 1216 | Ga0495676_0080098 | 3300047321 | Bacteria | 2481 |
| 1217 | Ga0495676_0115141 | 3300047321 | Bacteria | 1966 |
| 1218 | Ga0495676_0151994 | 3300047321 | Bacteria | 1646 |
| 1219 | Ga0495676_0265329 | 3300047321 | Bacteria | 1167 |
| 1220 | Ga0495680_0001385 | 3300047322 | Bacteria | 26203 |
| 1221 | Ga0495680_0002139 | 3300047322 | Bacteria | 20514 |
| 1222 | Ga0495680_0012328 | 3300047322 | Bacteria | 7529 |
| 1223 | Ga0495680_0031291 | 3300047322 | Bacteria | 4333 |
| 1224 | Ga0495680_0033026 | 3300047322 | Bacteria | 4194 |
| 1225 | Ga0495680_0059613 | 3300047322 | Bacteria | 2946 |
| 1226 | Ga0495680_0121345 | 3300047322 | Bacteria | 1929 |
| 1227 | Ga0495680_0133161 | 3300047322 | Bacteria | 1824 |
| 1228 | Ga0495680_0256882 | 3300047322 | Bacteria | 1237 |
| 1229 | Ga0495675_0000028 | 3300047444 | Bacteria | 105848 |
| 1230 | Ga0495675_0001398 | 3300047444 | Bacteria | 14624 |
| 1231 | Ga0495675_0002936 | 3300047444 | Bacteria | 10246 |
| 1232 | Ga0495675_0020224 | 3300047444 | Bacteria | 4232 |
| 1233 | Ga0495675_0173041 | 3300047444 | Bacteria | 1325 |
| 1234 | Ga0495685_021999 | 3300047447 | Bacteria | 2194 |
| 1235 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 1236 | Ga0495684_0003544 | 3300047471 | Bacteria | 12202 |
| 1237 | Ga0495684_0096843 | 3300047471 | Bacteria | 2233 |
| 1238 | Ga0495684_0173043 | 3300047471 | Bacteria | 1604 |
| 1239 | Ga0495684_0186828 | 3300047471 | Bacteria | 1534 |
| 1240 | Ga0495684_0246095 | 3300047471 | Bacteria | 1302 |
| 1241 | Ga0495593_0000140 | 3300047673 | Bacteria | 35205 |
| 1242 | Ga0495593_0003620 | 3300047673 | Bacteria | 9229 |
| 1243 | Ga0495593_0017662 | 3300047673 | Bacteria | 4016 |
| 1244 | Ga0495593_0019980 | 3300047673 | Bacteria | 3751 |
| 1245 | Ga0495593_0029930 | 3300047673 | Bacteria | 2982 |
| 1246 | Ga0495593_0058615 | 3300047673 | Bacteria | 2019 |
| 1247 | Ga0495593_0141588 | 3300047673 | Bacteria | 1218 |
| 1248 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 1249 | Ga0495602_0012613 | 3300048088 | Bacteria | 8673 |
| 1250 | Ga0495602_0013847 | 3300048088 | Bacteria | 8223 |
| 1251 | Ga0495602_0023728 | 3300048088 | Bacteria | 5969 |
| 1252 | Ga0495602_0028153 | 3300048088 | Bacteria | 5383 |
| 1253 | Ga0495602_0192161 | 3300048088 | Bacteria | 1564 |
| 1254 | Ga0495602_0224592 | 3300048088 | Bacteria | 1415 |
| 1255 | Ga0495602_0229125 | 3300048088 | Bacteria | 1397 |
| 1256 | Ga0495602_0318915 | 3300048088 | Bacteria | 1131 |
| 1257 | Ga0495614_0018609 | 3300048089 | Bacteria | 3009 |
| 1258 | Ga0495614_0050054 | 3300048089 | Bacteria | 1791 |
| 1259 | Ga0496100_0003363 | 3300048903 | Bacteria | 8326 |
| 1260 | Ga0496100_0010707 | 3300048903 | Bacteria | 5202 |
| 1261 | Ga0496100_0022979 | 3300048903 | Bacteria | 3780 |
| 1262 | Ga0496100_0126935 | 3300048903 | Bacteria | 1791 |
| 1263 | Ga0496101_0001983 | 3300048904 | Bacteria | 12419 |
| 1264 | Ga0496101_0004451 | 3300048904 | Bacteria | 8825 |
| 1265 | Ga0496101_0029082 | 3300048904 | Bacteria | 3863 |
| 1266 | Ga0496101_0038116 | 3300048904 | Bacteria | 3412 |
| 1267 | Ga0496101_0110681 | 3300048904 | Bacteria | 2067 |
| 1268 | Ga0496101_0162285 | 3300048904 | Bacteria | 1714 |
| 1269 | Ga0496101_0179948 | 3300048904 | Bacteria | 1628 |
| 1270 | Ga0496101_0228615 | 3300048904 | Bacteria | 1445 |
| 1271 | Ga0496102_0002793 | 3300048905 | Bacteria | 14888 |
| 1272 | Ga0496102_0006263 | 3300048905 | Bacteria | 10146 |
| 1273 | Ga0496102_0018288 | 3300048905 | Bacteria | 6157 |
| 1274 | Ga0496102_0031173 | 3300048905 | Bacteria | 4780 |
| 1275 | Ga0496102_0115925 | 3300048905 | Bacteria | 2499 |
| 1276 | Ga0496102_0120566 | 3300048905 | Bacteria | 2449 |
| 1277 | Ga0496102_0136784 | 3300048905 | Bacteria | 2296 |
| 1278 | Ga0496102_0158177 | 3300048905 | Bacteria | 2131 |
| 1279 | Ga0496102_0211868 | 3300048905 | Bacteria | 1826 |
| 1280 | Ga0496103_0002369 | 3300048906 | Bacteria | 11883 |
| 1281 | Ga0496103_0018805 | 3300048906 | Bacteria | 4147 |
| 1282 | Ga0496103_0025729 | 3300048906 | Bacteria | 3559 |
| 1283 | Ga0496103_0032986 | 3300048906 | Bacteria | 3162 |
| 1284 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 1285 | Ga0496104_0001496 | 3300048907 | Bacteria | 20148 |
| 1286 | Ga0496104_0002184 | 3300048907 | Bacteria | 16947 |
| 1287 | Ga0496104_0003070 | 3300048907 | Bacteria | 14395 |
| 1288 | Ga0496104_0004660 | 3300048907 | Bacteria | 11929 |
| 1289 | Ga0496104_0008945 | 3300048907 | Bacteria | 8901 |
| 1290 | Ga0496104_0095919 | 3300048907 | Bacteria | 2837 |
| 1291 | Ga0496104_0115235 | 3300048907 | Bacteria | 2578 |
| 1292 | Ga0496104_0199419 | 3300048907 | Bacteria | 1913 |
| 1293 | Ga0496104_0381273 | 3300048907 | Bacteria | 1322 |
| 1294 | Ga0496105_0002505 | 3300048908 | Bacteria | 13315 |
| 1295 | Ga0496105_0017751 | 3300048908 | Bacteria | 5708 |
| 1296 | Ga0496105_0032314 | 3300048908 | Bacteria | 4293 |
| 1297 | Ga0496105_0038039 | 3300048908 | Bacteria | 3963 |
| 1298 | Ga0496105_0044916 | 3300048908 | Bacteria | 3644 |
| 1299 | Ga0496105_0056308 | 3300048908 | Bacteria | 3245 |
| 1300 | Ga0496105_0083712 | 3300048908 | Bacteria | 2634 |
| 1301 | Ga0496105_0147889 | 3300048908 | Bacteria | 1932 |
| 1302 | Ga0496105_0257332 | 3300048908 | Bacteria | 1413 |
| 1303 | Ga0496106_0001556 | 3300048909 | Bacteria | 17284 |
| 1304 | Ga0496106_0006513 | 3300048909 | Bacteria | 8641 |
| 1305 | Ga0496106_0007123 | 3300048909 | Bacteria | 8258 |
| 1306 | Ga0496106_0010646 | 3300048909 | Bacteria | 6795 |
| 1307 | Ga0496106_0011495 | 3300048909 | Bacteria | 6547 |
| 1308 | Ga0496106_0025653 | 3300048909 | Bacteria | 4387 |
| 1309 | Ga0496106_0053802 | 3300048909 | Bacteria | 3041 |
| 1310 | Ga0496106_0143715 | 3300048909 | Bacteria | 1878 |
| 1311 | Ga0496106_0215676 | 3300048909 | Bacteria | 1529 |
| 1312 | Ga0496107_0002095 | 3300048910 | Bacteria | 12782 |
| 1313 | Ga0496107_0006823 | 3300048910 | Bacteria | 7864 |
| 1314 | Ga0496107_0009309 | 3300048910 | Bacteria | 6810 |
| 1315 | Ga0496107_0011605 | 3300048910 | Bacteria | 6141 |
| 1316 | Ga0496107_0011996 | 3300048910 | Bacteria | 6047 |
| 1317 | Ga0496107_0034987 | 3300048910 | Bacteria | 3600 |
| 1318 | Ga0496107_0037902 | 3300048910 | Bacteria | 3460 |
| 1319 | Ga0496107_0129269 | 3300048910 | Bacteria | 1864 |
| 1320 | Ga0496107_0301825 | 3300048910 | Bacteria | 1192 |
| 1321 | Ga0496108_0044354 | 3300048911 | Bacteria | 3712 |
| 1322 | Ga0496108_0061493 | 3300048911 | Bacteria | 3160 |
| 1323 | Ga0496108_0126233 | 3300048911 | Bacteria | 2196 |
| 1324 | Ga0496108_0270335 | 3300048911 | Bacteria | 1479 |
| 1325 | Ga0496108_0423472 | 3300048911 | Bacteria | 1163 |
| 1326 | Ga0496109_0004575 | 3300048912 | Bacteria | 11545 |
| 1327 | Ga0496109_0004879 | 3300048912 | Bacteria | 11202 |
| 1328 | Ga0496109_0024900 | 3300048912 | Bacteria | 5327 |
| 1329 | Ga0496109_0066090 | 3300048912 | Bacteria | 3310 |
| 1330 | Ga0496109_0074738 | 3300048912 | Bacteria | 3115 |
| 1331 | Ga0496110_0008731 | 3300048913 | Bacteria | 8160 |
| 1332 | Ga0496110_0033011 | 3300048913 | Bacteria | 4475 |
| 1333 | Ga0496110_0045663 | 3300048913 | Bacteria | 3830 |
| 1334 | Ga0496110_0074244 | 3300048913 | Bacteria | 3019 |
| 1335 | Ga0496110_0297043 | 3300048913 | Bacteria | 1471 |
| 1336 | Ga0496110_0310766 | 3300048913 | Bacteria | 1435 |
| 1337 | Ga0496111_0002467 | 3300048914 | Bacteria | 11163 |
| 1338 | Ga0496111_0005664 | 3300048914 | Bacteria | 8043 |
| 1339 | Ga0496111_0033708 | 3300048914 | Bacteria | 3653 |
| 1340 | Ga0496111_0071923 | 3300048914 | Bacteria | 2517 |
| 1341 | Ga0496111_0072960 | 3300048914 | Bacteria | 2499 |
| 1342 | Ga0496111_0118903 | 3300048914 | Bacteria | 1951 |
| 1343 | Ga0496112_0012109 | 3300048915 | Bacteria | 7913 |
| 1344 | Ga0496112_0013195 | 3300048915 | Bacteria | 7621 |
| 1345 | Ga0496112_0026113 | 3300048915 | Bacteria | 5615 |
| 1346 | Ga0496112_0058511 | 3300048915 | Bacteria | 3795 |
| 1347 | Ga0496112_0063132 | 3300048915 | Bacteria | 3653 |
| 1348 | Ga0496112_0070420 | 3300048915 | Bacteria | 3456 |
| 1349 | Ga0496112_0122868 | 3300048915 | Bacteria | 2567 |
| 1350 | Ga0496112_0138807 | 3300048915 | Bacteria | 2400 |
| 1351 | Ga0496112_0210891 | 3300048915 | Bacteria | 1900 |
| 1352 | Ga0496112_0221768 | 3300048915 | Bacteria | 1847 |
| 1353 | Ga0496112_0269770 | 3300048915 | Bacteria | 1650 |
| 1354 | Ga0496112_0377595 | 3300048915 | Bacteria | 1359 |
| 1355 | Ga0496113_0004559 | 3300048916 | Bacteria | 8532 |
| 1356 | Ga0496113_0030266 | 3300048916 | Bacteria | 3918 |
| 1357 | Ga0496113_0203544 | 3300048916 | Bacteria | 1574 |
| 1358 | Ga0496113_0427901 | 3300048916 | Bacteria | 1063 |
| 1359 | Ga0496114_0007468 | 3300048917 | Bacteria | 8642 |
| 1360 | Ga0496114_0014545 | 3300048917 | Bacteria | 6321 |
| 1361 | Ga0496114_0045150 | 3300048917 | Bacteria | 3659 |
| 1362 | Ga0496114_0065969 | 3300048917 | Bacteria | 3034 |
| 1363 | Ga0496114_0070232 | 3300048917 | Bacteria | 2941 |
| 1364 | Ga0496114_0076177 | 3300048917 | Bacteria | 2826 |
| 1365 | Ga0496114_0157252 | 3300048917 | Bacteria | 1974 |
| 1366 | Ga0496114_0191758 | 3300048917 | Bacteria | 1788 |
| 1367 | Ga0496115_0002647 | 3300048918 | Bacteria | 12855 |
| 1368 | Ga0496115_0003701 | 3300048918 | Bacteria | 11002 |
| 1369 | Ga0496115_0008444 | 3300048918 | Bacteria | 7619 |
| 1370 | Ga0496115_0014579 | 3300048918 | Bacteria | 5950 |
| 1371 | Ga0496115_0015732 | 3300048918 | Bacteria | 5746 |
| 1372 | Ga0496115_0023426 | 3300048918 | Bacteria | 4792 |
| 1373 | Ga0496115_0023859 | 3300048918 | Bacteria | 4750 |
| 1374 | Ga0496115_0029485 | 3300048918 | Bacteria | 4310 |
| 1375 | Ga0496115_0031985 | 3300048918 | Bacteria | 4149 |
| 1376 | Ga0496115_0044951 | 3300048918 | Bacteria | 3524 |
| 1377 | Ga0496115_0086975 | 3300048918 | Bacteria | 2550 |
| 1378 | Ga0496115_0100489 | 3300048918 | Bacteria | 2371 |
| 1379 | Ga0496115_0152473 | 3300048918 | Bacteria | 1908 |
| 1380 | Ga0496115_0158786 | 3300048918 | Bacteria | 1868 |
| 1381 | Ga0496115_0377670 | 3300048918 | Bacteria | 1153 |
| 1382 | Ga0496115_0405039 | 3300048918 | Bacteria | 1106 |
| 1383 | Ga0496119_0004791 | 3300048922 | Bacteria | 13278 |
| 1384 | Ga0496120_0058817 | 3300048923 | Bacteria | 2157 |
| 1385 | Ga0496121_0000221 | 3300048924 | Bacteria | 123829 |
| 1386 | Ga0496121_0002376 | 3300048924 | Bacteria | 28938 |
| 1387 | Ga0496122_0004715 | 3300048925 | Bacteria | 16745 |
| 1388 | Ga0496122_0038130 | 3300048925 | Bacteria | 3856 |
| 1389 | Ga0496122_0067923 | 3300048925 | Bacteria | 2563 |
| 1390 | Ga0496123_0000896 | 3300048926 | Bacteria | 47149 |
| 1391 | Ga0496125_0089726 | 3300048928 | Bacteria | 2310 |
| 1392 | Ga0496126_0001612 | 3300048929 | Bacteria | 34184 |
| 1393 | Ga0496126_0010859 | 3300048929 | Bacteria | 9493 |
| 1394 | Ga0496126_0058390 | 3300048929 | Bacteria | 3478 |
| 1395 | Ga0496126_0131925 | 3300048929 | Bacteria | 2158 |
| 1396 | Ga0501032_0010289 | 3300049569 | Bacteria | 6750 |
| 1397 | Ga0501032_0012972 | 3300049569 | Bacteria | 5935 |
| 1398 | Ga0501032_0068072 | 3300049569 | Bacteria | 2378 |
| 1399 | Ga0501032_0082357 | 3300049569 | Bacteria | 2141 |
| 1400 | Ga0501032_0183670 | 3300049569 | Bacteria | 1368 |
| 1401 | Ga0501033_0007661 | 3300049570 | Bacteria | 8383 |
| 1402 | Ga0501033_0012963 | 3300049570 | Bacteria | 6359 |
| 1403 | Ga0501033_0037850 | 3300049570 | Bacteria | 3609 |
| 1404 | Ga0501034_0001958 | 3300049571 | Bacteria | 26075 |
| 1405 | Ga0501034_0005332 | 3300049571 | Bacteria | 14085 |
| 1406 | Ga0501034_0022013 | 3300049571 | Bacteria | 6494 |
| 1407 | Ga0501034_0120311 | 3300049571 | Bacteria | 2612 |
| 1408 | Ga0501034_0149038 | 3300049571 | Bacteria | 2316 |
| 1409 | Ga0501034_0287018 | 3300049571 | Bacteria | 1584 |
| 1410 | Ga0501034_0362491 | 3300049571 | Bacteria | 1376 |
| 1411 | Ga0501036_0000177 | 3300049572 | Bacteria | 41942 |
| 1412 | Ga0501036_0025279 | 3300049572 | Bacteria | 5010 |
| 1413 | Ga0501036_0190859 | 3300049572 | Bacteria | 1724 |
| 1414 | Ga0501037_0044129 | 3300049573 | Bacteria | 3275 |
| 1415 | Ga0501037_0060809 | 3300049573 | Bacteria | 2755 |
| 1416 | Ga0501037_0147000 | 3300049573 | Bacteria | 1685 |
| 1417 | Ga0501037_0246760 | 3300049573 | Bacteria | 1250 |
| 1418 | Ga0501038_0060423 | 3300049574 | Bacteria | 3244 |
| 1419 | Ga0501038_0152036 | 3300049574 | Bacteria | 1886 |
| 1420 | Ga0501038_0261202 | 3300049574 | Bacteria | 1368 |
| 1421 | Ga0501038_0297497 | 3300049574 | Bacteria | 1267 |
| 1422 | Ga0501039_0071256 | 3300049575 | Bacteria | 2700 |
| 1423 | Ga0501040_0036906 | 3300049576 | Bacteria | 3318 |
| 1424 | Ga0501041_0012173 | 3300049577 | Bacteria | 5095 |
| 1425 | Ga0501041_0201472 | 3300049577 | Bacteria | 1248 |
| 1426 | Ga0501043_0001480 | 3300049579 | Bacteria | 20550 |
| 1427 | Ga0501043_0027137 | 3300049579 | Bacteria | 4495 |
| 1428 | Ga0501043_0071087 | 3300049579 | Bacteria | 2734 |
| 1429 | Ga0501043_0293721 | 3300049579 | Bacteria | 1243 |
| 1430 | Ga0501046_0080311 | 3300049580 | Bacteria | 2520 |
| 1431 | Ga0501047_0000756 | 3300049581 | Bacteria | 33738 |
| 1432 | Ga0501047_0063953 | 3300049581 | Bacteria | 3549 |
| 1433 | Ga0501047_0236407 | 3300049581 | Bacteria | 1679 |
| 1434 | Ga0501047_0301515 | 3300049581 | Bacteria | 1444 |
| 1435 | Ga0501048_0000115 | 3300049582 | Bacteria | 45729 |
| 1436 | Ga0501048_0000357 | 3300049582 | Bacteria | 31694 |
| 1437 | Ga0501068_0007338 | 3300049584 | Bacteria | 6105 |
| 1438 | Ga0501070_0000711 | 3300049586 | Bacteria | 30493 |
| 1439 | Ga0501070_0022959 | 3300049586 | Bacteria | 5222 |
| 1440 | Ga0501070_0041057 | 3300049586 | Bacteria | 3855 |
| 1441 | Ga0501070_0213232 | 3300049586 | Bacteria | 1584 |
| 1442 | Ga0501071_0129021 | 3300049587 | Bacteria | 1878 |
| 1443 | Ga0501072_0052570 | 3300049588 | Bacteria | 3208 |
| 1444 | Ga0501073_0013709 | 3300049589 | Bacteria | 5896 |
| 1445 | Ga0501073_0027800 | 3300049589 | Bacteria | 4042 |
| 1446 | Ga0501074_0063526 | 3300049590 | Bacteria | 2659 |
| 1447 | Ga0501076_0004238 | 3300049592 | Bacteria | 10148 |
| 1448 | Ga0501077_0061193 | 3300049593 | Bacteria | 2389 |
| 1449 | Ga0501077_0063025 | 3300049593 | Bacteria | 2352 |
| 1450 | Ga0501079_0012618 | 3300049741 | Bacteria | 6453 |
| 1451 | Ga0501079_0043632 | 3300049741 | Bacteria | 3462 |
| 1452 | Ga0501079_0126174 | 3300049741 | Bacteria | 1991 |
| 1453 | Ga0501080_0003552 | 3300049742 | Bacteria | 13734 |
| 1454 | Ga0501080_0053896 | 3300049742 | Bacteria | 3745 |
| 1455 | Ga0501080_0132077 | 3300049742 | Bacteria | 2312 |
| 1456 | Ga0501081_0249931 | 3300049743 | Bacteria | 1294 |
| 1457 | Ga0501083_0007330 | 3300049744 | Bacteria | 7822 |
| 1458 | Ga0501083_0014091 | 3300049744 | Bacteria | 5590 |
| 1459 | Ga0501083_0033341 | 3300049744 | Bacteria | 3527 |
| 1460 | Ga0501083_0046358 | 3300049744 | Bacteria | 2939 |
| 1461 | Ga0501035_0014773 | 3300049822 | Bacteria | 7210 |
| 1462 | Ga0501035_0032539 | 3300049822 | Bacteria | 4743 |
| 1463 | Ga0501035_0085018 | 3300049822 | Bacteria | 2789 |
| 1464 | Ga0501035_0174786 | 3300049822 | Bacteria | 1853 |
| 1465 | Ga0501044_0035047 | 3300049823 | Bacteria | 5257 |
| 1466 | Ga0501044_0163665 | 3300049823 | Bacteria | 2200 |
| 1467 | Ga0501044_0236190 | 3300049823 | Bacteria | 1773 |
| 1468 | Ga0501044_0249294 | 3300049823 | Bacteria | 1717 |
| 1469 | Ga0501045_0035685 | 3300049824 | Bacteria | 3610 |
| 1470 | Ga0501045_0105199 | 3300049824 | Bacteria | 2091 |
| 1471 | nmdc:mga03683_37233_c1 | 3300050489 | Bacteria | 1982 |
| 1472 | nmdc:mga03n38_16516_c1 | 3300050490 | Bacteria | 2872 |
| 1473 | nmdc:mga03n38_6050_c1 | 3300050490 | Bacteria | 4175 |
| 1474 | nmdc:mga03n38_65129_c1 | 3300050490 | Bacteria | 1670 |
| 1475 | nmdc:mga00v17_38731_c1 | 3300050491 | Bacteria | 2852 |
| 1476 | nmdc:mga00v17_41217_c1 | 3300050491 | Bacteria | 2773 |
| 1477 | nmdc:mga00v17_87003_c1 | 3300050491 | Bacteria | 1959 |
| 1478 | nmdc:mga0yw44_114654_c1 | 3300050492 | Bacteria | 1730 |
| 1479 | nmdc:mga0yw44_124287_c1 | 3300050492 | Bacteria | 1665 |
| 1480 | nmdc:mga0yw44_31228_c1 | 3300050492 | Bacteria | 3096 |
| 1481 | nmdc:mga0yw44_813_c1 | 3300050492 | Bacteria | 11629 |
| 1482 | nmdc:mga0k408_100398_c1 | 3300050493 | Bacteria | 1706 |
| 1483 | nmdc:mga0k408_106249_c1 | 3300050493 | Bacteria | 1658 |
| 1484 | nmdc:mga0k408_110273_c1 | 3300050493 | Bacteria | 1627 |
| 1485 | nmdc:mga0k408_274669_c1 | 3300050493 | Bacteria | 1006 |
| 1486 | nmdc:mga0k408_56850_c1 | 3300050493 | Bacteria | 2270 |
| 1487 | nmdc:mga06z11_2739_c1 | 3300050494 | Bacteria | 6760 |
| 1488 | nmdc:mga06z11_36637_c1 | 3300050494 | Bacteria | 2423 |
| 1489 | nmdc:mga07m45_130278_c1 | 3300050496 | Bacteria | 1455 |
| 1490 | nmdc:mga07m45_29681_c1 | 3300050496 | Bacteria | 3026 |
| 1491 | nmdc:mga07m45_96803_c1 | 3300050496 | Bacteria | 1694 |
| 1492 | nmdc:mga05p37_109457_c1 | 3300050507 | Bacteria | 3399 |
| 1493 | nmdc:mga05p37_140_c1 | 3300050507 | Bacteria | 67571 |
| 1494 | nmdc:mga05p37_6119_c1 | 3300050507 | Bacteria | 14175 |
| 1495 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 1496 | nmdc:mga05p37_71061_c1 | 3300050507 | Bacteria | 4281 |
| 1497 | nmdc:mga05p37_7273_c1 | 3300050507 | Bacteria | 13063 |
| 1498 | nmdc:mga05p37_82393_c1 | 3300050507 | Bacteria | 3964 |
| 1499 | nmdc:mga09592_1649_c1 | 3300050508 | Bacteria | 17953 |
| 1500 | nmdc:mga09592_672_c1 | 3300050508 | Bacteria | 26131 |
| 1501 | nmdc:mga09592_72071_c1 | 3300050508 | Bacteria | 2933 |
| 1502 | nmdc:mga0qj67_234885_c1 | 3300050509 | Bacteria | 1488 |
| 1503 | nmdc:mga0qj67_24846_c1 | 3300050509 | Bacteria | 4623 |
| 1504 | nmdc:mga0qj67_341_c1 | 3300050509 | Bacteria | 32144 |
| 1505 | nmdc:mga0qj67_36670_c1 | 3300050509 | Bacteria | 3837 |
| 1506 | nmdc:mga0qj67_58518_c1 | 3300050509 | Bacteria | 3055 |
| 1507 | nmdc:mga06r32_171978_c1 | 3300050510 | Bacteria | 2150 |
| 1508 | nmdc:mga06r32_206794_c1 | 3300050510 | Bacteria | 1951 |
| 1509 | nmdc:mga06r32_35478_c1 | 3300050510 | Bacteria | 4705 |
| 1510 | nmdc:mga06r32_404_c1 | 3300050510 | Bacteria | 36414 |
| 1511 | nmdc:mga06r32_47137_c1 | 3300050510 | Bacteria | 4115 |
| 1512 | nmdc:mga06r32_671_c1 | 3300050510 | Bacteria | 29849 |
| 1513 | nmdc:mga08y16_104_c1 | 3300050511 | Bacteria | 70280 |
| 1514 | nmdc:mga08y16_122720_c1 | 3300050511 | Bacteria | 2703 |
| 1515 | nmdc:mga08y16_193762_c1 | 3300050511 | Bacteria | 2107 |
| 1516 | nmdc:mga08y16_275652_c1 | 3300050511 | Bacteria | 1736 |
| 1517 | nmdc:mga08y16_615_c1 | 3300050511 | Bacteria | 33272 |
| 1518 | nmdc:mga08y16_865_c1 | 3300050511 | Bacteria | 29154 |
| 1519 | nmdc:mga0n895_125715_c1 | 3300050512 | Bacteria | 2588 |
| 1520 | nmdc:mga0n895_181670_c1 | 3300050512 | Bacteria | 2135 |
| 1521 | nmdc:mga0n895_19802_c1 | 3300050512 | Bacteria | 6261 |
| 1522 | nmdc:mga0n895_207416_c1 | 3300050512 | Bacteria | 1990 |
| 1523 | nmdc:mga0n895_258606_c1 | 3300050512 | Bacteria | 1767 |
| 1524 | nmdc:mga0n895_266281_c1 | 3300050512 | Bacteria | 1739 |
| 1525 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 1526 | nmdc:mga0rr50_187906_c1 | 3300050513 | Bacteria | 1692 |
| 1527 | nmdc:mga0rr50_5102_c1 | 3300050513 | Bacteria | 7792 |
| 1528 | nmdc:mga0rr50_85379_c1 | 3300050513 | Bacteria | 2446 |
| 1529 | nmdc:mga08x19_127599_c1 | 3300050514 | Bacteria | 1709 |
| 1530 | nmdc:mga08x19_4943_c1 | 3300050514 | Bacteria | 7874 |
| 1531 | nmdc:mga08x19_9575_c1 | 3300050514 | Bacteria | 5798 |
| 1532 | nmdc:mga0a205_11361_c1 | 3300050515 | Bacteria | 8196 |
| 1533 | nmdc:mga0a205_19073_c1 | 3300050515 | Bacteria | 6463 |
| 1534 | nmdc:mga0a205_268_c1 | 3300050515 | Bacteria | 37661 |
| 1535 | nmdc:mga0a205_289522_c1 | 3300050515 | Bacteria | 1512 |
| 1536 | nmdc:mga0a205_86437_c1 | 3300050515 | Bacteria | 3028 |
| 1537 | nmdc:mga0sz30_8011_c1 | 3300050516 | Bacteria | 1971 |
| 1538 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 1539 | Ga0495601_0000860 | 3300053077 | Bacteria | 16549 |
| 1540 | Ga0495601_0001376 | 3300053077 | Bacteria | 13385 |
| 1541 | Ga0495601_0002635 | 3300053077 | Bacteria | 10183 |
| 1542 | Ga0495601_0008009 | 3300053077 | Bacteria | 6225 |
| 1543 | Ga0495601_0014329 | 3300053077 | Bacteria | 4775 |
| 1544 | Ga0495601_0042558 | 3300053077 | Bacteria | 2850 |
| 1545 | Ga0495601_0082542 | 3300053077 | Bacteria | 2063 |
| 1546 | Ga0495601_0105887 | 3300053077 | Bacteria | 1819 |
| 1547 | Ga0495601_0252910 | 3300053077 | Bacteria | 1150 |
| 1548 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 1549 | Ga0495612_0000075 | 3300053078 | Bacteria | 45362 |
| 1550 | Ga0495612_0000562 | 3300053078 | Bacteria | 14913 |
| 1551 | Ga0495612_0001712 | 3300053078 | Bacteria | 8999 |
| 1552 | Ga0495612_0002201 | 3300053078 | Bacteria | 8017 |
| 1553 | Ga0495612_0013643 | 3300053078 | Bacteria | 3273 |
| 1554 | Ga0495612_0040405 | 3300053078 | Bacteria | 1900 |
| 1555 | Ga0495612_0058465 | 3300053078 | Bacteria | 1593 |
| 1556 | Ga0495595_0000026 | 3300053084 | Bacteria | 99949 |
| 1557 | Ga0495595_0000168 | 3300053084 | Bacteria | 25725 |
| 1558 | Ga0495595_0000589 | 3300053084 | Bacteria | 13861 |
| 1559 | Ga0495595_0003174 | 3300053084 | Bacteria | 6518 |
| 1560 | Ga0495595_0008606 | 3300053084 | Bacteria | 4196 |
| 1561 | Ga0495595_0013688 | 3300053084 | Bacteria | 3429 |
| 1562 | Ga0495595_0046146 | 3300053084 | Bacteria | 2006 |
| 1563 | Ga0495595_0070190 | 3300053084 | Bacteria | 1655 |
| 1564 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 1565 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 1566 | Ga0495619_0000388 | 3300053085 | Bacteria | 30051 |
| 1567 | Ga0495619_0003526 | 3300053085 | Bacteria | 10092 |
| 1568 | Ga0495619_0008861 | 3300053085 | Bacteria | 6358 |
| 1569 | Ga0495619_0013999 | 3300053085 | Bacteria | 5061 |
| 1570 | Ga0495619_0016140 | 3300053085 | Bacteria | 4727 |
| 1571 | Ga0495619_0027612 | 3300053085 | Bacteria | 3657 |
| 1572 | Ga0495619_0032806 | 3300053085 | Bacteria | 3370 |
| 1573 | Ga0495619_0109834 | 3300053085 | Bacteria | 1883 |
| 1574 | Ga0500643_001251 | 3300053087 | Bacteria | 15060 |
| 1575 | Ga0500566_0001887 | 3300053094 | Bacteria | 12333 |
| 1576 | Ga0500566_0019309 | 3300053094 | Bacteria | 4002 |
| 1577 | Ga0500641_0016442 | 3300053096 | Bacteria | 2755 |
| 1578 | Ga0500556_0000290 | 3300053104 | Bacteria | 39103 |
| 1579 | Ga0500593_000029 | 3300053117 | Bacteria | 51244 |
| 1580 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1581 | Ga0500595_001597 | 3300053119 | Bacteria | 11940 |
| 1582 | Ga0500652_000005 | 3300053131 | Bacteria | 171538 |
| 1583 | Ga0500652_005131 | 3300053131 | Bacteria | 4099 |
| 1584 | Ga0500559_0006649 | 3300053136 | Bacteria | 5199 |
| 1585 | Ga0500559_0025572 | 3300053136 | Bacteria | 2512 |
| 1586 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 1587 | Ga0500589_025042 | 3300053147 | Bacteria | 2761 |
| 1588 | Ga0500589_035423 | 3300053147 | Bacteria | 2330 |
| 1589 | Ga0500590_011273 | 3300053148 | Bacteria | 4526 |
| 1590 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1591 | Ga0500616_0006754 | 3300053153 | Bacteria | 7439 |
| 1592 | Ga0500638_000120 | 3300053162 | Bacteria | 15133 |
| 1593 | Ga0500637_0000070 | 3300053178 | Bacteria | 36880 |
| 1594 | Ga0500611_027050 | 3300053727 | Bacteria | 1152 |
| 1595 | Ga0500645_000156 | 3300053730 | Bacteria | 53110 |
| 1596 | Ga0500645_038386 | 3300053730 | Bacteria | 1421 |
| 1597 | Ga0501084_0160775 | 3300054114 | Bacteria | 1895 |
| 1598 | Ga0500661_000547 | 3300055283 | Bacteria | 7008 |
| 1599 | Ga0501082_0007283 | 3300060353 | Bacteria | 9543 |
| 1600 | Ga0501082_0169542 | 3300060353 | Bacteria | 1897 |
| 1601 | Ga0501082_0254320 | 3300060353 | Bacteria | 1528 |
| 1602 | Ga0530510_0107136 | 3300061734 | Bacteria | 2045 |
| 1603 | Ga0530510_0110402 | 3300061734 | Bacteria | 2014 |
| 1604 | 2513591490 | 2513237087 | Bacteria | 5817514 |
| 1605 | 2513677761 | 2513237098 | Bacteria | 9902361 |
| 1606 | 2513693277 | 2513237101 | Bacteria | 7952346 |
| 1607 | 2524467746 | 2524023210 | Bacteria | 9029266 |
| 1608 | 2545679291 | 2545555834 | Bacteria | 8130841 |
| 1609 | 2596372627 | 2595698237 | Bacteria | 6712432 |
| 1610 | 2643757308 | 2643221547 | Bacteria | 4740017 |
| 1611 | 2723848187 | 2721755755 | Bacteria | 8322773 |
| 1612 | 2793078104 | |||
| 1613 | 2824723110 | 2824714736 | Bacteria | 8717648 |
| 1614 | 2828308332 | 2828305725 | Bacteria | 4916900 |
| 1615 | 2857527140 | 2857524615 | Bacteria | 6615449 |
| 1616 | 2874608825 | 2874604998 | Bacteria | 7834745 |
| 1617 | 2879115446 | 2879110137 | Bacteria | 8907982 |
| 1618 | 2885390477 | 2885383462 | Bacteria | 9473874 |
| 1619 | 2889037297 | 2889033259 | Bacteria | 9099371 |
| 1620 | 2889308376 | 2889306138 | Bacteria | 6358934 |
| 1621 | 2893068082 | 2893066018 | Bacteria | 6158120 |
| 1622 | 2899260375 | 2899259804 | Bacteria | 3320927 |
| 1623 | 2902331308 | 2902330777 | Bacteria | 6395352 |
| 1624 | 2902410753 | 2902405164 | Bacteria | 6784948 |
| 1625 | 2903774279 | 2903768456 | Bacteria | 9749579 |
| 1626 | 2919078255 | 2919073203 | Bacteria | 6531949 |
| 1627 | 2919451909 | 2919450847 | Bacteria | 5631160 |
| 1628 | 2922361428 | 2922361189 | Bacteria | 7436256 |
| 1629 | 2922388851 | 2922386360 | Bacteria | 7017218 |
| 1630 | 2928127578 | 2928125067 | Bacteria | 5937560 |
| 1631 | 3003671439 | 3003665799 | Bacteria | 7279786 |
| 1632 | 641644620 | 641522639 | Bacteria | 7737025 |
| 1633 | 643602802 | 643348564 | Bacteria | 8839022 |
| 1634 | 8001849999 | 8001845381 | Bacteria | 5804942 |
| 1635 | 8006968877 | 8006964411 | Bacteria | 8966052 |
| 1636 | 8006985241 | 8006984368 | Bacteria | 9651211 |
| 1637 | 8006998562 | 8006994254 | Bacteria | 8309700 |
| 1638 | 8056675906 | 8056673599 | Bacteria | 7871253 |
| 1639 | 8056682175 | 8056681323 | Bacteria | 8472857 |
| 1640 | Ga0501072_0132472 | |||
| 1641 | 2214544914 | |||
| 1642 | ARcpr5oldR_c000055 | |||
| 1643 | ARSoilOldRDRAFT_c000092 | |||
| 1644 | ARCol0oldRDRAFT_c00958 | |||
| 1645 | ARCol0yngRDRAFT_1000049 | |||
| 1646 | JGI24746J21847_1000660 | |||
| 1647 | JGI24746J21847_1003668 | |||
| 1648 | JGI24739J22299_10005070 | |||
| 1649 | JGI24737J22298_10001725 | |||
| 1650 | JGI24737J22298_10006539 | |||
| 1651 | JGI24737J22298_10008869 | |||
| 1652 | JGI24750J21931_1000201 | |||
| 1653 | JGI24738J21930_10013666 | |||
| 1654 | JGI24749J21850_1003715 | |||
| 1655 | JGI24749J21850_1005688 | |||
| 1656 | JGI24744J21845_10002186 | |||
| 1657 | JGI24744J21845_10004285 | |||
| 1658 | JGI24035J26624_1000855 | |||
| 1659 | JGI24034J26672_10001663 | |||
| 1660 | JGI24742J22300_10000548 | |||
| 1661 | JGI25406J46586_10003809 | |||
| 1662 | JGI25406J46586_10007133 | |||
| 1663 | JGI25153J46596_10003847 | |||
| 1664 | JGI26129J50193_1002302 | |||
| 1665 | JGI25404J52841_10001785 | |||
| 1666 | JGI25405J52794_10006511 | |||
| 1667 | Ga0065712_10069289 | |||
| 1668 | Ga0065715_10000947 | |||
| 1669 | Ga0065715_10096595 | |||
| 1670 | Ga0070658_10065700 | |||
| 1671 | Ga0070658_10080543 | |||
| 1672 | Ga0070676_10004291 | |||
| 1673 | Ga0070676_10069735 | |||
| 1674 | Ga0070676_10267144 | |||
| 1675 | Ga0070683_100004677 | |||
| 1676 | Ga0070683_100080091 | |||
| 1677 | Ga0070683_100115011 | |||
| 1678 | Ga0070690_100008757 | |||
| 1679 | Ga0070690_100012125 | |||
| 1680 | Ga0070690_100032348 | |||
| 1681 | Ga0070690_100087661 | |||
| 1682 | Ga0070690_100173921 | |||
| 1683 | Ga0070670_100004378 | |||
| 1684 | Ga0070670_100006765 | |||
| 1685 | Ga0070670_100094117 | |||
| 1686 | Ga0070670_100179502 | |||
| 1687 | Ga0070677_10010687 | |||
| 1688 | Ga0070677_10022125 | |||
| 1689 | Ga0068869_100000546 | |||
| 1690 | Ga0070666_10016324 | |||
| 1691 | Ga0070680_100007445 | |||
| 1692 | Ga0070680_100009775 | |||
| 1693 | Ga0070680_100070058 | |||
| 1694 | Ga0070682_100003445 | |||
| 1695 | Ga0070682_100018516 | |||
| 1696 | Ga0070682_100023757 | |||
| 1697 | Ga0070682_100059999 | |||
| 1698 | Ga0070682_100115164 | |||
| 1699 | Ga0070682_100277844 | |||
| 1700 | Ga0068868_100013168 | |||
| 1701 | Ga0068868_100026486 | |||
| 1702 | Ga0068868_100029085 | |||
| 1703 | Ga0070660_100004111 | |||
| 1704 | Ga0070660_100024866 | |||
| 1705 | Ga0070660_100066748 | |||
| 1706 | Ga0070689_100002392 | |||
| 1707 | Ga0070689_100011343 | |||
| 1708 | Ga0070689_100023636 | |||
| 1709 | Ga0070689_100032975 | |||
| 1710 | Ga0070691_10003723 | |||
| 1711 | Ga0070691_10030403 | |||
| 1712 | Ga0070691_10059641 | |||
| 1713 | Ga0070691_10077486 | |||
| 1714 | Ga0070687_100001017 | |||
| 1715 | Ga0070687_100065224 | |||
| 1716 | Ga0070687_100081880 | |||
| 1717 | Ga0070661_100001763 | |||
| 1718 | Ga0070661_100036019 | |||
| 1719 | Ga0070661_100085189 | |||
| 1720 | Ga0070661_100180667 | |||
| 1721 | Ga0070661_100209699 | |||
| 1722 | Ga0070692_10074200 | |||
| 1723 | Ga0070692_10150731 | |||
| 1724 | Ga0070668_100049439 | |||
| 1725 | Ga0070668_100093478 | |||
| 1726 | Ga0070668_100230623 | |||
| 1727 | Ga0070669_100009976 | |||
| 1728 | Ga0070669_100033750 | |||
| 1729 | Ga0070669_100072827 | |||
| 1730 | Ga0070669_100074273 | |||
| 1731 | Ga0070669_100382860 | |||
| 1732 | Ga0070675_100029783 | |||
| 1733 | Ga0070675_100059157 | |||
| 1734 | Ga0070671_100007031 | |||
| 1735 | Ga0070671_100019747 | |||
| 1736 | Ga0070671_100033007 | |||
| 1737 | Ga0070671_100231059 | |||
| 1738 | Ga0070674_100018657 | |||
| 1739 | Ga0070674_100065444 | |||
| 1740 | Ga0070674_100107752 | |||
| 1741 | Ga0070674_100210462 | |||
| 1742 | Ga0070673_100000050 | |||
| 1743 | Ga0070673_100018483 | |||
| 1744 | Ga0070673_100074967 | |||
| 1745 | Ga0070673_100199892 | |||
| 1746 | Ga0070688_100005098 | |||
| 1747 | Ga0070688_100006605 | |||
| 1748 | Ga0070688_100019351 | |||
| 1749 | Ga0070688_100075812 | |||
| 1750 | Ga0070659_100014541 | |||
| 1751 | Ga0070659_100037328 | |||
| 1752 | Ga0070659_100078543 | |||
| 1753 | Ga0070659_100105397 | |||
| 1754 | Ga0070659_100120676 | |||
| 1755 | Ga0070659_100301430 | |||
| 1756 | Ga0070667_100036040 | |||
| 1757 | Ga0070667_100038413 | |||
| 1758 | Ga0070667_100040047 | |||
| 1759 | Ga0070667_100078274 | |||
| 1760 | Ga0070667_100329792 | |||
| 1761 | Ga0070667_100565331 | |||
| 1762 | Ga0070709_10021978 | |||
| 1763 | Ga0070709_10044047 | |||
| 1764 | Ga0070709_10076338 | |||
| 1765 | Ga0070709_10080285 | |||
| 1766 | Ga0070714_100004606 | |||
| 1767 | Ga0070714_100006031 | |||
| 1768 | Ga0070714_100014175 | |||
| 1769 | Ga0070714_100039953 | |||
| 1770 | Ga0070714_100063186 | |||
| 1771 | Ga0070714_100517564 | |||
| 1772 | Ga0070713_100005289 | |||
| 1773 | Ga0070713_100016906 | |||
| 1774 | Ga0070713_100035887 | |||
| 1775 | Ga0070713_100080357 | |||
| 1776 | Ga0070713_100175149 | |||
| 1777 | Ga0070713_100237268 | |||
| 1778 | Ga0070713_100268197 | |||
| 1779 | Ga0070710_10003313 | |||
| 1780 | Ga0070710_10012715 | |||
| 1781 | Ga0070710_10013665 | |||
| 1782 | Ga0070710_10071448 | |||
| 1783 | Ga0070701_10004186 | |||
| 1784 | Ga0070701_10011632 | |||
| 1785 | Ga0070711_100018457 | |||
| 1786 | Ga0070711_100030906 | |||
| 1787 | Ga0070711_100051890 | |||
| 1788 | Ga0070711_100152483 | |||
| 1789 | Ga0070705_100003118 | |||
| 1790 | Ga0070705_100081563 | |||
| 1791 | Ga0070705_100265069 | |||
| 1792 | Ga0070700_100002692 | |||
| 1793 | Ga0070700_100017552 | |||
| 1794 | Ga0070700_100048053 | |||
| 1795 | Ga0070700_100093787 | |||
| 1796 | Ga0070694_100008052 | |||
| 1797 | Ga0070694_100016432 | |||
| 1798 | Ga0070694_100086665 | |||
| 1799 | Ga0070708_100054884 | |||
| 1800 | Ga0070708_100198445 | |||
| 1801 | Ga0070663_100012871 | |||
| 1802 | Ga0070663_100017187 | |||
| 1803 | Ga0070663_100020225 | |||
| 1804 | Ga0070663_100026662 | |||
| 1805 | Ga0070663_100027275 | |||
| 1806 | Ga0070663_100071052 | |||
| 1807 | Ga0070678_100000518 | |||
| 1808 | Ga0070678_100034284 | |||
| 1809 | Ga0070678_100037451 | |||
| 1810 | Ga0070678_100048040 | |||
| 1811 | Ga0070678_100061509 | |||
| 1812 | Ga0070662_100021515 | |||
| 1813 | Ga0070662_100041959 | |||
| 1814 | Ga0070662_100045316 | |||
| 1815 | Ga0070662_100067761 | |||
| 1816 | Ga0070662_100133529 | |||
| 1817 | Ga0070662_100166872 | |||
| 1818 | Ga0070662_100250256 | |||
| 1819 | Ga0070681_10004661 | |||
| 1820 | Ga0070681_10010419 | |||
| 1821 | Ga0070681_10022966 | |||
| 1822 | Ga0070681_10027987 | |||
| 1823 | Ga0068867_100009022 | |||
| 1824 | Ga0068867_100018958 | |||
| 1825 | Ga0070685_10003674 | |||
| 1826 | Ga0070685_10007039 | |||
| 1827 | Ga0070707_100068310 | |||
| 1828 | Ga0070698_100201019 | |||
| 1829 | Ga0070699_100019495 | |||
| 1830 | Ga0070699_100174679 | |||
| 1831 | Ga0070679_100007667 | |||
| 1832 | Ga0070679_100030975 | |||
| 1833 | Ga0070679_100031240 | |||
| 1834 | Ga0070679_100047919 | |||
| 1835 | Ga0070679_100120399 | |||
| 1836 | Ga0070679_100155979 | |||
| 1837 | Ga0070679_100174109 | |||
| 1838 | Ga0070684_100004205 | |||
| 1839 | Ga0070684_100079903 | |||
| 1840 | Ga0070684_100105562 | |||
| 1841 | Ga0070684_100247283 | |||
| 1842 | Ga0068853_100015280 | |||
| 1843 | Ga0068853_100015701 | |||
| 1844 | Ga0068853_100030067 | |||
| 1845 | Ga0068853_100109958 | |||
| 1846 | Ga0068853_100299184 | |||
| 1847 | Ga0070672_100000643 | |||
| 1848 | Ga0070672_100040098 | |||
| 1849 | Ga0070672_100052229 | |||
| 1850 | Ga0070672_100128143 | |||
| 1851 | Ga0070686_100001304 | |||
| 1852 | Ga0070686_100065299 | |||
| 1853 | Ga0070695_100006337 | |||
| 1854 | Ga0070695_100015500 | |||
| 1855 | Ga0070695_100091458 | |||
| 1856 | Ga0070696_100018798 | |||
| 1857 | Ga0070696_100042306 | |||
| 1858 | Ga0070696_100139500 | |||
| 1859 | Ga0070693_100003235 | |||
| 1860 | Ga0070693_100008992 | |||
| 1861 | Ga0070693_100031899 | |||
| 1862 | Ga0070665_100021396 | |||
| 1863 | Ga0070665_100048596 | |||
| 1864 | Ga0070665_100085466 | |||
| 1865 | Ga0070665_100089171 | |||
| 1866 | Ga0070665_100219998 | |||
| 1867 | Ga0070665_100376162 | |||
| 1868 | Ga0070665_100436574 | |||
| 1869 | Ga0070704_100008125 | |||
| 1870 | Ga0070704_100240733 | |||
| 1871 | Ga0068855_100018496 | |||
| 1872 | Ga0068855_100021441 | |||
| 1873 | Ga0068855_100022276 | |||
| 1874 | Ga0068855_100089123 | |||
| 1875 | Ga0068855_100111695 | |||
| 1876 | Ga0068855_100293033 | |||
| 1877 | Ga0068855_100698323 | |||
| 1878 | Ga0070664_100026948 | |||
| 1879 | Ga0070664_100107252 | |||
| 1880 | Ga0070664_100198361 | |||
| 1881 | Ga0068857_100001038 | |||
| 1882 | Ga0068857_100015943 | |||
| 1883 | Ga0068854_100014606 | |||
| 1884 | Ga0068854_100020860 | |||
| 1885 | Ga0068854_100147355 | |||
| 1886 | Ga0068854_100257987 | |||
| 1887 | Ga0068856_100009104 | |||
| 1888 | Ga0068856_100038924 | |||
| 1889 | Ga0068856_100348432 | |||
| 1890 | Ga0070702_100004502 | |||
| 1891 | Ga0070702_100013098 | |||
| 1892 | Ga0070702_100035132 | |||
| 1893 | Ga0068852_100005996 | |||
| 1894 | Ga0068852_100168942 | |||
| 1895 | Ga0068859_100006706 | |||
| 1896 | Ga0068859_100135022 | |||
| 1897 | Ga0068859_100155044 | |||
| 1898 | Ga0068859_100390827 | |||
| 1899 | Ga0068864_100004096 | |||
| 1900 | Ga0068864_100006391 | |||
| 1901 | Ga0068864_100022271 | |||
| 1902 | Ga0068864_100054797 | |||
| 1903 | Ga0068866_10000791 | |||
| 1904 | Ga0068866_10079221 | |||
| 1905 | Ga0068866_10120115 | |||
| 1906 | Ga0068861_100002491 | |||
| 1907 | Ga0068861_100029004 | |||
| 1908 | Ga0068861_100049835 | |||
| 1909 | Ga0068861_100057052 | |||
| 1910 | Ga0068870_10001431 | |||
| 1911 | Ga0068870_10002318 | |||
| 1912 | Ga0068870_10043749 | |||
| 1913 | Ga0068870_10121272 | |||
| 1914 | Ga0068863_100016752 | |||
| 1915 | Ga0068863_100025687 | |||
| 1916 | Ga0068863_100051180 | |||
| 1917 | Ga0068858_100010247 | |||
| 1918 | Ga0068858_100017836 | |||
| 1919 | Ga0068858_100026083 | |||
| 1920 | Ga0068858_100192934 | |||
| 1921 | Ga0068860_100002530 | |||
| 1922 | Ga0068860_100047790 | |||
| 1923 | Ga0068860_100070139 | |||
| 1924 | Ga0068860_100156188 | |||
| 1925 | Ga0068862_100006671 | |||
| 1926 | Ga0068862_100040884 | |||
| 1927 | Ga0068862_100135610 | |||
| 1928 | Ga0068862_100264977 | |||
| 1929 | Ga0081455_10000081 | |||
| 1930 | Ga0081455_10003729 | |||
| 1931 | Ga0081455_10005438 | |||
| 1932 | Ga0081455_10010814 | |||
| 1933 | Ga0081455_10033699 | |||
| 1934 | Ga0081538_10001580 | |||
| 1935 | Ga0081538_10010111 | |||
| 1936 | Ga0081538_10020370 | |||
| 1937 | Ga0081538_10021466 | |||
| 1938 | Ga0081540_1000027 | |||
| 1939 | Ga0081540_1002386 | |||
| 1940 | Ga0081540_1002765 | |||
| 1941 | Ga0081540_1003265 | |||
| 1942 | Ga0081540_1003527 | |||
| 1943 | Ga0081540_1005126 | |||
| 1944 | Ga0081540_1005516 | |||
| 1945 | Ga0081540_1010700 | |||
| 1946 | Ga0081540_1010849 | |||
| 1947 | Ga0081540_1020053 | |||
| 1948 | Ga0081540_1024836 | |||
| 1949 | Ga0081540_1026792 | |||
| 1950 | Ga0081539_10000306 | |||
| 1951 | Ga0081539_10001260 | |||
| 1952 | Ga0081539_10050522 | |||
| 1953 | Ga0070717_10000485 | |||
| 1954 | Ga0070717_10000980 | |||
| 1955 | Ga0070717_10023003 | |||
| 1956 | Ga0075365_10037037 | |||
| 1957 | Ga0075365_10051214 | |||
| 1958 | Ga0075365_10171024 | |||
| 1959 | Ga0075368_10011758 | |||
| 1960 | Ga0075368_10071075 | |||
| 1961 | Ga0075363_100004615 | |||
| 1962 | Ga0075363_100011319 | |||
| 1963 | Ga0075363_100041849 | |||
| 1964 | Ga0075364_10006344 | |||
| 1965 | Ga0075364_10074566 | |||
| 1966 | Ga0075432_10000954 | |||
| 1967 | Ga0070715_10000289 | |||
| 1968 | Ga0070715_10003295 | |||
| 1969 | Ga0070715_10032333 | |||
| 1970 | Ga0070715_10081041 | |||
| 1971 | Ga0070716_100004147 | |||
| 1972 | Ga0070716_100016874 | |||
| 1973 | Ga0070716_100047513 | |||
| 1974 | Ga0070712_100020910 | |||
| 1975 | Ga0070712_100030045 | |||
| 1976 | Ga0070712_100043123 | |||
| 1977 | Ga0070712_100044021 | |||
| 1978 | Ga0070712_100049815 | |||
| 1979 | Ga0075362_10044483 | |||
| 1980 | Ga0075367_10068408 | |||
| 1981 | Ga0075369_10001806 | |||
| 1982 | Ga0075369_10016448 | |||
| 1983 | Ga0075366_10028015 | |||
| 1984 | Ga0097621_100001425 | |||
| 1985 | Ga0097621_100010536 | |||
| 1986 | Ga0097621_100147348 | |||
| 1987 | Ga0075370_10001231 | |||
| 1988 | Ga0068871_100002394 | |||
| 1989 | Ga0068871_100022579 | |||
| 1990 | Ga0068871_100033578 | |||
| 1991 | Ga0068871_100036707 | |||
| 1992 | Ga0068871_100107955 | |||
| 1993 | Ga0068871_100191120 | |||
| 1994 | Ga0075428_100005241 | |||
| 1995 | Ga0075428_100005805 | |||
| 1996 | Ga0075428_100011791 | |||
| 1997 | Ga0075428_100057524 | |||
| 1998 | Ga0075428_100211000 | |||
| 1999 | Ga0075430_100000424 | |||
| 2000 | Ga0075430_100006792 | |||
| 2001 | Ga0075430_100010396 | |||
| 2002 | Ga0075430_100093633 | |||
| 2003 | Ga0075431_100000105 | |||
| 2004 | Ga0075431_100002258 | |||
| 2005 | Ga0075431_100033491 | |||
| 2006 | Ga0075431_100121846 | |||
| 2007 | Ga0075431_100178116 | |||
| 2008 | Ga0075431_100188585 | |||
| 2009 | Ga0075431_100275949 | |||
| 2010 | Ga0075433_10000012 | |||
| 2011 | Ga0075434_100000310 | |||
| 2012 | Ga0075434_100004560 | |||
| 2013 | Ga0075434_100043177 | |||
| 2014 | Ga0075434_100086930 | |||
| 2015 | Ga0075434_100112131 | |||
| 2016 | Ga0075434_100139878 | |||
| 2017 | Ga0075434_100198536 | |||
| 2018 | Ga0075434_100217751 | |||
| 2019 | Ga0075434_100339222 | |||
| 2020 | Ga0075429_100001610 | |||
| 2021 | Ga0075429_100005372 | |||
| 2022 | Ga0068865_100001097 | |||
| 2023 | Ga0068865_100052560 | |||
| 2024 | Ga0068865_100081222 | |||
| 2025 | Ga0068865_100134544 | |||
| 2026 | Ga0075436_100008403 | |||
| 2027 | Ga0097620_100006706 | |||
| 2028 | Ga0097620_100135019 | |||
| 2029 | Ga0097620_100155037 | |||
| 2030 | Ga0097620_100390819 | |||
| 2031 | Ga0099824_1002861 | |||
| 2032 | Ga0075435_100002697 | |||
| 2033 | Ga0075435_100087604 | |||
| 2034 | Ga0075435_100114450 | |||
| 2035 | Ga0099794_10024802 | |||
| 2036 | Ga0099794_10031739 | |||
| 2037 | Ga0105244_10023607 | |||
| 2038 | Ga0105240_10175140 | |||
| 2039 | Ga0105240_10202808 | |||
| 2040 | Ga0111539_10000792 | |||
| 2041 | Ga0111539_10000842 | |||
| 2042 | Ga0111539_10014117 | |||
| 2043 | Ga0111539_10034470 | |||
| 2044 | Ga0105245_10025559 | |||
| 2045 | Ga0105245_10029815 | |||
| 2046 | Ga0105245_10099722 | |||
| 2047 | Ga0105245_10183751 | |||
| 2048 | Ga0105247_10024258 | |||
| 2049 | Ga0105247_10025129 | |||
| 2050 | Ga0105247_10033339 | |||
| 2051 | Ga0105247_10041196 | |||
| 2052 | Ga0114129_10000803 | |||
| 2053 | Ga0114129_10001669 | |||
| 2054 | Ga0114129_10003927 | |||
| 2055 | Ga0114129_10006740 | |||
| 2056 | Ga0114129_10006854 | |||
| 2057 | Ga0114129_10027094 | |||
| 2058 | Ga0114129_10071921 | |||
| 2059 | Ga0105243_10002400 | |||
| 2060 | Ga0105243_10004402 | |||
| 2061 | Ga0105243_10035105 | |||
| 2062 | Ga0105243_10047415 | |||
| 2063 | Ga0105243_10087524 | |||
| 2064 | Ga0105243_10094329 | |||
| 2065 | Ga0105241_10008636 | |||
| 2066 | Ga0105241_10010427 | |||
| 2067 | Ga0105241_10028300 | |||
| 2068 | Ga0105241_10090184 | |||
| 2069 | Ga0105241_10100074 | |||
| 2070 | Ga0105241_10260979 | |||
| 2071 | Ga0105242_10007578 | |||
| 2072 | Ga0105242_10008734 | |||
| 2073 | Ga0105242_10025583 | |||
| 2074 | Ga0105248_10010839 | |||
| 2075 | Ga0105248_10014218 | |||
| 2076 | Ga0105248_10059364 | |||
| 2077 | Ga0105248_10062156 | |||
| 2078 | Ga0105248_10081366 | |||
| 2079 | Ga0105237_10030610 | |||
| 2080 | Ga0105237_10032300 | |||
| 2081 | Ga0105237_10121260 | |||
| 2082 | Ga0105238_10009678 | |||
| 2083 | Ga0105238_10066536 | |||
| 2084 | Ga0105238_10099304 | |||
| 2085 | Ga0105238_10115780 | |||
| 2086 | Ga0105249_10011450 | |||
| 2087 | Ga0105249_10153117 | |||
| 2088 | Ga0105249_10160851 | |||
| 2089 | Ga0099796_10011799 | |||
| 2090 | Ga0105239_10024088 | |||
| 2091 | Ga0105239_10040214 | |||
| 2092 | Ga0105239_10346225 | |||
| 2093 | Ga0105246_10051104 | |||
| 2094 | Ga0105246_10071651 | |||
| 2095 | Ga0105246_10110265 | |||
| 2096 | Ga0157342_1000436 | |||
| 2097 | Ga0157373_10110086 | |||
| 2098 | Ga0157371_10195899 | |||
| 2099 | Ga0157370_10035641 | |||
| 2100 | Ga0157370_10193977 | |||
| 2101 | Ga0157369_10281738 | |||
| 2102 | Ga0157374_10001167 | |||
| 2103 | Ga0157374_10003779 | |||
| 2104 | Ga0157374_10027828 | |||
| 2105 | Ga0157378_10008023 | |||
| 2106 | Ga0163162_10010853 | |||
| 2107 | Ga0163162_10051562 | |||
| 2108 | Ga0163162_10139260 | |||
| 2109 | Ga0163162_10293571 | |||
| 2110 | Ga0163162_10671224 | |||
| 2111 | Ga0157372_10141014 | |||
| 2112 | Ga0157372_10279647 | |||
| 2113 | Ga0163163_10007288 | |||
| 2114 | Ga0163163_10007753 | |||
| 2115 | Ga0163163_10109647 | |||
| 2116 | Ga0157380_10001551 | |||
| 2117 | Ga0157380_10093514 | |||
| 2118 | Ga0157380_10231041 | |||
| 2119 | Ga0157377_10009300 | |||
| 2120 | Ga0157379_10036937 | |||
| 2121 | Ga0157376_10012121 | |||
| 2122 | Ga0157376_10059766 | |||
| 2123 | Ga0157376_10065769 | |||
| 2124 | Ga0157376_10093163 | |||
| 2125 | Ga0163161_10011103 | |||
| 2126 | Ga0163161_10086928 | |||
| 2127 | Ga0163161_10166223 | |||
| 2128 | Ga0206356_11037165 | |||
| 2129 | Ga0206350_10300830 | |||
| 2130 | Ga0206354_10798601 | |||
| 2131 | Ga0206353_11208914 | |||
| 2132 | Ga0213874_10003167 | |||
| 2133 | Ga0213876_10000514 | |||
| 2134 | Ga0213876_10004037 | |||
| 2135 | Ga0213875_10000122 | |||
| 2136 | Ga0213875_10002043 | |||
| 2137 | Ga0213875_10047189 | |||
| 2138 | Ga0213875_10049374 | |||
| 2139 | Ga0224712_10047026 | |||
| 2140 | Ga0224572_1020299 | |||
| 2141 | Ga0228598_1010870 | |||
| 2142 | Ga0207666_1000153 | |||
| 2143 | Ga0207666_1005029 | |||
| 2144 | Ga0207673_1000206 | |||
| 2145 | Ga0209758_1007275 | |||
| 2146 | Ga0207697_10001059 | |||
| 2147 | Ga0207653_10009860 | |||
| 2148 | Ga0207653_10017060 | |||
| 2149 | Ga0207682_10002553 | |||
| 2150 | Ga0207682_10033509 | |||
| 2151 | Ga0207692_10000282 | |||
| 2152 | Ga0207642_10016582 | |||
| 2153 | Ga0207642_10034683 | |||
| 2154 | Ga0207710_10000382 | |||
| 2155 | Ga0207688_10001640 | |||
| 2156 | Ga0207688_10015245 | |||
| 2157 | Ga0207680_10008936 | |||
| 2158 | Ga0207680_10010916 | |||
| 2159 | Ga0207680_10018703 | |||
| 2160 | Ga0207680_10052411 | |||
| 2161 | Ga0207647_10009706 | |||
| 2162 | Ga0207647_10009987 | |||
| 2163 | Ga0207647_10012209 | |||
| 2164 | Ga0207685_10000164 | |||
| 2165 | Ga0207685_10005449 | |||
| 2166 | Ga0207685_10041022 | |||
| 2167 | Ga0207685_10068246 | |||
| 2168 | Ga0207699_10004201 | |||
| 2169 | Ga0207699_10006008 | |||
| 2170 | Ga0207699_10067023 | |||
| 2171 | Ga0207699_10081032 | |||
| 2172 | Ga0207645_10002745 | |||
| 2173 | Ga0207645_10063850 | |||
| 2174 | Ga0207645_10077131 | |||
| 2175 | Ga0207643_10000004 | |||
| 2176 | Ga0207643_10001769 | |||
| 2177 | Ga0207643_10176573 | |||
| 2178 | Ga0207643_10196526 | |||
| 2179 | Ga0207705_10073895 | |||
| 2180 | Ga0207705_10217915 | |||
| 2181 | Ga0207684_10009569 | |||
| 2182 | Ga0207654_10008032 | |||
| 2183 | Ga0207654_10173227 | |||
| 2184 | Ga0207707_10011019 | |||
| 2185 | Ga0207707_10014644 | |||
| 2186 | Ga0207707_10016719 | |||
| 2187 | Ga0207707_10336335 | |||
| 2188 | Ga0207695_10086365 | |||
| 2189 | Ga0207671_10082682 | |||
| 2190 | Ga0207671_10087943 | |||
| 2191 | Ga0207671_10088536 | |||
| 2192 | Ga0207671_10129201 | |||
| 2193 | Ga0207671_10154096 | |||
| 2194 | Ga0207671_10168615 | |||
| 2195 | Ga0207693_10001038 | |||
| 2196 | Ga0207693_10005387 | |||
| 2197 | Ga0207693_10016176 | |||
| 2198 | Ga0207693_10034641 | |||
| 2199 | Ga0207693_10084937 | |||
| 2200 | Ga0207693_10201344 | |||
| 2201 | Ga0207663_10004587 | |||
| 2202 | Ga0207663_10026312 | |||
| 2203 | Ga0207663_10092326 | |||
| 2204 | Ga0207663_10328751 | |||
| 2205 | Ga0207660_10007217 | |||
| 2206 | Ga0207660_10009992 | |||
| 2207 | Ga0207660_10020495 | |||
| 2208 | Ga0207660_10124432 | |||
| 2209 | Ga0207662_10000392 | |||
| 2210 | Ga0207662_10001199 | |||
| 2211 | Ga0207662_10026540 | |||
| 2212 | Ga0207657_10002007 | |||
| 2213 | Ga0207657_10007818 | |||
| 2214 | Ga0207657_10012563 | |||
| 2215 | Ga0207657_10017247 | |||
| 2216 | Ga0207657_10038806 | |||
| 2217 | Ga0207657_10039060 | |||
| 2218 | Ga0207657_10043860 | |||
| 2219 | Ga0207657_10050813 | |||
| 2220 | Ga0207649_10005404 | |||
| 2221 | Ga0207652_10014772 | |||
| 2222 | Ga0207652_10053069 | |||
| 2223 | Ga0207652_10058342 | |||
| 2224 | Ga0207652_10059011 | |||
| 2225 | Ga0207652_10059737 | |||
| 2226 | Ga0207652_10113505 | |||
| 2227 | Ga0207652_10133288 | |||
| 2228 | Ga0207652_10295507 | |||
| 2229 | Ga0207646_10258077 | |||
| 2230 | Ga0207681_10024530 | |||
| 2231 | Ga0207681_10025222 | |||
| 2232 | Ga0207681_10149905 | |||
| 2233 | Ga0207694_10082893 | |||
| 2234 | Ga0207694_10110698 | |||
| 2235 | Ga0207650_10004542 | |||
| 2236 | Ga0207650_10064045 | |||
| 2237 | Ga0207650_10143039 | |||
| 2238 | Ga0207659_10000374 | |||
| 2239 | Ga0207659_10066883 | |||
| 2240 | Ga0207687_10005411 | |||
| 2241 | Ga0207687_10009764 | |||
| 2242 | Ga0207687_10016412 | |||
| 2243 | Ga0207687_10041692 | |||
| 2244 | Ga0207687_10092929 | |||
| 2245 | Ga0207700_10003347 | |||
| 2246 | Ga0207700_10015515 | |||
| 2247 | Ga0207700_10037965 | |||
| 2248 | Ga0207700_10122533 | |||
| 2249 | Ga0207700_10143551 | |||
| 2250 | Ga0207700_10161996 | |||
| 2251 | Ga0207700_10196238 | |||
| 2252 | Ga0207664_10009763 | |||
| 2253 | Ga0207664_10023358 | |||
| 2254 | Ga0207664_10033414 | |||
| 2255 | Ga0207664_10067954 | |||
| 2256 | Ga0207664_10106776 | |||
| 2257 | Ga0207664_10108798 | |||
| 2258 | Ga0207664_10187014 | |||
| 2259 | Ga0207664_10202086 | |||
| 2260 | Ga0207644_10003380 | |||
| 2261 | Ga0207644_10004888 | |||
| 2262 | Ga0207644_10055390 | |||
| 2263 | Ga0207690_10010819 | |||
| 2264 | Ga0207690_10013825 | |||
| 2265 | Ga0207690_10180370 | |||
| 2266 | Ga0207690_10218354 | |||
| 2267 | Ga0207706_10002819 | |||
| 2268 | Ga0207706_10006974 | |||
| 2269 | Ga0207706_10010623 | |||
| 2270 | Ga0207706_10022546 | |||
| 2271 | Ga0207706_10041500 | |||
| 2272 | Ga0207706_10341120 | |||
| 2273 | Ga0207686_10007542 | |||
| 2274 | Ga0207686_10020413 | |||
| 2275 | Ga0207686_10025932 | |||
| 2276 | Ga0207686_10151512 | |||
| 2277 | Ga0207709_10003882 | |||
| 2278 | Ga0207709_10014845 | |||
| 2279 | Ga0207709_10071979 | |||
| 2280 | Ga0207709_10091098 | |||
| 2281 | Ga0207709_10100149 | |||
| 2282 | Ga0207670_10001845 | |||
| 2283 | Ga0207670_10004902 | |||
| 2284 | Ga0207670_10067403 | |||
| 2285 | Ga0207669_10022356 | |||
| 2286 | Ga0207669_10051158 | |||
| 2287 | Ga0207669_10092832 | |||
| 2288 | Ga0207669_10135589 | |||
| 2289 | Ga0207704_10002620 | |||
| 2290 | Ga0207704_10005816 | |||
| 2291 | Ga0207704_10265795 | |||
| 2292 | Ga0207665_10000541 | |||
| 2293 | Ga0207665_10007581 | |||
| 2294 | Ga0207665_10017261 | |||
| 2295 | Ga0207665_10055563 | |||
| 2296 | Ga0207691_10004396 | |||
| 2297 | Ga0207691_10009932 | |||
| 2298 | Ga0207691_10041812 | |||
| 2299 | Ga0207691_10314525 | |||
| 2300 | Ga0207711_10002645 | |||
| 2301 | Ga0207711_10005696 | |||
| 2302 | Ga0207711_10035642 | |||
| 2303 | Ga0207711_10145854 | |||
| 2304 | Ga0207711_10170653 | |||
| 2305 | Ga0207711_10232888 | |||
| 2306 | Ga0207711_10362901 | |||
| 2307 | Ga0207689_10002724 | |||
| 2308 | Ga0207689_10004730 | |||
| 2309 | Ga0207661_10015256 | |||
| 2310 | Ga0207661_10054406 | |||
| 2311 | Ga0207679_10001617 | |||
| 2312 | Ga0207679_10053172 | |||
| 2313 | Ga0207679_10141139 | |||
| 2314 | Ga0207667_10071955 | |||
| 2315 | Ga0207667_10321136 | |||
| 2316 | Ga0207667_10497494 | |||
| 2317 | Ga0207651_10003064 | |||
| 2318 | Ga0207651_10004195 | |||
| 2319 | Ga0207651_10016908 | |||
| 2320 | Ga0207651_10045351 | |||
| 2321 | Ga0207712_10003120 | |||
| 2322 | Ga0207712_10102162 | |||
| 2323 | Ga0207668_10005763 | |||
| 2324 | Ga0207668_10124678 | |||
| 2325 | Ga0207668_10182291 | |||
| 2326 | Ga0207668_10195487 | |||
| 2327 | Ga0207640_10015642 | |||
| 2328 | Ga0207640_10021910 | |||
| 2329 | Ga0207640_10146331 | |||
| 2330 | Ga0207640_10183600 | |||
| 2331 | Ga0207658_10014919 | |||
| 2332 | Ga0207658_10035286 | |||
| 2333 | Ga0207658_10082393 | |||
| 2334 | Ga0207658_10103806 | |||
| 2335 | Ga0207658_10264958 | |||
| 2336 | Ga0207677_10006418 | |||
| 2337 | Ga0207677_10016744 | |||
| 2338 | Ga0207677_10028083 | |||
| 2339 | Ga0207677_10064470 | |||
| 2340 | Ga0207703_10001822 | |||
| 2341 | Ga0207703_10021203 | |||
| 2342 | Ga0207703_10041983 | |||
| 2343 | Ga0207703_10126942 | |||
| 2344 | Ga0207639_10019446 | |||
| 2345 | Ga0207639_10023621 | |||
| 2346 | Ga0207639_10058770 | |||
| 2347 | Ga0207678_10000414 | |||
| 2348 | Ga0207678_10002471 | |||
| 2349 | Ga0207678_10019865 | |||
| 2350 | Ga0207678_10020641 | |||
| 2351 | Ga0207678_10035698 | |||
| 2352 | Ga0207678_10041442 | |||
| 2353 | Ga0207678_10092328 | |||
| 2354 | Ga0207708_10001992 | |||
| 2355 | Ga0207708_10002001 | |||
| 2356 | Ga0207708_10006744 | |||
| 2357 | Ga0207708_10038352 | |||
| 2358 | Ga0207702_10021444 | |||
| 2359 | Ga0207702_10039899 | |||
| 2360 | Ga0207702_10041530 | |||
| 2361 | Ga0207702_10067064 | |||
| 2362 | Ga0207702_10294721 | |||
| 2363 | Ga0207641_10009850 | |||
| 2364 | Ga0207641_10015249 | |||
| 2365 | Ga0207641_10019509 | |||
| 2366 | Ga0207648_10004767 | |||
| 2367 | Ga0207648_10010273 | |||
| 2368 | Ga0207648_10174941 | |||
| 2369 | Ga0207676_10001979 | |||
| 2370 | Ga0207676_10002246 | |||
| 2371 | Ga0207676_10013708 | |||
| 2372 | Ga0207676_10050786 | |||
| 2373 | Ga0207674_10007733 | |||
| 2374 | Ga0207674_10416934 | |||
| 2375 | Ga0207675_100003883 | |||
| 2376 | Ga0207675_100007986 | |||
| 2377 | Ga0207675_100057031 | |||
| 2378 | Ga0207683_10002044 | |||
| 2379 | Ga0207683_10009279 | |||
| 2380 | Ga0207683_10016334 | |||
| 2381 | Ga0207698_10031944 | |||
| 2382 | Ga0207698_10186189 | |||
| 2383 | Ga0209967_1003782 | |||
| 2384 | Ga0209179_1029109 | |||
| 2385 | Ga0209983_1007836 | |||
| 2386 | Ga0209971_1002807 | |||
| 2387 | Ga0209966_1001490 | |||
| 2388 | Ga0209998_10000888 | |||
| 2389 | Ga0209998_10001985 | |||
| 2390 | Ga0207428_10000137 | |||
| 2391 | Ga0207428_10000501 | |||
| 2392 | Ga0207428_10001016 | |||
| 2393 | Ga0207428_10006625 | |||
| 2394 | Ga0207428_10143993 | |||
| 2395 | Ga0207428_10165874 | |||
| 2396 | Ga0265357_1000343 | |||
| 2397 | Ga0268266_10000446 | |||
| 2398 | Ga0268266_10000670 | |||
| 2399 | Ga0268266_10001262 | |||
| 2400 | Ga0268266_10012528 | |||
| 2401 | Ga0268266_10029942 | |||
| 2402 | Ga0268266_10050610 | |||
| 2403 | Ga0268266_10157018 | |||
| 2404 | Ga0268265_10014556 | |||
| 2405 | Ga0268265_10022589 | |||
| 2406 | Ga0268265_10055116 | |||
| 2407 | Ga0268265_10072977 | |||
| 2408 | Ga0268264_10041889 | |||
| 2409 | Ga0268264_10112900 | |||
| 2410 | Ga0265337_1004042 | |||
| 2411 | Ga0265337_1026650 | |||
| 2412 | Ga0265318_10007102 | |||
| 2413 | Ga0307517_10000512 | |||
| 2414 | Ga0307517_10130606 | |||
| 2415 | Ga0265338_10065426 | |||
| 2416 | Ga0265338_10263042 | |||
| 2417 | Ga0265770_1006025 | |||
| 2418 | Ga0265760_10022505 | |||
| 2419 | Ga0265330_10015179 | |||
| 2420 | Ga0265332_10000839 | |||
| 2421 | Ga0265332_10067620 | |||
| 2422 | Ga0265328_10017174 | |||
| 2423 | Ga0265320_10006407 | |||
| 2424 | Ga0265325_10000073 | |||
| 2425 | Ga0265325_10001135 | |||
| 2426 | Ga0265325_10011811 | |||
| 2427 | Ga0265325_10030916 | |||
| 2428 | Ga0265329_10008929 | |||
| 2429 | Ga0265340_10000382 | |||
| 2430 | Ga0265340_10020821 | |||
| 2431 | Ga0265339_10001051 | |||
| 2432 | Ga0265339_10003487 | |||
| 2433 | Ga0265339_10043806 | |||
| 2434 | Ga0265339_10068642 | |||
| 2435 | Ga0265331_10015018 | |||
| 2436 | Ga0265331_10034057 | |||
| 2437 | Ga0265331_10038656 | |||
| 2438 | Ga0265316_10105375 | |||
| 2439 | Ga0265316_10123065 | |||
| 2440 | Ga0265313_10000716 | |||
| 2441 | Ga0265313_10038079 | |||
| 2442 | Ga0265313_10046363 | |||
| 2443 | Ga0265314_10002492 | |||
| 2444 | Ga0265314_10044370 | |||
| 2445 | Ga0265342_10000179 | |||
| 2446 | Ga0265342_10000308 | |||
| 2447 | Ga0265342_10007369 | |||
| 2448 | Ga0265342_10011726 | |||
| 2449 | Ga0265342_10030537 | |||
| 2450 | Ga0307516_10078953 | |||
| 2451 | Ga0307405_10283945 | |||
| 2452 | Ga0307409_100037914 | |||
| 2453 | Ga0307416_100224479 | |||
| 2454 | Ga0307415_100082198 | |||
| 2455 | Ga0307415_100327245 | |||
| 2456 | Ga0307510_10009215 | |||
| 2457 | Ga0307510_10009742 | |||
| 2458 | Ga0373948_0002227 | |||
| 2459 | Ga0373948_0015021 | |||
| 2460 | Ga0373950_0000796 | |||
| 2461 | Ga0373958_0000398 | |||
| 2462 | Ga0373958_0009846 | |||
| 2463 | Ga0373959_0009242 | |||
| 2464 | Ga0373938_0000726 | |||
| 2465 | Ga0373938_0002589 | |||
| 2466 | Ga0373926_0002344 | |||
| 2467 | Ga0373926_0009236 | |||
| 2468 | Ga0373926_0050832 | |||
| 2469 | Ga0373928_0000779 | |||
| 2470 | Ga0373928_0001267 | |||
| 2471 | Ga0373929_0000064 | |||
| 2472 | Ga0373929_0020662 | |||
| 2473 | Ga0373934_0007860 | |||
| 2474 | Ga0373934_0020314 | |||
| 2475 | Ga0373940_0000195 | |||
| 2476 | Ga0373944_0000648 | |||
| 2477 | Ga0373944_0001561 | |||
| 2478 | Ga0373944_0013726 | |||
| 2479 | Ga0373949_0000532 | |||
| 2480 | Ga0373949_0001783 | |||
| 2481 | Ga0373949_0005307 | |||
| 2482 | Ga0373951_0000849 | |||
| 2483 | Ga0373951_0009362 | |||
| 2484 | Ga0373952_0000213 | |||
| 2485 | Ga0373952_0004534 | |||
| 2486 | Ga0373952_0009378 | |||
| 2487 | Ga0373923_0000903 | |||
| 2488 | Ga0373923_0001215 | |||
| 2489 | Ga0373923_0004217 | |||
| 2490 | Ga0373923_0031169 | |||
| 2491 | Ga0373932_0002875 | |||
| 2492 | Ga0373932_0003090 | |||
| 2493 | Ga0373936_0001539 | |||
| 2494 | Ga0373936_0003882 | |||
| 2495 | Ga0373936_0010131 | |||
| 2496 | Ga0373939_0000619 | |||
| 2497 | Ga0373939_0007187 | |||
| 2498 | Ga0373939_0022601 | |||
| 2499 | Ga0373941_0000027 | |||
| 2500 | Ga0373941_0001078 | |||
| 2501 | Ga0373945_0000024 | |||
| 2502 | Ga0373945_0007150 | |||
| 2503 | Ga0373953_0002197 | |||
| 2504 | Ga0373953_0003448 | |||
| 2505 | Ga0373953_0012954 | |||
| 2506 | Ga0373953_0054980 | |||
| 2507 | Ga0373953_0072680 | |||
| 2508 | Ga0373954_0004597 | |||
| 2509 | Ga0373954_0004676 | |||
| 2510 | Ga0373954_0005155 | |||
| 2511 | Ga0373954_0021313 | |||
| 2512 | Ga0373954_0031272 | |||
| 2513 | Ga0373956_0001142 | |||
| 2514 | Ga0373956_0012890 | |||
| 2515 | Ga0373956_0020290 | |||
| 2516 | Ga0373956_0048050 | |||
| 2517 | Ga0373957_0004186 | |||
| 2518 | Ga0373957_0066681 | |||
| 2519 | Ga0373960_0000904 | |||
| 2520 | Ga0373960_0002618 | |||
| 2521 | Ga0373943_0013643 | |||
| 2522 | Ga0373943_0034830 | |||
| 2523 | Ga0373943_0042435 | |||
| 2524 | Ga0373943_0058552 | |||
| 2525 | Ga0373943_0087942 | |||
| 2526 | Ga0373943_0111838 | |||
| 2527 | Ga0373946_0005953 | |||
| 2528 | Ga0373946_0014935 | |||
| 2529 | Ga0373946_0015890 | |||
| 2530 | Ga0373946_0030578 | |||
| 2531 | Ga0373946_0044776 | |||
| 2532 | Ga0373946_0051134 | |||
| 2533 | Ga0373955_0000172 | |||
| 2534 | Ga0373955_0001767 | |||
| 2535 | Ga0373955_0003013 | |||
| 2536 | Ga0373955_0010601 | |||
| 2537 | Ga0373955_0023058 | |||
| 2538 | Ga0373955_0174344 | |||
| 2539 | Ga0373942_0000012 | |||
| 2540 | Ga0373942_0002310 | |||
| 2541 | Ga0373961_0000800 | |||
| 2542 | Ga0373961_0003565 | |||
| 2543 | Ga0373961_0006335 | |||
| 2544 | Ga0373961_0022769 | |||
| 2545 | Ga0373962_0000193 | |||
| 2546 | Ga0373962_0003472 | |||
| 2547 | Ga0373962_0011022 | |||
| 2548 | Ga0316574_0151975 | |||
| 2549 | Ga0373924_0001803 | |||
| 2550 | Ga0373924_0006937 | |||
| 2551 | Ga0373924_0045414 | |||
| 2552 | Ga0373931_0007554 | |||
| 2553 | Ga0373931_0008043 | |||
| 2554 | Ga0373931_0015883 | |||
| 2555 | Ga0373931_0035730 | |||
| 2556 | Ga0373931_0041914 | |||
| 2557 | Ga0373931_0066399 | |||
| 2558 | Ga0373931_0078912 | |||
| 2559 | Ga0373931_0096327 | |||
| 2560 | Ga0373931_0150578 | |||
| 2561 | Ga0373935_0000038 | |||
| 2562 | Ga0373935_0008124 | |||
| 2563 | Ga0373935_0008653 | |||
| 2564 | Ga0373935_0031453 | |||
| 2565 | Ga0373935_0044826 | |||
| 2566 | Ga0373935_0110469 | |||
| 2567 | Ga0373935_0165642 | |||
| 2568 | Ga0373927_0001618 | |||
| 2569 | Ga0373927_0003867 | |||
| 2570 | Ga0373927_0004343 | |||
| 2571 | Ga0373927_0017582 | |||
| 2572 | Ga0373927_0059755 | |||
| 2573 | Ga0373927_0098966 | |||
| 2574 | Ga0373927_0102646 | |||
| 2575 | Ga0373927_0119317 | |||
| 2576 | Ga0373927_0155327 | |||
| 2577 | Ga0373927_0246921 | |||
| 2578 | Ga0373933_0001050 | |||
| 2579 | Ga0373933_0009485 | |||
| 2580 | Ga0373933_0019818 | |||
| 2581 | Ga0373933_0043041 | |||
| 2582 | Ga0373933_0070438 | |||
| 2583 | Ga0373947_0000229 | |||
| 2584 | Ga0373947_0000581 | |||
| 2585 | Ga0373947_0001717 | |||
| 2586 | Ga0373947_0012283 | |||
| 2587 | Ga0373947_0014863 | |||
| 2588 | Ga0373947_0037899 | |||
| 2589 | Ga0373947_0042744 | |||
| 2590 | Ga0373947_0137024 | |||
| 2591 | Ga0373937_0000004 | |||
| 2592 | Ga0373937_0001194 | |||
| 2593 | Ga0373937_0004490 | |||
| 2594 | Ga0373937_0013915 | |||
| 2595 | Ga0373937_0051666 | |||
| 2596 | Ga0373937_0173638 | |||
| 2597 | Ga0373925_0000424 | |||
| 2598 | Ga0373925_0006642 | |||
| 2599 | Ga0373925_0011259 | |||
| 2600 | Ga0373925_0011691 | |||
| 2601 | Ga0373925_0029290 | |||
| 2602 | Ga0373925_0042290 | |||
| 2603 | Ga0373925_0094879 | |||
| 2604 | Ga0373925_0126885 | |||
| 2605 | Ga0373925_0162556 | |||
| 2606 | Ga0373925_0172627 | |||
| 2607 | Ga0373925_0317423 | |||
| 2608 | Ga0395898_0062352 | |||
| 2609 | Ga0395898_0166629 | |||
| 2610 | Ga0395898_0167403 | |||
| 2611 | Ga0395905_0070001 | |||
| 2612 | Ga0436364_0345988 | |||
| 2613 | Ga0436364_0423755 | |||
| 2614 | Ga0436364_1276955 | |||
| 2615 | Ga0436364_1535918 | |||
| 2616 | Ga0395901_0246201 | |||
| 2617 | Ga0395901_0477365 | |||
| 2618 | Ga0395901_0488820 | |||
| 2619 | Ga0436365_0076921 | |||
| 2620 | Ga0436365_0412636 | |||
| 2621 | Ga0436365_0444168 | |||
| 2622 | Ga0436365_0579618 | |||
| 2623 | Ga0436365_0842200 | |||
| 2624 | Ga0436365_1149508 | |||
| 2625 | Ga0436365_1209982 | |||
| 2626 | Ga0436365_1517019 | |||
| 2627 | Ga0436365_1582991 | |||
| 2628 | Ga0436365_1807266 | |||
| 2629 | Ga0436361_0601490 | |||
| 2630 | Ga0436361_1055020 | |||
| 2631 | Ga0436361_1192122 | |||
| 2632 | Ga0436363_0271626 | |||
| 2633 | Ga0436363_0548238 | |||
| 2634 | Ga0436363_1101874 | |||
| 2635 | Ga0436363_1268862 | |||
| 2636 | Ga0436363_1691760 | |||
| 2637 | Ga0439448_0026459 | |||
| 2638 | Ga0439455_0013241 | |||
| 2639 | Ga0466961_0061021 | |||
| 2640 | Ga0466961_0130400 | |||
| 2641 | Ga0466963_0153274 | |||
| 2642 | Ga0466957_0047540 | |||
| 2643 | Ga0451576_0020422 | |||
| 2644 | Ga0466967_0004180 | |||
| 2645 | Ga0466967_0050355 | |||
| 2646 | Ga0495617_017934 | |||
| 2647 | Ga0495592_0000032 | |||
| 2648 | Ga0495592_0009020 | |||
| 2649 | Ga0495592_0016478 | |||
| 2650 | Ga0495592_0016847 | |||
| 2651 | Ga0495603_0005155 | |||
| 2652 | Ga0495603_0013983 | |||
| 2653 | Ga0495603_0037151 | |||
| 2654 | Ga0495603_0061058 | |||
| 2655 | Ga0495603_0095239 | |||
| 2656 | Ga0495590_0040082 | |||
| 2657 | Ga0495629_0001232 | |||
| 2658 | Ga0495629_0001465 | |||
| 2659 | Ga0495629_0002050 | |||
| 2660 | Ga0495638_0008231 | |||
| 2661 | Ga0495638_0077106 | |||
| 2662 | Ga0495641_0006019 | |||
| 2663 | Ga0495641_0014796 | |||
| 2664 | Ga0495641_0026036 | |||
| 2665 | Ga0495641_0060393 | |||
| 2666 | Ga0495641_0075574 | |||
| 2667 | Ga0495651_0000799 | |||
| 2668 | Ga0495651_0001360 | |||
| 2669 | Ga0495651_0007731 | |||
| 2670 | Ga0495651_0013259 | |||
| 2671 | Ga0495653_0000012 | |||
| 2672 | Ga0495653_0001069 | |||
| 2673 | Ga0495653_0003134 | |||
| 2674 | Ga0495653_0018668 | |||
| 2675 | Ga0495580_0005009 | |||
| 2676 | Ga0495580_0017623 | |||
| 2677 | Ga0495580_0058785 | |||
| 2678 | Ga0495580_0302495 | |||
| 2679 | Ga0495582_0000570 | |||
| 2680 | Ga0495582_0004754 | |||
| 2681 | Ga0495582_0028921 | |||
| 2682 | Ga0495582_0034833 | |||
| 2683 | Ga0495582_0044708 | |||
| 2684 | Ga0495582_0102076 | |||
| 2685 | Ga0495639_0002103 | |||
| 2686 | Ga0495639_0014886 | |||
| 2687 | Ga0495639_0027206 | |||
| 2688 | Ga0495639_0050994 | |||
| 2689 | Ga0495639_0077878 | |||
| 2690 | Ga0495662_0000879 | |||
| 2691 | Ga0495662_0001012 | |||
| 2692 | Ga0495662_0002431 | |||
| 2693 | Ga0495662_0016111 | |||
| 2694 | Ga0495662_0025150 | |||
| 2695 | Ga0495664_0000004 | |||
| 2696 | Ga0495664_0000146 | |||
| 2697 | Ga0495664_0000563 | |||
| 2698 | Ga0495664_0126142 | |||
| 2699 | Ga0495584_0010718 | |||
| 2700 | Ga0495585_0002912 | |||
| 2701 | Ga0495585_0174701 | |||
| 2702 | Ga0495594_0026229 | |||
| 2703 | Ga0495594_0056365 | |||
| 2704 | Ga0495594_0101385 | |||
| 2705 | Ga0495607_0042874 | |||
| 2706 | Ga0495583_0087074 | |||
| 2707 | Ga0495608_0000017 | |||
| 2708 | Ga0495608_0002512 | |||
| 2709 | Ga0495608_0003432 | |||
| 2710 | Ga0495608_0015292 | |||
| 2711 | Ga0495608_0095690 | |||
| 2712 | Ga0495608_0099976 | |||
| 2713 | Ga0495608_0234590 | |||
| 2714 | Ga0495616_0067680 | |||
| 2715 | Ga0495618_0000006 | |||
| 2716 | Ga0495618_0000473 | |||
| 2717 | Ga0495618_0035358 | |||
| 2718 | Ga0495618_0091228 | |||
| 2719 | Ga0495628_0000001 | |||
| 2720 | Ga0495628_0004103 | |||
| 2721 | Ga0495628_0005499 | |||
| 2722 | Ga0495628_0011495 | |||
| 2723 | Ga0495630_0000422 | |||
| 2724 | Ga0495630_0007807 | |||
| 2725 | Ga0495630_0068325 | |||
| 2726 | Ga0495630_0139263 | |||
| 2727 | Ga0495630_0157466 | |||
| 2728 | Ga0495631_0113702 | |||
| 2729 | Ga0495637_0063129 | |||
| 2730 | Ga0495643_0052199 | |||
| 2731 | Ga0495644_0024172 | |||
| 2732 | Ga0495644_0043960 | |||
| 2733 | Ga0495648_0075844 | |||
| 2734 | Ga0495666_0010597 | |||
| 2735 | Ga0495666_0014995 | |||
| 2736 | Ga0495652_0000002 | |||
| 2737 | Ga0495652_0003864 | |||
| 2738 | Ga0495652_0047192 | |||
| 2739 | Ga0495652_0070621 | |||
| 2740 | Ga0495652_0330327 | |||
| 2741 | Ga0495665_0000227 | |||
| 2742 | Ga0495665_0084309 | |||
| 2743 | Ga0495640_0000001 | |||
| 2744 | Ga0495640_0001488 | |||
| 2745 | Ga0495640_0002833 | |||
| 2746 | Ga0495640_0024233 | |||
| 2747 | Ga0495640_0034413 | |||
| 2748 | Ga0495640_0059161 | |||
| 2749 | Ga0495640_0075095 | |||
| 2750 | Ga0495586_0012979 | |||
| 2751 | Ga0495587_0000008 | |||
| 2752 | Ga0495587_0003639 | |||
| 2753 | Ga0495587_0008368 | |||
| 2754 | Ga0495587_0012855 | |||
| 2755 | Ga0495598_0041403 | |||
| 2756 | Ga0495609_0065627 | |||
| 2757 | Ga0495609_0081439 | |||
| 2758 | Ga0495609_0100173 | |||
| 2759 | Ga0495621_0055834 | |||
| 2760 | Ga0495645_0000002 | |||
| 2761 | Ga0495645_0009348 | |||
| 2762 | Ga0495645_0023181 | |||
| 2763 | Ga0495645_0097739 | |||
| 2764 | Ga0495622_0000406 | |||
| 2765 | Ga0495633_0005373 | |||
| 2766 | Ga0495667_0000124 | |||
| 2767 | Ga0495667_0001092 | |||
| 2768 | Ga0495667_0011961 | |||
| 2769 | Ga0495667_0034171 | |||
| 2770 | Ga0495667_0037745 | |||
| 2771 | Ga0495667_0067913 | |||
| 2772 | Ga0495667_0082616 | |||
| 2773 | Ga0495667_0090432 | |||
| 2774 | Ga0495667_0090541 | |||
| 2775 | Ga0495656_0000554 | |||
| 2776 | Ga0495668_0077490 | |||
| 2777 | Ga0495668_0149001 | |||
| 2778 | Ga0495668_0157654 | |||
| 2779 | Ga0495634_0000003 | |||
| 2780 | Ga0495634_0004424 | |||
| 2781 | Ga0495634_0046635 | |||
| 2782 | Ga0495634_0109540 | |||
| 2783 | Ga0495634_0117121 | |||
| 2784 | Ga0495611_0034086 | |||
| 2785 | Ga0495635_0000002 | |||
| 2786 | Ga0495635_0002104 | |||
| 2787 | Ga0495635_0016723 | |||
| 2788 | Ga0495635_0022896 | |||
| 2789 | Ga0495635_0024301 | |||
| 2790 | Ga0495635_0031658 | |||
| 2791 | Ga0495635_0040864 | |||
| 2792 | Ga0495635_0128331 | |||
| 2793 | Ga0495635_0261668 | |||
| 2794 | Ga0495659_0016170 | |||
| 2795 | Ga0495659_0023703 | |||
| 2796 | Ga0495659_0035644 | |||
| 2797 | Ga0495588_0004978 | |||
| 2798 | Ga0495588_0127124 | |||
| 2799 | Ga0495657_0000054 | |||
| 2800 | Ga0495657_0008729 | |||
| 2801 | Ga0495657_0096183 | |||
| 2802 | Ga0495657_0158481 | |||
| 2803 | Ga0495599_0000005 | |||
| 2804 | Ga0495599_0020724 | |||
| 2805 | Ga0495599_0022366 | |||
| 2806 | Ga0495599_0035696 | |||
| 2807 | Ga0495599_0076139 | |||
| 2808 | Ga0495623_0000148 | |||
| 2809 | Ga0495623_0002021 | |||
| 2810 | Ga0495623_0027550 | |||
| 2811 | Ga0495623_0097234 | |||
| 2812 | Ga0495646_0000002 | |||
| 2813 | Ga0495646_0016750 | |||
| 2814 | Ga0495646_0035451 | |||
| 2815 | Ga0495646_0112055 | |||
| 2816 | Ga0495646_0155292 | |||
| 2817 | Ga0495647_0009539 | |||
| 2818 | Ga0495658_0000543 | |||
| 2819 | Ga0495658_0002466 | |||
| 2820 | Ga0495658_0034649 | |||
| 2821 | Ga0495658_0050889 | |||
| 2822 | Ga0495658_0135987 | |||
| 2823 | Ga0495613_0002489 | |||
| 2824 | Ga0495613_0168083 | |||
| 2825 | Ga0495613_0188279 | |||
| 2826 | Ga0495624_0001896 | |||
| 2827 | Ga0495624_0013382 | |||
| 2828 | Ga0495624_0027306 | |||
| 2829 | Ga0495624_0129200 | |||
| 2830 | Ga0495624_0168611 | |||
| 2831 | Ga0495670_0009745 | |||
| 2832 | Ga0495600_0000012 | |||
| 2833 | Ga0495600_0004562 | |||
| 2834 | Ga0495600_0006388 | |||
| 2835 | Ga0495600_0016042 | |||
| 2836 | Ga0495660_0114681 | |||
| 2837 | Ga0495660_0145528 | |||
| 2838 | Ga0495581_0003432 | |||
| 2839 | Ga0495581_0027818 | |||
| 2840 | Ga0495581_0058614 | |||
| 2841 | Ga0495581_0070554 | |||
| 2842 | Ga0495604_0000009 | |||
| 2843 | Ga0495604_0000422 | |||
| 2844 | Ga0495604_0013474 | |||
| 2845 | Ga0495604_0015408 | |||
| 2846 | Ga0495604_0057176 | |||
| 2847 | Ga0495674_0000002 | |||
| 2848 | Ga0495674_0000641 | |||
| 2849 | Ga0495674_0001683 | |||
| 2850 | Ga0495674_0026343 | |||
| 2851 | Ga0495674_0175444 | |||
| 2852 | Ga0495672_0030618 | |||
| 2853 | Ga0495676_0013899 | |||
| 2854 | Ga0495676_0014569 | |||
| 2855 | Ga0495676_0080098 | |||
| 2856 | Ga0495676_0115141 | |||
| 2857 | Ga0495676_0151994 | |||
| 2858 | Ga0495676_0265329 | |||
| 2859 | Ga0495680_0001385 | |||
| 2860 | Ga0495680_0002139 | |||
| 2861 | Ga0495680_0012328 | |||
| 2862 | Ga0495680_0031291 | |||
| 2863 | Ga0495680_0033026 | |||
| 2864 | Ga0495680_0059613 | |||
| 2865 | Ga0495680_0121345 | |||
| 2866 | Ga0495680_0133161 | |||
| 2867 | Ga0495680_0256882 | |||
| 2868 | Ga0495675_0000028 | |||
| 2869 | Ga0495675_0001398 | |||
| 2870 | Ga0495675_0002936 | |||
| 2871 | Ga0495675_0020224 | |||
| 2872 | Ga0495675_0173041 | |||
| 2873 | Ga0495685_021999 | |||
| 2874 | Ga0495684_0000006 | |||
| 2875 | Ga0495684_0003544 | |||
| 2876 | Ga0495684_0096843 | |||
| 2877 | Ga0495684_0173043 | |||
| 2878 | Ga0495684_0186828 | |||
| 2879 | Ga0495684_0246095 | |||
| 2880 | Ga0495593_0000140 | |||
| 2881 | Ga0495593_0003620 | |||
| 2882 | Ga0495593_0017662 | |||
| 2883 | Ga0495593_0019980 | |||
| 2884 | Ga0495593_0029930 | |||
| 2885 | Ga0495593_0058615 | |||
| 2886 | Ga0495593_0141588 | |||
| 2887 | Ga0495602_0000005 | |||
| 2888 | Ga0495602_0012613 | |||
| 2889 | Ga0495602_0013847 | |||
| 2890 | Ga0495602_0023728 | |||
| 2891 | Ga0495602_0028153 | |||
| 2892 | Ga0495602_0192161 | |||
| 2893 | Ga0495602_0224592 | |||
| 2894 | Ga0495602_0229125 | |||
| 2895 | Ga0495602_0318915 | |||
| 2896 | Ga0495614_0018609 | |||
| 2897 | Ga0495614_0050054 | |||
| 2898 | Ga0496100_0003363 | |||
| 2899 | Ga0496100_0010707 | |||
| 2900 | Ga0496100_0022979 | |||
| 2901 | Ga0496100_0126935 | |||
| 2902 | Ga0496101_0001983 | |||
| 2903 | Ga0496101_0004451 | |||
| 2904 | Ga0496101_0029082 | |||
| 2905 | Ga0496101_0038116 | |||
| 2906 | Ga0496101_0110681 | |||
| 2907 | Ga0496101_0162285 | |||
| 2908 | Ga0496101_0179948 | |||
| 2909 | Ga0496101_0228615 | |||
| 2910 | Ga0496102_0002793 | |||
| 2911 | Ga0496102_0006263 | |||
| 2912 | Ga0496102_0018288 | |||
| 2913 | Ga0496102_0031173 | |||
| 2914 | Ga0496102_0115925 | |||
| 2915 | Ga0496102_0120566 | |||
| 2916 | Ga0496102_0136784 | |||
| 2917 | Ga0496102_0158177 | |||
| 2918 | Ga0496102_0211868 | |||
| 2919 | Ga0496103_0002369 | |||
| 2920 | Ga0496103_0018805 | |||
| 2921 | Ga0496103_0025729 | |||
| 2922 | Ga0496103_0032986 | |||
| 2923 | Ga0496104_0000092 | |||
| 2924 | Ga0496104_0001496 | |||
| 2925 | Ga0496104_0002184 | |||
| 2926 | Ga0496104_0003070 | |||
| 2927 | Ga0496104_0004660 | |||
| 2928 | Ga0496104_0008945 | |||
| 2929 | Ga0496104_0095919 | |||
| 2930 | Ga0496104_0115235 | |||
| 2931 | Ga0496104_0199419 | |||
| 2932 | Ga0496104_0381273 | |||
| 2933 | Ga0496105_0002505 | |||
| 2934 | Ga0496105_0017751 | |||
| 2935 | Ga0496105_0032314 | |||
| 2936 | Ga0496105_0038039 | |||
| 2937 | Ga0496105_0044916 | |||
| 2938 | Ga0496105_0056308 | |||
| 2939 | Ga0496105_0083712 | |||
| 2940 | Ga0496105_0147889 | |||
| 2941 | Ga0496105_0257332 | |||
| 2942 | Ga0496106_0001556 | |||
| 2943 | Ga0496106_0006513 | |||
| 2944 | Ga0496106_0007123 | |||
| 2945 | Ga0496106_0010646 | |||
| 2946 | Ga0496106_0011495 | |||
| 2947 | Ga0496106_0025653 | |||
| 2948 | Ga0496106_0053802 | |||
| 2949 | Ga0496106_0143715 | |||
| 2950 | Ga0496106_0215676 | |||
| 2951 | Ga0496107_0002095 | |||
| 2952 | Ga0496107_0006823 | |||
| 2953 | Ga0496107_0009309 | |||
| 2954 | Ga0496107_0011605 | |||
| 2955 | Ga0496107_0011996 | |||
| 2956 | Ga0496107_0034987 | |||
| 2957 | Ga0496107_0037902 | |||
| 2958 | Ga0496107_0129269 | |||
| 2959 | Ga0496107_0301825 | |||
| 2960 | Ga0496108_0044354 | |||
| 2961 | Ga0496108_0061493 | |||
| 2962 | Ga0496108_0126233 | |||
| 2963 | Ga0496108_0270335 | |||
| 2964 | Ga0496108_0423472 | |||
| 2965 | Ga0496109_0004575 | |||
| 2966 | Ga0496109_0004879 | |||
| 2967 | Ga0496109_0024900 | |||
| 2968 | Ga0496109_0066090 | |||
| 2969 | Ga0496109_0074738 | |||
| 2970 | Ga0496110_0008731 | |||
| 2971 | Ga0496110_0033011 | |||
| 2972 | Ga0496110_0045663 | |||
| 2973 | Ga0496110_0074244 | |||
| 2974 | Ga0496110_0297043 | |||
| 2975 | Ga0496110_0310766 | |||
| 2976 | Ga0496111_0002467 | |||
| 2977 | Ga0496111_0005664 | |||
| 2978 | Ga0496111_0033708 | |||
| 2979 | Ga0496111_0071923 | |||
| 2980 | Ga0496111_0072960 | |||
| 2981 | Ga0496111_0118903 | |||
| 2982 | Ga0496112_0012109 | |||
| 2983 | Ga0496112_0013195 | |||
| 2984 | Ga0496112_0026113 | |||
| 2985 | Ga0496112_0058511 | |||
| 2986 | Ga0496112_0063132 | |||
| 2987 | Ga0496112_0070420 | |||
| 2988 | Ga0496112_0122868 | |||
| 2989 | Ga0496112_0138807 | |||
| 2990 | Ga0496112_0210891 | |||
| 2991 | Ga0496112_0221768 | |||
| 2992 | Ga0496112_0269770 | |||
| 2993 | Ga0496112_0377595 | |||
| 2994 | Ga0496113_0004559 | |||
| 2995 | Ga0496113_0030266 | |||
| 2996 | Ga0496113_0203544 | |||
| 2997 | Ga0496113_0427901 | |||
| 2998 | Ga0496114_0007468 | |||
| 2999 | Ga0496114_0014545 | |||
| 3000 | Ga0496114_0045150 | |||
| 3001 | Ga0496114_0065969 | |||
| 3002 | Ga0496114_0070232 | |||
| 3003 | Ga0496114_0076177 | |||
| 3004 | Ga0496114_0157252 | |||
| 3005 | Ga0496114_0191758 | |||
| 3006 | Ga0496115_0002647 | |||
| 3007 | Ga0496115_0003701 | |||
| 3008 | Ga0496115_0008444 | |||
| 3009 | Ga0496115_0014579 | |||
| 3010 | Ga0496115_0015732 | |||
| 3011 | Ga0496115_0023426 | |||
| 3012 | Ga0496115_0023859 | |||
| 3013 | Ga0496115_0029485 | |||
| 3014 | Ga0496115_0031985 | |||
| 3015 | Ga0496115_0044951 | |||
| 3016 | Ga0496115_0086975 | |||
| 3017 | Ga0496115_0100489 | |||
| 3018 | Ga0496115_0152473 | |||
| 3019 | Ga0496115_0158786 | |||
| 3020 | Ga0496115_0377670 | |||
| 3021 | Ga0496115_0405039 | |||
| 3022 | Ga0496119_0004791 | |||
| 3023 | Ga0496120_0058817 | |||
| 3024 | Ga0496121_0000221 | |||
| 3025 | Ga0496121_0002376 | |||
| 3026 | Ga0496122_0004715 | |||
| 3027 | Ga0496122_0038130 | |||
| 3028 | Ga0496122_0067923 | |||
| 3029 | Ga0496123_0000896 | |||
| 3030 | Ga0496125_0089726 | |||
| 3031 | Ga0496126_0001612 | |||
| 3032 | Ga0496126_0010859 | |||
| 3033 | Ga0496126_0058390 | |||
| 3034 | Ga0496126_0131925 | |||
| 3035 | Ga0501032_0010289 | |||
| 3036 | Ga0501032_0012972 | |||
| 3037 | Ga0501032_0068072 | |||
| 3038 | Ga0501032_0082357 | |||
| 3039 | Ga0501032_0183670 | |||
| 3040 | Ga0501033_0007661 | |||
| 3041 | Ga0501033_0012963 | |||
| 3042 | Ga0501033_0037850 | |||
| 3043 | Ga0501034_0001958 | |||
| 3044 | Ga0501034_0005332 | |||
| 3045 | Ga0501034_0022013 | |||
| 3046 | Ga0501034_0120311 | |||
| 3047 | Ga0501034_0149038 | |||
| 3048 | Ga0501034_0287018 | |||
| 3049 | Ga0501034_0362491 | |||
| 3050 | Ga0501036_0000177 | |||
| 3051 | Ga0501036_0025279 | |||
| 3052 | Ga0501036_0190859 | |||
| 3053 | Ga0501037_0044129 | |||
| 3054 | Ga0501037_0060809 | |||
| 3055 | Ga0501037_0147000 | |||
| 3056 | Ga0501037_0246760 | |||
| 3057 | Ga0501038_0060423 | |||
| 3058 | Ga0501038_0152036 | |||
| 3059 | Ga0501038_0261202 | |||
| 3060 | Ga0501038_0297497 | |||
| 3061 | Ga0501039_0071256 | |||
| 3062 | Ga0501040_0036906 | |||
| 3063 | Ga0501041_0012173 | |||
| 3064 | Ga0501041_0201472 | |||
| 3065 | Ga0501043_0001480 | |||
| 3066 | Ga0501043_0027137 | |||
| 3067 | Ga0501043_0071087 | |||
| 3068 | Ga0501043_0293721 | |||
| 3069 | Ga0501046_0080311 | |||
| 3070 | Ga0501047_0000756 | |||
| 3071 | Ga0501047_0063953 | |||
| 3072 | Ga0501047_0236407 | |||
| 3073 | Ga0501047_0301515 | |||
| 3074 | Ga0501048_0000115 | |||
| 3075 | Ga0501048_0000357 | |||
| 3076 | Ga0501068_0007338 | |||
| 3077 | Ga0501070_0000711 | |||
| 3078 | Ga0501070_0022959 | |||
| 3079 | Ga0501070_0041057 | |||
| 3080 | Ga0501070_0213232 | |||
| 3081 | Ga0501071_0129021 | |||
| 3082 | Ga0501072_0052570 | |||
| 3083 | Ga0501073_0013709 | |||
| 3084 | Ga0501073_0027800 | |||
| 3085 | Ga0501074_0063526 | |||
| 3086 | Ga0501076_0004238 | |||
| 3087 | Ga0501077_0061193 | |||
| 3088 | Ga0501077_0063025 | |||
| 3089 | Ga0501079_0012618 | |||
| 3090 | Ga0501079_0043632 | |||
| 3091 | Ga0501079_0126174 | |||
| 3092 | Ga0501080_0003552 | |||
| 3093 | Ga0501080_0053896 | |||
| 3094 | Ga0501080_0132077 | |||
| 3095 | Ga0501081_0249931 | |||
| 3096 | Ga0501083_0007330 | |||
| 3097 | Ga0501083_0014091 | |||
| 3098 | Ga0501083_0033341 | |||
| 3099 | Ga0501083_0046358 | |||
| 3100 | Ga0501035_0014773 | |||
| 3101 | Ga0501035_0032539 | |||
| 3102 | Ga0501035_0085018 | |||
| 3103 | Ga0501035_0174786 | |||
| 3104 | Ga0501044_0035047 | |||
| 3105 | Ga0501044_0163665 | |||
| 3106 | Ga0501044_0236190 | |||
| 3107 | Ga0501044_0249294 | |||
| 3108 | Ga0501045_0035685 | |||
| 3109 | Ga0501045_0105199 | |||
| 3110 | nmdc:mga03683_37233_c1 | |||
| 3111 | nmdc:mga03n38_16516_c1 | |||
| 3112 | nmdc:mga03n38_6050_c1 | |||
| 3113 | nmdc:mga03n38_65129_c1 | |||
| 3114 | nmdc:mga00v17_38731_c1 | |||
| 3115 | nmdc:mga00v17_41217_c1 | |||
| 3116 | nmdc:mga00v17_87003_c1 | |||
| 3117 | nmdc:mga0yw44_114654_c1 | |||
| 3118 | nmdc:mga0yw44_124287_c1 | |||
| 3119 | nmdc:mga0yw44_31228_c1 | |||
| 3120 | nmdc:mga0yw44_813_c1 | |||
| 3121 | nmdc:mga0k408_100398_c1 | |||
| 3122 | nmdc:mga0k408_106249_c1 | |||
| 3123 | nmdc:mga0k408_110273_c1 | |||
| 3124 | nmdc:mga0k408_274669_c1 | |||
| 3125 | nmdc:mga0k408_56850_c1 | |||
| 3126 | nmdc:mga06z11_2739_c1 | |||
| 3127 | nmdc:mga06z11_36637_c1 | |||
| 3128 | nmdc:mga07m45_130278_c1 | |||
| 3129 | nmdc:mga07m45_29681_c1 | |||
| 3130 | nmdc:mga07m45_96803_c1 | |||
| 3131 | nmdc:mga05p37_109457_c1 | |||
| 3132 | nmdc:mga05p37_140_c1 | |||
| 3133 | nmdc:mga05p37_6119_c1 | |||
| 3134 | nmdc:mga05p37_66_c1 | |||
| 3135 | nmdc:mga05p37_71061_c1 | |||
| 3136 | nmdc:mga05p37_7273_c1 | |||
| 3137 | nmdc:mga05p37_82393_c1 | |||
| 3138 | nmdc:mga09592_1649_c1 | |||
| 3139 | nmdc:mga09592_672_c1 | |||
| 3140 | nmdc:mga09592_72071_c1 | |||
| 3141 | nmdc:mga0qj67_234885_c1 | |||
| 3142 | nmdc:mga0qj67_24846_c1 | |||
| 3143 | nmdc:mga0qj67_341_c1 | |||
| 3144 | nmdc:mga0qj67_36670_c1 | |||
| 3145 | nmdc:mga0qj67_58518_c1 | |||
| 3146 | nmdc:mga06r32_171978_c1 | |||
| 3147 | nmdc:mga06r32_206794_c1 | |||
| 3148 | nmdc:mga06r32_35478_c1 | |||
| 3149 | nmdc:mga06r32_404_c1 | |||
| 3150 | nmdc:mga06r32_47137_c1 | |||
| 3151 | nmdc:mga06r32_671_c1 | |||
| 3152 | nmdc:mga08y16_104_c1 | |||
| 3153 | nmdc:mga08y16_122720_c1 | |||
| 3154 | nmdc:mga08y16_193762_c1 | |||
| 3155 | nmdc:mga08y16_275652_c1 | |||
| 3156 | nmdc:mga08y16_615_c1 | |||
| 3157 | nmdc:mga08y16_865_c1 | |||
| 3158 | nmdc:mga0n895_125715_c1 | |||
| 3159 | nmdc:mga0n895_181670_c1 | |||
| 3160 | nmdc:mga0n895_19802_c1 | |||
| 3161 | nmdc:mga0n895_207416_c1 | |||
| 3162 | nmdc:mga0n895_258606_c1 | |||
| 3163 | nmdc:mga0n895_266281_c1 | |||
| 3164 | nmdc:mga0n895_43_c1 | |||
| 3165 | nmdc:mga0rr50_187906_c1 | |||
| 3166 | nmdc:mga0rr50_5102_c1 | |||
| 3167 | nmdc:mga0rr50_85379_c1 | |||
| 3168 | nmdc:mga08x19_127599_c1 | |||
| 3169 | nmdc:mga08x19_4943_c1 | |||
| 3170 | nmdc:mga08x19_9575_c1 | |||
| 3171 | nmdc:mga0a205_11361_c1 | |||
| 3172 | nmdc:mga0a205_19073_c1 | |||
| 3173 | nmdc:mga0a205_268_c1 | |||
| 3174 | nmdc:mga0a205_289522_c1 | |||
| 3175 | nmdc:mga0a205_86437_c1 | |||
| 3176 | nmdc:mga0sz30_8011_c1 | |||
| 3177 | Ga0495601_0000002 | |||
| 3178 | Ga0495601_0000860 | |||
| 3179 | Ga0495601_0001376 | |||
| 3180 | Ga0495601_0002635 | |||
| 3181 | Ga0495601_0008009 | |||
| 3182 | Ga0495601_0014329 | |||
| 3183 | Ga0495601_0042558 | |||
| 3184 | Ga0495601_0082542 | |||
| 3185 | Ga0495601_0105887 | |||
| 3186 | Ga0495601_0252910 | |||
| 3187 | Ga0495612_0000010 | |||
| 3188 | Ga0495612_0000075 | |||
| 3189 | Ga0495612_0000562 | |||
| 3190 | Ga0495612_0001712 | |||
| 3191 | Ga0495612_0002201 | |||
| 3192 | Ga0495612_0013643 | |||
| 3193 | Ga0495612_0040405 | |||
| 3194 | Ga0495612_0058465 | |||
| 3195 | Ga0495595_0000026 | |||
| 3196 | Ga0495595_0000168 | |||
| 3197 | Ga0495595_0000589 | |||
| 3198 | Ga0495595_0003174 | |||
| 3199 | Ga0495595_0008606 | |||
| 3200 | Ga0495595_0013688 | |||
| 3201 | Ga0495595_0046146 | |||
| 3202 | Ga0495595_0070190 | |||
| 3203 | Ga0495619_0000019 | |||
| 3204 | Ga0495619_0000045 | |||
| 3205 | Ga0495619_0000388 | |||
| 3206 | Ga0495619_0003526 | |||
| 3207 | Ga0495619_0008861 | |||
| 3208 | Ga0495619_0013999 | |||
| 3209 | Ga0495619_0016140 | |||
| 3210 | Ga0495619_0027612 | |||
| 3211 | Ga0495619_0032806 | |||
| 3212 | Ga0495619_0109834 | |||
| 3213 | Ga0500643_001251 | |||
| 3214 | Ga0500566_0001887 | |||
| 3215 | Ga0500566_0019309 | |||
| 3216 | Ga0500641_0016442 | |||
| 3217 | Ga0500556_0000290 | |||
| 3218 | Ga0500593_000029 | |||
| 3219 | Ga0500595_000002 | |||
| 3220 | Ga0500595_001597 | |||
| 3221 | Ga0500652_000005 | |||
| 3222 | Ga0500652_005131 | |||
| 3223 | Ga0500559_0006649 | |||
| 3224 | Ga0500559_0025572 | |||
| 3225 | Ga0500568_0000004 | |||
| 3226 | Ga0500589_025042 | |||
| 3227 | Ga0500589_035423 | |||
| 3228 | Ga0500590_011273 | |||
| 3229 | Ga0500616_0000002 | |||
| 3230 | Ga0500616_0006754 | |||
| 3231 | Ga0500638_000120 | |||
| 3232 | Ga0500637_0000070 | |||
| 3233 | Ga0500611_027050 | |||
| 3234 | Ga0500645_000156 | |||
| 3235 | Ga0500645_038386 | |||
| 3236 | Ga0501084_0160775 | |||
| 3237 | Ga0500661_000547 | |||
| 3238 | Ga0501082_0007283 | |||
| 3239 | Ga0501082_0169542 | |||
| 3240 | Ga0501082_0254320 | |||
| 3241 | Ga0530510_0107136 | |||
| 3242 | Ga0530510_0110402 | |||
| 3243 | 2513591490 | |||
| 3244 | 2513677761 | |||
| 3245 | 2513693277 | |||
| 3246 | 2524467746 | |||
| 3247 | 2545679291 | |||
| 3248 | 2596372627 | |||
| 3249 | 2643757308 | |||
| 3250 | 2723848187 | |||
| 3251 | 2793078104 | |||
| 3252 | 2824723110 | |||
| 3253 | 2828308332 | |||
| 3254 | 2857527140 | |||
| 3255 | 2874608825 | |||
| 3256 | 2879115446 | |||
| 3257 | 2885390477 | |||
| 3258 | 2889037297 | |||
| 3259 | 2889308376 | |||
| 3260 | 2893068082 | |||
| 3261 | 2899260375 | |||
| 3262 | 2902331308 | |||
| 3263 | 2902410753 | |||
| 3264 | 2903774279 | |||
| 3265 | 2919078255 | |||
| 3266 | 2919451909 | |||
| 3267 | 2922361428 | |||
| 3268 | 2922388851 | |||
| 3269 | 2928127578 | |||
| 3270 | 3003671439 | |||
| 3271 | 641644620 | |||
| 3272 | 643602802 | |||
| 3273 | 8001849999 | |||
| 3274 | 8006968877 | |||
| 3275 | 8006985241 | |||
| 3276 | 8006998562 | |||
| 3277 | 8056675906 | |||
| 3278 | 8056682175 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r44-assembly1.cif.gz_A | crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution | 0.902 | 6 | 331 |
| 2r44-assembly1.cif.gz_A | crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution | 0.8785 | 6 | 331 |
| 4upb-assembly1.cif.gz_C | electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci | 0.8168 | 20 | 330 |
| 4upb-assembly1.cif.gz_E | electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci | 0.8054 | 20 | 335 |
| 6q7m-assembly1.cif.gz_Z | spiral structure of e. coli rava in the rava-ldci cage-like complex | 0.7833 | 20 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q79FN7_37_232_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9652 | 25 | 219 | 3.40.50.300 |
| af_I6YGX9_248_354_1.10.8.80 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain | 0.9515 | 233 | 334 | 1.10.8.80 |
| af_Q79FN7_37_232_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9365 | 25 | 219 | 3.40.50.300 |
| af_O53314_205_312_1.10.8.80 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain | 0.9334 | 224 | 334 | 1.10.8.80 |
| af_Q79FN7_233_349_1.10.8.80 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain | 0.914 | 221 | 331 | 1.10.8.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S8EE60-F1-model_v4 | AAA domain-containing protein | 0.9902 | 13 | 336 |
GO:0005524
GO:0016887 |
| AF-A0A439V4C5-F1-model_v4 | AAA family ATPase | 0.9902 | 76 | 146 |
GO:0005524
GO:0016887 |
| AF-A0A529WXH1-F1-model_v4 | MoxR family ATPase | 0.9886 | 13 | 333 |
GO:0005524
GO:0016887 |
| AF-X6D4F3-F1-model_v4 | ATPase AAA | 0.9882 | 16 | 333 |
GO:0005524
GO:0016887 |
| AF-A0A1Q8ZQI2-F1-model_v4 | AAA family ATPase | 0.9881 | 13 | 334 |
GO:0005524
GO:0016887 |