F495162

General Info

Members Datasets Scaffolds Average Seq Length
1639 526 3278 336

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0132472|Ga0501072_0132472_28_1149
Length 373
Sequence MLPKESAFRPWSSVVTGGATKRFAERGPGRAENGAQSMAAVSSEGIEKLEDAIVRAAEATAASVRAAKSVIGTVIFGQEKVVEQALITVLCGGHALLVGLPGLAKTKLVDTMGVALGLDARRIQFTPDLMPSDIVGSEVLEEDQAGRRNFRFIPGPVFTQLLMADEINRASPRTQSALLQAMQELHVTVAGARHEVPRPFHVLATQNPIEQEGTYSLPEAQLDRFLMQIDVDYPDRDAERRIVFDTTGAEESKPKQAMTADDLLAAQRLVRRLPVGESVVEAILTLVRSARPGPDGGELAQPIAWGPSPRASQALMLAVRARALLDGRLAPSIDDVHEMAEPVLKHRMALSFAARAEGETIGSVVGRLKARIG

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
165 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
167 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
250 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
258 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
267 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
268 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
271 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
272 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
275 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
276 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
277 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
278 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
279 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
280 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
281 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
282 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
283 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
284 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
285 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
286 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
287 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
293 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
294 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
295 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
296 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
297 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
298 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
303 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
304 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
305 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
306 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
307 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
308 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
311 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
317 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
318 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
321 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
322 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
323 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
324 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
325 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
349 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
360 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
361 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
362 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
363 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
369 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
370 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
371 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
372 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
373 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
374 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
375 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
376 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
442 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
443 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
444 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
445 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
446 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
451 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
452 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
453 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
456 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
457 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
458 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
459 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
460 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
461 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
462 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
463 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
464 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
465 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
466 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
472 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
473 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
474 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
475 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
476 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
477 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
480 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
481 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
482 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
483 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
484 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
485 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
486 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
487 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
488 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
489 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
490 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
491 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
492 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
493 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
494 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
495 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
496 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
497 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
498 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
499 2791355199
500 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
501 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
502 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
503 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
504 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
505 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
506 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
507 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
508 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
509 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
510 2902330777 Methylobacterium sp. 2A Isolate Unclassified
511 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
512 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
513 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
514 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
515 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
516 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
517 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
518 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
519 641522639 Methylobacterium sp. 4-46 Isolate Nodule
520 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
521 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
522 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
525 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
526 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0.43
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 1.04
Rhizoplane 7.57
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0132472 3300049588 Bacteria 1987
2 2214544914 2209111006 Bacteria 24470
3 ARcpr5oldR_c000055 3300000041 Bacteria 20973
4 ARSoilOldRDRAFT_c000092 3300000044 Bacteria 16845
5 ARCol0oldRDRAFT_c00958 3300000045 Bacteria 2223
6 ARCol0yngRDRAFT_1000049 3300000652 Bacteria 20970
7 JGI24746J21847_1000660 3300001977 Bacteria 5285
8 JGI24746J21847_1003668 3300001977 Bacteria 2422
9 JGI24739J22299_10005070 3300001989 Bacteria 5015
10 JGI24737J22298_10001725 3300001990 Bacteria 7790
11 JGI24737J22298_10006539 3300001990 Bacteria 3974
12 JGI24737J22298_10008869 3300001990 Bacteria 3357
13 JGI24750J21931_1000201 3300002070 Bacteria 10078
14 JGI24738J21930_10013666 3300002075 Bacteria 1751
15 JGI24749J21850_1003715 3300002076 Bacteria 2136
16 JGI24749J21850_1005688 3300002076 Bacteria 1741
17 JGI24744J21845_10002186 3300002077 Bacteria 3978
18 JGI24744J21845_10004285 3300002077 Bacteria 2944
19 JGI24035J26624_1000855 3300002126 Bacteria 2865
20 JGI24034J26672_10001663 3300002239 Bacteria 2983
21 JGI24742J22300_10000548 3300002244 Bacteria 5621
22 JGI25406J46586_10003809 3300003203 Bacteria 7048
23 JGI25406J46586_10007133 3300003203 Bacteria 5117
24 JGI25153J46596_10003847 3300003215 Bacteria 8260
25 JGI26129J50193_1002302 3300003349 Bacteria 1340
26 JGI25404J52841_10001785 3300003659 Bacteria 3898
27 JGI25405J52794_10006511 3300003911 Bacteria 2134
28 Ga0065712_10069289 3300005290 Bacteria 7569
29 Ga0065715_10000947 3300005293 Bacteria 9826
30 Ga0065715_10096595 3300005293 Bacteria 3846
31 Ga0070658_10065700 3300005327 Bacteria 2962
32 Ga0070658_10080543 3300005327 Bacteria 2675
33 Ga0070676_10004291 3300005328 Bacteria 7488
34 Ga0070676_10069735 3300005328 Bacteria 2107
35 Ga0070676_10267144 3300005328 Bacteria 1148
36 Ga0070683_100004677 3300005329 Bacteria 11310
37 Ga0070683_100080091 3300005329 Bacteria 3057
38 Ga0070683_100115011 3300005329 Bacteria 2539
39 Ga0070690_100008757 3300005330 Bacteria 5842
40 Ga0070690_100012125 3300005330 Bacteria 5066
41 Ga0070690_100032348 3300005330 Bacteria 3266
42 Ga0070690_100087661 3300005330 Bacteria 2044
43 Ga0070690_100173921 3300005330 Bacteria 1484
44 Ga0070670_100004378 3300005331 Bacteria 11820
45 Ga0070670_100006765 3300005331 Bacteria 9714
46 Ga0070670_100094117 3300005331 Bacteria 2577
47 Ga0070670_100179502 3300005331 Bacteria 1838
48 Ga0070677_10010687 3300005333 Bacteria 3145
49 Ga0070677_10022125 3300005333 Bacteria 2338
50 Ga0068869_100000546 3300005334 Bacteria 21018
51 Ga0070666_10016324 3300005335 Bacteria 4749
52 Ga0070680_100007445 3300005336 Bacteria 8352
53 Ga0070680_100009775 3300005336 Bacteria 7384
54 Ga0070680_100070058 3300005336 Bacteria 2880
55 Ga0070682_100003445 3300005337 Bacteria 8766
56 Ga0070682_100018516 3300005337 Bacteria 4073
57 Ga0070682_100023757 3300005337 Bacteria 3642
58 Ga0070682_100059999 3300005337 Bacteria 2404
59 Ga0070682_100115164 3300005337 Bacteria 1797
60 Ga0070682_100277844 3300005337 Bacteria 1219
61 Ga0068868_100013168 3300005338 Bacteria 6058
62 Ga0068868_100026486 3300005338 Bacteria 4420
63 Ga0068868_100029085 3300005338 Bacteria 4231
64 Ga0070660_100004111 3300005339 Bacteria 10041
65 Ga0070660_100024866 3300005339 Bacteria 4448
66 Ga0070660_100066748 3300005339 Bacteria 2802
67 Ga0070689_100002392 3300005340 Bacteria 12238
68 Ga0070689_100011343 3300005340 Bacteria 6380
69 Ga0070689_100023636 3300005340 Bacteria 4603
70 Ga0070689_100032975 3300005340 Bacteria 3943
71 Ga0070691_10003723 3300005341 Bacteria 6886
72 Ga0070691_10030403 3300005341 Bacteria 2530
73 Ga0070691_10059641 3300005341 Bacteria 1834
74 Ga0070691_10077486 3300005341 Bacteria 1623
75 Ga0070687_100001017 3300005343 Bacteria 9561
76 Ga0070687_100065224 3300005343 Bacteria 1937
77 Ga0070687_100081880 3300005343 Bacteria 1764
78 Ga0070661_100001763 3300005344 Bacteria 15010
79 Ga0070661_100036019 3300005344 Bacteria 3597
80 Ga0070661_100085189 3300005344 Bacteria 2335
81 Ga0070661_100180667 3300005344 Bacteria 1605
82 Ga0070661_100209699 3300005344 Bacteria 1491
83 Ga0070692_10074200 3300005345 Bacteria 1819
84 Ga0070692_10150731 3300005345 Bacteria 1324
85 Ga0070668_100049439 3300005347 Bacteria 3235
86 Ga0070668_100093478 3300005347 Bacteria 2373
87 Ga0070668_100230623 3300005347 Bacteria 1530
88 Ga0070669_100009976 3300005353 Bacteria 6754
89 Ga0070669_100033750 3300005353 Bacteria 3703
90 Ga0070669_100072827 3300005353 Bacteria 2544
91 Ga0070669_100074273 3300005353 Bacteria 2521
92 Ga0070669_100382860 3300005353 Bacteria 1147
93 Ga0070675_100029783 3300005354 Bacteria 4404
94 Ga0070675_100059157 3300005354 Bacteria 3160
95 Ga0070671_100007031 3300005355 Bacteria 9015
96 Ga0070671_100019747 3300005355 Bacteria 5488
97 Ga0070671_100033007 3300005355 Bacteria 4279
98 Ga0070671_100231059 3300005355 Bacteria 1569
99 Ga0070674_100018657 3300005356 Bacteria 4392
100 Ga0070674_100065444 3300005356 Bacteria 2551
101 Ga0070674_100107752 3300005356 Bacteria 2040
102 Ga0070674_100210462 3300005356 Bacteria 1507
103 Ga0070673_100000050 3300005364 Bacteria 49499
104 Ga0070673_100018483 3300005364 Bacteria 4981
105 Ga0070673_100074967 3300005364 Bacteria 2727
106 Ga0070673_100199892 3300005364 Bacteria 1721
107 Ga0070688_100005098 3300005365 Bacteria 6886
108 Ga0070688_100006605 3300005365 Bacteria 6209
109 Ga0070688_100019351 3300005365 Bacteria 3943
110 Ga0070688_100075812 3300005365 Bacteria 2163
111 Ga0070659_100014541 3300005366 Bacteria 5882
112 Ga0070659_100037328 3300005366 Bacteria 3787
113 Ga0070659_100078543 3300005366 Bacteria 2633
114 Ga0070659_100105397 3300005366 Bacteria 2272
115 Ga0070659_100120676 3300005366 Bacteria 2123
116 Ga0070659_100301430 3300005366 Bacteria 1336
117 Ga0070667_100036040 3300005367 Bacteria 4146
118 Ga0070667_100038413 3300005367 Bacteria 4013
119 Ga0070667_100040047 3300005367 Bacteria 3929
120 Ga0070667_100078274 3300005367 Bacteria 2824
121 Ga0070667_100329792 3300005367 Bacteria 1378
122 Ga0070667_100565331 3300005367 Bacteria 1046
123 Ga0070709_10021978 3300005434 Bacteria 3725
124 Ga0070709_10044047 3300005434 Bacteria 2762
125 Ga0070709_10076338 3300005434 Bacteria 2176
126 Ga0070709_10080285 3300005434 Bacteria 2126
127 Ga0070714_100004606 3300005435 Bacteria 10396
128 Ga0070714_100006031 3300005435 Bacteria 9304
129 Ga0070714_100014175 3300005435 Bacteria 6399
130 Ga0070714_100039953 3300005435 Bacteria 3953
131 Ga0070714_100063186 3300005435 Bacteria 3183
132 Ga0070714_100517564 3300005435 Bacteria 1139
133 Ga0070713_100005289 3300005436 Bacteria 8803
134 Ga0070713_100016906 3300005436 Bacteria 5497
135 Ga0070713_100035887 3300005436 Bacteria 3996
136 Ga0070713_100080357 3300005436 Bacteria 2780
137 Ga0070713_100175149 3300005436 Bacteria 1924
138 Ga0070713_100237268 3300005436 Bacteria 1659
139 Ga0070713_100268197 3300005436 Bacteria 1562
140 Ga0070710_10003313 3300005437 Bacteria 7639
141 Ga0070710_10012715 3300005437 Bacteria 4188
142 Ga0070710_10013665 3300005437 Bacteria 4073
143 Ga0070710_10071448 3300005437 Bacteria 2001
144 Ga0070701_10004186 3300005438 Bacteria 5806
145 Ga0070701_10011632 3300005438 Bacteria 3943
146 Ga0070711_100018457 3300005439 Bacteria 4455
147 Ga0070711_100030906 3300005439 Bacteria 3550
148 Ga0070711_100051890 3300005439 Bacteria 2820
149 Ga0070711_100152483 3300005439 Bacteria 1744
150 Ga0070705_100003118 3300005440 Bacteria 8153
151 Ga0070705_100081563 3300005440 Bacteria 1988
152 Ga0070705_100265069 3300005440 Bacteria 1214
153 Ga0070700_100002692 3300005441 Bacteria 9079
154 Ga0070700_100017552 3300005441 Bacteria 4096
155 Ga0070700_100048053 3300005441 Bacteria 2644
156 Ga0070700_100093787 3300005441 Bacteria 1964
157 Ga0070694_100008052 3300005444 Bacteria 6437
158 Ga0070694_100016432 3300005444 Bacteria 4658
159 Ga0070694_100086665 3300005444 Bacteria 2189
160 Ga0070708_100054884 3300005445 Bacteria 3541
161 Ga0070708_100198445 3300005445 Bacteria 1878
162 Ga0070663_100012871 3300005455 Bacteria 5311
163 Ga0070663_100017187 3300005455 Bacteria 4715
164 Ga0070663_100020225 3300005455 Bacteria 4404
165 Ga0070663_100026662 3300005455 Bacteria 3916
166 Ga0070663_100027275 3300005455 Bacteria 3877
167 Ga0070663_100071052 3300005455 Bacteria 2532
168 Ga0070678_100000518 3300005456 Bacteria 18676
169 Ga0070678_100034284 3300005456 Bacteria 3533
170 Ga0070678_100037451 3300005456 Bacteria 3406
171 Ga0070678_100048040 3300005456 Bacteria 3070
172 Ga0070678_100061509 3300005456 Bacteria 2768
173 Ga0070662_100021515 3300005457 Bacteria 4404
174 Ga0070662_100041959 3300005457 Bacteria 3266
175 Ga0070662_100045316 3300005457 Bacteria 3154
176 Ga0070662_100067761 3300005457 Bacteria 2622
177 Ga0070662_100133529 3300005457 Bacteria 1917
178 Ga0070662_100166872 3300005457 Bacteria 1726
179 Ga0070662_100250256 3300005457 Bacteria 1424
180 Ga0070681_10004661 3300005458 Bacteria 13105
181 Ga0070681_10010419 3300005458 Bacteria 9183
182 Ga0070681_10022966 3300005458 Bacteria 6268
183 Ga0070681_10027987 3300005458 Bacteria 5666
184 Ga0068867_100009022 3300005459 Bacteria 7035
185 Ga0068867_100018958 3300005459 Bacteria 4897
186 Ga0070685_10003674 3300005466 Bacteria 7777
187 Ga0070685_10007039 3300005466 Bacteria 5742
188 Ga0070707_100068310 3300005468 Bacteria 3420
189 Ga0070698_100201019 3300005471 Bacteria 1929
190 Ga0070699_100019495 3300005518 Bacteria 5841
191 Ga0070699_100174679 3300005518 Bacteria 1904
192 Ga0070679_100007667 3300005530 Bacteria 10102
193 Ga0070679_100030975 3300005530 Bacteria 5284
194 Ga0070679_100031240 3300005530 Bacteria 5260
195 Ga0070679_100047919 3300005530 Bacteria 4258
196 Ga0070679_100120399 3300005530 Bacteria 2610
197 Ga0070679_100155979 3300005530 Bacteria 2258
198 Ga0070679_100174109 3300005530 Bacteria 2125
199 Ga0070684_100004205 3300005535 Bacteria 10907
200 Ga0070684_100079903 3300005535 Bacteria 2892
201 Ga0070684_100105562 3300005535 Bacteria 2521
202 Ga0070684_100247283 3300005535 Bacteria 1630
203 Ga0068853_100015280 3300005539 Bacteria 6309
204 Ga0068853_100015701 3300005539 Bacteria 6221
205 Ga0068853_100030067 3300005539 Bacteria 4585
206 Ga0068853_100109958 3300005539 Bacteria 2447
207 Ga0068853_100299184 3300005539 Bacteria 1487
208 Ga0070672_100000643 3300005543 Bacteria 20456
209 Ga0070672_100040098 3300005543 Bacteria 3591
210 Ga0070672_100052229 3300005543 Bacteria 3191
211 Ga0070672_100128143 3300005543 Bacteria 2084
212 Ga0070686_100001304 3300005544 Bacteria 14085
213 Ga0070686_100065299 3300005544 Bacteria 2364
214 Ga0070695_100006337 3300005545 Bacteria 6992
215 Ga0070695_100015500 3300005545 Bacteria 4603
216 Ga0070695_100091458 3300005545 Bacteria 2032
217 Ga0070696_100018798 3300005546 Bacteria 4677
218 Ga0070696_100042306 3300005546 Bacteria 3150
219 Ga0070696_100139500 3300005546 Bacteria 1770
220 Ga0070693_100003235 3300005547 Bacteria 7563
221 Ga0070693_100008992 3300005547 Bacteria 4957
222 Ga0070693_100031899 3300005547 Bacteria 2892
223 Ga0070665_100021396 3300005548 Bacteria 6505
224 Ga0070665_100048596 3300005548 Bacteria 4258
225 Ga0070665_100085466 3300005548 Bacteria 3160
226 Ga0070665_100089171 3300005548 Bacteria 3090
227 Ga0070665_100219998 3300005548 Bacteria 1899
228 Ga0070665_100376162 3300005548 Bacteria 1427
229 Ga0070665_100436574 3300005548 Bacteria 1318
230 Ga0070704_100008125 3300005549 Bacteria 6273
231 Ga0070704_100240733 3300005549 Bacteria 1481
232 Ga0068855_100018496 3300005563 Bacteria 8376
233 Ga0068855_100021441 3300005563 Bacteria 7748
234 Ga0068855_100022276 3300005563 Bacteria 7592
235 Ga0068855_100089123 3300005563 Bacteria 3563
236 Ga0068855_100111695 3300005563 Bacteria 3137
237 Ga0068855_100293033 3300005563 Bacteria 1803
238 Ga0068855_100698323 3300005563 Bacteria 1086
239 Ga0070664_100026948 3300005564 Bacteria 4773
240 Ga0070664_100107252 3300005564 Bacteria 2435
241 Ga0070664_100198361 3300005564 Bacteria 1790
242 Ga0068857_100001038 3300005577 Bacteria 21487
243 Ga0068857_100015943 3300005577 Bacteria 6581
244 Ga0068854_100014606 3300005578 Bacteria 5181
245 Ga0068854_100020860 3300005578 Bacteria 4439
246 Ga0068854_100147355 3300005578 Bacteria 1812
247 Ga0068854_100257987 3300005578 Bacteria 1395
248 Ga0068856_100009104 3300005614 Bacteria 9654
249 Ga0068856_100038924 3300005614 Bacteria 4668
250 Ga0068856_100348432 3300005614 Bacteria 1499
251 Ga0070702_100004502 3300005615 Bacteria 6373
252 Ga0070702_100013098 3300005615 Bacteria 4178
253 Ga0070702_100035132 3300005615 Bacteria 2767
254 Ga0068852_100005996 3300005616 Bacteria 8755
255 Ga0068852_100168942 3300005616 Bacteria 2048
256 Ga0068859_100006706 3300005617 Bacteria 11694
257 Ga0068859_100135022 3300005617 Bacteria 2540
258 Ga0068859_100155044 3300005617 Bacteria 2367
259 Ga0068859_100390827 3300005617 Bacteria 1487
260 Ga0068864_100004096 3300005618 Bacteria 11968
261 Ga0068864_100006391 3300005618 Bacteria 9654
262 Ga0068864_100022271 3300005618 Bacteria 5312
263 Ga0068864_100054797 3300005618 Bacteria 3442
264 Ga0068866_10000791 3300005718 Bacteria 14174
265 Ga0068866_10079221 3300005718 Bacteria 1759
266 Ga0068866_10120115 3300005718 Bacteria 1480
267 Ga0068861_100002491 3300005719 Bacteria 12008
268 Ga0068861_100029004 3300005719 Bacteria 4042
269 Ga0068861_100049835 3300005719 Bacteria 3172
270 Ga0068861_100057052 3300005719 Bacteria 2982
271 Ga0068870_10001431 3300005840 Bacteria 9645
272 Ga0068870_10002318 3300005840 Bacteria 7910
273 Ga0068870_10043749 3300005840 Bacteria 2337
274 Ga0068870_10121272 3300005840 Bacteria 1506
275 Ga0068863_100016752 3300005841 Bacteria 7031
276 Ga0068863_100025687 3300005841 Bacteria 5618
277 Ga0068863_100051180 3300005841 Bacteria 3915
278 Ga0068858_100010247 3300005842 Bacteria 8893
279 Ga0068858_100017836 3300005842 Bacteria 6647
280 Ga0068858_100026083 3300005842 Bacteria 5433
281 Ga0068858_100192934 3300005842 Bacteria 1925
282 Ga0068860_100002530 3300005843 Bacteria 19153
283 Ga0068860_100047790 3300005843 Bacteria 4078
284 Ga0068860_100070139 3300005843 Bacteria 3332
285 Ga0068860_100156188 3300005843 Bacteria 2198
286 Ga0068862_100006671 3300005844 Bacteria 9577
287 Ga0068862_100040884 3300005844 Bacteria 3943
288 Ga0068862_100135610 3300005844 Bacteria 2181
289 Ga0068862_100264977 3300005844 Bacteria 1570
290 Ga0081455_10000081 3300005937 Bacteria 103752
291 Ga0081455_10003729 3300005937 Bacteria 17413
292 Ga0081455_10005438 3300005937 Bacteria 13976
293 Ga0081455_10010814 3300005937 Bacteria 9222
294 Ga0081455_10033699 3300005937 Bacteria 4598
295 Ga0081538_10001580 3300005981 Bacteria 23375
296 Ga0081538_10010111 3300005981 Bacteria 7763
297 Ga0081538_10020370 3300005981 Bacteria 4883
298 Ga0081538_10021466 3300005981 Bacteria 4713
299 Ga0081540_1000027 3300005983 Bacteria 151880
300 Ga0081540_1002386 3300005983 Bacteria 15324
301 Ga0081540_1002765 3300005983 Bacteria 14238
302 Ga0081540_1003265 3300005983 Bacteria 12889
303 Ga0081540_1003527 3300005983 Bacteria 12331
304 Ga0081540_1005126 3300005983 Bacteria 9820
305 Ga0081540_1005516 3300005983 Bacteria 9433
306 Ga0081540_1010700 3300005983 Bacteria 6183
307 Ga0081540_1010849 3300005983 Bacteria 6124
308 Ga0081540_1020053 3300005983 Bacteria 4036
309 Ga0081540_1024836 3300005983 Bacteria 3467
310 Ga0081540_1026792 3300005983 Bacteria 3281
311 Ga0081539_10000306 3300005985 Bacteria 110402
312 Ga0081539_10001260 3300005985 Bacteria 44845
313 Ga0081539_10050522 3300005985 Bacteria 2352
314 Ga0070717_10000485 3300006028 Bacteria 25249
315 Ga0070717_10000980 3300006028 Bacteria 19102
316 Ga0070717_10023003 3300006028 Bacteria 4932
317 Ga0075365_10037037 3300006038 Bacteria 3165
318 Ga0075365_10051214 3300006038 Bacteria 2726
319 Ga0075365_10171024 3300006038 Bacteria 1516
320 Ga0075368_10011758 3300006042 Bacteria 3191
321 Ga0075368_10071075 3300006042 Bacteria 1405
322 Ga0075363_100004615 3300006048 Bacteria 6051
323 Ga0075363_100011319 3300006048 Bacteria 4268
324 Ga0075363_100041849 3300006048 Bacteria 2417
325 Ga0075364_10006344 3300006051 Bacteria 6948
326 Ga0075364_10074566 3300006051 Bacteria 2237
327 Ga0075432_10000954 3300006058 Bacteria 9136
328 Ga0070715_10000289 3300006163 Bacteria 12366
329 Ga0070715_10003295 3300006163 Bacteria 5105
330 Ga0070715_10032333 3300006163 Bacteria 2131
331 Ga0070715_10081041 3300006163 Bacteria 1473
332 Ga0070716_100004147 3300006173 Bacteria 6883
333 Ga0070716_100016874 3300006173 Bacteria 3776
334 Ga0070716_100047513 3300006173 Bacteria 2422
335 Ga0070712_100020910 3300006175 Bacteria 4289
336 Ga0070712_100030045 3300006175 Bacteria 3648
337 Ga0070712_100043123 3300006175 Bacteria 3104
338 Ga0070712_100044021 3300006175 Bacteria 3076
339 Ga0070712_100049815 3300006175 Bacteria 2910
340 Ga0075362_10044483 3300006177 Bacteria 1969
341 Ga0075367_10068408 3300006178 Bacteria 2130
342 Ga0075369_10001806 3300006186 Bacteria 7454
343 Ga0075369_10016448 3300006186 Bacteria 2985
344 Ga0075366_10028015 3300006195 Bacteria 3305
345 Ga0097621_100001425 3300006237 Bacteria 16408
346 Ga0097621_100010536 3300006237 Bacteria 6771
347 Ga0097621_100147348 3300006237 Bacteria 2016
348 Ga0075370_10001231 3300006353 Bacteria 10859
349 Ga0068871_100002394 3300006358 Bacteria 12790
350 Ga0068871_100022579 3300006358 Bacteria 4853
351 Ga0068871_100033578 3300006358 Bacteria 4065
352 Ga0068871_100036707 3300006358 Bacteria 3903
353 Ga0068871_100107955 3300006358 Bacteria 2338
354 Ga0068871_100191120 3300006358 Bacteria 1764
355 Ga0075428_100005241 3300006844 Bacteria 14417
356 Ga0075428_100005805 3300006844 Bacteria 13709
357 Ga0075428_100011791 3300006844 Bacteria 9730
358 Ga0075428_100057524 3300006844 Bacteria 4256
359 Ga0075428_100211000 3300006844 Bacteria 2098
360 Ga0075430_100000424 3300006846 Bacteria 31568
361 Ga0075430_100006792 3300006846 Bacteria 9643
362 Ga0075430_100010396 3300006846 Bacteria 7882
363 Ga0075430_100093633 3300006846 Bacteria 2512
364 Ga0075431_100000105 3300006847 Bacteria 53256
365 Ga0075431_100002258 3300006847 Bacteria 18482
366 Ga0075431_100033491 3300006847 Bacteria 5294
367 Ga0075431_100121846 3300006847 Bacteria 2691
368 Ga0075431_100178116 3300006847 Bacteria 2182
369 Ga0075431_100188585 3300006847 Bacteria 2113
370 Ga0075431_100275949 3300006847 Bacteria 1702
371 Ga0075433_10000012 3300006852 Bacteria 71065
372 Ga0075434_100000310 3300006871 Bacteria 34771
373 Ga0075434_100004560 3300006871 Bacteria 12511
374 Ga0075434_100043177 3300006871 Bacteria 4471
375 Ga0075434_100086930 3300006871 Bacteria 3127
376 Ga0075434_100112131 3300006871 Bacteria 2738
377 Ga0075434_100139878 3300006871 Bacteria 2440
378 Ga0075434_100198536 3300006871 Bacteria 2026
379 Ga0075434_100217751 3300006871 Bacteria 1929
380 Ga0075434_100339222 3300006871 Bacteria 1524
381 Ga0075429_100001610 3300006880 Bacteria 18632
382 Ga0075429_100005372 3300006880 Bacteria 11021
383 Ga0068865_100001097 3300006881 Bacteria 15622
384 Ga0068865_100052560 3300006881 Bacteria 2824
385 Ga0068865_100081222 3300006881 Bacteria 2327
386 Ga0068865_100134544 3300006881 Bacteria 1856
387 Ga0075436_100008403 3300006914 Bacteria 7059
388 Ga0097620_100006706 3300006931 Bacteria 11694
389 Ga0097620_100135019 3300006931 Bacteria 2540
390 Ga0097620_100155037 3300006931 Bacteria 2367
391 Ga0097620_100390819 3300006931 Bacteria 1487
392 Ga0099824_1002861 3300006942 Bacteria 25261
393 Ga0075435_100002697 3300007076 Bacteria 11855
394 Ga0075435_100087604 3300007076 Bacteria 2565
395 Ga0075435_100114450 3300007076 Bacteria 2245
396 Ga0099794_10024802 3300007265 Bacteria 2756
397 Ga0099794_10031739 3300007265 Bacteria 2475
398 Ga0105244_10023607 3300009036 Bacteria 3369
399 Ga0105240_10175140 3300009093 Bacteria 2537
400 Ga0105240_10202808 3300009093 Bacteria 2323
401 Ga0111539_10000792 3300009094 Bacteria 41176
402 Ga0111539_10000842 3300009094 Bacteria 39938
403 Ga0111539_10014117 3300009094 Bacteria 9982
404 Ga0111539_10034470 3300009094 Bacteria 6137
405 Ga0105245_10025559 3300009098 Bacteria 5194
406 Ga0105245_10029815 3300009098 Bacteria 4823
407 Ga0105245_10099722 3300009098 Bacteria 2686
408 Ga0105245_10183751 3300009098 Bacteria 1999
409 Ga0105247_10024258 3300009101 Bacteria 3653
410 Ga0105247_10025129 3300009101 Bacteria 3594
411 Ga0105247_10033339 3300009101 Bacteria 3132
412 Ga0105247_10041196 3300009101 Bacteria 2825
413 Ga0114129_10000803 3300009147 Bacteria 40282
414 Ga0114129_10001669 3300009147 Bacteria 30222
415 Ga0114129_10003927 3300009147 Bacteria 20989
416 Ga0114129_10006740 3300009147 Bacteria 16309
417 Ga0114129_10006854 3300009147 Bacteria 16194
418 Ga0114129_10027094 3300009147 Bacteria 8115
419 Ga0114129_10071921 3300009147 Bacteria 4822
420 Ga0105243_10002400 3300009148 Bacteria 15707
421 Ga0105243_10004402 3300009148 Bacteria 11139
422 Ga0105243_10035105 3300009148 Bacteria 3886
423 Ga0105243_10047415 3300009148 Bacteria 3382
424 Ga0105243_10087524 3300009148 Bacteria 2557
425 Ga0105243_10094329 3300009148 Bacteria 2471
426 Ga0105241_10008636 3300009174 Bacteria 7488
427 Ga0105241_10010427 3300009174 Bacteria 6819
428 Ga0105241_10028300 3300009174 Bacteria 4176
429 Ga0105241_10090184 3300009174 Bacteria 2417
430 Ga0105241_10100074 3300009174 Bacteria 2303
431 Ga0105241_10260979 3300009174 Bacteria 1472
432 Ga0105242_10007578 3300009176 Bacteria 8356
433 Ga0105242_10008734 3300009176 Bacteria 7775
434 Ga0105242_10025583 3300009176 Bacteria 4672
435 Ga0105248_10010839 3300009177 Bacteria 10064
436 Ga0105248_10014218 3300009177 Bacteria 8762
437 Ga0105248_10059364 3300009177 Bacteria 4296
438 Ga0105248_10062156 3300009177 Bacteria 4194
439 Ga0105248_10081366 3300009177 Bacteria 3640
440 Ga0105237_10030610 3300009545 Bacteria 5465
441 Ga0105237_10032300 3300009545 Bacteria 5300
442 Ga0105237_10121260 3300009545 Bacteria 2609
443 Ga0105238_10009678 3300009551 Bacteria 9647
444 Ga0105238_10066536 3300009551 Bacteria 3605
445 Ga0105238_10099304 3300009551 Bacteria 2894
446 Ga0105238_10115780 3300009551 Bacteria 2660
447 Ga0105249_10011450 3300009553 Bacteria 7790
448 Ga0105249_10153117 3300009553 Bacteria 2222
449 Ga0105249_10160851 3300009553 Bacteria 2170
450 Ga0099796_10011799 3300010159 Bacteria 2450
451 Ga0105239_10024088 3300010375 Bacteria 6704
452 Ga0105239_10040214 3300010375 Bacteria 5123
453 Ga0105239_10346225 3300010375 Bacteria 1678
454 Ga0105246_10051104 3300011119 Bacteria 2837
455 Ga0105246_10071651 3300011119 Bacteria 2441
456 Ga0105246_10110265 3300011119 Bacteria 2021
457 Ga0157342_1000436 3300012507 Bacteria 2516
458 Ga0157373_10110086 3300013100 Bacteria 1936
459 Ga0157371_10195899 3300013102 Bacteria 1447
460 Ga0157370_10035641 3300013104 Bacteria 4833
461 Ga0157370_10193977 3300013104 Bacteria 1885
462 Ga0157369_10281738 3300013105 Bacteria 1731
463 Ga0157374_10001167 3300013296 Bacteria 22404
464 Ga0157374_10003779 3300013296 Bacteria 12738
465 Ga0157374_10027828 3300013296 Bacteria 5103
466 Ga0157378_10008023 3300013297 Bacteria 9217
467 Ga0163162_10010853 3300013306 Bacteria 8866
468 Ga0163162_10051562 3300013306 Bacteria 4129
469 Ga0163162_10139260 3300013306 Bacteria 2539
470 Ga0163162_10293571 3300013306 Bacteria 1757
471 Ga0163162_10671224 3300013306 Bacteria 1159
472 Ga0157372_10141014 3300013307 Bacteria 2776
473 Ga0157372_10279647 3300013307 Bacteria 1940
474 Ga0163163_10007288 3300014325 Bacteria 9756
475 Ga0163163_10007753 3300014325 Bacteria 9488
476 Ga0163163_10109647 3300014325 Bacteria 2788
477 Ga0157380_10001551 3300014326 Bacteria 15111
478 Ga0157380_10093514 3300014326 Bacteria 2486
479 Ga0157380_10231041 3300014326 Bacteria 1661
480 Ga0157377_10009300 3300014745 Bacteria 4814
481 Ga0157379_10036937 3300014968 Bacteria 4356
482 Ga0157376_10012121 3300014969 Bacteria 6386
483 Ga0157376_10059766 3300014969 Bacteria 3197
484 Ga0157376_10065769 3300014969 Bacteria 3063
485 Ga0157376_10093163 3300014969 Bacteria 2615
486 Ga0163161_10011103 3300017792 Bacteria 6240
487 Ga0163161_10086928 3300017792 Bacteria 2308
488 Ga0163161_10166223 3300017792 Bacteria 1685
489 Ga0206356_11037165 3300020070 Bacteria 2624
490 Ga0206350_10300830 3300020080 Bacteria 1629
491 Ga0206354_10798601 3300020081 Bacteria 4257
492 Ga0206353_11208914 3300020082 Bacteria 5004
493 Ga0213874_10003167 3300021377 Bacteria 3626
494 Ga0213876_10000514 3300021384 Bacteria 29913
495 Ga0213876_10004037 3300021384 Bacteria 8258
496 Ga0213875_10000122 3300021388 Bacteria 87195
497 Ga0213875_10002043 3300021388 Bacteria 12397
498 Ga0213875_10047189 3300021388 Bacteria 2021
499 Ga0213875_10049374 3300021388 Bacteria 1972
500 Ga0224712_10047026 3300022467 Bacteria 1659
501 Ga0224572_1020299 3300024225 Bacteria 1276
502 Ga0228598_1010870 3300024227 Bacteria 1813
503 Ga0207666_1000153 3300025271 Bacteria 10663
504 Ga0207666_1005029 3300025271 Bacteria 1679
505 Ga0207673_1000206 3300025290 Bacteria 5940
506 Ga0209758_1007275 3300025297 Bacteria 7604
507 Ga0207697_10001059 3300025315 Bacteria 15198
508 Ga0207653_10009860 3300025885 Bacteria 2978
509 Ga0207653_10017060 3300025885 Bacteria 2283
510 Ga0207682_10002553 3300025893 Bacteria 8126
511 Ga0207682_10033509 3300025893 Bacteria 2069
512 Ga0207692_10000282 3300025898 Bacteria 17493
513 Ga0207642_10016582 3300025899 Bacteria 2779
514 Ga0207642_10034683 3300025899 Bacteria 2148
515 Ga0207710_10000382 3300025900 Bacteria 30360
516 Ga0207688_10001640 3300025901 Bacteria 11816
517 Ga0207688_10015245 3300025901 Bacteria 4171
518 Ga0207680_10008936 3300025903 Bacteria 4943
519 Ga0207680_10010916 3300025903 Bacteria 4566
520 Ga0207680_10018703 3300025903 Bacteria 3690
521 Ga0207680_10052411 3300025903 Bacteria 2445
522 Ga0207647_10009706 3300025904 Bacteria 6828
523 Ga0207647_10009987 3300025904 Bacteria 6722
524 Ga0207647_10012209 3300025904 Bacteria 5988
525 Ga0207685_10000164 3300025905 Bacteria 10037
526 Ga0207685_10005449 3300025905 Bacteria 3361
527 Ga0207685_10041022 3300025905 Bacteria 1729
528 Ga0207685_10068246 3300025905 Bacteria 1432
529 Ga0207699_10004201 3300025906 Bacteria 6891
530 Ga0207699_10006008 3300025906 Bacteria 5843
531 Ga0207699_10067023 3300025906 Bacteria 2181
532 Ga0207699_10081032 3300025906 Bacteria 2012
533 Ga0207645_10002745 3300025907 Bacteria 13711
534 Ga0207645_10063850 3300025907 Bacteria 2353
535 Ga0207645_10077131 3300025907 Bacteria 2135
536 Ga0207643_10000004 3300025908 Bacteria 187006
537 Ga0207643_10001769 3300025908 Bacteria 12048
538 Ga0207643_10176573 3300025908 Bacteria 1291
539 Ga0207643_10196526 3300025908 Bacteria 1226
540 Ga0207705_10073895 3300025909 Bacteria 2474
541 Ga0207705_10217915 3300025909 Bacteria 1449
542 Ga0207684_10009569 3300025910 Bacteria 8549
543 Ga0207654_10008032 3300025911 Bacteria 5318
544 Ga0207654_10173227 3300025911 Bacteria 1403
545 Ga0207707_10011019 3300025912 Bacteria 7866
546 Ga0207707_10014644 3300025912 Bacteria 6833
547 Ga0207707_10016719 3300025912 Bacteria 6393
548 Ga0207707_10336335 3300025912 Bacteria 1302
549 Ga0207695_10086365 3300025913 Bacteria 3164
550 Ga0207671_10082682 3300025914 Bacteria 2410
551 Ga0207671_10087943 3300025914 Bacteria 2337
552 Ga0207671_10088536 3300025914 Bacteria 2329
553 Ga0207671_10129201 3300025914 Bacteria 1938
554 Ga0207671_10154096 3300025914 Bacteria 1777
555 Ga0207671_10168615 3300025914 Bacteria 1699
556 Ga0207693_10001038 3300025915 Bacteria 24865
557 Ga0207693_10005387 3300025915 Bacteria 10692
558 Ga0207693_10016176 3300025915 Bacteria 5966
559 Ga0207693_10034641 3300025915 Bacteria 3983
560 Ga0207693_10084937 3300025915 Bacteria 2480
561 Ga0207693_10201344 3300025915 Bacteria 1566
562 Ga0207663_10004587 3300025916 Bacteria 6885
563 Ga0207663_10026312 3300025916 Bacteria 3375
564 Ga0207663_10092326 3300025916 Bacteria 2012
565 Ga0207663_10328751 3300025916 Bacteria 1151
566 Ga0207660_10007217 3300025917 Bacteria 7193
567 Ga0207660_10009992 3300025917 Bacteria 6148
568 Ga0207660_10020495 3300025917 Bacteria 4437
569 Ga0207660_10124432 3300025917 Bacteria 1957
570 Ga0207662_10000392 3300025918 Bacteria 19588
571 Ga0207662_10001199 3300025918 Bacteria 12365
572 Ga0207662_10026540 3300025918 Bacteria 3341
573 Ga0207657_10002007 3300025919 Bacteria 22003
574 Ga0207657_10007818 3300025919 Bacteria 10913
575 Ga0207657_10012563 3300025919 Bacteria 8349
576 Ga0207657_10017247 3300025919 Bacteria 6932
577 Ga0207657_10038806 3300025919 Bacteria 4236
578 Ga0207657_10039060 3300025919 Bacteria 4220
579 Ga0207657_10043860 3300025919 Bacteria 3936
580 Ga0207657_10050813 3300025919 Bacteria 3605
581 Ga0207649_10005404 3300025920 Bacteria 6918
582 Ga0207652_10014772 3300025921 Bacteria 6329
583 Ga0207652_10053069 3300025921 Bacteria 3482
584 Ga0207652_10058342 3300025921 Bacteria 3326
585 Ga0207652_10059011 3300025921 Bacteria 3307
586 Ga0207652_10059737 3300025921 Bacteria 3287
587 Ga0207652_10113505 3300025921 Bacteria 2405
588 Ga0207652_10133288 3300025921 Bacteria 2217
589 Ga0207652_10295507 3300025921 Bacteria 1462
590 Ga0207646_10258077 3300025922 Bacteria 1575
591 Ga0207681_10024530 3300025923 Bacteria 3871
592 Ga0207681_10025222 3300025923 Bacteria 3822
593 Ga0207681_10149905 3300025923 Bacteria 1746
594 Ga0207694_10082893 3300025924 Bacteria 2521
595 Ga0207694_10110698 3300025924 Bacteria 2185
596 Ga0207650_10004542 3300025925 Bacteria 9492
597 Ga0207650_10064045 3300025925 Bacteria 2751
598 Ga0207650_10143039 3300025925 Bacteria 1882
599 Ga0207659_10000374 3300025926 Bacteria 26976
600 Ga0207659_10066883 3300025926 Bacteria 2609
601 Ga0207687_10005411 3300025927 Bacteria 8442
602 Ga0207687_10009764 3300025927 Bacteria 6279
603 Ga0207687_10016412 3300025927 Bacteria 4864
604 Ga0207687_10041692 3300025927 Bacteria 3153
605 Ga0207687_10092929 3300025927 Bacteria 2204
606 Ga0207700_10003347 3300025928 Bacteria 9298
607 Ga0207700_10015515 3300025928 Bacteria 5028
608 Ga0207700_10037965 3300025928 Bacteria 3493
609 Ga0207700_10122533 3300025928 Bacteria 2110
610 Ga0207700_10143551 3300025928 Bacteria 1964
611 Ga0207700_10161996 3300025928 Bacteria 1858
612 Ga0207700_10196238 3300025928 Bacteria 1699
613 Ga0207664_10009763 3300025929 Bacteria 6751
614 Ga0207664_10023358 3300025929 Bacteria 4631
615 Ga0207664_10033414 3300025929 Bacteria 3951
616 Ga0207664_10067954 3300025929 Bacteria 2861
617 Ga0207664_10106776 3300025929 Bacteria 2322
618 Ga0207664_10108798 3300025929 Bacteria 2302
619 Ga0207664_10187014 3300025929 Bacteria 1781
620 Ga0207664_10202086 3300025929 Bacteria 1716
621 Ga0207644_10003380 3300025931 Bacteria 10298
622 Ga0207644_10004888 3300025931 Bacteria 8732
623 Ga0207644_10055390 3300025931 Bacteria 2858
624 Ga0207690_10010819 3300025932 Bacteria 5436
625 Ga0207690_10013825 3300025932 Bacteria 4862
626 Ga0207690_10180370 3300025932 Bacteria 1589
627 Ga0207690_10218354 3300025932 Bacteria 1457
628 Ga0207706_10002819 3300025933 Bacteria 16867
629 Ga0207706_10006974 3300025933 Bacteria 10444
630 Ga0207706_10010623 3300025933 Bacteria 8409
631 Ga0207706_10022546 3300025933 Bacteria 5651
632 Ga0207706_10041500 3300025933 Bacteria 4079
633 Ga0207706_10341120 3300025933 Bacteria 1303
634 Ga0207686_10007542 3300025934 Bacteria 5858
635 Ga0207686_10020413 3300025934 Bacteria 3785
636 Ga0207686_10025932 3300025934 Bacteria 3416
637 Ga0207686_10151512 3300025934 Bacteria 1615
638 Ga0207709_10003882 3300025935 Bacteria 8742
639 Ga0207709_10014845 3300025935 Bacteria 4308
640 Ga0207709_10071979 3300025935 Bacteria 2197
641 Ga0207709_10091098 3300025935 Bacteria 1993
642 Ga0207709_10100149 3300025935 Bacteria 1914
643 Ga0207670_10001845 3300025936 Bacteria 11059
644 Ga0207670_10004902 3300025936 Bacteria 7280
645 Ga0207670_10067403 3300025936 Bacteria 2462
646 Ga0207669_10022356 3300025937 Bacteria 3358
647 Ga0207669_10051158 3300025937 Bacteria 2473
648 Ga0207669_10092832 3300025937 Bacteria 1970
649 Ga0207669_10135589 3300025937 Bacteria 1699
650 Ga0207704_10002620 3300025938 Bacteria 8124
651 Ga0207704_10005816 3300025938 Bacteria 5705
652 Ga0207704_10265795 3300025938 Bacteria 1296
653 Ga0207665_10000541 3300025939 Bacteria 25458
654 Ga0207665_10007581 3300025939 Bacteria 7171
655 Ga0207665_10017261 3300025939 Bacteria 4742
656 Ga0207665_10055563 3300025939 Bacteria 2671
657 Ga0207691_10004396 3300025940 Bacteria 13666
658 Ga0207691_10009932 3300025940 Bacteria 9139
659 Ga0207691_10041812 3300025940 Bacteria 4228
660 Ga0207691_10314525 3300025940 Bacteria 1343
661 Ga0207711_10002645 3300025941 Bacteria 15844
662 Ga0207711_10005696 3300025941 Bacteria 10522
663 Ga0207711_10035642 3300025941 Bacteria 4219
664 Ga0207711_10145854 3300025941 Bacteria 2132
665 Ga0207711_10170653 3300025941 Bacteria 1974
666 Ga0207711_10232888 3300025941 Bacteria 1687
667 Ga0207711_10362901 3300025941 Bacteria 1342
668 Ga0207689_10002724 3300025942 Bacteria 16345
669 Ga0207689_10004730 3300025942 Bacteria 12274
670 Ga0207661_10015256 3300025944 Bacteria 5649
671 Ga0207661_10054406 3300025944 Bacteria 3206
672 Ga0207679_10001617 3300025945 Bacteria 14034
673 Ga0207679_10053172 3300025945 Bacteria 2974
674 Ga0207679_10141139 3300025945 Bacteria 1947
675 Ga0207667_10071955 3300025949 Bacteria 3594
676 Ga0207667_10321136 3300025949 Bacteria 1581
677 Ga0207667_10497494 3300025949 Bacteria 1237
678 Ga0207651_10003064 3300025960 Bacteria 8113
679 Ga0207651_10004195 3300025960 Bacteria 7218
680 Ga0207651_10016908 3300025960 Bacteria 4292
681 Ga0207651_10045351 3300025960 Bacteria 2948
682 Ga0207712_10003120 3300025961 Bacteria 10571
683 Ga0207712_10102162 3300025961 Bacteria 2134
684 Ga0207668_10005763 3300025972 Bacteria 7301
685 Ga0207668_10124678 3300025972 Bacteria 1956
686 Ga0207668_10182291 3300025972 Bacteria 1657
687 Ga0207668_10195487 3300025972 Bacteria 1607
688 Ga0207640_10015642 3300025981 Bacteria 4396
689 Ga0207640_10021910 3300025981 Bacteria 3816
690 Ga0207640_10146331 3300025981 Bacteria 1729
691 Ga0207640_10183600 3300025981 Bacteria 1570
692 Ga0207658_10014919 3300025986 Bacteria 5325
693 Ga0207658_10035286 3300025986 Bacteria 3580
694 Ga0207658_10082393 3300025986 Bacteria 2470
695 Ga0207658_10103806 3300025986 Bacteria 2232
696 Ga0207658_10264958 3300025986 Bacteria 1466
697 Ga0207677_10006418 3300026023 Bacteria 6450
698 Ga0207677_10016744 3300026023 Bacteria 4351
699 Ga0207677_10028083 3300026023 Bacteria 3554
700 Ga0207677_10064470 3300026023 Bacteria 2552
701 Ga0207703_10001822 3300026035 Bacteria 19007
702 Ga0207703_10021203 3300026035 Bacteria 5086
703 Ga0207703_10041983 3300026035 Bacteria 3666
704 Ga0207703_10126942 3300026035 Bacteria 2197
705 Ga0207639_10019446 3300026041 Bacteria 4844
706 Ga0207639_10023621 3300026041 Bacteria 4440
707 Ga0207639_10058770 3300026041 Bacteria 2959
708 Ga0207678_10000414 3300026067 Bacteria 38612
709 Ga0207678_10002471 3300026067 Bacteria 16791
710 Ga0207678_10019865 3300026067 Bacteria 5905
711 Ga0207678_10020641 3300026067 Bacteria 5775
712 Ga0207678_10035698 3300026067 Bacteria 4328
713 Ga0207678_10041442 3300026067 Bacteria 3993
714 Ga0207678_10092328 3300026067 Bacteria 2588
715 Ga0207708_10001992 3300026075 Bacteria 15035
716 Ga0207708_10002001 3300026075 Bacteria 15007
717 Ga0207708_10006744 3300026075 Bacteria 8497
718 Ga0207708_10038352 3300026075 Bacteria 3650
719 Ga0207702_10021444 3300026078 Bacteria 5349
720 Ga0207702_10039899 3300026078 Bacteria 3936
721 Ga0207702_10041530 3300026078 Bacteria 3857
722 Ga0207702_10067064 3300026078 Bacteria 3079
723 Ga0207702_10294721 3300026078 Bacteria 1538
724 Ga0207641_10009850 3300026088 Bacteria 7868
725 Ga0207641_10015249 3300026088 Bacteria 6297
726 Ga0207641_10019509 3300026088 Bacteria 5565
727 Ga0207648_10004767 3300026089 Bacteria 13850
728 Ga0207648_10010273 3300026089 Bacteria 8889
729 Ga0207648_10174941 3300026089 Bacteria 1898
730 Ga0207676_10001979 3300026095 Bacteria 14919
731 Ga0207676_10002246 3300026095 Bacteria 13878
732 Ga0207676_10013708 3300026095 Bacteria 5821
733 Ga0207676_10050786 3300026095 Bacteria 3235
734 Ga0207674_10007733 3300026116 Bacteria 12510
735 Ga0207674_10416934 3300026116 Bacteria 1297
736 Ga0207675_100003883 3300026118 Bacteria 14527
737 Ga0207675_100007986 3300026118 Bacteria 9973
738 Ga0207675_100057031 3300026118 Bacteria 3644
739 Ga0207683_10002044 3300026121 Bacteria 17862
740 Ga0207683_10009279 3300026121 Bacteria 8382
741 Ga0207683_10016334 3300026121 Bacteria 6319
742 Ga0207698_10031944 3300026142 Bacteria 3808
743 Ga0207698_10186189 3300026142 Bacteria 1844
744 Ga0209967_1003782 3300027364 Bacteria 1998
745 Ga0209179_1029109 3300027512 Bacteria 1122
746 Ga0209983_1007836 3300027665 Bacteria 2185
747 Ga0209971_1002807 3300027682 Bacteria 4163
748 Ga0209966_1001490 3300027695 Bacteria 4070
749 Ga0209998_10000888 3300027717 Bacteria 7667
750 Ga0209998_10001985 3300027717 Bacteria 4800
751 Ga0207428_10000137 3300027907 Bacteria 98535
752 Ga0207428_10000501 3300027907 Bacteria 46798
753 Ga0207428_10001016 3300027907 Bacteria 31079
754 Ga0207428_10006625 3300027907 Bacteria 10652
755 Ga0207428_10143993 3300027907 Bacteria 1817
756 Ga0207428_10165874 3300027907 Bacteria 1675
757 Ga0265357_1000343 3300028023 Bacteria 2536
758 Ga0268266_10000446 3300028379 Bacteria 61283
759 Ga0268266_10000670 3300028379 Bacteria 46181
760 Ga0268266_10001262 3300028379 Bacteria 30924
761 Ga0268266_10012528 3300028379 Bacteria 7328
762 Ga0268266_10029942 3300028379 Bacteria 4626
763 Ga0268266_10050610 3300028379 Bacteria 3565
764 Ga0268266_10157018 3300028379 Bacteria 2056
765 Ga0268265_10014556 3300028380 Bacteria 5361
766 Ga0268265_10022589 3300028380 Bacteria 4422
767 Ga0268265_10055116 3300028380 Bacteria 3019
768 Ga0268265_10072977 3300028380 Bacteria 2678
769 Ga0268264_10041889 3300028381 Bacteria 3788
770 Ga0268264_10112900 3300028381 Bacteria 2383
771 Ga0265337_1004042 3300028556 Bacteria 6193
772 Ga0265337_1026650 3300028556 Bacteria 1749
773 Ga0265318_10007102 3300028577 Bacteria 5094
774 Ga0307517_10000512 3300028786 Bacteria 66501
775 Ga0307517_10130606 3300028786 Bacteria 1810
776 Ga0265338_10065426 3300028800 Bacteria 3154
777 Ga0265338_10263042 3300028800 Bacteria 1267
778 Ga0265770_1006025 3300030878 Bacteria 1679
779 Ga0265760_10022505 3300031090 Bacteria 1826
780 Ga0265330_10015179 3300031235 Bacteria 3566
781 Ga0265332_10000839 3300031238 Bacteria 18678
782 Ga0265332_10067620 3300031238 Bacteria 1523
783 Ga0265328_10017174 3300031239 Bacteria 2805
784 Ga0265320_10006407 3300031240 Bacteria 7422
785 Ga0265325_10000073 3300031241 Bacteria 70109
786 Ga0265325_10001135 3300031241 Bacteria 19104
787 Ga0265325_10011811 3300031241 Bacteria 5010
788 Ga0265325_10030916 3300031241 Bacteria 2869
789 Ga0265329_10008929 3300031242 Bacteria 3772
790 Ga0265340_10000382 3300031247 Bacteria 23632
791 Ga0265340_10020821 3300031247 Bacteria 3365
792 Ga0265339_10001051 3300031249 Bacteria 20994
793 Ga0265339_10003487 3300031249 Bacteria 10996
794 Ga0265339_10043806 3300031249 Bacteria 2472
795 Ga0265339_10068642 3300031249 Bacteria 1893
796 Ga0265331_10015018 3300031250 Bacteria 4104
797 Ga0265331_10034057 3300031250 Bacteria 2515
798 Ga0265331_10038656 3300031250 Bacteria 2331
799 Ga0265316_10105375 3300031344 Bacteria 2139
800 Ga0265316_10123065 3300031344 Bacteria 1958
801 Ga0265313_10000716 3300031595 Bacteria 34149
802 Ga0265313_10038079 3300031595 Bacteria 2398
803 Ga0265313_10046363 3300031595 Bacteria 2110
804 Ga0265314_10002492 3300031711 Bacteria 18802
805 Ga0265314_10044370 3300031711 Bacteria 3152
806 Ga0265342_10000179 3300031712 Bacteria 70615
807 Ga0265342_10000308 3300031712 Bacteria 55378
808 Ga0265342_10007369 3300031712 Bacteria 8067
809 Ga0265342_10011726 3300031712 Bacteria 5980
810 Ga0265342_10030537 3300031712 Bacteria 3338
811 Ga0307516_10078953 3300031730 Bacteria 3136
812 Ga0307405_10283945 3300031731 Bacteria 1247
813 Ga0307409_100037914 3300031995 Bacteria 3558
814 Ga0307416_100224479 3300032002 Bacteria 1805
815 Ga0307415_100082198 3300032126 Bacteria 2304
816 Ga0307415_100327245 3300032126 Bacteria 1280
817 Ga0307510_10009215 3300033180 Bacteria 11759
818 Ga0307510_10009742 3300033180 Bacteria 11434
819 Ga0373948_0002227 3300034817 Bacteria 2832
820 Ga0373948_0015021 3300034817 Bacteria 1417
821 Ga0373950_0000796 3300034818 Bacteria 3944
822 Ga0373958_0000398 3300034819 Bacteria 5260
823 Ga0373958_0009846 3300034819 Bacteria 1582
824 Ga0373959_0009242 3300034820 Bacteria 1695
825 Ga0373938_0000726 3300034957 Bacteria 5330
826 Ga0373938_0002589 3300034957 Bacteria 2917
827 Ga0373926_0002344 3300035083 Bacteria 5996
828 Ga0373926_0009236 3300035083 Bacteria 3291
829 Ga0373926_0050832 3300035083 Bacteria 1494
830 Ga0373928_0000779 3300035084 Bacteria 6200
831 Ga0373928_0001267 3300035084 Bacteria 4972
832 Ga0373929_0000064 3300035085 Bacteria 18387
833 Ga0373929_0020662 3300035085 Bacteria 1329
834 Ga0373934_0007860 3300035086 Bacteria 3966
835 Ga0373934_0020314 3300035086 Bacteria 2552
836 Ga0373940_0000195 3300035088 Bacteria 8348
837 Ga0373944_0000648 3300035089 Bacteria 8271
838 Ga0373944_0001561 3300035089 Bacteria 5790
839 Ga0373944_0013726 3300035089 Bacteria 2252
840 Ga0373949_0000532 3300035090 Bacteria 12548
841 Ga0373949_0001783 3300035090 Bacteria 5906
842 Ga0373949_0005307 3300035090 Bacteria 2881
843 Ga0373951_0000849 3300035091 Bacteria 8284
844 Ga0373951_0009362 3300035091 Bacteria 2207
845 Ga0373952_0000213 3300035092 Bacteria 9154
846 Ga0373952_0004534 3300035092 Bacteria 2521
847 Ga0373952_0009378 3300035092 Bacteria 1872
848 Ga0373923_0000903 3300035111 Bacteria 7919
849 Ga0373923_0001215 3300035111 Bacteria 7223
850 Ga0373923_0004217 3300035111 Bacteria 4747
851 Ga0373923_0031169 3300035111 Bacteria 2148
852 Ga0373932_0002875 3300035112 Bacteria 4252
853 Ga0373932_0003090 3300035112 Bacteria 4057
854 Ga0373936_0001539 3300035113 Bacteria 8398
855 Ga0373936_0003882 3300035113 Bacteria 5634
856 Ga0373936_0010131 3300035113 Bacteria 3559
857 Ga0373939_0000619 3300035114 Bacteria 8812
858 Ga0373939_0007187 3300035114 Bacteria 2701
859 Ga0373939_0022601 3300035114 Bacteria 1734
860 Ga0373941_0000027 3300035115 Bacteria 22089
861 Ga0373941_0001078 3300035115 Bacteria 5676
862 Ga0373945_0000024 3300035116 Bacteria 30607
863 Ga0373945_0007150 3300035116 Bacteria 3614
864 Ga0373953_0002197 3300035117 Bacteria 5844
865 Ga0373953_0003448 3300035117 Bacteria 4928
866 Ga0373953_0012954 3300035117 Bacteria 2967
867 Ga0373953_0054980 3300035117 Bacteria 1615
868 Ga0373953_0072680 3300035117 Bacteria 1421
869 Ga0373954_0004597 3300035118 Bacteria 5947
870 Ga0373954_0004676 3300035118 Bacteria 5902
871 Ga0373954_0005155 3300035118 Bacteria 5642
872 Ga0373954_0021313 3300035118 Bacteria 2933
873 Ga0373954_0031272 3300035118 Bacteria 2457
874 Ga0373956_0001142 3300035119 Bacteria 10971
875 Ga0373956_0012890 3300035119 Bacteria 3472
876 Ga0373956_0020290 3300035119 Bacteria 2826
877 Ga0373956_0048050 3300035119 Bacteria 1910
878 Ga0373957_0004186 3300035120 Bacteria 4365
879 Ga0373957_0066681 3300035120 Bacteria 1402
880 Ga0373960_0000904 3300035121 Bacteria 6305
881 Ga0373960_0002618 3300035121 Bacteria 4069
882 Ga0373943_0013643 3300035170 Bacteria 3673
883 Ga0373943_0034830 3300035170 Bacteria 2403
884 Ga0373943_0042435 3300035170 Bacteria 2205
885 Ga0373943_0058552 3300035170 Bacteria 1918
886 Ga0373943_0087942 3300035170 Bacteria 1604
887 Ga0373943_0111838 3300035170 Bacteria 1441
888 Ga0373946_0005953 3300035171 Bacteria 4419
889 Ga0373946_0014935 3300035171 Bacteria 2936
890 Ga0373946_0015890 3300035171 Bacteria 2861
891 Ga0373946_0030578 3300035171 Bacteria 2150
892 Ga0373946_0044776 3300035171 Bacteria 1828
893 Ga0373946_0051134 3300035171 Bacteria 1728
894 Ga0373955_0000172 3300035172 Bacteria 26530
895 Ga0373955_0001767 3300035172 Bacteria 9270
896 Ga0373955_0003013 3300035172 Bacteria 7382
897 Ga0373955_0010601 3300035172 Bacteria 4359
898 Ga0373955_0023058 3300035172 Bacteria 3166
899 Ga0373955_0174344 3300035172 Bacteria 1274
900 Ga0373942_0000012 3300035207 Bacteria 34288
901 Ga0373942_0002310 3300035207 Bacteria 4661
902 Ga0373961_0000800 3300035241 Bacteria 10745
903 Ga0373961_0003565 3300035241 Bacteria 3831
904 Ga0373961_0006335 3300035241 Bacteria 2845
905 Ga0373961_0022769 3300035241 Bacteria 1679
906 Ga0373962_0000193 3300035242 Bacteria 12928
907 Ga0373962_0003472 3300035242 Bacteria 3785
908 Ga0373962_0011022 3300035242 Bacteria 2261
909 Ga0316574_0151975 3300035398 Bacteria 1492
910 Ga0373924_0001803 3300035410 Bacteria 7079
911 Ga0373924_0006937 3300035410 Bacteria 4077
912 Ga0373924_0045414 3300035410 Bacteria 1807
913 Ga0373931_0007554 3300035691 Bacteria 5120
914 Ga0373931_0008043 3300035691 Bacteria 4989
915 Ga0373931_0015883 3300035691 Bacteria 3697
916 Ga0373931_0035730 3300035691 Bacteria 2585
917 Ga0373931_0041914 3300035691 Bacteria 2406
918 Ga0373931_0066399 3300035691 Bacteria 1957
919 Ga0373931_0078912 3300035691 Bacteria 1812
920 Ga0373931_0096327 3300035691 Bacteria 1657
921 Ga0373931_0150578 3300035691 Bacteria 1356
922 Ga0373935_0000038 3300035692 Bacteria 51446
923 Ga0373935_0008124 3300035692 Bacteria 6291
924 Ga0373935_0008653 3300035692 Bacteria 6095
925 Ga0373935_0031453 3300035692 Bacteria 3294
926 Ga0373935_0044826 3300035692 Bacteria 2789
927 Ga0373935_0110469 3300035692 Bacteria 1824
928 Ga0373935_0165642 3300035692 Bacteria 1509
929 Ga0373927_0001618 3300035695 Bacteria 16878
930 Ga0373927_0003867 3300035695 Bacteria 10616
931 Ga0373927_0004343 3300035695 Bacteria 9943
932 Ga0373927_0017582 3300035695 Bacteria 4705
933 Ga0373927_0059755 3300035695 Bacteria 2466
934 Ga0373927_0098966 3300035695 Bacteria 1896
935 Ga0373927_0102646 3300035695 Bacteria 1860
936 Ga0373927_0119317 3300035695 Bacteria 1721
937 Ga0373927_0155327 3300035695 Bacteria 1498
938 Ga0373927_0246921 3300035695 Bacteria 1173
939 Ga0373933_0001050 3300035724 Bacteria 16724
940 Ga0373933_0009485 3300035724 Bacteria 5315
941 Ga0373933_0019818 3300035724 Bacteria 3806
942 Ga0373933_0043041 3300035724 Bacteria 2670
943 Ga0373933_0070438 3300035724 Bacteria 2127
944 Ga0373947_0000229 3300035725 Bacteria 31423
945 Ga0373947_0000581 3300035725 Bacteria 21444
946 Ga0373947_0001717 3300035725 Bacteria 13399
947 Ga0373947_0012283 3300035725 Bacteria 4906
948 Ga0373947_0014863 3300035725 Bacteria 4467
949 Ga0373947_0037899 3300035725 Bacteria 2861
950 Ga0373947_0042744 3300035725 Bacteria 2705
951 Ga0373947_0137024 3300035725 Bacteria 1567
952 Ga0373937_0000004 3300036401 Bacteria 212269
953 Ga0373937_0001194 3300036401 Bacteria 21805
954 Ga0373937_0004490 3300036401 Bacteria 11855
955 Ga0373937_0013915 3300036401 Bacteria 7093
956 Ga0373937_0051666 3300036401 Bacteria 3767
957 Ga0373937_0173638 3300036401 Bacteria 2022
958 Ga0373925_0000424 3300037068 Bacteria 42803
959 Ga0373925_0006642 3300037068 Bacteria 8493
960 Ga0373925_0011259 3300037068 Bacteria 6488
961 Ga0373925_0011691 3300037068 Bacteria 6348
962 Ga0373925_0029290 3300037068 Bacteria 4039
963 Ga0373925_0042290 3300037068 Bacteria 3380
964 Ga0373925_0094879 3300037068 Bacteria 2284
965 Ga0373925_0126885 3300037068 Bacteria 1986
966 Ga0373925_0162556 3300037068 Bacteria 1759
967 Ga0373925_0172627 3300037068 Bacteria 1707
968 Ga0373925_0317423 3300037068 Bacteria 1260
969 Ga0395898_0062352 3300037466 Bacteria 3621
970 Ga0395898_0166629 3300037466 Bacteria 2107
971 Ga0395898_0167403 3300037466 Bacteria 2101
972 Ga0395905_0070001 3300037471 Bacteria 3287
973 Ga0436364_0345988 3300037853 Bacteria 7115
974 Ga0436364_0423755 3300037853 Bacteria 87339
975 Ga0436364_1276955 3300037853 Bacteria 2218
976 Ga0436364_1535918 3300037853 Bacteria 3968
977 Ga0395901_0246201 3300038443 Bacteria 1863
978 Ga0395901_0477365 3300038443 Bacteria 1272
979 Ga0395901_0488820 3300038443 Bacteria 1254
980 Ga0436365_0076921 3300039437 Bacteria 40502
981 Ga0436365_0412636 3300039437 Bacteria 56608
982 Ga0436365_0444168 3300039437 Bacteria 22362
983 Ga0436365_0579618 3300039437 Bacteria 2875
984 Ga0436365_0842200 3300039437 Bacteria 6262
985 Ga0436365_1149508 3300039437 Bacteria 1345
986 Ga0436365_1209982 3300039437 Bacteria 1327
987 Ga0436365_1517019 3300039437 Bacteria 1289
988 Ga0436365_1582991 3300039437 Bacteria 3489
989 Ga0436365_1807266 3300039437 Bacteria 2762
990 Ga0436361_0601490 3300039447 Bacteria 1978
991 Ga0436361_1055020 3300039447 Bacteria 6935
992 Ga0436361_1192122 3300039447 Bacteria 3932
993 Ga0436363_0271626 3300039450 Bacteria 2497
994 Ga0436363_0548238 3300039450 Bacteria 7729
995 Ga0436363_1101874 3300039450 Bacteria 38864
996 Ga0436363_1268862 3300039450 Bacteria 1888
997 Ga0436363_1691760 3300039450 Bacteria 1300
998 Ga0439448_0026459 3300042005 Bacteria 1824
999 Ga0439455_0013241 3300042012 Bacteria 1865
1000 Ga0466961_0061021 3300044693 Bacteria 2397
1001 Ga0466961_0130400 3300044693 Bacteria 1576
1002 Ga0466963_0153274 3300044694 Bacteria 1601
1003 Ga0466957_0047540 3300044842 Bacteria 2607
1004 Ga0451576_0020422 3300045051 Bacteria 7215
1005 Ga0466967_0004180 3300045976 Bacteria 9663
1006 Ga0466967_0050355 3300045976 Bacteria 3647
1007 Ga0495617_017934 3300046452 Bacteria 2393
1008 Ga0495592_0000032 3300046454 Bacteria 128274
1009 Ga0495592_0009020 3300046454 Bacteria 7494
1010 Ga0495592_0016478 3300046454 Bacteria 5607
1011 Ga0495592_0016847 3300046454 Bacteria 5549
1012 Ga0495603_0005155 3300046455 Bacteria 7806
1013 Ga0495603_0013983 3300046455 Bacteria 4854
1014 Ga0495603_0037151 3300046455 Bacteria 2922
1015 Ga0495603_0061058 3300046455 Bacteria 2226
1016 Ga0495603_0095239 3300046455 Bacteria 1739
1017 Ga0495590_0040082 3300046457 Bacteria 1634
1018 Ga0495629_0001232 3300046459 Bacteria 20103
1019 Ga0495629_0001465 3300046459 Bacteria 18592
1020 Ga0495629_0002050 3300046459 Bacteria 15663
1021 Ga0495638_0008231 3300046460 Bacteria 7410
1022 Ga0495638_0077106 3300046460 Bacteria 2030
1023 Ga0495641_0006019 3300046461 Bacteria 7983
1024 Ga0495641_0014796 3300046461 Bacteria 4204
1025 Ga0495641_0026036 3300046461 Bacteria 2861
1026 Ga0495641_0060393 3300046461 Bacteria 1713
1027 Ga0495641_0075574 3300046461 Bacteria 1510
1028 Ga0495651_0000799 3300046462 Bacteria 24378
1029 Ga0495651_0001360 3300046462 Bacteria 18929
1030 Ga0495651_0007731 3300046462 Bacteria 8226
1031 Ga0495651_0013259 3300046462 Bacteria 6374
1032 Ga0495653_0000012 3300046463 Bacteria 266880
1033 Ga0495653_0001069 3300046463 Bacteria 21100
1034 Ga0495653_0003134 3300046463 Bacteria 13253
1035 Ga0495653_0018668 3300046463 Bacteria 5630
1036 Ga0495580_0005009 3300046472 Bacteria 11048
1037 Ga0495580_0017623 3300046472 Bacteria 5335
1038 Ga0495580_0058785 3300046472 Bacteria 2703
1039 Ga0495580_0302495 3300046472 Bacteria 1089
1040 Ga0495582_0000570 3300046473 Bacteria 20403
1041 Ga0495582_0004754 3300046473 Bacteria 7634
1042 Ga0495582_0028921 3300046473 Bacteria 3043
1043 Ga0495582_0034833 3300046473 Bacteria 2768
1044 Ga0495582_0044708 3300046473 Bacteria 2439
1045 Ga0495582_0102076 3300046473 Bacteria 1606
1046 Ga0495639_0002103 3300046475 Bacteria 8793
1047 Ga0495639_0014886 3300046475 Bacteria 3371
1048 Ga0495639_0027206 3300046475 Bacteria 2530
1049 Ga0495639_0050994 3300046475 Bacteria 1881
1050 Ga0495639_0077878 3300046475 Bacteria 1540
1051 Ga0495662_0000879 3300046476 Bacteria 14679
1052 Ga0495662_0001012 3300046476 Bacteria 13797
1053 Ga0495662_0002431 3300046476 Bacteria 9362
1054 Ga0495662_0016111 3300046476 Bacteria 3625
1055 Ga0495662_0025150 3300046476 Bacteria 2874
1056 Ga0495664_0000004 3300046477 Bacteria 489411
1057 Ga0495664_0000146 3300046477 Bacteria 35506
1058 Ga0495664_0000563 3300046477 Bacteria 18692
1059 Ga0495664_0126142 3300046477 Bacteria 1548
1060 Ga0495584_0010718 3300046491 Bacteria 4708
1061 Ga0495585_0002912 3300046492 Bacteria 11854
1062 Ga0495585_0174701 3300046492 Bacteria 1107
1063 Ga0495594_0026229 3300046499 Bacteria 3134
1064 Ga0495594_0056365 3300046499 Bacteria 2168
1065 Ga0495594_0101385 3300046499 Bacteria 1619
1066 Ga0495607_0042874 3300046501 Bacteria 2679
1067 Ga0495583_0087074 3300046506 Bacteria 1350
1068 Ga0495608_0000017 3300046511 Bacteria 192929
1069 Ga0495608_0002512 3300046511 Bacteria 13163
1070 Ga0495608_0003432 3300046511 Bacteria 11348
1071 Ga0495608_0015292 3300046511 Bacteria 5324
1072 Ga0495608_0095690 3300046511 Bacteria 1918
1073 Ga0495608_0099976 3300046511 Bacteria 1870
1074 Ga0495608_0234590 3300046511 Bacteria 1148
1075 Ga0495616_0067680 3300046513 Bacteria 1735
1076 Ga0495618_0000006 3300046514 Bacteria 229906
1077 Ga0495618_0000473 3300046514 Bacteria 28654
1078 Ga0495618_0035358 3300046514 Bacteria 3135
1079 Ga0495618_0091228 3300046514 Bacteria 1947
1080 Ga0495628_0000001 3300046516 Bacteria 917742
1081 Ga0495628_0004103 3300046516 Bacteria 12959
1082 Ga0495628_0005499 3300046516 Bacteria 11090
1083 Ga0495628_0011495 3300046516 Bacteria 7483
1084 Ga0495630_0000422 3300046517 Bacteria 32636
1085 Ga0495630_0007807 3300046517 Bacteria 7660
1086 Ga0495630_0068325 3300046517 Bacteria 2672
1087 Ga0495630_0139263 3300046517 Bacteria 1845
1088 Ga0495630_0157466 3300046517 Bacteria 1729
1089 Ga0495631_0113702 3300046518 Bacteria 1164
1090 Ga0495637_0063129 3300046520 Bacteria 1514
1091 Ga0495643_0052199 3300046522 Bacteria 2196
1092 Ga0495644_0024172 3300046523 Bacteria 2311
1093 Ga0495644_0043960 3300046523 Bacteria 1680
1094 Ga0495648_0075844 3300046524 Bacteria 1932
1095 Ga0495666_0010597 3300046526 Bacteria 4595
1096 Ga0495666_0014995 3300046526 Bacteria 3857
1097 Ga0495652_0000002 3300046529 Bacteria 946606
1098 Ga0495652_0003864 3300046529 Bacteria 14606
1099 Ga0495652_0047192 3300046529 Bacteria 3694
1100 Ga0495652_0070621 3300046529 Bacteria 2918
1101 Ga0495652_0330327 3300046529 Bacteria 1099
1102 Ga0495665_0000227 3300046531 Bacteria 28192
1103 Ga0495665_0084309 3300046531 Bacteria 1670
1104 Ga0495640_0000001 3300046533 Bacteria 853827
1105 Ga0495640_0001488 3300046533 Bacteria 18447
1106 Ga0495640_0002833 3300046533 Bacteria 13941
1107 Ga0495640_0024233 3300046533 Bacteria 4415
1108 Ga0495640_0034413 3300046533 Bacteria 3592
1109 Ga0495640_0059161 3300046533 Bacteria 2611
1110 Ga0495640_0075095 3300046533 Bacteria 2258
1111 Ga0495586_0012979 3300046535 Bacteria 4415
1112 Ga0495587_0000008 3300046536 Bacteria 271097
1113 Ga0495587_0003639 3300046536 Bacteria 10260
1114 Ga0495587_0008368 3300046536 Bacteria 6655
1115 Ga0495587_0012855 3300046536 Bacteria 5264
1116 Ga0495598_0041403 3300046537 Bacteria 1347
1117 Ga0495609_0065627 3300046538 Bacteria 1600
1118 Ga0495609_0081439 3300046538 Bacteria 1415
1119 Ga0495609_0100173 3300046538 Bacteria 1256
1120 Ga0495621_0055834 3300046539 Bacteria 1422
1121 Ga0495645_0000002 3300046543 Bacteria 651644
1122 Ga0495645_0009348 3300046543 Bacteria 6854
1123 Ga0495645_0023181 3300046543 Bacteria 4495
1124 Ga0495645_0097739 3300046543 Bacteria 2090
1125 Ga0495622_0000406 3300046557 Bacteria 28954
1126 Ga0495633_0005373 3300046558 Bacteria 7855
1127 Ga0495667_0000124 3300046559 Bacteria 55660
1128 Ga0495667_0001092 3300046559 Bacteria 17609
1129 Ga0495667_0011961 3300046559 Bacteria 5881
1130 Ga0495667_0034171 3300046559 Bacteria 3399
1131 Ga0495667_0037745 3300046559 Bacteria 3219
1132 Ga0495667_0067913 3300046559 Bacteria 2329
1133 Ga0495667_0082616 3300046559 Bacteria 2087
1134 Ga0495667_0090432 3300046559 Bacteria 1983
1135 Ga0495667_0090541 3300046559 Bacteria 1982
1136 Ga0495656_0000554 3300046615 Bacteria 12229
1137 Ga0495668_0077490 3300046616 Bacteria 1825
1138 Ga0495668_0149001 3300046616 Bacteria 1281
1139 Ga0495668_0157654 3300046616 Bacteria 1243
1140 Ga0495634_0000003 3300046642 Bacteria 206222
1141 Ga0495634_0004424 3300046642 Bacteria 11039
1142 Ga0495634_0046635 3300046642 Bacteria 2924
1143 Ga0495634_0109540 3300046642 Bacteria 1777
1144 Ga0495634_0117121 3300046642 Bacteria 1708
1145 Ga0495611_0034086 3300046648 Bacteria 2249
1146 Ga0495635_0000002 3300046663 Bacteria 490490
1147 Ga0495635_0002104 3300046663 Bacteria 13505
1148 Ga0495635_0016723 3300046663 Bacteria 5125
1149 Ga0495635_0022896 3300046663 Bacteria 4354
1150 Ga0495635_0024301 3300046663 Bacteria 4224
1151 Ga0495635_0031658 3300046663 Bacteria 3670
1152 Ga0495635_0040864 3300046663 Bacteria 3204
1153 Ga0495635_0128331 3300046663 Bacteria 1729
1154 Ga0495635_0261668 3300046663 Bacteria 1165
1155 Ga0495659_0016170 3300046664 Bacteria 2459
1156 Ga0495659_0023703 3300046664 Bacteria 2087
1157 Ga0495659_0035644 3300046664 Bacteria 1754
1158 Ga0495588_0004978 3300046674 Bacteria 5900
1159 Ga0495588_0127124 3300046674 Bacteria 1344
1160 Ga0495657_0000054 3300046675 Bacteria 99620
1161 Ga0495657_0008729 3300046675 Bacteria 7737
1162 Ga0495657_0096183 3300046675 Bacteria 1892
1163 Ga0495657_0158481 3300046675 Bacteria 1401
1164 Ga0495599_0000005 3300046678 Bacteria 300169
1165 Ga0495599_0020724 3300046678 Bacteria 4097
1166 Ga0495599_0022366 3300046678 Bacteria 3946
1167 Ga0495599_0035696 3300046678 Bacteria 3121
1168 Ga0495599_0076139 3300046678 Bacteria 2095
1169 Ga0495623_0000148 3300046679 Bacteria 43192
1170 Ga0495623_0002021 3300046679 Bacteria 13614
1171 Ga0495623_0027550 3300046679 Bacteria 3656
1172 Ga0495623_0097234 3300046679 Bacteria 1798
1173 Ga0495646_0000002 3300046680 Bacteria 310568
1174 Ga0495646_0016750 3300046680 Bacteria 4653
1175 Ga0495646_0035451 3300046680 Bacteria 3095
1176 Ga0495646_0112055 3300046680 Bacteria 1552
1177 Ga0495646_0155292 3300046680 Bacteria 1270
1178 Ga0495647_0009539 3300046681 Bacteria 3290
1179 Ga0495658_0000543 3300046683 Bacteria 20578
1180 Ga0495658_0002466 3300046683 Bacteria 9317
1181 Ga0495658_0034649 3300046683 Bacteria 2771
1182 Ga0495658_0050889 3300046683 Bacteria 2345
1183 Ga0495658_0135987 3300046683 Bacteria 1499
1184 Ga0495613_0002489 3300046689 Bacteria 13900
1185 Ga0495613_0168083 3300046689 Bacteria 1557
1186 Ga0495613_0188279 3300046689 Bacteria 1459
1187 Ga0495624_0001896 3300046690 Bacteria 15925
1188 Ga0495624_0013382 3300046690 Bacteria 5595
1189 Ga0495624_0027306 3300046690 Bacteria 3737
1190 Ga0495624_0129200 3300046690 Bacteria 1550
1191 Ga0495624_0168611 3300046690 Bacteria 1336
1192 Ga0495670_0009745 3300046691 Bacteria 4721
1193 Ga0495600_0000012 3300046809 Bacteria 119798
1194 Ga0495600_0004562 3300046809 Bacteria 8305
1195 Ga0495600_0006388 3300046809 Bacteria 7175
1196 Ga0495600_0016042 3300046809 Bacteria 4749
1197 Ga0495660_0114681 3300046810 Bacteria 1371
1198 Ga0495660_0145528 3300046810 Bacteria 1175
1199 Ga0495581_0003432 3300047315 Bacteria 9101
1200 Ga0495581_0027818 3300047315 Bacteria 3279
1201 Ga0495581_0058614 3300047315 Bacteria 2224
1202 Ga0495581_0070554 3300047315 Bacteria 2021
1203 Ga0495604_0000009 3300047317 Bacteria 326341
1204 Ga0495604_0000422 3300047317 Bacteria 38179
1205 Ga0495604_0013474 3300047317 Bacteria 6513
1206 Ga0495604_0015408 3300047317 Bacteria 6101
1207 Ga0495604_0057176 3300047317 Bacteria 2999
1208 Ga0495674_0000002 3300047319 Bacteria 642785
1209 Ga0495674_0000641 3300047319 Bacteria 32747
1210 Ga0495674_0001683 3300047319 Bacteria 21746
1211 Ga0495674_0026343 3300047319 Bacteria 5320
1212 Ga0495674_0175444 3300047319 Bacteria 1786
1213 Ga0495672_0030618 3300047320 Bacteria 3373
1214 Ga0495676_0013899 3300047321 Bacteria 7217
1215 Ga0495676_0014569 3300047321 Bacteria 7034
1216 Ga0495676_0080098 3300047321 Bacteria 2481
1217 Ga0495676_0115141 3300047321 Bacteria 1966
1218 Ga0495676_0151994 3300047321 Bacteria 1646
1219 Ga0495676_0265329 3300047321 Bacteria 1167
1220 Ga0495680_0001385 3300047322 Bacteria 26203
1221 Ga0495680_0002139 3300047322 Bacteria 20514
1222 Ga0495680_0012328 3300047322 Bacteria 7529
1223 Ga0495680_0031291 3300047322 Bacteria 4333
1224 Ga0495680_0033026 3300047322 Bacteria 4194
1225 Ga0495680_0059613 3300047322 Bacteria 2946
1226 Ga0495680_0121345 3300047322 Bacteria 1929
1227 Ga0495680_0133161 3300047322 Bacteria 1824
1228 Ga0495680_0256882 3300047322 Bacteria 1237
1229 Ga0495675_0000028 3300047444 Bacteria 105848
1230 Ga0495675_0001398 3300047444 Bacteria 14624
1231 Ga0495675_0002936 3300047444 Bacteria 10246
1232 Ga0495675_0020224 3300047444 Bacteria 4232
1233 Ga0495675_0173041 3300047444 Bacteria 1325
1234 Ga0495685_021999 3300047447 Bacteria 2194
1235 Ga0495684_0000006 3300047471 Bacteria 247568
1236 Ga0495684_0003544 3300047471 Bacteria 12202
1237 Ga0495684_0096843 3300047471 Bacteria 2233
1238 Ga0495684_0173043 3300047471 Bacteria 1604
1239 Ga0495684_0186828 3300047471 Bacteria 1534
1240 Ga0495684_0246095 3300047471 Bacteria 1302
1241 Ga0495593_0000140 3300047673 Bacteria 35205
1242 Ga0495593_0003620 3300047673 Bacteria 9229
1243 Ga0495593_0017662 3300047673 Bacteria 4016
1244 Ga0495593_0019980 3300047673 Bacteria 3751
1245 Ga0495593_0029930 3300047673 Bacteria 2982
1246 Ga0495593_0058615 3300047673 Bacteria 2019
1247 Ga0495593_0141588 3300047673 Bacteria 1218
1248 Ga0495602_0000005 3300048088 Bacteria 325957
1249 Ga0495602_0012613 3300048088 Bacteria 8673
1250 Ga0495602_0013847 3300048088 Bacteria 8223
1251 Ga0495602_0023728 3300048088 Bacteria 5969
1252 Ga0495602_0028153 3300048088 Bacteria 5383
1253 Ga0495602_0192161 3300048088 Bacteria 1564
1254 Ga0495602_0224592 3300048088 Bacteria 1415
1255 Ga0495602_0229125 3300048088 Bacteria 1397
1256 Ga0495602_0318915 3300048088 Bacteria 1131
1257 Ga0495614_0018609 3300048089 Bacteria 3009
1258 Ga0495614_0050054 3300048089 Bacteria 1791
1259 Ga0496100_0003363 3300048903 Bacteria 8326
1260 Ga0496100_0010707 3300048903 Bacteria 5202
1261 Ga0496100_0022979 3300048903 Bacteria 3780
1262 Ga0496100_0126935 3300048903 Bacteria 1791
1263 Ga0496101_0001983 3300048904 Bacteria 12419
1264 Ga0496101_0004451 3300048904 Bacteria 8825
1265 Ga0496101_0029082 3300048904 Bacteria 3863
1266 Ga0496101_0038116 3300048904 Bacteria 3412
1267 Ga0496101_0110681 3300048904 Bacteria 2067
1268 Ga0496101_0162285 3300048904 Bacteria 1714
1269 Ga0496101_0179948 3300048904 Bacteria 1628
1270 Ga0496101_0228615 3300048904 Bacteria 1445
1271 Ga0496102_0002793 3300048905 Bacteria 14888
1272 Ga0496102_0006263 3300048905 Bacteria 10146
1273 Ga0496102_0018288 3300048905 Bacteria 6157
1274 Ga0496102_0031173 3300048905 Bacteria 4780
1275 Ga0496102_0115925 3300048905 Bacteria 2499
1276 Ga0496102_0120566 3300048905 Bacteria 2449
1277 Ga0496102_0136784 3300048905 Bacteria 2296
1278 Ga0496102_0158177 3300048905 Bacteria 2131
1279 Ga0496102_0211868 3300048905 Bacteria 1826
1280 Ga0496103_0002369 3300048906 Bacteria 11883
1281 Ga0496103_0018805 3300048906 Bacteria 4147
1282 Ga0496103_0025729 3300048906 Bacteria 3559
1283 Ga0496103_0032986 3300048906 Bacteria 3162
1284 Ga0496104_0000092 3300048907 Bacteria 87232
1285 Ga0496104_0001496 3300048907 Bacteria 20148
1286 Ga0496104_0002184 3300048907 Bacteria 16947
1287 Ga0496104_0003070 3300048907 Bacteria 14395
1288 Ga0496104_0004660 3300048907 Bacteria 11929
1289 Ga0496104_0008945 3300048907 Bacteria 8901
1290 Ga0496104_0095919 3300048907 Bacteria 2837
1291 Ga0496104_0115235 3300048907 Bacteria 2578
1292 Ga0496104_0199419 3300048907 Bacteria 1913
1293 Ga0496104_0381273 3300048907 Bacteria 1322
1294 Ga0496105_0002505 3300048908 Bacteria 13315
1295 Ga0496105_0017751 3300048908 Bacteria 5708
1296 Ga0496105_0032314 3300048908 Bacteria 4293
1297 Ga0496105_0038039 3300048908 Bacteria 3963
1298 Ga0496105_0044916 3300048908 Bacteria 3644
1299 Ga0496105_0056308 3300048908 Bacteria 3245
1300 Ga0496105_0083712 3300048908 Bacteria 2634
1301 Ga0496105_0147889 3300048908 Bacteria 1932
1302 Ga0496105_0257332 3300048908 Bacteria 1413
1303 Ga0496106_0001556 3300048909 Bacteria 17284
1304 Ga0496106_0006513 3300048909 Bacteria 8641
1305 Ga0496106_0007123 3300048909 Bacteria 8258
1306 Ga0496106_0010646 3300048909 Bacteria 6795
1307 Ga0496106_0011495 3300048909 Bacteria 6547
1308 Ga0496106_0025653 3300048909 Bacteria 4387
1309 Ga0496106_0053802 3300048909 Bacteria 3041
1310 Ga0496106_0143715 3300048909 Bacteria 1878
1311 Ga0496106_0215676 3300048909 Bacteria 1529
1312 Ga0496107_0002095 3300048910 Bacteria 12782
1313 Ga0496107_0006823 3300048910 Bacteria 7864
1314 Ga0496107_0009309 3300048910 Bacteria 6810
1315 Ga0496107_0011605 3300048910 Bacteria 6141
1316 Ga0496107_0011996 3300048910 Bacteria 6047
1317 Ga0496107_0034987 3300048910 Bacteria 3600
1318 Ga0496107_0037902 3300048910 Bacteria 3460
1319 Ga0496107_0129269 3300048910 Bacteria 1864
1320 Ga0496107_0301825 3300048910 Bacteria 1192
1321 Ga0496108_0044354 3300048911 Bacteria 3712
1322 Ga0496108_0061493 3300048911 Bacteria 3160
1323 Ga0496108_0126233 3300048911 Bacteria 2196
1324 Ga0496108_0270335 3300048911 Bacteria 1479
1325 Ga0496108_0423472 3300048911 Bacteria 1163
1326 Ga0496109_0004575 3300048912 Bacteria 11545
1327 Ga0496109_0004879 3300048912 Bacteria 11202
1328 Ga0496109_0024900 3300048912 Bacteria 5327
1329 Ga0496109_0066090 3300048912 Bacteria 3310
1330 Ga0496109_0074738 3300048912 Bacteria 3115
1331 Ga0496110_0008731 3300048913 Bacteria 8160
1332 Ga0496110_0033011 3300048913 Bacteria 4475
1333 Ga0496110_0045663 3300048913 Bacteria 3830
1334 Ga0496110_0074244 3300048913 Bacteria 3019
1335 Ga0496110_0297043 3300048913 Bacteria 1471
1336 Ga0496110_0310766 3300048913 Bacteria 1435
1337 Ga0496111_0002467 3300048914 Bacteria 11163
1338 Ga0496111_0005664 3300048914 Bacteria 8043
1339 Ga0496111_0033708 3300048914 Bacteria 3653
1340 Ga0496111_0071923 3300048914 Bacteria 2517
1341 Ga0496111_0072960 3300048914 Bacteria 2499
1342 Ga0496111_0118903 3300048914 Bacteria 1951
1343 Ga0496112_0012109 3300048915 Bacteria 7913
1344 Ga0496112_0013195 3300048915 Bacteria 7621
1345 Ga0496112_0026113 3300048915 Bacteria 5615
1346 Ga0496112_0058511 3300048915 Bacteria 3795
1347 Ga0496112_0063132 3300048915 Bacteria 3653
1348 Ga0496112_0070420 3300048915 Bacteria 3456
1349 Ga0496112_0122868 3300048915 Bacteria 2567
1350 Ga0496112_0138807 3300048915 Bacteria 2400
1351 Ga0496112_0210891 3300048915 Bacteria 1900
1352 Ga0496112_0221768 3300048915 Bacteria 1847
1353 Ga0496112_0269770 3300048915 Bacteria 1650
1354 Ga0496112_0377595 3300048915 Bacteria 1359
1355 Ga0496113_0004559 3300048916 Bacteria 8532
1356 Ga0496113_0030266 3300048916 Bacteria 3918
1357 Ga0496113_0203544 3300048916 Bacteria 1574
1358 Ga0496113_0427901 3300048916 Bacteria 1063
1359 Ga0496114_0007468 3300048917 Bacteria 8642
1360 Ga0496114_0014545 3300048917 Bacteria 6321
1361 Ga0496114_0045150 3300048917 Bacteria 3659
1362 Ga0496114_0065969 3300048917 Bacteria 3034
1363 Ga0496114_0070232 3300048917 Bacteria 2941
1364 Ga0496114_0076177 3300048917 Bacteria 2826
1365 Ga0496114_0157252 3300048917 Bacteria 1974
1366 Ga0496114_0191758 3300048917 Bacteria 1788
1367 Ga0496115_0002647 3300048918 Bacteria 12855
1368 Ga0496115_0003701 3300048918 Bacteria 11002
1369 Ga0496115_0008444 3300048918 Bacteria 7619
1370 Ga0496115_0014579 3300048918 Bacteria 5950
1371 Ga0496115_0015732 3300048918 Bacteria 5746
1372 Ga0496115_0023426 3300048918 Bacteria 4792
1373 Ga0496115_0023859 3300048918 Bacteria 4750
1374 Ga0496115_0029485 3300048918 Bacteria 4310
1375 Ga0496115_0031985 3300048918 Bacteria 4149
1376 Ga0496115_0044951 3300048918 Bacteria 3524
1377 Ga0496115_0086975 3300048918 Bacteria 2550
1378 Ga0496115_0100489 3300048918 Bacteria 2371
1379 Ga0496115_0152473 3300048918 Bacteria 1908
1380 Ga0496115_0158786 3300048918 Bacteria 1868
1381 Ga0496115_0377670 3300048918 Bacteria 1153
1382 Ga0496115_0405039 3300048918 Bacteria 1106
1383 Ga0496119_0004791 3300048922 Bacteria 13278
1384 Ga0496120_0058817 3300048923 Bacteria 2157
1385 Ga0496121_0000221 3300048924 Bacteria 123829
1386 Ga0496121_0002376 3300048924 Bacteria 28938
1387 Ga0496122_0004715 3300048925 Bacteria 16745
1388 Ga0496122_0038130 3300048925 Bacteria 3856
1389 Ga0496122_0067923 3300048925 Bacteria 2563
1390 Ga0496123_0000896 3300048926 Bacteria 47149
1391 Ga0496125_0089726 3300048928 Bacteria 2310
1392 Ga0496126_0001612 3300048929 Bacteria 34184
1393 Ga0496126_0010859 3300048929 Bacteria 9493
1394 Ga0496126_0058390 3300048929 Bacteria 3478
1395 Ga0496126_0131925 3300048929 Bacteria 2158
1396 Ga0501032_0010289 3300049569 Bacteria 6750
1397 Ga0501032_0012972 3300049569 Bacteria 5935
1398 Ga0501032_0068072 3300049569 Bacteria 2378
1399 Ga0501032_0082357 3300049569 Bacteria 2141
1400 Ga0501032_0183670 3300049569 Bacteria 1368
1401 Ga0501033_0007661 3300049570 Bacteria 8383
1402 Ga0501033_0012963 3300049570 Bacteria 6359
1403 Ga0501033_0037850 3300049570 Bacteria 3609
1404 Ga0501034_0001958 3300049571 Bacteria 26075
1405 Ga0501034_0005332 3300049571 Bacteria 14085
1406 Ga0501034_0022013 3300049571 Bacteria 6494
1407 Ga0501034_0120311 3300049571 Bacteria 2612
1408 Ga0501034_0149038 3300049571 Bacteria 2316
1409 Ga0501034_0287018 3300049571 Bacteria 1584
1410 Ga0501034_0362491 3300049571 Bacteria 1376
1411 Ga0501036_0000177 3300049572 Bacteria 41942
1412 Ga0501036_0025279 3300049572 Bacteria 5010
1413 Ga0501036_0190859 3300049572 Bacteria 1724
1414 Ga0501037_0044129 3300049573 Bacteria 3275
1415 Ga0501037_0060809 3300049573 Bacteria 2755
1416 Ga0501037_0147000 3300049573 Bacteria 1685
1417 Ga0501037_0246760 3300049573 Bacteria 1250
1418 Ga0501038_0060423 3300049574 Bacteria 3244
1419 Ga0501038_0152036 3300049574 Bacteria 1886
1420 Ga0501038_0261202 3300049574 Bacteria 1368
1421 Ga0501038_0297497 3300049574 Bacteria 1267
1422 Ga0501039_0071256 3300049575 Bacteria 2700
1423 Ga0501040_0036906 3300049576 Bacteria 3318
1424 Ga0501041_0012173 3300049577 Bacteria 5095
1425 Ga0501041_0201472 3300049577 Bacteria 1248
1426 Ga0501043_0001480 3300049579 Bacteria 20550
1427 Ga0501043_0027137 3300049579 Bacteria 4495
1428 Ga0501043_0071087 3300049579 Bacteria 2734
1429 Ga0501043_0293721 3300049579 Bacteria 1243
1430 Ga0501046_0080311 3300049580 Bacteria 2520
1431 Ga0501047_0000756 3300049581 Bacteria 33738
1432 Ga0501047_0063953 3300049581 Bacteria 3549
1433 Ga0501047_0236407 3300049581 Bacteria 1679
1434 Ga0501047_0301515 3300049581 Bacteria 1444
1435 Ga0501048_0000115 3300049582 Bacteria 45729
1436 Ga0501048_0000357 3300049582 Bacteria 31694
1437 Ga0501068_0007338 3300049584 Bacteria 6105
1438 Ga0501070_0000711 3300049586 Bacteria 30493
1439 Ga0501070_0022959 3300049586 Bacteria 5222
1440 Ga0501070_0041057 3300049586 Bacteria 3855
1441 Ga0501070_0213232 3300049586 Bacteria 1584
1442 Ga0501071_0129021 3300049587 Bacteria 1878
1443 Ga0501072_0052570 3300049588 Bacteria 3208
1444 Ga0501073_0013709 3300049589 Bacteria 5896
1445 Ga0501073_0027800 3300049589 Bacteria 4042
1446 Ga0501074_0063526 3300049590 Bacteria 2659
1447 Ga0501076_0004238 3300049592 Bacteria 10148
1448 Ga0501077_0061193 3300049593 Bacteria 2389
1449 Ga0501077_0063025 3300049593 Bacteria 2352
1450 Ga0501079_0012618 3300049741 Bacteria 6453
1451 Ga0501079_0043632 3300049741 Bacteria 3462
1452 Ga0501079_0126174 3300049741 Bacteria 1991
1453 Ga0501080_0003552 3300049742 Bacteria 13734
1454 Ga0501080_0053896 3300049742 Bacteria 3745
1455 Ga0501080_0132077 3300049742 Bacteria 2312
1456 Ga0501081_0249931 3300049743 Bacteria 1294
1457 Ga0501083_0007330 3300049744 Bacteria 7822
1458 Ga0501083_0014091 3300049744 Bacteria 5590
1459 Ga0501083_0033341 3300049744 Bacteria 3527
1460 Ga0501083_0046358 3300049744 Bacteria 2939
1461 Ga0501035_0014773 3300049822 Bacteria 7210
1462 Ga0501035_0032539 3300049822 Bacteria 4743
1463 Ga0501035_0085018 3300049822 Bacteria 2789
1464 Ga0501035_0174786 3300049822 Bacteria 1853
1465 Ga0501044_0035047 3300049823 Bacteria 5257
1466 Ga0501044_0163665 3300049823 Bacteria 2200
1467 Ga0501044_0236190 3300049823 Bacteria 1773
1468 Ga0501044_0249294 3300049823 Bacteria 1717
1469 Ga0501045_0035685 3300049824 Bacteria 3610
1470 Ga0501045_0105199 3300049824 Bacteria 2091
1471 nmdc:mga03683_37233_c1 3300050489 Bacteria 1982
1472 nmdc:mga03n38_16516_c1 3300050490 Bacteria 2872
1473 nmdc:mga03n38_6050_c1 3300050490 Bacteria 4175
1474 nmdc:mga03n38_65129_c1 3300050490 Bacteria 1670
1475 nmdc:mga00v17_38731_c1 3300050491 Bacteria 2852
1476 nmdc:mga00v17_41217_c1 3300050491 Bacteria 2773
1477 nmdc:mga00v17_87003_c1 3300050491 Bacteria 1959
1478 nmdc:mga0yw44_114654_c1 3300050492 Bacteria 1730
1479 nmdc:mga0yw44_124287_c1 3300050492 Bacteria 1665
1480 nmdc:mga0yw44_31228_c1 3300050492 Bacteria 3096
1481 nmdc:mga0yw44_813_c1 3300050492 Bacteria 11629
1482 nmdc:mga0k408_100398_c1 3300050493 Bacteria 1706
1483 nmdc:mga0k408_106249_c1 3300050493 Bacteria 1658
1484 nmdc:mga0k408_110273_c1 3300050493 Bacteria 1627
1485 nmdc:mga0k408_274669_c1 3300050493 Bacteria 1006
1486 nmdc:mga0k408_56850_c1 3300050493 Bacteria 2270
1487 nmdc:mga06z11_2739_c1 3300050494 Bacteria 6760
1488 nmdc:mga06z11_36637_c1 3300050494 Bacteria 2423
1489 nmdc:mga07m45_130278_c1 3300050496 Bacteria 1455
1490 nmdc:mga07m45_29681_c1 3300050496 Bacteria 3026
1491 nmdc:mga07m45_96803_c1 3300050496 Bacteria 1694
1492 nmdc:mga05p37_109457_c1 3300050507 Bacteria 3399
1493 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
1494 nmdc:mga05p37_6119_c1 3300050507 Bacteria 14175
1495 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
1496 nmdc:mga05p37_71061_c1 3300050507 Bacteria 4281
1497 nmdc:mga05p37_7273_c1 3300050507 Bacteria 13063
1498 nmdc:mga05p37_82393_c1 3300050507 Bacteria 3964
1499 nmdc:mga09592_1649_c1 3300050508 Bacteria 17953
1500 nmdc:mga09592_672_c1 3300050508 Bacteria 26131
1501 nmdc:mga09592_72071_c1 3300050508 Bacteria 2933
1502 nmdc:mga0qj67_234885_c1 3300050509 Bacteria 1488
1503 nmdc:mga0qj67_24846_c1 3300050509 Bacteria 4623
1504 nmdc:mga0qj67_341_c1 3300050509 Bacteria 32144
1505 nmdc:mga0qj67_36670_c1 3300050509 Bacteria 3837
1506 nmdc:mga0qj67_58518_c1 3300050509 Bacteria 3055
1507 nmdc:mga06r32_171978_c1 3300050510 Bacteria 2150
1508 nmdc:mga06r32_206794_c1 3300050510 Bacteria 1951
1509 nmdc:mga06r32_35478_c1 3300050510 Bacteria 4705
1510 nmdc:mga06r32_404_c1 3300050510 Bacteria 36414
1511 nmdc:mga06r32_47137_c1 3300050510 Bacteria 4115
1512 nmdc:mga06r32_671_c1 3300050510 Bacteria 29849
1513 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
1514 nmdc:mga08y16_122720_c1 3300050511 Bacteria 2703
1515 nmdc:mga08y16_193762_c1 3300050511 Bacteria 2107
1516 nmdc:mga08y16_275652_c1 3300050511 Bacteria 1736
1517 nmdc:mga08y16_615_c1 3300050511 Bacteria 33272
1518 nmdc:mga08y16_865_c1 3300050511 Bacteria 29154
1519 nmdc:mga0n895_125715_c1 3300050512 Bacteria 2588
1520 nmdc:mga0n895_181670_c1 3300050512 Bacteria 2135
1521 nmdc:mga0n895_19802_c1 3300050512 Bacteria 6261
1522 nmdc:mga0n895_207416_c1 3300050512 Bacteria 1990
1523 nmdc:mga0n895_258606_c1 3300050512 Bacteria 1767
1524 nmdc:mga0n895_266281_c1 3300050512 Bacteria 1739
1525 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
1526 nmdc:mga0rr50_187906_c1 3300050513 Bacteria 1692
1527 nmdc:mga0rr50_5102_c1 3300050513 Bacteria 7792
1528 nmdc:mga0rr50_85379_c1 3300050513 Bacteria 2446
1529 nmdc:mga08x19_127599_c1 3300050514 Bacteria 1709
1530 nmdc:mga08x19_4943_c1 3300050514 Bacteria 7874
1531 nmdc:mga08x19_9575_c1 3300050514 Bacteria 5798
1532 nmdc:mga0a205_11361_c1 3300050515 Bacteria 8196
1533 nmdc:mga0a205_19073_c1 3300050515 Bacteria 6463
1534 nmdc:mga0a205_268_c1 3300050515 Bacteria 37661
1535 nmdc:mga0a205_289522_c1 3300050515 Bacteria 1512
1536 nmdc:mga0a205_86437_c1 3300050515 Bacteria 3028
1537 nmdc:mga0sz30_8011_c1 3300050516 Bacteria 1971
1538 Ga0495601_0000002 3300053077 Bacteria 528704
1539 Ga0495601_0000860 3300053077 Bacteria 16549
1540 Ga0495601_0001376 3300053077 Bacteria 13385
1541 Ga0495601_0002635 3300053077 Bacteria 10183
1542 Ga0495601_0008009 3300053077 Bacteria 6225
1543 Ga0495601_0014329 3300053077 Bacteria 4775
1544 Ga0495601_0042558 3300053077 Bacteria 2850
1545 Ga0495601_0082542 3300053077 Bacteria 2063
1546 Ga0495601_0105887 3300053077 Bacteria 1819
1547 Ga0495601_0252910 3300053077 Bacteria 1150
1548 Ga0495612_0000010 3300053078 Bacteria 227618
1549 Ga0495612_0000075 3300053078 Bacteria 45362
1550 Ga0495612_0000562 3300053078 Bacteria 14913
1551 Ga0495612_0001712 3300053078 Bacteria 8999
1552 Ga0495612_0002201 3300053078 Bacteria 8017
1553 Ga0495612_0013643 3300053078 Bacteria 3273
1554 Ga0495612_0040405 3300053078 Bacteria 1900
1555 Ga0495612_0058465 3300053078 Bacteria 1593
1556 Ga0495595_0000026 3300053084 Bacteria 99949
1557 Ga0495595_0000168 3300053084 Bacteria 25725
1558 Ga0495595_0000589 3300053084 Bacteria 13861
1559 Ga0495595_0003174 3300053084 Bacteria 6518
1560 Ga0495595_0008606 3300053084 Bacteria 4196
1561 Ga0495595_0013688 3300053084 Bacteria 3429
1562 Ga0495595_0046146 3300053084 Bacteria 2006
1563 Ga0495595_0070190 3300053084 Bacteria 1655
1564 Ga0495619_0000019 3300053085 Bacteria 209518
1565 Ga0495619_0000045 3300053085 Bacteria 108543
1566 Ga0495619_0000388 3300053085 Bacteria 30051
1567 Ga0495619_0003526 3300053085 Bacteria 10092
1568 Ga0495619_0008861 3300053085 Bacteria 6358
1569 Ga0495619_0013999 3300053085 Bacteria 5061
1570 Ga0495619_0016140 3300053085 Bacteria 4727
1571 Ga0495619_0027612 3300053085 Bacteria 3657
1572 Ga0495619_0032806 3300053085 Bacteria 3370
1573 Ga0495619_0109834 3300053085 Bacteria 1883
1574 Ga0500643_001251 3300053087 Bacteria 15060
1575 Ga0500566_0001887 3300053094 Bacteria 12333
1576 Ga0500566_0019309 3300053094 Bacteria 4002
1577 Ga0500641_0016442 3300053096 Bacteria 2755
1578 Ga0500556_0000290 3300053104 Bacteria 39103
1579 Ga0500593_000029 3300053117 Bacteria 51244
1580 Ga0500595_000002 3300053119 Bacteria 1074388
1581 Ga0500595_001597 3300053119 Bacteria 11940
1582 Ga0500652_000005 3300053131 Bacteria 171538
1583 Ga0500652_005131 3300053131 Bacteria 4099
1584 Ga0500559_0006649 3300053136 Bacteria 5199
1585 Ga0500559_0025572 3300053136 Bacteria 2512
1586 Ga0500568_0000004 3300053139 Bacteria 621666
1587 Ga0500589_025042 3300053147 Bacteria 2761
1588 Ga0500589_035423 3300053147 Bacteria 2330
1589 Ga0500590_011273 3300053148 Bacteria 4526
1590 Ga0500616_0000002 3300053153 Bacteria 1611257
1591 Ga0500616_0006754 3300053153 Bacteria 7439
1592 Ga0500638_000120 3300053162 Bacteria 15133
1593 Ga0500637_0000070 3300053178 Bacteria 36880
1594 Ga0500611_027050 3300053727 Bacteria 1152
1595 Ga0500645_000156 3300053730 Bacteria 53110
1596 Ga0500645_038386 3300053730 Bacteria 1421
1597 Ga0501084_0160775 3300054114 Bacteria 1895
1598 Ga0500661_000547 3300055283 Bacteria 7008
1599 Ga0501082_0007283 3300060353 Bacteria 9543
1600 Ga0501082_0169542 3300060353 Bacteria 1897
1601 Ga0501082_0254320 3300060353 Bacteria 1528
1602 Ga0530510_0107136 3300061734 Bacteria 2045
1603 Ga0530510_0110402 3300061734 Bacteria 2014
1604 2513591490 2513237087 Bacteria 5817514
1605 2513677761 2513237098 Bacteria 9902361
1606 2513693277 2513237101 Bacteria 7952346
1607 2524467746 2524023210 Bacteria 9029266
1608 2545679291 2545555834 Bacteria 8130841
1609 2596372627 2595698237 Bacteria 6712432
1610 2643757308 2643221547 Bacteria 4740017
1611 2723848187 2721755755 Bacteria 8322773
1612 2793078104
1613 2824723110 2824714736 Bacteria 8717648
1614 2828308332 2828305725 Bacteria 4916900
1615 2857527140 2857524615 Bacteria 6615449
1616 2874608825 2874604998 Bacteria 7834745
1617 2879115446 2879110137 Bacteria 8907982
1618 2885390477 2885383462 Bacteria 9473874
1619 2889037297 2889033259 Bacteria 9099371
1620 2889308376 2889306138 Bacteria 6358934
1621 2893068082 2893066018 Bacteria 6158120
1622 2899260375 2899259804 Bacteria 3320927
1623 2902331308 2902330777 Bacteria 6395352
1624 2902410753 2902405164 Bacteria 6784948
1625 2903774279 2903768456 Bacteria 9749579
1626 2919078255 2919073203 Bacteria 6531949
1627 2919451909 2919450847 Bacteria 5631160
1628 2922361428 2922361189 Bacteria 7436256
1629 2922388851 2922386360 Bacteria 7017218
1630 2928127578 2928125067 Bacteria 5937560
1631 3003671439 3003665799 Bacteria 7279786
1632 641644620 641522639 Bacteria 7737025
1633 643602802 643348564 Bacteria 8839022
1634 8001849999 8001845381 Bacteria 5804942
1635 8006968877 8006964411 Bacteria 8966052
1636 8006985241 8006984368 Bacteria 9651211
1637 8006998562 8006994254 Bacteria 8309700
1638 8056675906 8056673599 Bacteria 7871253
1639 8056682175 8056681323 Bacteria 8472857
1640 Ga0501072_0132472
1641 2214544914
1642 ARcpr5oldR_c000055
1643 ARSoilOldRDRAFT_c000092
1644 ARCol0oldRDRAFT_c00958
1645 ARCol0yngRDRAFT_1000049
1646 JGI24746J21847_1000660
1647 JGI24746J21847_1003668
1648 JGI24739J22299_10005070
1649 JGI24737J22298_10001725
1650 JGI24737J22298_10006539
1651 JGI24737J22298_10008869
1652 JGI24750J21931_1000201
1653 JGI24738J21930_10013666
1654 JGI24749J21850_1003715
1655 JGI24749J21850_1005688
1656 JGI24744J21845_10002186
1657 JGI24744J21845_10004285
1658 JGI24035J26624_1000855
1659 JGI24034J26672_10001663
1660 JGI24742J22300_10000548
1661 JGI25406J46586_10003809
1662 JGI25406J46586_10007133
1663 JGI25153J46596_10003847
1664 JGI26129J50193_1002302
1665 JGI25404J52841_10001785
1666 JGI25405J52794_10006511
1667 Ga0065712_10069289
1668 Ga0065715_10000947
1669 Ga0065715_10096595
1670 Ga0070658_10065700
1671 Ga0070658_10080543
1672 Ga0070676_10004291
1673 Ga0070676_10069735
1674 Ga0070676_10267144
1675 Ga0070683_100004677
1676 Ga0070683_100080091
1677 Ga0070683_100115011
1678 Ga0070690_100008757
1679 Ga0070690_100012125
1680 Ga0070690_100032348
1681 Ga0070690_100087661
1682 Ga0070690_100173921
1683 Ga0070670_100004378
1684 Ga0070670_100006765
1685 Ga0070670_100094117
1686 Ga0070670_100179502
1687 Ga0070677_10010687
1688 Ga0070677_10022125
1689 Ga0068869_100000546
1690 Ga0070666_10016324
1691 Ga0070680_100007445
1692 Ga0070680_100009775
1693 Ga0070680_100070058
1694 Ga0070682_100003445
1695 Ga0070682_100018516
1696 Ga0070682_100023757
1697 Ga0070682_100059999
1698 Ga0070682_100115164
1699 Ga0070682_100277844
1700 Ga0068868_100013168
1701 Ga0068868_100026486
1702 Ga0068868_100029085
1703 Ga0070660_100004111
1704 Ga0070660_100024866
1705 Ga0070660_100066748
1706 Ga0070689_100002392
1707 Ga0070689_100011343
1708 Ga0070689_100023636
1709 Ga0070689_100032975
1710 Ga0070691_10003723
1711 Ga0070691_10030403
1712 Ga0070691_10059641
1713 Ga0070691_10077486
1714 Ga0070687_100001017
1715 Ga0070687_100065224
1716 Ga0070687_100081880
1717 Ga0070661_100001763
1718 Ga0070661_100036019
1719 Ga0070661_100085189
1720 Ga0070661_100180667
1721 Ga0070661_100209699
1722 Ga0070692_10074200
1723 Ga0070692_10150731
1724 Ga0070668_100049439
1725 Ga0070668_100093478
1726 Ga0070668_100230623
1727 Ga0070669_100009976
1728 Ga0070669_100033750
1729 Ga0070669_100072827
1730 Ga0070669_100074273
1731 Ga0070669_100382860
1732 Ga0070675_100029783
1733 Ga0070675_100059157
1734 Ga0070671_100007031
1735 Ga0070671_100019747
1736 Ga0070671_100033007
1737 Ga0070671_100231059
1738 Ga0070674_100018657
1739 Ga0070674_100065444
1740 Ga0070674_100107752
1741 Ga0070674_100210462
1742 Ga0070673_100000050
1743 Ga0070673_100018483
1744 Ga0070673_100074967
1745 Ga0070673_100199892
1746 Ga0070688_100005098
1747 Ga0070688_100006605
1748 Ga0070688_100019351
1749 Ga0070688_100075812
1750 Ga0070659_100014541
1751 Ga0070659_100037328
1752 Ga0070659_100078543
1753 Ga0070659_100105397
1754 Ga0070659_100120676
1755 Ga0070659_100301430
1756 Ga0070667_100036040
1757 Ga0070667_100038413
1758 Ga0070667_100040047
1759 Ga0070667_100078274
1760 Ga0070667_100329792
1761 Ga0070667_100565331
1762 Ga0070709_10021978
1763 Ga0070709_10044047
1764 Ga0070709_10076338
1765 Ga0070709_10080285
1766 Ga0070714_100004606
1767 Ga0070714_100006031
1768 Ga0070714_100014175
1769 Ga0070714_100039953
1770 Ga0070714_100063186
1771 Ga0070714_100517564
1772 Ga0070713_100005289
1773 Ga0070713_100016906
1774 Ga0070713_100035887
1775 Ga0070713_100080357
1776 Ga0070713_100175149
1777 Ga0070713_100237268
1778 Ga0070713_100268197
1779 Ga0070710_10003313
1780 Ga0070710_10012715
1781 Ga0070710_10013665
1782 Ga0070710_10071448
1783 Ga0070701_10004186
1784 Ga0070701_10011632
1785 Ga0070711_100018457
1786 Ga0070711_100030906
1787 Ga0070711_100051890
1788 Ga0070711_100152483
1789 Ga0070705_100003118
1790 Ga0070705_100081563
1791 Ga0070705_100265069
1792 Ga0070700_100002692
1793 Ga0070700_100017552
1794 Ga0070700_100048053
1795 Ga0070700_100093787
1796 Ga0070694_100008052
1797 Ga0070694_100016432
1798 Ga0070694_100086665
1799 Ga0070708_100054884
1800 Ga0070708_100198445
1801 Ga0070663_100012871
1802 Ga0070663_100017187
1803 Ga0070663_100020225
1804 Ga0070663_100026662
1805 Ga0070663_100027275
1806 Ga0070663_100071052
1807 Ga0070678_100000518
1808 Ga0070678_100034284
1809 Ga0070678_100037451
1810 Ga0070678_100048040
1811 Ga0070678_100061509
1812 Ga0070662_100021515
1813 Ga0070662_100041959
1814 Ga0070662_100045316
1815 Ga0070662_100067761
1816 Ga0070662_100133529
1817 Ga0070662_100166872
1818 Ga0070662_100250256
1819 Ga0070681_10004661
1820 Ga0070681_10010419
1821 Ga0070681_10022966
1822 Ga0070681_10027987
1823 Ga0068867_100009022
1824 Ga0068867_100018958
1825 Ga0070685_10003674
1826 Ga0070685_10007039
1827 Ga0070707_100068310
1828 Ga0070698_100201019
1829 Ga0070699_100019495
1830 Ga0070699_100174679
1831 Ga0070679_100007667
1832 Ga0070679_100030975
1833 Ga0070679_100031240
1834 Ga0070679_100047919
1835 Ga0070679_100120399
1836 Ga0070679_100155979
1837 Ga0070679_100174109
1838 Ga0070684_100004205
1839 Ga0070684_100079903
1840 Ga0070684_100105562
1841 Ga0070684_100247283
1842 Ga0068853_100015280
1843 Ga0068853_100015701
1844 Ga0068853_100030067
1845 Ga0068853_100109958
1846 Ga0068853_100299184
1847 Ga0070672_100000643
1848 Ga0070672_100040098
1849 Ga0070672_100052229
1850 Ga0070672_100128143
1851 Ga0070686_100001304
1852 Ga0070686_100065299
1853 Ga0070695_100006337
1854 Ga0070695_100015500
1855 Ga0070695_100091458
1856 Ga0070696_100018798
1857 Ga0070696_100042306
1858 Ga0070696_100139500
1859 Ga0070693_100003235
1860 Ga0070693_100008992
1861 Ga0070693_100031899
1862 Ga0070665_100021396
1863 Ga0070665_100048596
1864 Ga0070665_100085466
1865 Ga0070665_100089171
1866 Ga0070665_100219998
1867 Ga0070665_100376162
1868 Ga0070665_100436574
1869 Ga0070704_100008125
1870 Ga0070704_100240733
1871 Ga0068855_100018496
1872 Ga0068855_100021441
1873 Ga0068855_100022276
1874 Ga0068855_100089123
1875 Ga0068855_100111695
1876 Ga0068855_100293033
1877 Ga0068855_100698323
1878 Ga0070664_100026948
1879 Ga0070664_100107252
1880 Ga0070664_100198361
1881 Ga0068857_100001038
1882 Ga0068857_100015943
1883 Ga0068854_100014606
1884 Ga0068854_100020860
1885 Ga0068854_100147355
1886 Ga0068854_100257987
1887 Ga0068856_100009104
1888 Ga0068856_100038924
1889 Ga0068856_100348432
1890 Ga0070702_100004502
1891 Ga0070702_100013098
1892 Ga0070702_100035132
1893 Ga0068852_100005996
1894 Ga0068852_100168942
1895 Ga0068859_100006706
1896 Ga0068859_100135022
1897 Ga0068859_100155044
1898 Ga0068859_100390827
1899 Ga0068864_100004096
1900 Ga0068864_100006391
1901 Ga0068864_100022271
1902 Ga0068864_100054797
1903 Ga0068866_10000791
1904 Ga0068866_10079221
1905 Ga0068866_10120115
1906 Ga0068861_100002491
1907 Ga0068861_100029004
1908 Ga0068861_100049835
1909 Ga0068861_100057052
1910 Ga0068870_10001431
1911 Ga0068870_10002318
1912 Ga0068870_10043749
1913 Ga0068870_10121272
1914 Ga0068863_100016752
1915 Ga0068863_100025687
1916 Ga0068863_100051180
1917 Ga0068858_100010247
1918 Ga0068858_100017836
1919 Ga0068858_100026083
1920 Ga0068858_100192934
1921 Ga0068860_100002530
1922 Ga0068860_100047790
1923 Ga0068860_100070139
1924 Ga0068860_100156188
1925 Ga0068862_100006671
1926 Ga0068862_100040884
1927 Ga0068862_100135610
1928 Ga0068862_100264977
1929 Ga0081455_10000081
1930 Ga0081455_10003729
1931 Ga0081455_10005438
1932 Ga0081455_10010814
1933 Ga0081455_10033699
1934 Ga0081538_10001580
1935 Ga0081538_10010111
1936 Ga0081538_10020370
1937 Ga0081538_10021466
1938 Ga0081540_1000027
1939 Ga0081540_1002386
1940 Ga0081540_1002765
1941 Ga0081540_1003265
1942 Ga0081540_1003527
1943 Ga0081540_1005126
1944 Ga0081540_1005516
1945 Ga0081540_1010700
1946 Ga0081540_1010849
1947 Ga0081540_1020053
1948 Ga0081540_1024836
1949 Ga0081540_1026792
1950 Ga0081539_10000306
1951 Ga0081539_10001260
1952 Ga0081539_10050522
1953 Ga0070717_10000485
1954 Ga0070717_10000980
1955 Ga0070717_10023003
1956 Ga0075365_10037037
1957 Ga0075365_10051214
1958 Ga0075365_10171024
1959 Ga0075368_10011758
1960 Ga0075368_10071075
1961 Ga0075363_100004615
1962 Ga0075363_100011319
1963 Ga0075363_100041849
1964 Ga0075364_10006344
1965 Ga0075364_10074566
1966 Ga0075432_10000954
1967 Ga0070715_10000289
1968 Ga0070715_10003295
1969 Ga0070715_10032333
1970 Ga0070715_10081041
1971 Ga0070716_100004147
1972 Ga0070716_100016874
1973 Ga0070716_100047513
1974 Ga0070712_100020910
1975 Ga0070712_100030045
1976 Ga0070712_100043123
1977 Ga0070712_100044021
1978 Ga0070712_100049815
1979 Ga0075362_10044483
1980 Ga0075367_10068408
1981 Ga0075369_10001806
1982 Ga0075369_10016448
1983 Ga0075366_10028015
1984 Ga0097621_100001425
1985 Ga0097621_100010536
1986 Ga0097621_100147348
1987 Ga0075370_10001231
1988 Ga0068871_100002394
1989 Ga0068871_100022579
1990 Ga0068871_100033578
1991 Ga0068871_100036707
1992 Ga0068871_100107955
1993 Ga0068871_100191120
1994 Ga0075428_100005241
1995 Ga0075428_100005805
1996 Ga0075428_100011791
1997 Ga0075428_100057524
1998 Ga0075428_100211000
1999 Ga0075430_100000424
2000 Ga0075430_100006792
2001 Ga0075430_100010396
2002 Ga0075430_100093633
2003 Ga0075431_100000105
2004 Ga0075431_100002258
2005 Ga0075431_100033491
2006 Ga0075431_100121846
2007 Ga0075431_100178116
2008 Ga0075431_100188585
2009 Ga0075431_100275949
2010 Ga0075433_10000012
2011 Ga0075434_100000310
2012 Ga0075434_100004560
2013 Ga0075434_100043177
2014 Ga0075434_100086930
2015 Ga0075434_100112131
2016 Ga0075434_100139878
2017 Ga0075434_100198536
2018 Ga0075434_100217751
2019 Ga0075434_100339222
2020 Ga0075429_100001610
2021 Ga0075429_100005372
2022 Ga0068865_100001097
2023 Ga0068865_100052560
2024 Ga0068865_100081222
2025 Ga0068865_100134544
2026 Ga0075436_100008403
2027 Ga0097620_100006706
2028 Ga0097620_100135019
2029 Ga0097620_100155037
2030 Ga0097620_100390819
2031 Ga0099824_1002861
2032 Ga0075435_100002697
2033 Ga0075435_100087604
2034 Ga0075435_100114450
2035 Ga0099794_10024802
2036 Ga0099794_10031739
2037 Ga0105244_10023607
2038 Ga0105240_10175140
2039 Ga0105240_10202808
2040 Ga0111539_10000792
2041 Ga0111539_10000842
2042 Ga0111539_10014117
2043 Ga0111539_10034470
2044 Ga0105245_10025559
2045 Ga0105245_10029815
2046 Ga0105245_10099722
2047 Ga0105245_10183751
2048 Ga0105247_10024258
2049 Ga0105247_10025129
2050 Ga0105247_10033339
2051 Ga0105247_10041196
2052 Ga0114129_10000803
2053 Ga0114129_10001669
2054 Ga0114129_10003927
2055 Ga0114129_10006740
2056 Ga0114129_10006854
2057 Ga0114129_10027094
2058 Ga0114129_10071921
2059 Ga0105243_10002400
2060 Ga0105243_10004402
2061 Ga0105243_10035105
2062 Ga0105243_10047415
2063 Ga0105243_10087524
2064 Ga0105243_10094329
2065 Ga0105241_10008636
2066 Ga0105241_10010427
2067 Ga0105241_10028300
2068 Ga0105241_10090184
2069 Ga0105241_10100074
2070 Ga0105241_10260979
2071 Ga0105242_10007578
2072 Ga0105242_10008734
2073 Ga0105242_10025583
2074 Ga0105248_10010839
2075 Ga0105248_10014218
2076 Ga0105248_10059364
2077 Ga0105248_10062156
2078 Ga0105248_10081366
2079 Ga0105237_10030610
2080 Ga0105237_10032300
2081 Ga0105237_10121260
2082 Ga0105238_10009678
2083 Ga0105238_10066536
2084 Ga0105238_10099304
2085 Ga0105238_10115780
2086 Ga0105249_10011450
2087 Ga0105249_10153117
2088 Ga0105249_10160851
2089 Ga0099796_10011799
2090 Ga0105239_10024088
2091 Ga0105239_10040214
2092 Ga0105239_10346225
2093 Ga0105246_10051104
2094 Ga0105246_10071651
2095 Ga0105246_10110265
2096 Ga0157342_1000436
2097 Ga0157373_10110086
2098 Ga0157371_10195899
2099 Ga0157370_10035641
2100 Ga0157370_10193977
2101 Ga0157369_10281738
2102 Ga0157374_10001167
2103 Ga0157374_10003779
2104 Ga0157374_10027828
2105 Ga0157378_10008023
2106 Ga0163162_10010853
2107 Ga0163162_10051562
2108 Ga0163162_10139260
2109 Ga0163162_10293571
2110 Ga0163162_10671224
2111 Ga0157372_10141014
2112 Ga0157372_10279647
2113 Ga0163163_10007288
2114 Ga0163163_10007753
2115 Ga0163163_10109647
2116 Ga0157380_10001551
2117 Ga0157380_10093514
2118 Ga0157380_10231041
2119 Ga0157377_10009300
2120 Ga0157379_10036937
2121 Ga0157376_10012121
2122 Ga0157376_10059766
2123 Ga0157376_10065769
2124 Ga0157376_10093163
2125 Ga0163161_10011103
2126 Ga0163161_10086928
2127 Ga0163161_10166223
2128 Ga0206356_11037165
2129 Ga0206350_10300830
2130 Ga0206354_10798601
2131 Ga0206353_11208914
2132 Ga0213874_10003167
2133 Ga0213876_10000514
2134 Ga0213876_10004037
2135 Ga0213875_10000122
2136 Ga0213875_10002043
2137 Ga0213875_10047189
2138 Ga0213875_10049374
2139 Ga0224712_10047026
2140 Ga0224572_1020299
2141 Ga0228598_1010870
2142 Ga0207666_1000153
2143 Ga0207666_1005029
2144 Ga0207673_1000206
2145 Ga0209758_1007275
2146 Ga0207697_10001059
2147 Ga0207653_10009860
2148 Ga0207653_10017060
2149 Ga0207682_10002553
2150 Ga0207682_10033509
2151 Ga0207692_10000282
2152 Ga0207642_10016582
2153 Ga0207642_10034683
2154 Ga0207710_10000382
2155 Ga0207688_10001640
2156 Ga0207688_10015245
2157 Ga0207680_10008936
2158 Ga0207680_10010916
2159 Ga0207680_10018703
2160 Ga0207680_10052411
2161 Ga0207647_10009706
2162 Ga0207647_10009987
2163 Ga0207647_10012209
2164 Ga0207685_10000164
2165 Ga0207685_10005449
2166 Ga0207685_10041022
2167 Ga0207685_10068246
2168 Ga0207699_10004201
2169 Ga0207699_10006008
2170 Ga0207699_10067023
2171 Ga0207699_10081032
2172 Ga0207645_10002745
2173 Ga0207645_10063850
2174 Ga0207645_10077131
2175 Ga0207643_10000004
2176 Ga0207643_10001769
2177 Ga0207643_10176573
2178 Ga0207643_10196526
2179 Ga0207705_10073895
2180 Ga0207705_10217915
2181 Ga0207684_10009569
2182 Ga0207654_10008032
2183 Ga0207654_10173227
2184 Ga0207707_10011019
2185 Ga0207707_10014644
2186 Ga0207707_10016719
2187 Ga0207707_10336335
2188 Ga0207695_10086365
2189 Ga0207671_10082682
2190 Ga0207671_10087943
2191 Ga0207671_10088536
2192 Ga0207671_10129201
2193 Ga0207671_10154096
2194 Ga0207671_10168615
2195 Ga0207693_10001038
2196 Ga0207693_10005387
2197 Ga0207693_10016176
2198 Ga0207693_10034641
2199 Ga0207693_10084937
2200 Ga0207693_10201344
2201 Ga0207663_10004587
2202 Ga0207663_10026312
2203 Ga0207663_10092326
2204 Ga0207663_10328751
2205 Ga0207660_10007217
2206 Ga0207660_10009992
2207 Ga0207660_10020495
2208 Ga0207660_10124432
2209 Ga0207662_10000392
2210 Ga0207662_10001199
2211 Ga0207662_10026540
2212 Ga0207657_10002007
2213 Ga0207657_10007818
2214 Ga0207657_10012563
2215 Ga0207657_10017247
2216 Ga0207657_10038806
2217 Ga0207657_10039060
2218 Ga0207657_10043860
2219 Ga0207657_10050813
2220 Ga0207649_10005404
2221 Ga0207652_10014772
2222 Ga0207652_10053069
2223 Ga0207652_10058342
2224 Ga0207652_10059011
2225 Ga0207652_10059737
2226 Ga0207652_10113505
2227 Ga0207652_10133288
2228 Ga0207652_10295507
2229 Ga0207646_10258077
2230 Ga0207681_10024530
2231 Ga0207681_10025222
2232 Ga0207681_10149905
2233 Ga0207694_10082893
2234 Ga0207694_10110698
2235 Ga0207650_10004542
2236 Ga0207650_10064045
2237 Ga0207650_10143039
2238 Ga0207659_10000374
2239 Ga0207659_10066883
2240 Ga0207687_10005411
2241 Ga0207687_10009764
2242 Ga0207687_10016412
2243 Ga0207687_10041692
2244 Ga0207687_10092929
2245 Ga0207700_10003347
2246 Ga0207700_10015515
2247 Ga0207700_10037965
2248 Ga0207700_10122533
2249 Ga0207700_10143551
2250 Ga0207700_10161996
2251 Ga0207700_10196238
2252 Ga0207664_10009763
2253 Ga0207664_10023358
2254 Ga0207664_10033414
2255 Ga0207664_10067954
2256 Ga0207664_10106776
2257 Ga0207664_10108798
2258 Ga0207664_10187014
2259 Ga0207664_10202086
2260 Ga0207644_10003380
2261 Ga0207644_10004888
2262 Ga0207644_10055390
2263 Ga0207690_10010819
2264 Ga0207690_10013825
2265 Ga0207690_10180370
2266 Ga0207690_10218354
2267 Ga0207706_10002819
2268 Ga0207706_10006974
2269 Ga0207706_10010623
2270 Ga0207706_10022546
2271 Ga0207706_10041500
2272 Ga0207706_10341120
2273 Ga0207686_10007542
2274 Ga0207686_10020413
2275 Ga0207686_10025932
2276 Ga0207686_10151512
2277 Ga0207709_10003882
2278 Ga0207709_10014845
2279 Ga0207709_10071979
2280 Ga0207709_10091098
2281 Ga0207709_10100149
2282 Ga0207670_10001845
2283 Ga0207670_10004902
2284 Ga0207670_10067403
2285 Ga0207669_10022356
2286 Ga0207669_10051158
2287 Ga0207669_10092832
2288 Ga0207669_10135589
2289 Ga0207704_10002620
2290 Ga0207704_10005816
2291 Ga0207704_10265795
2292 Ga0207665_10000541
2293 Ga0207665_10007581
2294 Ga0207665_10017261
2295 Ga0207665_10055563
2296 Ga0207691_10004396
2297 Ga0207691_10009932
2298 Ga0207691_10041812
2299 Ga0207691_10314525
2300 Ga0207711_10002645
2301 Ga0207711_10005696
2302 Ga0207711_10035642
2303 Ga0207711_10145854
2304 Ga0207711_10170653
2305 Ga0207711_10232888
2306 Ga0207711_10362901
2307 Ga0207689_10002724
2308 Ga0207689_10004730
2309 Ga0207661_10015256
2310 Ga0207661_10054406
2311 Ga0207679_10001617
2312 Ga0207679_10053172
2313 Ga0207679_10141139
2314 Ga0207667_10071955
2315 Ga0207667_10321136
2316 Ga0207667_10497494
2317 Ga0207651_10003064
2318 Ga0207651_10004195
2319 Ga0207651_10016908
2320 Ga0207651_10045351
2321 Ga0207712_10003120
2322 Ga0207712_10102162
2323 Ga0207668_10005763
2324 Ga0207668_10124678
2325 Ga0207668_10182291
2326 Ga0207668_10195487
2327 Ga0207640_10015642
2328 Ga0207640_10021910
2329 Ga0207640_10146331
2330 Ga0207640_10183600
2331 Ga0207658_10014919
2332 Ga0207658_10035286
2333 Ga0207658_10082393
2334 Ga0207658_10103806
2335 Ga0207658_10264958
2336 Ga0207677_10006418
2337 Ga0207677_10016744
2338 Ga0207677_10028083
2339 Ga0207677_10064470
2340 Ga0207703_10001822
2341 Ga0207703_10021203
2342 Ga0207703_10041983
2343 Ga0207703_10126942
2344 Ga0207639_10019446
2345 Ga0207639_10023621
2346 Ga0207639_10058770
2347 Ga0207678_10000414
2348 Ga0207678_10002471
2349 Ga0207678_10019865
2350 Ga0207678_10020641
2351 Ga0207678_10035698
2352 Ga0207678_10041442
2353 Ga0207678_10092328
2354 Ga0207708_10001992
2355 Ga0207708_10002001
2356 Ga0207708_10006744
2357 Ga0207708_10038352
2358 Ga0207702_10021444
2359 Ga0207702_10039899
2360 Ga0207702_10041530
2361 Ga0207702_10067064
2362 Ga0207702_10294721
2363 Ga0207641_10009850
2364 Ga0207641_10015249
2365 Ga0207641_10019509
2366 Ga0207648_10004767
2367 Ga0207648_10010273
2368 Ga0207648_10174941
2369 Ga0207676_10001979
2370 Ga0207676_10002246
2371 Ga0207676_10013708
2372 Ga0207676_10050786
2373 Ga0207674_10007733
2374 Ga0207674_10416934
2375 Ga0207675_100003883
2376 Ga0207675_100007986
2377 Ga0207675_100057031
2378 Ga0207683_10002044
2379 Ga0207683_10009279
2380 Ga0207683_10016334
2381 Ga0207698_10031944
2382 Ga0207698_10186189
2383 Ga0209967_1003782
2384 Ga0209179_1029109
2385 Ga0209983_1007836
2386 Ga0209971_1002807
2387 Ga0209966_1001490
2388 Ga0209998_10000888
2389 Ga0209998_10001985
2390 Ga0207428_10000137
2391 Ga0207428_10000501
2392 Ga0207428_10001016
2393 Ga0207428_10006625
2394 Ga0207428_10143993
2395 Ga0207428_10165874
2396 Ga0265357_1000343
2397 Ga0268266_10000446
2398 Ga0268266_10000670
2399 Ga0268266_10001262
2400 Ga0268266_10012528
2401 Ga0268266_10029942
2402 Ga0268266_10050610
2403 Ga0268266_10157018
2404 Ga0268265_10014556
2405 Ga0268265_10022589
2406 Ga0268265_10055116
2407 Ga0268265_10072977
2408 Ga0268264_10041889
2409 Ga0268264_10112900
2410 Ga0265337_1004042
2411 Ga0265337_1026650
2412 Ga0265318_10007102
2413 Ga0307517_10000512
2414 Ga0307517_10130606
2415 Ga0265338_10065426
2416 Ga0265338_10263042
2417 Ga0265770_1006025
2418 Ga0265760_10022505
2419 Ga0265330_10015179
2420 Ga0265332_10000839
2421 Ga0265332_10067620
2422 Ga0265328_10017174
2423 Ga0265320_10006407
2424 Ga0265325_10000073
2425 Ga0265325_10001135
2426 Ga0265325_10011811
2427 Ga0265325_10030916
2428 Ga0265329_10008929
2429 Ga0265340_10000382
2430 Ga0265340_10020821
2431 Ga0265339_10001051
2432 Ga0265339_10003487
2433 Ga0265339_10043806
2434 Ga0265339_10068642
2435 Ga0265331_10015018
2436 Ga0265331_10034057
2437 Ga0265331_10038656
2438 Ga0265316_10105375
2439 Ga0265316_10123065
2440 Ga0265313_10000716
2441 Ga0265313_10038079
2442 Ga0265313_10046363
2443 Ga0265314_10002492
2444 Ga0265314_10044370
2445 Ga0265342_10000179
2446 Ga0265342_10000308
2447 Ga0265342_10007369
2448 Ga0265342_10011726
2449 Ga0265342_10030537
2450 Ga0307516_10078953
2451 Ga0307405_10283945
2452 Ga0307409_100037914
2453 Ga0307416_100224479
2454 Ga0307415_100082198
2455 Ga0307415_100327245
2456 Ga0307510_10009215
2457 Ga0307510_10009742
2458 Ga0373948_0002227
2459 Ga0373948_0015021
2460 Ga0373950_0000796
2461 Ga0373958_0000398
2462 Ga0373958_0009846
2463 Ga0373959_0009242
2464 Ga0373938_0000726
2465 Ga0373938_0002589
2466 Ga0373926_0002344
2467 Ga0373926_0009236
2468 Ga0373926_0050832
2469 Ga0373928_0000779
2470 Ga0373928_0001267
2471 Ga0373929_0000064
2472 Ga0373929_0020662
2473 Ga0373934_0007860
2474 Ga0373934_0020314
2475 Ga0373940_0000195
2476 Ga0373944_0000648
2477 Ga0373944_0001561
2478 Ga0373944_0013726
2479 Ga0373949_0000532
2480 Ga0373949_0001783
2481 Ga0373949_0005307
2482 Ga0373951_0000849
2483 Ga0373951_0009362
2484 Ga0373952_0000213
2485 Ga0373952_0004534
2486 Ga0373952_0009378
2487 Ga0373923_0000903
2488 Ga0373923_0001215
2489 Ga0373923_0004217
2490 Ga0373923_0031169
2491 Ga0373932_0002875
2492 Ga0373932_0003090
2493 Ga0373936_0001539
2494 Ga0373936_0003882
2495 Ga0373936_0010131
2496 Ga0373939_0000619
2497 Ga0373939_0007187
2498 Ga0373939_0022601
2499 Ga0373941_0000027
2500 Ga0373941_0001078
2501 Ga0373945_0000024
2502 Ga0373945_0007150
2503 Ga0373953_0002197
2504 Ga0373953_0003448
2505 Ga0373953_0012954
2506 Ga0373953_0054980
2507 Ga0373953_0072680
2508 Ga0373954_0004597
2509 Ga0373954_0004676
2510 Ga0373954_0005155
2511 Ga0373954_0021313
2512 Ga0373954_0031272
2513 Ga0373956_0001142
2514 Ga0373956_0012890
2515 Ga0373956_0020290
2516 Ga0373956_0048050
2517 Ga0373957_0004186
2518 Ga0373957_0066681
2519 Ga0373960_0000904
2520 Ga0373960_0002618
2521 Ga0373943_0013643
2522 Ga0373943_0034830
2523 Ga0373943_0042435
2524 Ga0373943_0058552
2525 Ga0373943_0087942
2526 Ga0373943_0111838
2527 Ga0373946_0005953
2528 Ga0373946_0014935
2529 Ga0373946_0015890
2530 Ga0373946_0030578
2531 Ga0373946_0044776
2532 Ga0373946_0051134
2533 Ga0373955_0000172
2534 Ga0373955_0001767
2535 Ga0373955_0003013
2536 Ga0373955_0010601
2537 Ga0373955_0023058
2538 Ga0373955_0174344
2539 Ga0373942_0000012
2540 Ga0373942_0002310
2541 Ga0373961_0000800
2542 Ga0373961_0003565
2543 Ga0373961_0006335
2544 Ga0373961_0022769
2545 Ga0373962_0000193
2546 Ga0373962_0003472
2547 Ga0373962_0011022
2548 Ga0316574_0151975
2549 Ga0373924_0001803
2550 Ga0373924_0006937
2551 Ga0373924_0045414
2552 Ga0373931_0007554
2553 Ga0373931_0008043
2554 Ga0373931_0015883
2555 Ga0373931_0035730
2556 Ga0373931_0041914
2557 Ga0373931_0066399
2558 Ga0373931_0078912
2559 Ga0373931_0096327
2560 Ga0373931_0150578
2561 Ga0373935_0000038
2562 Ga0373935_0008124
2563 Ga0373935_0008653
2564 Ga0373935_0031453
2565 Ga0373935_0044826
2566 Ga0373935_0110469
2567 Ga0373935_0165642
2568 Ga0373927_0001618
2569 Ga0373927_0003867
2570 Ga0373927_0004343
2571 Ga0373927_0017582
2572 Ga0373927_0059755
2573 Ga0373927_0098966
2574 Ga0373927_0102646
2575 Ga0373927_0119317
2576 Ga0373927_0155327
2577 Ga0373927_0246921
2578 Ga0373933_0001050
2579 Ga0373933_0009485
2580 Ga0373933_0019818
2581 Ga0373933_0043041
2582 Ga0373933_0070438
2583 Ga0373947_0000229
2584 Ga0373947_0000581
2585 Ga0373947_0001717
2586 Ga0373947_0012283
2587 Ga0373947_0014863
2588 Ga0373947_0037899
2589 Ga0373947_0042744
2590 Ga0373947_0137024
2591 Ga0373937_0000004
2592 Ga0373937_0001194
2593 Ga0373937_0004490
2594 Ga0373937_0013915
2595 Ga0373937_0051666
2596 Ga0373937_0173638
2597 Ga0373925_0000424
2598 Ga0373925_0006642
2599 Ga0373925_0011259
2600 Ga0373925_0011691
2601 Ga0373925_0029290
2602 Ga0373925_0042290
2603 Ga0373925_0094879
2604 Ga0373925_0126885
2605 Ga0373925_0162556
2606 Ga0373925_0172627
2607 Ga0373925_0317423
2608 Ga0395898_0062352
2609 Ga0395898_0166629
2610 Ga0395898_0167403
2611 Ga0395905_0070001
2612 Ga0436364_0345988
2613 Ga0436364_0423755
2614 Ga0436364_1276955
2615 Ga0436364_1535918
2616 Ga0395901_0246201
2617 Ga0395901_0477365
2618 Ga0395901_0488820
2619 Ga0436365_0076921
2620 Ga0436365_0412636
2621 Ga0436365_0444168
2622 Ga0436365_0579618
2623 Ga0436365_0842200
2624 Ga0436365_1149508
2625 Ga0436365_1209982
2626 Ga0436365_1517019
2627 Ga0436365_1582991
2628 Ga0436365_1807266
2629 Ga0436361_0601490
2630 Ga0436361_1055020
2631 Ga0436361_1192122
2632 Ga0436363_0271626
2633 Ga0436363_0548238
2634 Ga0436363_1101874
2635 Ga0436363_1268862
2636 Ga0436363_1691760
2637 Ga0439448_0026459
2638 Ga0439455_0013241
2639 Ga0466961_0061021
2640 Ga0466961_0130400
2641 Ga0466963_0153274
2642 Ga0466957_0047540
2643 Ga0451576_0020422
2644 Ga0466967_0004180
2645 Ga0466967_0050355
2646 Ga0495617_017934
2647 Ga0495592_0000032
2648 Ga0495592_0009020
2649 Ga0495592_0016478
2650 Ga0495592_0016847
2651 Ga0495603_0005155
2652 Ga0495603_0013983
2653 Ga0495603_0037151
2654 Ga0495603_0061058
2655 Ga0495603_0095239
2656 Ga0495590_0040082
2657 Ga0495629_0001232
2658 Ga0495629_0001465
2659 Ga0495629_0002050
2660 Ga0495638_0008231
2661 Ga0495638_0077106
2662 Ga0495641_0006019
2663 Ga0495641_0014796
2664 Ga0495641_0026036
2665 Ga0495641_0060393
2666 Ga0495641_0075574
2667 Ga0495651_0000799
2668 Ga0495651_0001360
2669 Ga0495651_0007731
2670 Ga0495651_0013259
2671 Ga0495653_0000012
2672 Ga0495653_0001069
2673 Ga0495653_0003134
2674 Ga0495653_0018668
2675 Ga0495580_0005009
2676 Ga0495580_0017623
2677 Ga0495580_0058785
2678 Ga0495580_0302495
2679 Ga0495582_0000570
2680 Ga0495582_0004754
2681 Ga0495582_0028921
2682 Ga0495582_0034833
2683 Ga0495582_0044708
2684 Ga0495582_0102076
2685 Ga0495639_0002103
2686 Ga0495639_0014886
2687 Ga0495639_0027206
2688 Ga0495639_0050994
2689 Ga0495639_0077878
2690 Ga0495662_0000879
2691 Ga0495662_0001012
2692 Ga0495662_0002431
2693 Ga0495662_0016111
2694 Ga0495662_0025150
2695 Ga0495664_0000004
2696 Ga0495664_0000146
2697 Ga0495664_0000563
2698 Ga0495664_0126142
2699 Ga0495584_0010718
2700 Ga0495585_0002912
2701 Ga0495585_0174701
2702 Ga0495594_0026229
2703 Ga0495594_0056365
2704 Ga0495594_0101385
2705 Ga0495607_0042874
2706 Ga0495583_0087074
2707 Ga0495608_0000017
2708 Ga0495608_0002512
2709 Ga0495608_0003432
2710 Ga0495608_0015292
2711 Ga0495608_0095690
2712 Ga0495608_0099976
2713 Ga0495608_0234590
2714 Ga0495616_0067680
2715 Ga0495618_0000006
2716 Ga0495618_0000473
2717 Ga0495618_0035358
2718 Ga0495618_0091228
2719 Ga0495628_0000001
2720 Ga0495628_0004103
2721 Ga0495628_0005499
2722 Ga0495628_0011495
2723 Ga0495630_0000422
2724 Ga0495630_0007807
2725 Ga0495630_0068325
2726 Ga0495630_0139263
2727 Ga0495630_0157466
2728 Ga0495631_0113702
2729 Ga0495637_0063129
2730 Ga0495643_0052199
2731 Ga0495644_0024172
2732 Ga0495644_0043960
2733 Ga0495648_0075844
2734 Ga0495666_0010597
2735 Ga0495666_0014995
2736 Ga0495652_0000002
2737 Ga0495652_0003864
2738 Ga0495652_0047192
2739 Ga0495652_0070621
2740 Ga0495652_0330327
2741 Ga0495665_0000227
2742 Ga0495665_0084309
2743 Ga0495640_0000001
2744 Ga0495640_0001488
2745 Ga0495640_0002833
2746 Ga0495640_0024233
2747 Ga0495640_0034413
2748 Ga0495640_0059161
2749 Ga0495640_0075095
2750 Ga0495586_0012979
2751 Ga0495587_0000008
2752 Ga0495587_0003639
2753 Ga0495587_0008368
2754 Ga0495587_0012855
2755 Ga0495598_0041403
2756 Ga0495609_0065627
2757 Ga0495609_0081439
2758 Ga0495609_0100173
2759 Ga0495621_0055834
2760 Ga0495645_0000002
2761 Ga0495645_0009348
2762 Ga0495645_0023181
2763 Ga0495645_0097739
2764 Ga0495622_0000406
2765 Ga0495633_0005373
2766 Ga0495667_0000124
2767 Ga0495667_0001092
2768 Ga0495667_0011961
2769 Ga0495667_0034171
2770 Ga0495667_0037745
2771 Ga0495667_0067913
2772 Ga0495667_0082616
2773 Ga0495667_0090432
2774 Ga0495667_0090541
2775 Ga0495656_0000554
2776 Ga0495668_0077490
2777 Ga0495668_0149001
2778 Ga0495668_0157654
2779 Ga0495634_0000003
2780 Ga0495634_0004424
2781 Ga0495634_0046635
2782 Ga0495634_0109540
2783 Ga0495634_0117121
2784 Ga0495611_0034086
2785 Ga0495635_0000002
2786 Ga0495635_0002104
2787 Ga0495635_0016723
2788 Ga0495635_0022896
2789 Ga0495635_0024301
2790 Ga0495635_0031658
2791 Ga0495635_0040864
2792 Ga0495635_0128331
2793 Ga0495635_0261668
2794 Ga0495659_0016170
2795 Ga0495659_0023703
2796 Ga0495659_0035644
2797 Ga0495588_0004978
2798 Ga0495588_0127124
2799 Ga0495657_0000054
2800 Ga0495657_0008729
2801 Ga0495657_0096183
2802 Ga0495657_0158481
2803 Ga0495599_0000005
2804 Ga0495599_0020724
2805 Ga0495599_0022366
2806 Ga0495599_0035696
2807 Ga0495599_0076139
2808 Ga0495623_0000148
2809 Ga0495623_0002021
2810 Ga0495623_0027550
2811 Ga0495623_0097234
2812 Ga0495646_0000002
2813 Ga0495646_0016750
2814 Ga0495646_0035451
2815 Ga0495646_0112055
2816 Ga0495646_0155292
2817 Ga0495647_0009539
2818 Ga0495658_0000543
2819 Ga0495658_0002466
2820 Ga0495658_0034649
2821 Ga0495658_0050889
2822 Ga0495658_0135987
2823 Ga0495613_0002489
2824 Ga0495613_0168083
2825 Ga0495613_0188279
2826 Ga0495624_0001896
2827 Ga0495624_0013382
2828 Ga0495624_0027306
2829 Ga0495624_0129200
2830 Ga0495624_0168611
2831 Ga0495670_0009745
2832 Ga0495600_0000012
2833 Ga0495600_0004562
2834 Ga0495600_0006388
2835 Ga0495600_0016042
2836 Ga0495660_0114681
2837 Ga0495660_0145528
2838 Ga0495581_0003432
2839 Ga0495581_0027818
2840 Ga0495581_0058614
2841 Ga0495581_0070554
2842 Ga0495604_0000009
2843 Ga0495604_0000422
2844 Ga0495604_0013474
2845 Ga0495604_0015408
2846 Ga0495604_0057176
2847 Ga0495674_0000002
2848 Ga0495674_0000641
2849 Ga0495674_0001683
2850 Ga0495674_0026343
2851 Ga0495674_0175444
2852 Ga0495672_0030618
2853 Ga0495676_0013899
2854 Ga0495676_0014569
2855 Ga0495676_0080098
2856 Ga0495676_0115141
2857 Ga0495676_0151994
2858 Ga0495676_0265329
2859 Ga0495680_0001385
2860 Ga0495680_0002139
2861 Ga0495680_0012328
2862 Ga0495680_0031291
2863 Ga0495680_0033026
2864 Ga0495680_0059613
2865 Ga0495680_0121345
2866 Ga0495680_0133161
2867 Ga0495680_0256882
2868 Ga0495675_0000028
2869 Ga0495675_0001398
2870 Ga0495675_0002936
2871 Ga0495675_0020224
2872 Ga0495675_0173041
2873 Ga0495685_021999
2874 Ga0495684_0000006
2875 Ga0495684_0003544
2876 Ga0495684_0096843
2877 Ga0495684_0173043
2878 Ga0495684_0186828
2879 Ga0495684_0246095
2880 Ga0495593_0000140
2881 Ga0495593_0003620
2882 Ga0495593_0017662
2883 Ga0495593_0019980
2884 Ga0495593_0029930
2885 Ga0495593_0058615
2886 Ga0495593_0141588
2887 Ga0495602_0000005
2888 Ga0495602_0012613
2889 Ga0495602_0013847
2890 Ga0495602_0023728
2891 Ga0495602_0028153
2892 Ga0495602_0192161
2893 Ga0495602_0224592
2894 Ga0495602_0229125
2895 Ga0495602_0318915
2896 Ga0495614_0018609
2897 Ga0495614_0050054
2898 Ga0496100_0003363
2899 Ga0496100_0010707
2900 Ga0496100_0022979
2901 Ga0496100_0126935
2902 Ga0496101_0001983
2903 Ga0496101_0004451
2904 Ga0496101_0029082
2905 Ga0496101_0038116
2906 Ga0496101_0110681
2907 Ga0496101_0162285
2908 Ga0496101_0179948
2909 Ga0496101_0228615
2910 Ga0496102_0002793
2911 Ga0496102_0006263
2912 Ga0496102_0018288
2913 Ga0496102_0031173
2914 Ga0496102_0115925
2915 Ga0496102_0120566
2916 Ga0496102_0136784
2917 Ga0496102_0158177
2918 Ga0496102_0211868
2919 Ga0496103_0002369
2920 Ga0496103_0018805
2921 Ga0496103_0025729
2922 Ga0496103_0032986
2923 Ga0496104_0000092
2924 Ga0496104_0001496
2925 Ga0496104_0002184
2926 Ga0496104_0003070
2927 Ga0496104_0004660
2928 Ga0496104_0008945
2929 Ga0496104_0095919
2930 Ga0496104_0115235
2931 Ga0496104_0199419
2932 Ga0496104_0381273
2933 Ga0496105_0002505
2934 Ga0496105_0017751
2935 Ga0496105_0032314
2936 Ga0496105_0038039
2937 Ga0496105_0044916
2938 Ga0496105_0056308
2939 Ga0496105_0083712
2940 Ga0496105_0147889
2941 Ga0496105_0257332
2942 Ga0496106_0001556
2943 Ga0496106_0006513
2944 Ga0496106_0007123
2945 Ga0496106_0010646
2946 Ga0496106_0011495
2947 Ga0496106_0025653
2948 Ga0496106_0053802
2949 Ga0496106_0143715
2950 Ga0496106_0215676
2951 Ga0496107_0002095
2952 Ga0496107_0006823
2953 Ga0496107_0009309
2954 Ga0496107_0011605
2955 Ga0496107_0011996
2956 Ga0496107_0034987
2957 Ga0496107_0037902
2958 Ga0496107_0129269
2959 Ga0496107_0301825
2960 Ga0496108_0044354
2961 Ga0496108_0061493
2962 Ga0496108_0126233
2963 Ga0496108_0270335
2964 Ga0496108_0423472
2965 Ga0496109_0004575
2966 Ga0496109_0004879
2967 Ga0496109_0024900
2968 Ga0496109_0066090
2969 Ga0496109_0074738
2970 Ga0496110_0008731
2971 Ga0496110_0033011
2972 Ga0496110_0045663
2973 Ga0496110_0074244
2974 Ga0496110_0297043
2975 Ga0496110_0310766
2976 Ga0496111_0002467
2977 Ga0496111_0005664
2978 Ga0496111_0033708
2979 Ga0496111_0071923
2980 Ga0496111_0072960
2981 Ga0496111_0118903
2982 Ga0496112_0012109
2983 Ga0496112_0013195
2984 Ga0496112_0026113
2985 Ga0496112_0058511
2986 Ga0496112_0063132
2987 Ga0496112_0070420
2988 Ga0496112_0122868
2989 Ga0496112_0138807
2990 Ga0496112_0210891
2991 Ga0496112_0221768
2992 Ga0496112_0269770
2993 Ga0496112_0377595
2994 Ga0496113_0004559
2995 Ga0496113_0030266
2996 Ga0496113_0203544
2997 Ga0496113_0427901
2998 Ga0496114_0007468
2999 Ga0496114_0014545
3000 Ga0496114_0045150
3001 Ga0496114_0065969
3002 Ga0496114_0070232
3003 Ga0496114_0076177
3004 Ga0496114_0157252
3005 Ga0496114_0191758
3006 Ga0496115_0002647
3007 Ga0496115_0003701
3008 Ga0496115_0008444
3009 Ga0496115_0014579
3010 Ga0496115_0015732
3011 Ga0496115_0023426
3012 Ga0496115_0023859
3013 Ga0496115_0029485
3014 Ga0496115_0031985
3015 Ga0496115_0044951
3016 Ga0496115_0086975
3017 Ga0496115_0100489
3018 Ga0496115_0152473
3019 Ga0496115_0158786
3020 Ga0496115_0377670
3021 Ga0496115_0405039
3022 Ga0496119_0004791
3023 Ga0496120_0058817
3024 Ga0496121_0000221
3025 Ga0496121_0002376
3026 Ga0496122_0004715
3027 Ga0496122_0038130
3028 Ga0496122_0067923
3029 Ga0496123_0000896
3030 Ga0496125_0089726
3031 Ga0496126_0001612
3032 Ga0496126_0010859
3033 Ga0496126_0058390
3034 Ga0496126_0131925
3035 Ga0501032_0010289
3036 Ga0501032_0012972
3037 Ga0501032_0068072
3038 Ga0501032_0082357
3039 Ga0501032_0183670
3040 Ga0501033_0007661
3041 Ga0501033_0012963
3042 Ga0501033_0037850
3043 Ga0501034_0001958
3044 Ga0501034_0005332
3045 Ga0501034_0022013
3046 Ga0501034_0120311
3047 Ga0501034_0149038
3048 Ga0501034_0287018
3049 Ga0501034_0362491
3050 Ga0501036_0000177
3051 Ga0501036_0025279
3052 Ga0501036_0190859
3053 Ga0501037_0044129
3054 Ga0501037_0060809
3055 Ga0501037_0147000
3056 Ga0501037_0246760
3057 Ga0501038_0060423
3058 Ga0501038_0152036
3059 Ga0501038_0261202
3060 Ga0501038_0297497
3061 Ga0501039_0071256
3062 Ga0501040_0036906
3063 Ga0501041_0012173
3064 Ga0501041_0201472
3065 Ga0501043_0001480
3066 Ga0501043_0027137
3067 Ga0501043_0071087
3068 Ga0501043_0293721
3069 Ga0501046_0080311
3070 Ga0501047_0000756
3071 Ga0501047_0063953
3072 Ga0501047_0236407
3073 Ga0501047_0301515
3074 Ga0501048_0000115
3075 Ga0501048_0000357
3076 Ga0501068_0007338
3077 Ga0501070_0000711
3078 Ga0501070_0022959
3079 Ga0501070_0041057
3080 Ga0501070_0213232
3081 Ga0501071_0129021
3082 Ga0501072_0052570
3083 Ga0501073_0013709
3084 Ga0501073_0027800
3085 Ga0501074_0063526
3086 Ga0501076_0004238
3087 Ga0501077_0061193
3088 Ga0501077_0063025
3089 Ga0501079_0012618
3090 Ga0501079_0043632
3091 Ga0501079_0126174
3092 Ga0501080_0003552
3093 Ga0501080_0053896
3094 Ga0501080_0132077
3095 Ga0501081_0249931
3096 Ga0501083_0007330
3097 Ga0501083_0014091
3098 Ga0501083_0033341
3099 Ga0501083_0046358
3100 Ga0501035_0014773
3101 Ga0501035_0032539
3102 Ga0501035_0085018
3103 Ga0501035_0174786
3104 Ga0501044_0035047
3105 Ga0501044_0163665
3106 Ga0501044_0236190
3107 Ga0501044_0249294
3108 Ga0501045_0035685
3109 Ga0501045_0105199
3110 nmdc:mga03683_37233_c1
3111 nmdc:mga03n38_16516_c1
3112 nmdc:mga03n38_6050_c1
3113 nmdc:mga03n38_65129_c1
3114 nmdc:mga00v17_38731_c1
3115 nmdc:mga00v17_41217_c1
3116 nmdc:mga00v17_87003_c1
3117 nmdc:mga0yw44_114654_c1
3118 nmdc:mga0yw44_124287_c1
3119 nmdc:mga0yw44_31228_c1
3120 nmdc:mga0yw44_813_c1
3121 nmdc:mga0k408_100398_c1
3122 nmdc:mga0k408_106249_c1
3123 nmdc:mga0k408_110273_c1
3124 nmdc:mga0k408_274669_c1
3125 nmdc:mga0k408_56850_c1
3126 nmdc:mga06z11_2739_c1
3127 nmdc:mga06z11_36637_c1
3128 nmdc:mga07m45_130278_c1
3129 nmdc:mga07m45_29681_c1
3130 nmdc:mga07m45_96803_c1
3131 nmdc:mga05p37_109457_c1
3132 nmdc:mga05p37_140_c1
3133 nmdc:mga05p37_6119_c1
3134 nmdc:mga05p37_66_c1
3135 nmdc:mga05p37_71061_c1
3136 nmdc:mga05p37_7273_c1
3137 nmdc:mga05p37_82393_c1
3138 nmdc:mga09592_1649_c1
3139 nmdc:mga09592_672_c1
3140 nmdc:mga09592_72071_c1
3141 nmdc:mga0qj67_234885_c1
3142 nmdc:mga0qj67_24846_c1
3143 nmdc:mga0qj67_341_c1
3144 nmdc:mga0qj67_36670_c1
3145 nmdc:mga0qj67_58518_c1
3146 nmdc:mga06r32_171978_c1
3147 nmdc:mga06r32_206794_c1
3148 nmdc:mga06r32_35478_c1
3149 nmdc:mga06r32_404_c1
3150 nmdc:mga06r32_47137_c1
3151 nmdc:mga06r32_671_c1
3152 nmdc:mga08y16_104_c1
3153 nmdc:mga08y16_122720_c1
3154 nmdc:mga08y16_193762_c1
3155 nmdc:mga08y16_275652_c1
3156 nmdc:mga08y16_615_c1
3157 nmdc:mga08y16_865_c1
3158 nmdc:mga0n895_125715_c1
3159 nmdc:mga0n895_181670_c1
3160 nmdc:mga0n895_19802_c1
3161 nmdc:mga0n895_207416_c1
3162 nmdc:mga0n895_258606_c1
3163 nmdc:mga0n895_266281_c1
3164 nmdc:mga0n895_43_c1
3165 nmdc:mga0rr50_187906_c1
3166 nmdc:mga0rr50_5102_c1
3167 nmdc:mga0rr50_85379_c1
3168 nmdc:mga08x19_127599_c1
3169 nmdc:mga08x19_4943_c1
3170 nmdc:mga08x19_9575_c1
3171 nmdc:mga0a205_11361_c1
3172 nmdc:mga0a205_19073_c1
3173 nmdc:mga0a205_268_c1
3174 nmdc:mga0a205_289522_c1
3175 nmdc:mga0a205_86437_c1
3176 nmdc:mga0sz30_8011_c1
3177 Ga0495601_0000002
3178 Ga0495601_0000860
3179 Ga0495601_0001376
3180 Ga0495601_0002635
3181 Ga0495601_0008009
3182 Ga0495601_0014329
3183 Ga0495601_0042558
3184 Ga0495601_0082542
3185 Ga0495601_0105887
3186 Ga0495601_0252910
3187 Ga0495612_0000010
3188 Ga0495612_0000075
3189 Ga0495612_0000562
3190 Ga0495612_0001712
3191 Ga0495612_0002201
3192 Ga0495612_0013643
3193 Ga0495612_0040405
3194 Ga0495612_0058465
3195 Ga0495595_0000026
3196 Ga0495595_0000168
3197 Ga0495595_0000589
3198 Ga0495595_0003174
3199 Ga0495595_0008606
3200 Ga0495595_0013688
3201 Ga0495595_0046146
3202 Ga0495595_0070190
3203 Ga0495619_0000019
3204 Ga0495619_0000045
3205 Ga0495619_0000388
3206 Ga0495619_0003526
3207 Ga0495619_0008861
3208 Ga0495619_0013999
3209 Ga0495619_0016140
3210 Ga0495619_0027612
3211 Ga0495619_0032806
3212 Ga0495619_0109834
3213 Ga0500643_001251
3214 Ga0500566_0001887
3215 Ga0500566_0019309
3216 Ga0500641_0016442
3217 Ga0500556_0000290
3218 Ga0500593_000029
3219 Ga0500595_000002
3220 Ga0500595_001597
3221 Ga0500652_000005
3222 Ga0500652_005131
3223 Ga0500559_0006649
3224 Ga0500559_0025572
3225 Ga0500568_0000004
3226 Ga0500589_025042
3227 Ga0500589_035423
3228 Ga0500590_011273
3229 Ga0500616_0000002
3230 Ga0500616_0006754
3231 Ga0500638_000120
3232 Ga0500637_0000070
3233 Ga0500611_027050
3234 Ga0500645_000156
3235 Ga0500645_038386
3236 Ga0501084_0160775
3237 Ga0500661_000547
3238 Ga0501082_0007283
3239 Ga0501082_0169542
3240 Ga0501082_0254320
3241 Ga0530510_0107136
3242 Ga0530510_0110402
3243 2513591490
3244 2513677761
3245 2513693277
3246 2524467746
3247 2545679291
3248 2596372627
3249 2643757308
3250 2723848187
3251 2793078104
3252 2824723110
3253 2828308332
3254 2857527140
3255 2874608825
3256 2879115446
3257 2885390477
3258 2889037297
3259 2889308376
3260 2893068082
3261 2899260375
3262 2902331308
3263 2902410753
3264 2903774279
3265 2919078255
3266 2919451909
3267 2922361428
3268 2922388851
3269 2928127578
3270 3003671439
3271 641644620
3272 643602802
3273 8001849999
3274 8006968877
3275 8006985241
3276 8006998562
3277 8056675906
3278 8056682175

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

94

227

0.99

PF17863

AAA_lid_2

AAA lid domain

300

368

0.93

PF07728

AAA_5

AAA domain (dynein-related subfamily)

94

225

0.89

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

62

269

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.902 6 331
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8785 6 331
4upb-assembly1.cif.gz_C electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.8168 20 330
4upb-assembly1.cif.gz_E electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.8054 20 335
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.7833 20 331
ID Description Score Start End Superfamily
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9652 25 219 3.40.50.300
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9515 233 334 1.10.8.80
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9365 25 219 3.40.50.300
af_O53314_205_312_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9334 224 334 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.914 221 331 1.10.8.80
ID Description Score Start End GO Terms
AF-A0A7S8EE60-F1-model_v4 AAA domain-containing protein 0.9902 13 336 GO:0005524
GO:0016887
AF-A0A439V4C5-F1-model_v4 AAA family ATPase 0.9902 76 146 GO:0005524
GO:0016887
AF-A0A529WXH1-F1-model_v4 MoxR family ATPase 0.9886 13 333 GO:0005524
GO:0016887
AF-X6D4F3-F1-model_v4 ATPase AAA 0.9882 16 333 GO:0005524
GO:0016887
AF-A0A1Q8ZQI2-F1-model_v4 AAA family ATPase 0.9881 13 334 GO:0005524
GO:0016887

Map