F495170

General Info

Members Datasets Scaffolds Average Seq Length
1641 968 3282 294

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0104021|Ga0439465_0104021_10_942
Length 310
Sequence MSILIDKNTKVVCQGFTGKNGTFHSEQAIAYGTQMVGGTSPGKGGALHLGLPVFDTVAEAKEKTGAEASVVYVPPPGAADAICEAIDAEIPLIICITEGIPVLDMVRVKRSLCGSKSRLIGPNCPGVVTAGESKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTSNEGLGQTTAVGIGGDPVKGTEFIDMLEMFLADEKTTSIVMIGEIGGSAEEDAAQFIKDEAKRGRRKPMVGFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGKTLVEVLAGAPASQEERSPEIEWSF

Samples

Sample ID Description Type Environment
1 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
114 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
115 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
136 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
137 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
138 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
261 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
264 3300041493 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT Metatranscriptome Unclassified
265 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
266 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
267 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
268 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
269 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
270 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
273 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
274 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
275 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
377 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
380 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
381 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 2508501050 Microvirga lupini Lut6 Isolate Nodule
394 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
395 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
396 2509276019 Ensifer aridi TW10 Isolate Nodule
397 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
398 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
399 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
400 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
401 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
402 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
403 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
404 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
405 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
406 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
407 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
408 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
409 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
410 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
411 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
412 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
413 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
414 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
415 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
416 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
417 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
418 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
419 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
420 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
421 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
422 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
423 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
424 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
425 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
426 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
427 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
428 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
429 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
430 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
431 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
432 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
433 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
434 2519899620 Rhizobium sp. Pop5 Isolate Nodule
435 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
436 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
437 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
438 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
439 2534681786 Brucella suis 92/29 Isolate Unclassified
440 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
441 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
442 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
443 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
444 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
445 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
446 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
447 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
448 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
449 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
450 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
451 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
452 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
453 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
454 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
455 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
456 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
457 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
458 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
459 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
460 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
461 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
462 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
463 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
464 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
465 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
466 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
467 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
468 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
469 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
470 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
471 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
472 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
473 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
474 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
475 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
476 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
477 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
478 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
479 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
480 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
481 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
482 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
483 2643221558 Rhizobium sp. Root149 Isolate Unclassified
484 2643221568 Rhizobium sp. Root564 Isolate Unclassified
485 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
486 2643221582 Rhizobium sp. Root651 Isolate Unclassified
487 2643221591 Devosia sp. Root685 Isolate Unclassified
488 2643221599 Rhizobium sp. Root708 Isolate Unclassified
489 2643221607 Rhizobium sp. Root73 Isolate Unclassified
490 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
491 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
492 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
493 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
494 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
495 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
496 2643221688 Rhizobium sp. Root482 Isolate Unclassified
497 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
498 2643221693 Rhizobium sp. Root491 Isolate Unclassified
499 2643221718 Rhizobium sp. Root268 Isolate Unclassified
500 2643221719 Rhizobium sp. Root274 Isolate Unclassified
501 2643221723 Ensifer sp. Root278 Isolate Unclassified
502 2643221733 Bosea sp. Root381 Isolate Unclassified
503 2643221734 Bosea sp. Root670 Isolate Unclassified
504 2643221736 Bosea sp. Root483D1 Isolate Unclassified
505 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
506 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
507 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
508 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
509 2718217882 Rhizobium sp. N741 Isolate Nodule
510 2718217927 Rhizobium sp. N324 Isolate Nodule
511 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
512 2718218009 Rhizobium sp. N561 Isolate Nodule
513 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
514 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
515 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
516 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
517 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
518 2718218363 Rhizobium sp. N113 Isolate Nodule
519 2718218365 Rhizobium sp. N731 Isolate Nodule
520 2718218366 Rhizobium sp. N621 Isolate Nodule
521 2718218423 Rhizobium sp. N941 Isolate Nodule
522 2721755514 Rhizobium sp. N6212 Isolate Nodule
523 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
524 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
525 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
526 2721755809 Rhizobium sp. N541 Isolate Nodule
527 2721755810 Rhizobium sp. N871 Isolate Nodule
528 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
529 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
530 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
531 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
532 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
533 2728369365 Rhizobium sp. N1341 Isolate Nodule
534 2728369397 Rhizobium sp. N1314 Isolate Nodule
535 2738541293 Rhizobium sp. GV031 Isolate Unclassified
536 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
537 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
538 2751185800 Brucella pituitosa AA2 Isolate Unclassified
539 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
540 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
541 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
542 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
543 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
544 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
545 2773857925 Microvirga vignae BR3299 Isolate Unclassified
546 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
547 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
548 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
549 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
550 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
551 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
552 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
553 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
554 2791355256 Rhizobium sp. M10 Isolate Nodule
555 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
556 2791355260 Rhizobium sp. L9 Isolate Nodule
557 2791355261 Rhizobium sp. J15 Isolate Nodule
558 2791355262 Rhizobium sp. M1 Isolate Nodule
559 2791355263 Rhizobium chutanense C5 Isolate Nodule
560 2791355264 Rhizobium sp. S9 Isolate Nodule
561 2791355265 Rhizobium sp. H4 Isolate Nodule
562 2791355266 Rhizobium sp. L43 Isolate Nodule
563 2791355267 Rhizobium sp. L18 Isolate Nodule
564 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
565 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
566 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
567 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
568 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
569 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
570 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
571 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
572 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
573 2802429633 Rhizobium anhuiense J3 Isolate Nodule
574 2802429634 Rhizobium anhuiense S10 Isolate Nodule
575 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
576 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
577 2802429637 Rhizobium anhuiense C15 Isolate Nodule
578 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
579 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
580 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
581 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
582 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
583 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
584 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
585 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
586 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
587 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
588 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
589 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
590 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
591 2838048938 Rhizobium pisi 27/80 Isolate Nodule
592 2838061910 Rhizobium phaseoli L15 Isolate Nodule
593 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
594 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
595 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
596 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
597 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
598 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
599 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
600 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
601 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
602 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
603 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
604 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
605 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
606 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
607 2841760612 Bosea sp. Tri-49 Isolate Nodule
608 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
609 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
610 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
611 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
612 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
613 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
614 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
615 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
616 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
617 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
618 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
619 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
620 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
621 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
622 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
623 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
624 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
625 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
626 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
627 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
628 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
629 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
630 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
631 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
632 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
633 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
634 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
635 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
636 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
637 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
638 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
639 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
640 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
641 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
642 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
643 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
644 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
645 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
646 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
647 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
648 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
649 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
650 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
651 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
652 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
653 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
654 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
655 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
656 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
657 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
658 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
659 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
660 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
661 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
662 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
663 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
664 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
665 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
666 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
667 2842694124 Methylopila sp. R-72369 Isolate Unclassified
668 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
669 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
670 2844104063 Bosea sp. Tri-39 Isolate Nodule
671 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
672 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
673 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
674 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
675 2851182111 Bosea sp. Tri-44 Isolate Nodule
676 2851246043 Bosea sp. Tri-54 Isolate Nodule
677 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
678 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
679 2854911287 Brucella lupini LUP21 Isolate Unclassified
680 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
681 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
682 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
683 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
684 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
685 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
686 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
687 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
688 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
689 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
690 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
691 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
692 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
693 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
694 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
695 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
696 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
697 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
698 2902330777 Methylobacterium sp. 2A Isolate Unclassified
699 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
700 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
701 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
702 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
703 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
704 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
705 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
706 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
707 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
708 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
709 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
710 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
711 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
712 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
713 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
714 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
715 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
716 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
717 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
718 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
719 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
720 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
721 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
722 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
723 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
724 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
725 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
726 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
727 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
728 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
729 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
730 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
731 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
732 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
733 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
734 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
735 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
736 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
737 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
738 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
739 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
740 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
741 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
742 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
743 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
744 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
745 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
746 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
747 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
748 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
749 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
750 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
751 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
752 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
753 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
754 2932401849 Devosia sp. 2618 Isolate Rhizosphere
755 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
756 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
757 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
758 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
759 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
760 2933599457 Rhizobium phaseoli M3 Isolate Nodule
761 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
762 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
763 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
764 2936381700 Rhizobium chutanense C16 Isolate Unclassified
765 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
766 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
767 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
768 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
769 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
770 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
771 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
772 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
773 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
774 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
775 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
776 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
777 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
778 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
779 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
780 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
781 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
782 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
783 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
784 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
785 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
786 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
787 2952252522 Salinicola sp. DM10 Isolate Unclassified
788 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
789 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
790 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
791 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
792 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
793 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
794 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
795 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
796 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
797 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
798 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
799 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
800 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
801 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
802 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
803 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
804 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
805 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
806 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
807 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
808 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
809 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
810 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
811 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
812 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
813 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
814 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
815 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
816 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
817 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
818 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
819 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
820 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
821 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
822 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
823 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
824 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
825 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
826 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
827 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
828 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
829 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
830 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
831 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
832 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
833 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
834 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
835 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
836 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
837 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
838 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
839 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
840 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
841 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
842 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
843 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
844 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
845 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
846 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
847 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
848 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
849 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
850 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
851 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
852 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
853 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
854 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
855 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
856 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
857 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
858 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
859 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
860 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
861 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
862 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
863 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
864 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
865 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
866 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
867 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
868 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
869 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
870 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
871 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
872 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
873 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
874 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
875 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
876 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
877 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
878 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
879 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
880 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
881 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
882 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
883 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
884 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
885 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
886 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
887 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
888 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
889 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
890 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
891 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
892 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
893 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
894 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
895 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
896 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
897 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
898 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
899 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
900 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
901 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
902 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
903 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
904 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
905 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
906 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
907 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
908 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
909 2996893221 Rhizobium sp. R635 Isolate Nodule
910 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
911 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
912 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
913 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
914 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
915 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
916 641522639 Methylobacterium sp. 4-46 Isolate Nodule
917 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
918 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
919 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
920 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
921 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
922 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
923 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
924 8005275841 Rhizobium sp. N4311 Isolate Nodule
925 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
926 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
927 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
928 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
929 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
930 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
931 8005382845 Rhizobium sp. R634 Isolate Nodule
932 8005395548 Rhizobium sp. R339 Isolate Nodule
933 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
934 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
935 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
936 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
937 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
938 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
939 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
940 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
941 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
942 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
943 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
944 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
945 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
946 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
947 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
948 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
949 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
950 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
951 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
952 8018176218 Rhizobium sp. N122 Isolate Nodule
953 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
954 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
955 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
956 8024501048 Rhizobium sp. H4 Isolate Nodule
957 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
958 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
959 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
960 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
961 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
962 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
963 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
964 8056382006 Rhizobium croatiense 13T Isolate Nodule
965 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
966 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
967 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
968 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.92
Metatranscriptomes 0.98
Isolates 35.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 9.26
Nodule 25.23
Rhizoplane 2.86
Rhizosphere 51.49
Stem 0
Stem Tuber 0.06
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439465_0104021 3300041413 Bacteria 983
2 JGI24736J21556_1005675 3300001904 Bacteria 2109
3 JGI24740J21852_10006819 3300001979 Bacteria 4690
4 JGI24740J21852_10015888 3300001979 Bacteria 2735
5 JGI24739J22299_10001619 3300001989 Bacteria 8546
6 JGI24737J22298_10000011 3300001990 Bacteria 53665
7 JGI24737J22298_10021292 3300001990 Bacteria 2067
8 JGI24737J22298_10044655 3300001990 Bacteria 1354
9 JGI24743J22301_10021546 3300001991 Bacteria 1232
10 JGI24735J21928_10020080 3300002067 Bacteria 2048
11 JGI24735J21928_10042315 3300002067 Bacteria 1327
12 JGI24738J21930_10013531 3300002075 Bacteria 1762
13 JGI24738J21930_10015919 3300002075 Bacteria 1594
14 JGI24744J21845_10001141 3300002077 Bacteria 5162
15 JGI25152J39213_1022201 3300002773 Bacteria 1101
16 JGI25150J39212_1000037 3300002774 Bacteria 88885
17 JGI25150J39212_1000166 3300002774 Bacteria 37196
18 JGI25150J39212_1015167 3300002774 Bacteria 1292
19 JGI25159J45721_1000053 3300002987 Bacteria 56912
20 JGI25159J45721_1001774 3300002987 Bacteria 8663
21 JGI25151J46595_10001088 3300003187 Bacteria 20142
22 JGI25151J46595_10036151 3300003187 Bacteria 1866
23 JGI25151J46595_10039658 3300003187 Bacteria 1735
24 JGI25153J46596_10005207 3300003215 Bacteria 6842
25 JGI25153J46596_10010307 3300003215 Bacteria 4241
26 JGI25160J50197_1000168 3300003354 Bacteria 56596
27 JGI25160J50197_1000401 3300003354 Bacteria 27912
28 JGI25160J50197_1003063 3300003354 Bacteria 7621
29 JGI25161J50226_1000137 3300003374 Bacteria 50627
30 JGI25161J50226_1001074 3300003374 Bacteria 9258
31 Ga0006562J51391_1007307 3300003578 Bacteria 2650
32 JGI25404J52841_10015385 3300003659 Bacteria 1660
33 Ga0055542_1003610 3300003762 Bacteria 4093
34 Ga0055529_1007007 3300003763 Bacteria 1547
35 Ga0055526_1002810 3300003771 Bacteria 11530
36 Ga0055526_1012561 3300003771 Bacteria 3677
37 Ga0055526_1013430 3300003771 Bacteria 3466
38 Ga0055526_1027399 3300003771 Bacteria 1762
39 Ga0055524_1002041 3300003775 Bacteria 10739
40 Ga0055524_1003213 3300003775 Bacteria 8015
41 Ga0055524_1006675 3300003775 Bacteria 4987
42 Ga0055524_1021290 3300003775 Bacteria 2154
43 Ga0055524_1022932 3300003775 Bacteria 2023
44 Ga0055536_1002589 3300003781 Bacteria 10076
45 Ga0055536_1003952 3300003781 Bacteria 7770
46 Ga0055528_1002391 3300003790 Bacteria 10108
47 Ga0055528_1005252 3300003790 Bacteria 6075
48 Ga0055530_10007487 3300003791 Bacteria 4584
49 Ga0055540_1002246 3300003792 Bacteria 10437
50 Ga0055540_1003538 3300003792 Bacteria 7486
51 Ga0058692_1002874 3300003856 Bacteria 5601
52 Ga0055543_1000321 3300004625 Bacteria 33172
53 Ga0055543_1000412 3300004625 Bacteria 26967
54 Ga0055543_1010130 3300004625 Bacteria 1991
55 Ga0065165_1000133 3300005262 Bacteria 128540
56 Ga0065165_1005095 3300005262 Bacteria 7636
57 Ga0065712_10112331 3300005290 Bacteria 1802
58 Ga0065715_10108239 3300005293 Bacteria 2684
59 Ga0070658_10000013 3300005327 Bacteria 267776
60 Ga0070658_10000496 3300005327 Bacteria 34219
61 Ga0070658_10000877 3300005327 Bacteria 25749
62 Ga0070658_10010544 3300005327 Bacteria 7406
63 Ga0070658_10021906 3300005327 Bacteria 5125
64 Ga0070658_10034231 3300005327 Bacteria 4087
65 Ga0070658_10075736 3300005327 Bacteria 2760
66 Ga0070658_10094549 3300005327 Bacteria 2466
67 Ga0070658_10110946 3300005327 Bacteria 2272
68 Ga0070658_10127678 3300005327 Bacteria 2117
69 Ga0070658_10213983 3300005327 Bacteria 1629
70 Ga0070676_10020952 3300005328 Bacteria 3656
71 Ga0070676_10079603 3300005328 Bacteria 1984
72 Ga0070683_100013062 3300005329 Bacteria 7232
73 Ga0070683_100032926 3300005329 Bacteria 4724
74 Ga0070683_100035079 3300005329 Bacteria 4586
75 Ga0070670_100022214 3300005331 Bacteria 5460
76 Ga0070670_100039178 3300005331 Bacteria 4075
77 Ga0070670_100245911 3300005331 Bacteria 1558
78 Ga0068869_100000304 3300005334 Bacteria 26244
79 Ga0068869_100038708 3300005334 Bacteria 3401
80 Ga0068869_100076772 3300005334 Bacteria 2484
81 Ga0070666_10030363 3300005335 Bacteria 3560
82 Ga0070680_100000717 3300005336 Bacteria 23047
83 Ga0070680_100004343 3300005336 Bacteria 10658
84 Ga0070680_100006159 3300005336 Bacteria 9099
85 Ga0070680_100108293 3300005336 Bacteria 2311
86 Ga0070680_100150077 3300005336 Bacteria 1956
87 Ga0070682_100108088 3300005337 Bacteria 1849
88 Ga0068868_100000003 3300005338 Bacteria 155611
89 Ga0070660_100000024 3300005339 Bacteria 94300
90 Ga0070660_100000043 3300005339 Bacteria 72315
91 Ga0070660_100000688 3300005339 Bacteria 22377
92 Ga0070660_100003447 3300005339 Bacteria 10887
93 Ga0070660_100007819 3300005339 Bacteria 7456
94 Ga0070660_100018225 3300005339 Bacteria 5127
95 Ga0070660_100018756 3300005339 Bacteria 5060
96 Ga0070660_100022376 3300005339 Bacteria 4674
97 Ga0070660_100059012 3300005339 Bacteria 2975
98 Ga0070660_100063220 3300005339 Bacteria 2877
99 Ga0070660_100091671 3300005339 Bacteria 2397
100 Ga0070660_100431740 3300005339 Bacteria 1091
101 Ga0070691_10000453 3300005341 Bacteria 15235
102 Ga0070661_100000222 3300005344 Bacteria 47111
103 Ga0070661_100029590 3300005344 Bacteria 3954
104 Ga0070661_100100324 3300005344 Bacteria 2152
105 Ga0070668_100001661 3300005347 Bacteria 16140
106 Ga0070668_100044062 3300005347 Bacteria 3422
107 Ga0070668_100082309 3300005347 Bacteria 2525
108 Ga0070669_100058352 3300005353 Bacteria 2832
109 Ga0070669_100087908 3300005353 Bacteria 2325
110 Ga0070669_100298226 3300005353 Bacteria 1296
111 Ga0070675_100039469 3300005354 Bacteria 3853
112 Ga0070675_100050555 3300005354 Bacteria 3413
113 Ga0070675_100069921 3300005354 Bacteria 2909
114 Ga0070671_100006859 3300005355 Bacteria 9118
115 Ga0070671_100009179 3300005355 Bacteria 7940
116 Ga0070671_100029197 3300005355 Bacteria 4547
117 Ga0070671_100152128 3300005355 Bacteria 1954
118 Ga0070674_100103372 3300005356 Bacteria 2080
119 Ga0070673_100000008 3300005364 Bacteria 166844
120 Ga0070673_100516727 3300005364 Bacteria 1082
121 Ga0070659_100001101 3300005366 Bacteria 19729
122 Ga0070659_100015615 3300005366 Bacteria 5688
123 Ga0070659_100016397 3300005366 Bacteria 5562
124 Ga0070659_100038982 3300005366 Bacteria 3708
125 Ga0070659_100042549 3300005366 Bacteria 3552
126 Ga0070659_100132331 3300005366 Bacteria 2026
127 Ga0070659_100144824 3300005366 Bacteria 1935
128 Ga0070659_100187363 3300005366 Bacteria 1700
129 Ga0070659_100352796 3300005366 Bacteria 1234
130 Ga0070667_100050486 3300005367 Bacteria 3506
131 Ga0070667_100087748 3300005367 Bacteria 2670
132 Ga0070667_100098563 3300005367 Bacteria 2522
133 Ga0070667_100113036 3300005367 Bacteria 2356
134 Ga0070667_100240476 3300005367 Bacteria 1616
135 Ga0070667_100401031 3300005367 Bacteria 1248
136 Ga0070709_10062932 3300005434 Bacteria 2367
137 Ga0070714_100051049 3300005435 Bacteria 3525
138 Ga0070713_100204449 3300005436 Bacteria 1785
139 Ga0070711_100337227 3300005439 Bacteria 1209
140 Ga0070694_100004336 3300005444 Bacteria 8529
141 Ga0070663_100004718 3300005455 Bacteria 8039
142 Ga0070663_100095587 3300005455 Bacteria 2209
143 Ga0070663_100329921 3300005455 Bacteria 1229
144 Ga0070678_100004243 3300005456 Bacteria 8098
145 Ga0070678_100051010 3300005456 Bacteria 2996
146 Ga0070678_100145383 3300005456 Bacteria 1902
147 Ga0070678_100161933 3300005456 Bacteria 1814
148 Ga0070662_100005905 3300005457 Bacteria 7853
149 Ga0070662_100012171 3300005457 Bacteria 5697
150 Ga0070662_100037700 3300005457 Bacteria 3428
151 Ga0070662_100085967 3300005457 Bacteria 2351
152 Ga0070662_100251921 3300005457 Bacteria 1420
153 Ga0070681_10035926 3300005458 Bacteria 4977
154 Ga0070681_10057374 3300005458 Bacteria 3874
155 Ga0070681_10086993 3300005458 Bacteria 3078
156 Ga0068867_100000003 3300005459 Bacteria 217886
157 Ga0068867_100010880 3300005459 Bacteria 6417
158 Ga0068867_100034948 3300005459 Bacteria 3644
159 Ga0070698_100037255 3300005471 Bacteria 5016
160 Ga0070679_100000001 3300005530 Bacteria 764811
161 Ga0070679_100056354 3300005530 Bacteria 3916
162 Ga0070679_100099110 3300005530 Bacteria 2901
163 Ga0070684_100001796 3300005535 Bacteria 15691
164 Ga0070684_100003281 3300005535 Bacteria 12120
165 Ga0068853_100001903 3300005539 Bacteria 15374
166 Ga0068853_100034661 3300005539 Bacteria 4285
167 Ga0068853_100045661 3300005539 Bacteria 3753
168 Ga0068853_100049574 3300005539 Bacteria 3609
169 Ga0068853_100103953 3300005539 Bacteria 2514
170 Ga0068853_100361269 3300005539 Bacteria 1353
171 Ga0070672_100014210 3300005543 Bacteria 5635
172 Ga0070672_100033962 3300005543 Bacteria 3867
173 Ga0070672_100102087 3300005543 Bacteria 2327
174 Ga0070672_100145401 3300005543 Bacteria 1959
175 Ga0070696_100012851 3300005546 Bacteria 5619
176 Ga0070696_100026650 3300005546 Bacteria 3932
177 Ga0070665_100000157 3300005548 Bacteria 124344
178 Ga0070665_100001220 3300005548 Bacteria 31311
179 Ga0070665_100007394 3300005548 Bacteria 11176
180 Ga0070665_100024562 3300005548 Bacteria 6072
181 Ga0070665_100038358 3300005548 Bacteria 4816
182 Ga0070665_100130758 3300005548 Bacteria 2513
183 Ga0070665_100178349 3300005548 Bacteria 2125
184 Ga0070704_100455059 3300005549 Bacteria 1103
185 Ga0068855_100000292 3300005563 Bacteria 62086
186 Ga0068855_100000775 3300005563 Bacteria 39423
187 Ga0068855_100009958 3300005563 Bacteria 11462
188 Ga0068855_100036156 3300005563 Bacteria 5880
189 Ga0068855_100083901 3300005563 Bacteria 3690
190 Ga0068855_100089369 3300005563 Bacteria 3557
191 Ga0068855_100146040 3300005563 Bacteria 2692
192 Ga0068855_100267089 3300005563 Bacteria 1904
193 Ga0068855_100387039 3300005563 Bacteria 1535
194 Ga0068855_100461588 3300005563 Bacteria 1385
195 Ga0070664_100001794 3300005564 Bacteria 17208
196 Ga0070664_100011587 3300005564 Bacteria 7153
197 Ga0070664_100093319 3300005564 Bacteria 2608
198 Ga0070664_100186865 3300005564 Bacteria 1845
199 Ga0068857_100000315 3300005577 Bacteria 33485
200 Ga0068857_100015553 3300005577 Bacteria 6648
201 Ga0068857_100018103 3300005577 Bacteria 6179
202 Ga0068857_100022353 3300005577 Bacteria 5564
203 Ga0068857_100048518 3300005577 Bacteria 3769
204 Ga0068857_100079144 3300005577 Bacteria 2934
205 Ga0068857_100222964 3300005577 Bacteria 1723
206 Ga0068854_100000580 3300005578 Bacteria 21838
207 Ga0068854_100014030 3300005578 Bacteria 5273
208 Ga0068856_100021339 3300005614 Bacteria 6294
209 Ga0068856_100057360 3300005614 Bacteria 3844
210 Ga0068856_100087214 3300005614 Bacteria 3102
211 Ga0068856_100167670 3300005614 Bacteria 2207
212 Ga0068856_100216111 3300005614 Bacteria 1932
213 Ga0068856_100223238 3300005614 Bacteria 1899
214 Ga0068856_100234514 3300005614 Bacteria 1850
215 Ga0068852_100018675 3300005616 Bacteria 5465
216 Ga0068852_100028215 3300005616 Bacteria 4589
217 Ga0068852_100050217 3300005616 Bacteria 3573
218 Ga0068852_100098230 3300005616 Bacteria 2636
219 Ga0068852_100630221 3300005616 Bacteria 1078
220 Ga0068859_100055560 3300005617 Bacteria 3984
221 Ga0068859_100145190 3300005617 Bacteria 2447
222 Ga0068859_100206632 3300005617 Bacteria 2049
223 Ga0068864_100117537 3300005618 Bacteria 2374
224 Ga0068864_100159161 3300005618 Bacteria 2052
225 Ga0068863_100005102 3300005841 Bacteria 12954
226 Ga0068863_100017559 3300005841 Bacteria 6856
227 Ga0068863_100018723 3300005841 Bacteria 6625
228 Ga0068863_100061105 3300005841 Bacteria 3562
229 Ga0068860_100009476 3300005843 Bacteria 9670
230 Ga0068860_100067462 3300005843 Bacteria 3399
231 Ga0068860_100068354 3300005843 Bacteria 3375
232 Ga0068860_100264386 3300005843 Bacteria 1678
233 Ga0068862_100024314 3300005844 Bacteria 5082
234 Ga0068862_100139568 3300005844 Bacteria 2150
235 Ga0068862_100642694 3300005844 Bacteria 1023
236 Ga0081540_1000191 3300005983 Bacteria 63533
237 Ga0081539_10005453 3300005985 Bacteria 12976
238 Ga0075365_10006550 3300006038 Bacteria 6418
239 Ga0075365_10060552 3300006038 Bacteria 2526
240 Ga0075365_10066784 3300006038 Bacteria 2413
241 Ga0075368_10009715 3300006042 Bacteria 3465
242 Ga0075363_100052967 3300006048 Bacteria 2167
243 Ga0075364_10000195 3300006051 Bacteria 28057
244 Ga0075364_10006289 3300006051 Bacteria 6969
245 Ga0070715_10033869 3300006163 Bacteria 2091
246 Ga0070716_100255235 3300006173 Bacteria 1197
247 Ga0070712_100037236 3300006175 Bacteria 3315
248 Ga0070712_100259257 3300006175 Bacteria 1392
249 Ga0075362_10005902 3300006177 Bacteria 4522
250 Ga0075367_10023004 3300006178 Bacteria 3502
251 Ga0075367_10068048 3300006178 Bacteria 2136
252 Ga0075369_10023210 3300006186 Bacteria 2563
253 Ga0075369_10049112 3300006186 Bacteria 1822
254 Ga0075369_10151184 3300006186 Bacteria 1061
255 Ga0075366_10005542 3300006195 Bacteria 6841
256 Ga0075366_10041318 3300006195 Bacteria 2730
257 Ga0097621_100048846 3300006237 Bacteria 3435
258 Ga0097621_100139391 3300006237 Bacteria 2071
259 Ga0097621_100180350 3300006237 Bacteria 1825
260 Ga0075370_10027037 3300006353 Bacteria 3182
261 Ga0075370_10071843 3300006353 Bacteria 1980
262 Ga0075370_10140512 3300006353 Bacteria 1411
263 Ga0075370_10166313 3300006353 Bacteria 1295
264 Ga0068871_100246863 3300006358 Bacteria 1554
265 Ga0068871_100326794 3300006358 Bacteria 1352
266 Ga0075433_10090355 3300006852 Bacteria 2707
267 Ga0075434_100021786 3300006871 Bacteria 6233
268 Ga0068865_100000002 3300006881 Bacteria 285745
269 Ga0097620_100055558 3300006931 Bacteria 3984
270 Ga0097620_100145200 3300006931 Bacteria 2447
271 Ga0097620_100206643 3300006931 Bacteria 2049
272 Ga0099826_10002340 3300006948 Bacteria 12184
273 Ga0075435_100052467 3300007076 Bacteria 3287
274 Ga0105251_10041925 3300009011 Bacteria 2225
275 Ga0105240_10029449 3300009093 Bacteria 7152
276 Ga0105240_10036499 3300009093 Bacteria 6321
277 Ga0111539_10024579 3300009094 Bacteria 7390
278 Ga0105245_10000060 3300009098 Bacteria 119425
279 Ga0105243_10000031 3300009148 Bacteria 185825
280 Ga0105242_10003359 3300009176 Bacteria 12453
281 Ga0105242_10188358 3300009176 Bacteria 1825
282 Ga0105248_10001711 3300009177 Bacteria 24398
283 Ga0105248_10008016 3300009177 Bacteria 11600
284 Ga0105248_10206954 3300009177 Bacteria 2211
285 Ga0105248_10591262 3300009177 Bacteria 1252
286 Ga0105237_10039295 3300009545 Bacteria 4777
287 Ga0105238_10064109 3300009551 Bacteria 3675
288 Ga0105238_10094550 3300009551 Bacteria 2977
289 Ga0105249_10009802 3300009553 Bacteria 8395
290 Ga0105249_10011175 3300009553 Bacteria 7887
291 Ga0123340_1061837 3300009763 Bacteria 1060
292 Ga0123341_1000009 3300009765 Bacteria 122597
293 Ga0123341_1032128 3300009765 Bacteria 3865
294 Ga0123342_1007031 3300009766 Bacteria 15168
295 Ga0123342_1022906 3300009766 Bacteria 4145
296 Ga0105239_10239706 3300010375 Bacteria 2035
297 Ga0105246_10080315 3300011119 Bacteria 2321
298 Ga0157373_10025617 3300013100 Bacteria 4264
299 Ga0157373_10028164 3300013100 Bacteria 4053
300 Ga0157373_10033059 3300013100 Bacteria 3723
301 Ga0157373_10084069 3300013100 Bacteria 2243
302 Ga0157373_10091637 3300013100 Bacteria 2141
303 Ga0157373_10128667 3300013100 Bacteria 1781
304 Ga0157373_10173948 3300013100 Bacteria 1515
305 Ga0157371_10000108 3300013102 Bacteria 126288
306 Ga0157371_10007070 3300013102 Bacteria 9130
307 Ga0157371_10428545 3300013102 Bacteria 970
308 Ga0157370_10000720 3300013104 Bacteria 41451
309 Ga0157370_10006359 3300013104 Bacteria 13041
310 Ga0157370_10444802 3300013104 Bacteria 1192
311 Ga0157370_10499872 3300013104 Bacteria 1117
312 Ga0157369_10017281 3300013105 Bacteria 8108
313 Ga0157369_10026069 3300013105 Bacteria 6485
314 Ga0157369_10044322 3300013105 Bacteria 4843
315 Ga0157369_10172969 3300013105 Bacteria 2275
316 Ga0157369_10217847 3300013105 Bacteria 1999
317 Ga0157369_10308314 3300013105 Bacteria 1646
318 Ga0171463_1004 3300013249 Bacteria 437207
319 Ga0157374_10103056 3300013296 Bacteria 2738
320 Ga0157378_10001613 3300013297 Bacteria 20403
321 Ga0157378_10003693 3300013297 Bacteria 13573
322 Ga0163162_10261248 3300013306 Bacteria 1863
323 Ga0157372_10731912 3300013307 Bacteria 1150
324 Ga0163163_10021100 3300014325 Bacteria 6144
325 Ga0163163_10317594 3300014325 Bacteria 1611
326 Ga0182008_10138971 3300014497 Bacteria 1215
327 Ga0157377_10012384 3300014745 Bacteria 4289
328 Ga0157379_10119387 3300014968 Bacteria 2372
329 Ga0157376_10000107 3300014969 Bacteria 59840
330 Ga0183363_1287 3300015690 Bacteria 7240
331 Ga0163161_10281768 3300017792 Bacteria 1304
332 Ga0206353_11380738 3300020082 Bacteria 1126
333 Ga0214544_1000010 3300021320 Bacteria 270164
334 Ga0214542_1000023 3300021321 Bacteria 191557
335 Ga0214543_1000019 3300021327 Bacteria 267908
336 Ga0213873_10000017 3300021358 Bacteria 123962
337 Ga0213872_10111290 3300021361 Bacteria 1216
338 Ga0213876_10000071 3300021384 Bacteria 123962
339 Ga0213876_10000692 3300021384 Bacteria 23763
340 Ga0213876_10025158 3300021384 Bacteria 3142
341 Ga0228598_1001030 3300024227 Bacteria 6126
342 Ga0228598_1006720 3300024227 Bacteria 2371
343 Ga0209436_106726 3300025208 Bacteria 2483
344 Ga0209563_102292 3300025230 Bacteria 4401
345 Ga0207425_1000034 3300025245 Bacteria 227886
346 Ga0207425_1001521 3300025245 Bacteria 9538
347 Ga0207425_1012395 3300025245 Bacteria 2001
348 Ga0209148_1000112 3300025254 Bacteria 197101
349 Ga0209148_1004789 3300025254 Bacteria 3239
350 Ga0209148_1004802 3300025254 Bacteria 3233
351 Ga0209129_1000094 3300025258 Bacteria 172051
352 Ga0209129_1000118 3300025258 Bacteria 139972
353 Ga0209129_1001625 3300025258 Bacteria 12189
354 Ga0209129_1002893 3300025258 Bacteria 7897
355 Ga0209129_1007832 3300025258 Bacteria 3088
356 Ga0209129_1008145 3300025258 Bacteria 2968
357 Ga0209455_1000347 3300025272 Bacteria 43550
358 Ga0209673_1000033 3300025273 Bacteria 335369
359 Ga0209673_1000052 3300025273 Bacteria 279795
360 Ga0209673_1000459 3300025273 Bacteria 68727
361 Ga0209673_1002376 3300025273 Bacteria 13220
362 Ga0209673_1002990 3300025273 Bacteria 10524
363 Ga0209673_1004965 3300025273 Bacteria 6902
364 Ga0209130_1000009 3300025284 Bacteria 498952
365 Ga0209130_1000027 3300025284 Bacteria 327700
366 Ga0209675_1021639 3300025291 Bacteria 1710
367 Ga0209676_1001384 3300025292 Bacteria 23645
368 Ga0209676_1006231 3300025292 Bacteria 5956
369 Ga0209025_1000184 3300025294 Bacteria 155611
370 Ga0209025_1000241 3300025294 Bacteria 128329
371 Ga0209025_1000245 3300025294 Bacteria 127801
372 Ga0209025_1000765 3300025294 Bacteria 53466
373 Ga0209025_1009149 3300025294 Bacteria 6962
374 Ga0209025_1012677 3300025294 Bacteria 5379
375 Ga0209025_1025313 3300025294 Bacteria 3025
376 Ga0209025_1026884 3300025294 Bacteria 2872
377 Ga0209025_1044051 3300025294 Bacteria 1871
378 Ga0209564_1000031 3300025295 Bacteria 494703
379 Ga0209564_1000111 3300025295 Bacteria 212210
380 Ga0209564_1000569 3300025295 Bacteria 58592
381 Ga0209564_1001292 3300025295 Bacteria 27247
382 Ga0209564_1003155 3300025295 Bacteria 11607
383 Ga0209564_1007729 3300025295 Bacteria 5472
384 Ga0209758_1000159 3300025297 Bacteria 155588
385 Ga0209758_1000323 3300025297 Bacteria 92123
386 Ga0209758_1005301 3300025297 Bacteria 10067
387 Ga0209758_1009330 3300025297 Bacteria 6123
388 Ga0209758_1009555 3300025297 Bacteria 5995
389 Ga0209758_1014923 3300025297 Bacteria 4076
390 Ga0209758_1024440 3300025297 Bacteria 2692
391 Ga0209050_1001966 3300025298 Bacteria 19412
392 Ga0209050_1005083 3300025298 Bacteria 8485
393 Ga0209050_1021945 3300025298 Bacteria 2306
394 Ga0209256_1000132 3300025299 Bacteria 160806
395 Ga0209256_1000361 3300025299 Bacteria 73723
396 Ga0209256_1000510 3300025299 Bacteria 57080
397 Ga0209256_1000762 3300025299 Bacteria 41835
398 Ga0209256_1001681 3300025299 Bacteria 21438
399 Ga0209256_1002153 3300025299 Bacteria 16996
400 Ga0209256_1002516 3300025299 Bacteria 14737
401 Ga0209256_1003192 3300025299 Bacteria 11860
402 Ga0209256_1016623 3300025299 Bacteria 2494
403 Ga0207426_1000041 3300025302 Bacteria 433536
404 Ga0207426_1000072 3300025302 Bacteria 327700
405 Ga0207426_1000595 3300025302 Bacteria 47697
406 Ga0207426_1000723 3300025302 Bacteria 38116
407 Ga0209051_1000561 3300025303 Bacteria 45148
408 Ga0209051_1000871 3300025303 Bacteria 30516
409 Ga0209051_1011343 3300025303 Bacteria 4407
410 Ga0209051_1011825 3300025303 Bacteria 4273
411 Ga0209051_1040535 3300025303 Bacteria 1667
412 Ga0209257_1000989 3300025304 Bacteria 38561
413 Ga0209257_1001613 3300025304 Bacteria 25850
414 Ga0209257_1013913 3300025304 Bacteria 3516
415 Ga0207697_10020216 3300025315 Bacteria 2726
416 Ga0207656_10034669 3300025321 Bacteria 2108
417 Ga0207682_10007236 3300025893 Bacteria 4436
418 Ga0207682_10015663 3300025893 Bacteria 2953
419 Ga0207642_10046017 3300025899 Bacteria 1941
420 Ga0207688_10037733 3300025901 Bacteria 2680
421 Ga0207680_10054522 3300025903 Bacteria 2405
422 Ga0207647_10000203 3300025904 Bacteria 48448
423 Ga0207647_10006191 3300025904 Bacteria 8718
424 Ga0207647_10008623 3300025904 Bacteria 7292
425 Ga0207647_10033796 3300025904 Bacteria 3270
426 Ga0207647_10054896 3300025904 Bacteria 2449
427 Ga0207647_10151579 3300025904 Bacteria 1355
428 Ga0207699_10138314 3300025906 Bacteria 1598
429 Ga0207699_10228646 3300025906 Bacteria 1273
430 Ga0207645_10018160 3300025907 Bacteria 4635
431 Ga0207645_10039623 3300025907 Bacteria 3019
432 Ga0207645_10206183 3300025907 Bacteria 1294
433 Ga0207643_10070298 3300025908 Bacteria 2013
434 Ga0207643_10209865 3300025908 Bacteria 1188
435 Ga0207705_10000002 3300025909 Bacteria 2046852
436 Ga0207705_10000238 3300025909 Bacteria 54681
437 Ga0207705_10001215 3300025909 Bacteria 20857
438 Ga0207705_10001455 3300025909 Bacteria 18886
439 Ga0207705_10002699 3300025909 Bacteria 13583
440 Ga0207705_10007647 3300025909 Bacteria 7947
441 Ga0207705_10010693 3300025909 Bacteria 6662
442 Ga0207705_10016317 3300025909 Bacteria 5326
443 Ga0207705_10021247 3300025909 Bacteria 4630
444 Ga0207705_10039357 3300025909 Bacteria 3388
445 Ga0207705_10055660 3300025909 Bacteria 2852
446 Ga0207705_10070879 3300025909 Bacteria 2526
447 Ga0207705_10102733 3300025909 Bacteria 2105
448 Ga0207705_10153529 3300025909 Bacteria 1726
449 Ga0207705_10158885 3300025909 Bacteria 1697
450 Ga0207705_10176592 3300025909 Bacteria 1610
451 Ga0207707_10011740 3300025912 Bacteria 7622
452 Ga0207707_10101598 3300025912 Bacteria 2513
453 Ga0207707_10243957 3300025912 Bacteria 1561
454 Ga0207707_10481642 3300025912 Bacteria 1060
455 Ga0207695_10012312 3300025913 Bacteria 10277
456 Ga0207695_10018522 3300025913 Bacteria 8048
457 Ga0207695_10021564 3300025913 Bacteria 7346
458 Ga0207695_10162253 3300025913 Bacteria 2166
459 Ga0207671_10051830 3300025914 Bacteria 3040
460 Ga0207693_10035507 3300025915 Bacteria 3930
461 Ga0207660_10000372 3300025917 Bacteria 29302
462 Ga0207660_10000472 3300025917 Bacteria 26680
463 Ga0207660_10002158 3300025917 Bacteria 13058
464 Ga0207660_10003625 3300025917 Bacteria 10068
465 Ga0207660_10007649 3300025917 Bacteria 6997
466 Ga0207660_10022658 3300025917 Bacteria 4233
467 Ga0207660_10044133 3300025917 Bacteria 3136
468 Ga0207660_10090679 3300025917 Bacteria 2265
469 Ga0207660_10101123 3300025917 Bacteria 2153
470 Ga0207657_10001648 3300025919 Bacteria 24067
471 Ga0207657_10001718 3300025919 Bacteria 23607
472 Ga0207657_10001725 3300025919 Bacteria 23567
473 Ga0207657_10002408 3300025919 Bacteria 20215
474 Ga0207657_10003729 3300025919 Bacteria 16196
475 Ga0207657_10004043 3300025919 Bacteria 15582
476 Ga0207657_10006306 3300025919 Bacteria 12321
477 Ga0207657_10006994 3300025919 Bacteria 11616
478 Ga0207657_10007295 3300025919 Bacteria 11340
479 Ga0207657_10021945 3300025919 Bacteria 5994
480 Ga0207657_10026478 3300025919 Bacteria 5329
481 Ga0207657_10030264 3300025919 Bacteria 4915
482 Ga0207657_10050361 3300025919 Bacteria 3625
483 Ga0207657_10051544 3300025919 Bacteria 3577
484 Ga0207657_10053962 3300025919 Bacteria 3479
485 Ga0207657_10101267 3300025919 Bacteria 2391
486 Ga0207649_10000218 3300025920 Bacteria 47072
487 Ga0207649_10007281 3300025920 Bacteria 6016
488 Ga0207649_10070914 3300025920 Bacteria 2224
489 Ga0207652_10000003 3300025921 Bacteria 502441
490 Ga0207652_10005251 3300025921 Bacteria 10522
491 Ga0207652_10032826 3300025921 Bacteria 4368
492 Ga0207681_10017186 3300025923 Bacteria 4538
493 Ga0207681_10023695 3300025923 Bacteria 3930
494 Ga0207681_10078652 3300025923 Bacteria 2321
495 Ga0207681_10079573 3300025923 Bacteria 2310
496 Ga0207694_10013615 3300025924 Bacteria 6131
497 Ga0207694_10281725 3300025924 Bacteria 1366
498 Ga0207650_10022175 3300025925 Bacteria 4495
499 Ga0207650_10123375 3300025925 Bacteria 2019
500 Ga0207659_10016014 3300025926 Bacteria 4872
501 Ga0207659_10046222 3300025926 Bacteria 3073
502 Ga0207659_10098301 3300025926 Bacteria 2201
503 Ga0207687_10008578 3300025927 Bacteria 6683
504 Ga0207664_10060683 3300025929 Bacteria 3015
505 Ga0207664_10072522 3300025929 Bacteria 2776
506 Ga0207644_10008606 3300025931 Bacteria 6675
507 Ga0207644_10025390 3300025931 Bacteria 4076
508 Ga0207644_10035573 3300025931 Bacteria 3490
509 Ga0207644_10084803 3300025931 Bacteria 2349
510 Ga0207644_10144074 3300025931 Bacteria 1837
511 Ga0207644_10158317 3300025931 Bacteria 1758
512 Ga0207690_10000436 3300025932 Bacteria 27136
513 Ga0207690_10003780 3300025932 Bacteria 8964
514 Ga0207690_10004309 3300025932 Bacteria 8398
515 Ga0207690_10008895 3300025932 Bacteria 5962
516 Ga0207690_10014921 3300025932 Bacteria 4703
517 Ga0207690_10017012 3300025932 Bacteria 4434
518 Ga0207690_10024988 3300025932 Bacteria 3746
519 Ga0207690_10031819 3300025932 Bacteria 3380
520 Ga0207690_10102013 3300025932 Bacteria 2051
521 Ga0207690_10209797 3300025932 Bacteria 1484
522 Ga0207706_10002142 3300025933 Bacteria 19310
523 Ga0207706_10002499 3300025933 Bacteria 17916
524 Ga0207706_10021154 3300025933 Bacteria 5846
525 Ga0207706_10042941 3300025933 Bacteria 4007
526 Ga0207706_10064780 3300025933 Bacteria 3218
527 Ga0207706_10086218 3300025933 Bacteria 2760
528 Ga0207706_10171179 3300025933 Bacteria 1908
529 Ga0207706_10252037 3300025933 Bacteria 1542
530 Ga0207706_10288267 3300025933 Bacteria 1431
531 Ga0207686_10003536 3300025934 Bacteria 8382
532 Ga0207709_10000122 3300025935 Bacteria 116068
533 Ga0207709_10160089 3300025935 Bacteria 1569
534 Ga0207669_10063574 3300025937 Bacteria 2279
535 Ga0207669_10226467 3300025937 Bacteria 1376
536 Ga0207704_10000003 3300025938 Bacteria 285808
537 Ga0207665_10207231 3300025939 Bacteria 1431
538 Ga0207665_10243083 3300025939 Bacteria 1327
539 Ga0207691_10002983 3300025940 Bacteria 16515
540 Ga0207691_10015632 3300025940 Bacteria 7215
541 Ga0207691_10095628 3300025940 Bacteria 2657
542 Ga0207691_10161158 3300025940 Bacteria 1968
543 Ga0207691_10196869 3300025940 Bacteria 1755
544 Ga0207691_10211527 3300025940 Bacteria 1684
545 Ga0207711_10002983 3300025941 Bacteria 14788
546 Ga0207711_10007983 3300025941 Bacteria 8853
547 Ga0207711_10010233 3300025941 Bacteria 7787
548 Ga0207711_10518400 3300025941 Bacteria 1111
549 Ga0207689_10000125 3300025942 Bacteria 64633
550 Ga0207689_10000135 3300025942 Bacteria 62838
551 Ga0207689_10021419 3300025942 Bacteria 5435
552 Ga0207689_10042943 3300025942 Bacteria 3738
553 Ga0207689_10053228 3300025942 Bacteria 3335
554 Ga0207689_10204216 3300025942 Bacteria 1631
555 Ga0207661_10004111 3300025944 Bacteria 10175
556 Ga0207661_10031889 3300025944 Bacteria 4076
557 Ga0207661_10034010 3300025944 Bacteria 3960
558 Ga0207661_10128655 3300025944 Bacteria 2166
559 Ga0207679_10001651 3300025945 Bacteria 13919
560 Ga0207679_10019071 3300025945 Bacteria 4603
561 Ga0207679_10075726 3300025945 Bacteria 2554
562 Ga0207679_10211897 3300025945 Bacteria 1625
563 Ga0207679_10294438 3300025945 Bacteria 1396
564 Ga0207667_10000007 3300025949 Bacteria 630590
565 Ga0207667_10000576 3300025949 Bacteria 47850
566 Ga0207667_10000670 3300025949 Bacteria 44352
567 Ga0207667_10012721 3300025949 Bacteria 9666
568 Ga0207667_10019976 3300025949 Bacteria 7462
569 Ga0207667_10056946 3300025949 Bacteria 4104
570 Ga0207667_10065659 3300025949 Bacteria 3784
571 Ga0207667_10090133 3300025949 Bacteria 3169
572 Ga0207667_10535064 3300025949 Bacteria 1186
573 Ga0207667_10686111 3300025949 Bacteria 1027
574 Ga0207651_10000003 3300025960 Bacteria 308050
575 Ga0207651_10137447 3300025960 Bacteria 1882
576 Ga0207651_10248514 3300025960 Bacteria 1454
577 Ga0207651_10531435 3300025960 Bacteria 1020
578 Ga0207712_10000946 3300025961 Bacteria 20945
579 Ga0207712_10009797 3300025961 Bacteria 6071
580 Ga0207668_10000062 3300025972 Bacteria 88123
581 Ga0207640_10000106 3300025981 Bacteria 63751
582 Ga0207640_10010686 3300025981 Bacteria 5179
583 Ga0207640_10022063 3300025981 Bacteria 3805
584 Ga0207640_10046882 3300025981 Bacteria 2784
585 Ga0207658_10010217 3300025986 Bacteria 6376
586 Ga0207658_10023625 3300025986 Bacteria 4293
587 Ga0207658_10039013 3300025986 Bacteria 3425
588 Ga0207658_10145956 3300025986 Bacteria 1921
589 Ga0207658_10176760 3300025986 Bacteria 1763
590 Ga0207677_10000364 3300026023 Bacteria 31713
591 Ga0207677_10107895 3300026023 Bacteria 2066
592 Ga0207639_10056336 3300026041 Bacteria 3013
593 Ga0207639_10063209 3300026041 Bacteria 2865
594 Ga0207639_10084509 3300026041 Bacteria 2522
595 Ga0207639_10304816 3300026041 Bacteria 1409
596 Ga0207639_10327941 3300026041 Bacteria 1361
597 Ga0207639_10368480 3300026041 Bacteria 1287
598 Ga0207639_10582459 3300026041 Bacteria 1030
599 Ga0207639_10583772 3300026041 Bacteria 1029
600 Ga0207678_10001924 3300026067 Bacteria 18941
601 Ga0207678_10007717 3300026067 Bacteria 9503
602 Ga0207678_10010454 3300026067 Bacteria 8149
603 Ga0207678_10017805 3300026067 Bacteria 6238
604 Ga0207678_10022080 3300026067 Bacteria 5576
605 Ga0207678_10077712 3300026067 Bacteria 2843
606 Ga0207678_10141194 3300026067 Bacteria 2056
607 Ga0207678_10296500 3300026067 Bacteria 1389
608 Ga0207678_10306236 3300026067 Bacteria 1366
609 Ga0207678_10414884 3300026067 Bacteria 1167
610 Ga0207678_10487005 3300026067 Bacteria 1074
611 Ga0207702_10015725 3300026078 Bacteria 6265
612 Ga0207702_10040345 3300026078 Bacteria 3914
613 Ga0207702_10121643 3300026078 Bacteria 2337
614 Ga0207702_10250504 3300026078 Bacteria 1663
615 Ga0207702_10303289 3300026078 Bacteria 1516
616 Ga0207641_10006103 3300026088 Bacteria 10197
617 Ga0207641_10014928 3300026088 Bacteria 6368
618 Ga0207641_10065086 3300026088 Bacteria 3117
619 Ga0207641_10125490 3300026088 Bacteria 2297
620 Ga0207648_10000007 3300026089 Bacteria 217865
621 Ga0207648_10000530 3300026089 Bacteria 42624
622 Ga0207648_10020393 3300026089 Bacteria 5969
623 Ga0207676_10005993 3300026095 Bacteria 8574
624 Ga0207674_10000319 3300026116 Bacteria 61196
625 Ga0207674_10002750 3300026116 Bacteria 21946
626 Ga0207674_10003722 3300026116 Bacteria 18621
627 Ga0207674_10003878 3300026116 Bacteria 18231
628 Ga0207674_10084151 3300026116 Bacteria 3179
629 Ga0207674_10304040 3300026116 Bacteria 1544
630 Ga0207675_100492338 3300026118 Bacteria 1220
631 Ga0207683_10003639 3300026121 Bacteria 13412
632 Ga0207683_10037280 3300026121 Bacteria 4233
633 Ga0207683_10296593 3300026121 Bacteria 1479
634 Ga0207698_10001611 3300026142 Bacteria 13137
635 Ga0207698_10006210 3300026142 Bacteria 7435
636 Ga0207698_10046952 3300026142 Bacteria 3266
637 Ga0207698_10060729 3300026142 Bacteria 2941
638 Ga0207698_10159863 3300026142 Bacteria 1969
639 Ga0209371_1000037 3300027312 Bacteria 367074
640 Ga0209371_1008956 3300027312 Bacteria 3245
641 Ga0209282_1000283 3300027666 Bacteria 25146
642 Ga0209282_1090605 3300027666 Bacteria 1603
643 Ga0209813_10002017 3300027866 Bacteria 4598
644 Ga0268266_10000003 3300028379 Bacteria 1701703
645 Ga0268266_10000437 3300028379 Bacteria 62490
646 Ga0268266_10002433 3300028379 Bacteria 19998
647 Ga0268266_10009696 3300028379 Bacteria 8463
648 Ga0268266_10017087 3300028379 Bacteria 6195
649 Ga0268266_10018637 3300028379 Bacteria 5914
650 Ga0268266_10053267 3300028379 Bacteria 3476
651 Ga0268266_10126335 3300028379 Bacteria 2283
652 Ga0268265_10057263 3300028380 Bacteria 2969
653 Ga0268265_10080919 3300028380 Bacteria 2563
654 Ga0268265_10094084 3300028380 Bacteria 2402
655 Ga0268265_10096504 3300028380 Bacteria 2376
656 Ga0268265_10482582 3300028380 Bacteria 1164
657 Ga0268265_10485082 3300028380 Bacteria 1162
658 Ga0268264_10003522 3300028381 Bacteria 13489
659 Ga0268264_10018767 3300028381 Bacteria 5654
660 Ga0268264_10120600 3300028381 Bacteria 2310
661 Ga0307515_10000377 3300028794 Bacteria 109082
662 Ga0307515_10081914 3300028794 Bacteria 4183
663 Ga0307515_10180265 3300028794 Bacteria 2065
664 Ga0265338_10218976 3300028800 Bacteria 1423
665 Ga0268256_1000039 3300030500 Bacteria 354969
666 Ga0268256_1003110 3300030500 Bacteria 7742
667 Ga0307513_10001888 3300031456 Bacteria 29770
668 Ga0307513_10026273 3300031456 Bacteria 6719
669 Ga0307513_10096554 3300031456 Bacteria 2993
670 Ga0307408_100079865 3300031548 Bacteria 2442
671 Ga0307408_100094177 3300031548 Bacteria 2267
672 Ga0307408_100416986 3300031548 Bacteria 1157
673 Ga0307408_100598925 3300031548 Bacteria 979
674 Ga0307516_10000035 3300031730 Bacteria 152658
675 Ga0307405_10023372 3300031731 Bacteria 3513
676 Ga0307405_10038530 3300031731 Bacteria 2882
677 Ga0307405_10057393 3300031731 Bacteria 2445
678 Ga0307413_10004980 3300031824 Bacteria 5859
679 Ga0307413_10005334 3300031824 Bacteria 5724
680 Ga0307413_10005996 3300031824 Bacteria 5499
681 Ga0307413_10011075 3300031824 Bacteria 4413
682 Ga0307413_10020932 3300031824 Bacteria 3490
683 Ga0307413_10056553 3300031824 Bacteria 2394
684 Ga0307413_10167691 3300031824 Bacteria 1550
685 Ga0307413_10232281 3300031824 Bacteria 1355
686 Ga0307413_10253041 3300031824 Bacteria 1308
687 Ga0307410_10002232 3300031852 Bacteria 9247
688 Ga0307410_10003177 3300031852 Bacteria 8180
689 Ga0307410_10003979 3300031852 Bacteria 7541
690 Ga0307410_10020225 3300031852 Bacteria 4067
691 Ga0307410_10024866 3300031852 Bacteria 3747
692 Ga0307410_10118109 3300031852 Bacteria 1929
693 Ga0307410_10191489 3300031852 Bacteria 1555
694 Ga0307410_10291992 3300031852 Bacteria 1283
695 Ga0307406_10003270 3300031901 Bacteria 8831
696 Ga0307406_10030854 3300031901 Bacteria 3259
697 Ga0307406_10125683 3300031901 Bacteria 1791
698 Ga0307407_10004296 3300031903 Bacteria 6019
699 Ga0307407_10009408 3300031903 Bacteria 4551
700 Ga0307407_10020688 3300031903 Bacteria 3376
701 Ga0307407_10024400 3300031903 Bacteria 3171
702 Ga0307407_10147633 3300031903 Bacteria 1524
703 Ga0307412_10006437 3300031911 Bacteria 6637
704 Ga0307409_100014500 3300031995 Bacteria 5130
705 Ga0307409_100016675 3300031995 Bacteria 4869
706 Ga0307409_100019114 3300031995 Bacteria 4629
707 Ga0307409_100043597 3300031995 Bacteria 3370
708 Ga0307409_100050432 3300031995 Bacteria 3178
709 Ga0307409_100057413 3300031995 Bacteria 3016
710 Ga0307409_100112352 3300031995 Bacteria 2287
711 Ga0307416_100010519 3300032002 Bacteria 6116
712 Ga0307416_100035360 3300032002 Bacteria 3814
713 Ga0307416_100241481 3300032002 Bacteria 1751
714 Ga0307414_10000921 3300032004 Bacteria 15040
715 Ga0307414_10010373 3300032004 Bacteria 5402
716 Ga0307414_10077990 3300032004 Bacteria 2413
717 Ga0307414_10147443 3300032004 Bacteria 1851
718 Ga0307414_10419315 3300032004 Bacteria 1167
719 Ga0307411_10001400 3300032005 Bacteria 9803
720 Ga0307411_10001821 3300032005 Bacteria 9039
721 Ga0307411_10013162 3300032005 Bacteria 4551
722 Ga0307411_10015792 3300032005 Bacteria 4254
723 Ga0307411_10031239 3300032005 Bacteria 3274
724 Ga0307411_10037106 3300032005 Bacteria 3060
725 Ga0307411_10038322 3300032005 Bacteria 3022
726 Ga0307411_10053686 3300032005 Bacteria 2642
727 Ga0307411_10163078 3300032005 Bacteria 1672
728 Ga0307411_10276370 3300032005 Bacteria 1334
729 Ga0307411_10308469 3300032005 Bacteria 1272
730 Ga0307415_100074825 3300032126 Bacteria 2395
731 Ga0307415_100098511 3300032126 Bacteria 2137
732 Ga0307415_100159580 3300032126 Bacteria 1746
733 Ga0307415_100257547 3300032126 Bacteria 1421
734 Ga0373923_0003972 3300035111 Bacteria 4834
735 Ga0373936_0104065 3300035113 Bacteria 1200
736 Ga0373954_0019633 3300035118 Bacteria 3051
737 Ga0373957_0021557 3300035120 Bacteria 2289
738 Ga0373943_0008540 3300035170 Bacteria 4593
739 Ga0373943_0030042 3300035170 Bacteria 2570
740 Ga0373955_0001792 3300035172 Bacteria 9226
741 Ga0373935_0140118 3300035692 Bacteria 1633
742 Ga0373933_0135952 3300035724 Bacteria 1549
743 Ga0373947_0008998 3300035725 Bacteria 5741
744 Ga0373937_0013888 3300036401 Bacteria 7101
745 Ga0373937_0406219 3300036401 Bacteria 1292
746 Ga0373925_0003075 3300037068 Bacteria 13123
747 Ga0373925_0041499 3300037068 Bacteria 3411
748 Ga0373925_0107209 3300037068 Bacteria 2154
749 Ga0395899_0000112 3300037312 Bacteria 138389
750 Ga0395899_0001881 3300037312 Bacteria 17330
751 Ga0395899_0012750 3300037312 Bacteria 6440
752 Ga0395899_0061559 3300037312 Bacteria 2764
753 Ga0395899_0077095 3300037312 Bacteria 2431
754 Ga0395899_0262697 3300037312 Bacteria 1180
755 Ga0395899_0373842 3300037312 Bacteria 948
756 Ga0395900_0000614 3300037418 Bacteria 48329
757 Ga0395900_0000956 3300037418 Bacteria 37678
758 Ga0395900_0001333 3300037418 Bacteria 29893
759 Ga0395900_0017290 3300037418 Bacteria 7360
760 Ga0395900_0037211 3300037418 Bacteria 5019
761 Ga0395900_0038837 3300037418 Bacteria 4908
762 Ga0395900_0050798 3300037418 Bacteria 4270
763 Ga0395900_0051787 3300037418 Bacteria 4227
764 Ga0395900_0126780 3300037418 Bacteria 2618
765 Ga0395900_0127502 3300037418 Bacteria 2609
766 Ga0395900_0151892 3300037418 Bacteria 2365
767 Ga0395900_0205426 3300037418 Bacteria 1991
768 Ga0395900_0281297 3300037418 Bacteria 1655
769 Ga0395900_0326414 3300037418 Bacteria 1513
770 Ga0395900_0362949 3300037418 Bacteria 1419
771 Ga0395900_0479445 3300037418 Bacteria 1196
772 Ga0395898_0000856 3300037466 Bacteria 49957
773 Ga0395898_0009114 3300037466 Bacteria 10451
774 Ga0395898_0139607 3300037466 Bacteria 2320
775 Ga0395898_0142087 3300037466 Bacteria 2298
776 Ga0395898_0214164 3300037466 Bacteria 1838
777 Ga0395898_0412694 3300037466 Bacteria 1287
778 Ga0395905_0000002 3300037471 Bacteria 1356358
779 Ga0395905_0000756 3300037471 Bacteria 42590
780 Ga0395905_0003430 3300037471 Bacteria 16961
781 Ga0395905_0023768 3300037471 Bacteria 5786
782 Ga0395905_0025300 3300037471 Bacteria 5598
783 Ga0395905_0025479 3300037471 Bacteria 5578
784 Ga0395905_0028641 3300037471 Bacteria 5251
785 Ga0395905_0030591 3300037471 Bacteria 5071
786 Ga0395905_0033570 3300037471 Bacteria 4819
787 Ga0395905_0045251 3300037471 Bacteria 4128
788 Ga0395905_0068941 3300037471 Bacteria 3312
789 Ga0395905_0094956 3300037471 Bacteria 2798
790 Ga0395905_0097317 3300037471 Bacteria 2763
791 Ga0395905_0133699 3300037471 Bacteria 2333
792 Ga0395905_0148476 3300037471 Bacteria 2205
793 Ga0395905_0151278 3300037471 Bacteria 2183
794 Ga0395905_0152497 3300037471 Bacteria 2174
795 Ga0395905_0236269 3300037471 Bacteria 1708
796 Ga0395905_0277188 3300037471 Bacteria 1563
797 Ga0395905_0323777 3300037471 Bacteria 1431
798 Ga0395905_0347710 3300037471 Bacteria 1374
799 Ga0395905_0415720 3300037471 Bacteria 1240
800 Ga0395905_0539350 3300037471 Bacteria 1067
801 Ga0436364_1182124 3300037853 Bacteria 1231
802 Ga0395901_0000047 3300038443 Bacteria 175221
803 Ga0395901_0001266 3300038443 Bacteria 26792
804 Ga0395901_0027549 3300038443 Bacteria 5839
805 Ga0395901_0030907 3300038443 Bacteria 5519
806 Ga0395901_0072476 3300038443 Bacteria 3591
807 Ga0395901_0084889 3300038443 Bacteria 3309
808 Ga0395901_0097665 3300038443 Bacteria 3079
809 Ga0395901_0108881 3300038443 Bacteria 2908
810 Ga0395901_0259175 3300038443 Bacteria 1810
811 Ga0395901_0380113 3300038443 Bacteria 1454
812 Ga0395901_0436127 3300038443 Bacteria 1342
813 Ga0395901_0735731 3300038443 Bacteria 980
814 Ga0400489_61960 3300039093 Bacteria 1296
815 Ga0436365_0178572 3300039437 Bacteria 58477
816 Ga0436365_0575374 3300039437 Bacteria 3292
817 Ga0436365_0646826 3300039437 Bacteria 110896
818 Ga0436360_0218255 3300039438 Bacteria 1259
819 Ga0436360_0347187 3300039438 Bacteria 2114
820 Ga0436361_0843768 3300039447 Bacteria 1138
821 Ga0436362_0199967 3300039453 Bacteria 28994
822 Ga0439461_0061267 3300041410 Bacteria 855
823 Ga0451805_114317 3300041461 Bacteria 1773
824 Ga0451807_1040591 3300041486 Bacteria 1646
825 Ga0451833_0382737 3300041491 Bacteria 1170
826 Ga0451836_13430 3300041493 Bacteria 2771
827 Ga0451840_17616 3300041497 Bacteria 2012
828 Ga0451844_01918 3300041500 Bacteria 1532
829 Ga0451847_0366726 3300041503 Bacteria 1514
830 Ga0451848_02292 3300041504 Bacteria 3660
831 Ga0451850_34886 3300041506 Bacteria 2845
832 Ga0451851_0207979 3300041507 Bacteria 2746
833 Ga0451853_2415485 3300041512 Bacteria 3260
834 Ga0452268_04190 3300041907 Bacteria 2529
835 Ga0439442_022337 3300042002 Bacteria 1313
836 Ga0450920_010858 3300042122 Bacteria 1691
837 Ga0439458_0001563 3300042157 Bacteria 5726
838 Ga0439464_0006897 3300042439 Bacteria 2964
839 Ga0450918_022643 3300042531 Bacteria 1098
840 Ga0466972_0044050 3300044658 Bacteria 2165
841 Ga0466966_0021123 3300044684 Bacteria 4275
842 Ga0466966_0026104 3300044684 Bacteria 3814
843 Ga0466966_0103860 3300044684 Bacteria 1756
844 Ga0466961_0002991 3300044693 Bacteria 10497
845 Ga0466961_0272458 3300044693 Bacteria 1037
846 Ga0466963_0095059 3300044694 Bacteria 2033
847 Ga0466963_0156045 3300044694 Bacteria 1587
848 Ga0466963_0180524 3300044694 Bacteria 1473
849 Ga0466963_0256461 3300044694 Bacteria 1227
850 Ga0453684_0077525 3300044712 Archaea 4164
851 Ga0466968_0057464 3300044735 Bacteria 1672
852 Ga0466968_0112096 3300044735 Bacteria 1227
853 Ga0466970_0211897 3300044765 Bacteria 1080
854 Ga0466960_0069981 3300044901 Bacteria 1744
855 Ga0466959_0051129 3300045049 Bacteria 3032
856 Ga0466958_0005444 3300045836 Bacteria 6853
857 Ga0466967_0016516 3300045976 Bacteria 5825
858 Ga0466967_0053146 3300045976 Bacteria 3559
859 Ga0466967_0172907 3300045976 Bacteria 2033
860 Ga0466967_0189161 3300045976 Bacteria 1945
861 Ga0466967_0223230 3300045976 Bacteria 1791
862 Ga0466967_0250988 3300045976 Bacteria 1690
863 Ga0495629_0309947 3300046459 Bacteria 1080
864 Ga0495650_0054491 3300046471 Bacteria 1632
865 Ga0495584_0198223 3300046491 Bacteria 1021
866 Ga0495606_0000842 3300046507 Bacteria 46207
867 Ga0495606_0006190 3300046507 Bacteria 11137
868 Ga0495610_0023020 3300046512 Bacteria 3394
869 Ga0495610_0027830 3300046512 Bacteria 2998
870 Ga0495618_0109772 3300046514 Bacteria 1766
871 Ga0495632_0029818 3300046519 Bacteria 2837
872 Ga0495643_0030806 3300046522 Bacteria 2991
873 Ga0495643_0049214 3300046522 Bacteria 2274
874 Ga0495648_0063982 3300046524 Bacteria 2169
875 Ga0495663_0001575 3300046525 Bacteria 7152
876 Ga0495586_0092693 3300046535 Bacteria 1670
877 Ga0495621_0019233 3300046539 Bacteria 2229
878 Ga0495621_0080541 3300046539 Bacteria 1214
879 Ga0495668_0025865 3300046616 Bacteria 3333
880 Ga0495623_0032843 3300046679 Bacteria 3334
881 Ga0495669_0004244 3300046684 Bacteria 5904
882 Ga0495669_0073522 3300046684 Bacteria 1561
883 Ga0495670_0002753 3300046691 Bacteria 8691
884 Ga0495671_0027198 3300046692 Bacteria 2956
885 Ga0495649_0131529 3300046694 Bacteria 1320
886 Ga0495581_0001641 3300047315 Bacteria 12467
887 Ga0495672_0019292 3300047320 Bacteria 4502
888 Ga0495684_0280826 3300047471 Bacteria 1201
889 Ga0495686_0095614 3300047472 Bacteria 1799
890 Ga0495686_0173413 3300047472 Bacteria 1253
891 Ga0495602_0027123 3300048088 Bacteria 5513
892 Ga0496101_0059302 3300048904 Bacteria 2773
893 Ga0496102_0020912 3300048905 Bacteria 5785
894 Ga0496102_0501878 3300048905 Bacteria 1135
895 Ga0496103_0019417 3300048906 Bacteria 4082
896 Ga0496103_0062160 3300048906 Bacteria 2324
897 Ga0496104_0005087 3300048907 Bacteria 11477
898 Ga0496105_0029761 3300048908 Bacteria 4471
899 Ga0496105_0124152 3300048908 Bacteria 2128
900 Ga0496105_0288302 3300048908 Bacteria 1322
901 Ga0496106_0019237 3300048909 Bacteria 5065
902 Ga0496106_0109486 3300048909 Bacteria 2149
903 Ga0496107_0010761 3300048910 Bacteria 6361
904 Ga0496107_0014006 3300048910 Bacteria 5613
905 Ga0496107_0280966 3300048910 Bacteria 1239
906 Ga0496108_0007128 3300048911 Bacteria 9057
907 Ga0496108_0027624 3300048911 Bacteria 4689
908 Ga0496109_0006219 3300048912 Bacteria 10036
909 Ga0496109_0053030 3300048912 Bacteria 3698
910 Ga0496109_0090275 3300048912 Bacteria 2833
911 Ga0496110_0011342 3300048913 Bacteria 7290
912 Ga0496110_0093295 3300048913 Bacteria 2695
913 Ga0496111_0013893 3300048914 Bacteria 5491
914 Ga0496111_0022256 3300048914 Bacteria 4434
915 Ga0496111_0034277 3300048914 Bacteria 3624
916 Ga0496111_0156243 3300048914 Bacteria 1693
917 Ga0496112_0056815 3300048915 Bacteria 3852
918 Ga0496112_0061115 3300048915 Bacteria 3713
919 Ga0496112_0184074 3300048915 Bacteria 2052
920 Ga0496112_0300058 3300048915 Bacteria 1552
921 Ga0496112_0329469 3300048915 Bacteria 1471
922 Ga0496113_0004502 3300048916 Bacteria 8580
923 Ga0496113_0035281 3300048916 Bacteria 3656
924 Ga0496114_0508298 3300048917 Bacteria 1066
925 Ga0496115_0002304 3300048918 Bacteria 13672
926 Ga0496115_0216444 3300048918 Bacteria 1581
927 Ga0496115_0286737 3300048918 Bacteria 1351
928 Ga0496116_0036603 3300048919 Bacteria 3431
929 Ga0496116_0046785 3300048919 Bacteria 2917
930 Ga0496117_0000031 3300048920 Bacteria 381048
931 Ga0496117_0010158 3300048920 Bacteria 8639
932 Ga0496117_0046354 3300048920 Bacteria 3127
933 Ga0496117_0072181 3300048920 Bacteria 2309
934 Ga0496117_0123635 3300048920 Bacteria 1584
935 Ga0496118_0009453 3300048921 Bacteria 9842
936 Ga0496118_0047506 3300048921 Bacteria 3325
937 Ga0496118_0050212 3300048921 Bacteria 3204
938 Ga0496118_0111548 3300048921 Bacteria 1813
939 Ga0496119_0016219 3300048922 Bacteria 5686
940 Ga0496119_0022765 3300048922 Bacteria 4472
941 Ga0496119_0065871 3300048922 Bacteria 2143
942 Ga0496119_0068627 3300048922 Bacteria 2086
943 Ga0496120_0002214 3300048923 Bacteria 20503
944 Ga0496120_0008737 3300048923 Bacteria 7288
945 Ga0496121_0000034 3300048924 Bacteria 377095
946 Ga0496121_0037228 3300048924 Bacteria 4324
947 Ga0496121_0100280 3300048924 Bacteria 2235
948 Ga0496122_0000023 3300048925 Bacteria 381035
949 Ga0496122_0000074 3300048925 Bacteria 219900
950 Ga0496122_0002284 3300048925 Bacteria 27720
951 Ga0496122_0049974 3300048925 Bacteria 3193
952 Ga0496122_0054751 3300048925 Bacteria 2992
953 Ga0496122_0077694 3300048925 Bacteria 2329
954 Ga0496123_0000027 3300048926 Bacteria 306773
955 Ga0496123_0000062 3300048926 Bacteria 219882
956 Ga0496123_0000290 3300048926 Bacteria 98053
957 Ga0496123_0017447 3300048926 Bacteria 5772
958 Ga0496123_0045104 3300048926 Bacteria 3007
959 Ga0496123_0060366 3300048926 Bacteria 2445
960 Ga0496123_0084091 3300048926 Bacteria 1920
961 Ga0496124_0000130 3300048927 Bacteria 156467
962 Ga0496124_0132682 3300048927 Bacteria 1976
963 Ga0496124_0157216 3300048927 Bacteria 1776
964 Ga0496124_0192753 3300048927 Bacteria 1557
965 Ga0496125_0000030 3300048928 Bacteria 375023
966 Ga0496125_0000191 3300048928 Bacteria 131220
967 Ga0496125_0043497 3300048928 Bacteria 3810
968 Ga0496125_0043789 3300048928 Bacteria 3793
969 Ga0496125_0046609 3300048928 Bacteria 3635
970 Ga0496125_0083656 3300048928 Bacteria 2426
971 Ga0496125_0308991 3300048928 Bacteria 964
972 Ga0496126_0002183 3300048929 Bacteria 27192
973 Ga0496126_0110669 3300048929 Bacteria 2392
974 Ga0496126_0215911 3300048929 Bacteria 1613
975 Ga0496126_0515506 3300048929 Bacteria 953
976 Ga0501031_0062249 3300049568 Bacteria 2431
977 Ga0501032_0017999 3300049569 Bacteria 4956
978 Ga0501032_0059538 3300049569 Bacteria 2563
979 Ga0501033_0001390 3300049570 Bacteria 21504
980 Ga0501033_0293730 3300049570 Bacteria 1145
981 Ga0501034_0027245 3300049571 Bacteria 5814
982 Ga0501034_0043144 3300049571 Bacteria 4565
983 Ga0501034_0053984 3300049571 Bacteria 4046
984 Ga0501034_0064642 3300049571 Bacteria 3672
985 Ga0501034_0100185 3300049571 Bacteria 2891
986 Ga0501036_0008099 3300049572 Bacteria 8611
987 Ga0501037_0055182 3300049573 Bacteria 2905
988 Ga0501037_0103708 3300049573 Bacteria 2051
989 Ga0501037_0148244 3300049573 Bacteria 1678
990 Ga0501038_0008659 3300049574 Bacteria 9345
991 Ga0501038_0075372 3300049574 Bacteria 2851
992 Ga0501038_0309836 3300049574 Bacteria 1237
993 Ga0501038_0401126 3300049574 Bacteria 1061
994 Ga0501039_0244631 3300049575 Bacteria 1410
995 Ga0501043_0025032 3300049579 Bacteria 4682
996 Ga0501043_0130198 3300049579 Bacteria 1972
997 Ga0501047_0059274 3300049581 Bacteria 3696
998 Ga0501047_0081910 3300049581 Bacteria 3102
999 Ga0501047_0225063 3300049581 Bacteria 1731
1000 Ga0501067_0157526 3300049583 Bacteria 1265
1001 Ga0501069_0116597 3300049585 Bacteria 1523
1002 Ga0501070_0269989 3300049586 Bacteria 1389
1003 Ga0501071_0182854 3300049587 Bacteria 1571
1004 Ga0501071_0311564 3300049587 Bacteria 1194
1005 Ga0501073_0042928 3300049589 Bacteria 3190
1006 Ga0501073_0076554 3300049589 Bacteria 2328
1007 Ga0501074_0164020 3300049590 Bacteria 1586
1008 Ga0501075_0055494 3300049591 Bacteria 2981
1009 Ga0501075_0294804 3300049591 Bacteria 1236
1010 Ga0501076_0002832 3300049592 Bacteria 11990
1011 Ga0501076_0526787 3300049592 Bacteria 974
1012 Ga0501077_0014202 3300049593 Bacteria 4999
1013 Ga0501238_008432 3300049671 Bacteria 1356
1014 Ga0501079_0014267 3300049741 Bacteria 6057
1015 Ga0501080_0080082 3300049742 Bacteria 3036
1016 Ga0501080_0090942 3300049742 Bacteria 2834
1017 Ga0501080_0103533 3300049742 Bacteria 2640
1018 Ga0501081_0011512 3300049743 Bacteria 5787
1019 Ga0501083_0038424 3300049744 Bacteria 3254
1020 Ga0501083_0103072 3300049744 Bacteria 1881
1021 Ga0501035_0000316 3300049822 Bacteria 55833
1022 Ga0501035_0056084 3300049822 Bacteria 3517
1023 Ga0501035_0205223 3300049822 Bacteria 1688
1024 Ga0501044_0032533 3300049823 Bacteria 5482
1025 Ga0501044_0078832 3300049823 Bacteria 3338
1026 Ga0501044_0296335 3300049823 Bacteria 1547
1027 Ga0501044_0506104 3300049823 Bacteria 1108
1028 Ga0501044_0545136 3300049823 Bacteria 1057
1029 nmdc:mga03n38_159935_c1 3300050490 Bacteria 1140
1030 nmdc:mga00v17_117335_c1 3300050491 Bacteria 1693
1031 nmdc:mga00v17_360_c1 3300050491 Bacteria 25745
1032 nmdc:mga00v17_9201_c1 3300050491 Bacteria 5336
1033 nmdc:mga06z11_162722_c1 3300050494 Bacteria 1276
1034 nmdc:mga06z11_195420_c1 3300050494 Bacteria 1173
1035 nmdc:mga07m45_10486_c1 3300050496 Bacteria 4842
1036 nmdc:mga07m45_33705_c1 3300050496 Bacteria 2845
1037 nmdc:mga07m45_39862_c1 3300050496 Bacteria 2626
1038 nmdc:mga07m45_44016_c1 3300050496 Bacteria 2504
1039 nmdc:mga07m45_97233_c1 3300050496 Bacteria 1690
1040 nmdc:mga05p37_4690_c1 3300050507 Bacteria 15966
1041 nmdc:mga08y16_75638_c1 3300050511 Bacteria 3510
1042 nmdc:mga0n895_400699_c1 3300050512 Bacteria 1388
1043 nmdc:mga0rr50_94491_c1 3300050513 Bacteria 2335
1044 nmdc:mga0a205_3134_c1 3300050515 Bacteria 14667
1045 nmdc:mga0sz30_2754_c1 3300050516 Bacteria 6272
1046 Ga0500643_040966 3300053087 Bacteria 1363
1047 Ga0500641_0073152 3300053096 Bacteria 1446
1048 Ga0500572_005072 3300053111 Bacteria 2981
1049 Ga0500658_0000023 3300053134 Bacteria 123176
1050 Ga0500658_0043369 3300053134 Bacteria 1811
1051 Ga0500616_0070123 3300053153 Bacteria 1790
1052 Ga0500622_0032643 3300053156 Bacteria 2729
1053 Ga0500627_0020379 3300053158 Bacteria 2658
1054 Ga0500636_0000025 3300053177 Bacteria 86697
1055 Ga0501084_0023191 3300054114 Bacteria 5181
1056 Ga0587066_005314 3300059490 Bacteria 1642
1057 Ga0587083_0015354 3300059505 Bacteria 1335
1058 Ga0587086_001890 3300059507 Bacteria 1894
1059 Ga0587090_000117 3300059510 Bacteria 5012
1060 Ga0587091_006347 3300059511 Bacteria 1657
1061 Ga0587067_000537 3300059640 Bacteria 3394
1062 Ga0587068_008100 3300059641 Bacteria 1514
1063 Ga0501082_0016884 3300060353 Bacteria 6286
1064 Ga0466962_0069291 3300061719 Bacteria 1685
1065 Ga0530510_0197617 3300061734 Bacteria 1493
1066 2508734362 2508501050 Bacteria 9633614
1067 2509079271 2508501114 Bacteria 7082538
1068 2509109470 2508501122 Bacteria 6292184
1069 2509378220 2509276019 Bacteria 6802256
1070 2509389485 2509276021 Bacteria 7634384
1071 2509446103 2509276033 Bacteria 7180565
1072 2510135164 2510065019 Bacteria 6903379
1073 2510307621 2510065057 Bacteria 6649661
1074 2510841293 2510461069 Bacteria 5505000
1075 2510896590 2510461076 Bacteria 8618824
1076 2511174119 2510917026 Bacteria 7046020
1077 2511184861 2510917028 Bacteria 6185411
1078 2511503204 2511231052 Bacteria 6974333
1079 2512534478 2512047086 Bacteria 6850303
1080 2512973713 2512875026 Bacteria 6861065
1081 2513571532 2513237084 Bacteria 7231967
1082 2513578555 2513237085 Bacteria 7695351
1083 2513585187 2513237086 Bacteria 7265287
1084 2513598130 2513237088 Bacteria 6927906
1085 2513601769 2513237089 Bacteria 6553624
1086 2513616954 2513237091 Bacteria 6900273
1087 2513630266 2513237093 Bacteria 7545552
1088 2513713125 2513237103 Bacteria 7647401
1089 2513869188 2513237138 Bacteria 7368160
1090 2513884170 2513237140 Bacteria 7076289
1091 2513903499 2513237143 Bacteria 6664116
1092 2513984043 2513237156 Bacteria 6402557
1093 2513998559 2513237159 Bacteria 6810126
1094 2514003647 2513237160 Bacteria 6650282
1095 2514019286 2513237162 Bacteria 7468464
1096 2515114317 2515075009 Bacteria 7288508
1097 2515610942 2515154107 Bacteria 6795637
1098 2515636208 2515154113 Bacteria 7807172
1099 2515643298 2515154114 Bacteria 7848616
1100 2515660785 2515154116 Bacteria 7552979
1101 2515741482 2515154134 Bacteria 7220242
1102 2516894636 2516653046 Bacteria 6989037
1103 2517078203 2516653085 Bacteria 7346596
1104 2517096972 2517093000 Bacteria 7412387
1105 2517408623 2517287029 Bacteria 6905599
1106 2517571284 2517487022 Bacteria 7227575
1107 2520376381 2519899620 Bacteria 6499161
1108 2523468749 2523231067 Bacteria 5230452
1109 2524450570 2524023207 Bacteria 6813453
1110 2524458392 2524023209 Bacteria 6679728
1111 2530647420 2529292951 Bacteria 6916614
1112 2535485381 2534681786 Bacteria 3308809
1113 2535518944 2534681796 Bacteria 7146037
1114 2537876656 2537561587 Bacteria 5425293
1115 2551679638 2551306084 Bacteria 8942552
1116 2551687381 2551306085 Bacteria 7347181
1117 2551691541 2551306086 Bacteria 6843938
1118 2551698012 2551306087 Bacteria 7351905
1119 2551711053 2551306089 Bacteria 7162724
1120 2551720239 2551306090 Bacteria 7953713
1121 2551725364 2551306091 Bacteria 7086830
1122 2551738054 2551306092 Bacteria 6992595
1123 2551743515 2551306093 Bacteria 7064773
1124 2554248799 2554235003 Bacteria 5877155
1125 2558867294 2558860100 Bacteria 8458965
1126 2559295887 2558860242 Bacteria 5568029
1127 2561467043 2558860983 Bacteria 4133860
1128 2585166796 2582581283 Bacteria 6030556
1129 2585223853 2582581298 Bacteria 7315509
1130 2585228813 2582581299 Bacteria 6518058
1131 2585257429 2582581304 Bacteria 5831370
1132 2585266856 2582581306 Bacteria 6450535
1133 2585280655 2582581308 Bacteria 7413247
1134 2585387899 2582581865 Bacteria 6644329
1135 2585395993 2582581866 Bacteria 6859583
1136 2585399676 2582581867 Bacteria 7184437
1137 2585526152 2585427526 Bacteria 7258840
1138 2585531589 2585427527 Bacteria 7273426
1139 2585540694 2585427528 Bacteria 6842387
1140 2585549076 2585427529 Bacteria 7395659
1141 2585551464 2585427530 Bacteria 7383882
1142 2585820763 2585427590 Bacteria 6824633
1143 2585838963 2585427593 Bacteria 7141551
1144 2585844816 2585427594 Bacteria 6180594
1145 2585997707 2585427633 Bacteria 6413184
1146 2586002293 2585427634 Bacteria 6455027
1147 2599335043 2599185156 Bacteria 5403036
1148 2599603321 2599185210 Bacteria 5624189
1149 2600373303 2600254933 Bacteria 4750527
1150 2601610773 2600255279 Bacteria 5605316
1151 2601747547 2600255308 Bacteria 5611129
1152 2616296385 2615840624 Bacteria 6557588
1153 2616306800 2615840626 Bacteria 7921970
1154 2616557651 2615840698 Bacteria 7319877
1155 2617383319 2617270742 Bacteria 6808054
1156 2643813685 2643221558 Bacteria 5460675
1157 2643855015 2643221568 Bacteria 5187270
1158 2643882566 2643221574 Bacteria 2789653
1159 2643921412 2643221582 Bacteria 5804683
1160 2643964712 2643221591 Bacteria 4397626
1161 2644002396 2643221599 Bacteria 6292121
1162 2644051968 2643221607 Bacteria 6314006
1163 2644194895 2643221634 Bacteria 6705461
1164 2644209403 2643221637 Bacteria 5345260
1165 2644240576 2643221643 Bacteria 5749658
1166 2644299948 2643221653 Bacteria 4569637
1167 2644353598 2643221663 Bacteria 3425771
1168 2644484420 2643221686 Bacteria 6310811
1169 2644492429 2643221688 Bacteria 5260751
1170 2644499849 2643221689 Bacteria 6042950
1171 2644521465 2643221693 Bacteria 5513853
1172 2644652931 2643221718 Bacteria 5345506
1173 2644658175 2643221719 Bacteria 4568197
1174 2644677193 2643221723 Bacteria 7095460
1175 2644728610 2643221733 Bacteria 5690728
1176 2644736999 2643221734 Bacteria 5365412
1177 2644746155 2643221736 Bacteria 6608466
1178 2657682524 2657244999 Bacteria 5946535
1179 2671113546 2667528174 Bacteria 6435400
1180 2687579578 2687453129 Bacteria 4387428
1181 2692320205 2690316117 Bacteria 6800650
1182 2719182892 2718217882 Bacteria 6556348
1183 2719387587 2718217927 Bacteria 6972593
1184 2719667232 2718217997 Bacteria 6740740
1185 2719733609 2718218009 Bacteria 6478651
1186 2720493652 2718218199 Bacteria 6740745
1187 2720615106 2718218232 Bacteria 6720332
1188 2720621899 2718218233 Bacteria 6662049
1189 2720633249 2718218235 Bacteria 6630699
1190 2720776948 2718218269 Bacteria 6906114
1191 2721149004 2718218363 Bacteria 6524337
1192 2721160402 2718218365 Bacteria 6274507
1193 2721165817 2718218366 Bacteria 6425255
1194 2721401221 2718218423 Bacteria 6438183
1195 2722841987 2721755514 Bacteria 6424414
1196 2723028547 2721755556 Bacteria 6745503
1197 2723562149 2721755684 Bacteria 6859907
1198 2723568852 2721755685 Bacteria 6704835
1199 2724040035 2721755809 Bacteria 6438790
1200 2724046365 2721755810 Bacteria 6479005
1201 2724091555 2721755819 Bacteria 6906405
1202 2724106117 2721755822 Bacteria 6726041
1203 2724111923 2721755823 Bacteria 6752556
1204 2725947421 2724679232 Bacteria 7646494
1205 2730109483 2728369352 Bacteria 6745171
1206 2730166127 2728369365 Bacteria 6555560
1207 2730300034 2728369397 Bacteria 6274511
1208 2738805369 2738541293 Bacteria 7065685
1209 2739037182 2738541333 Bacteria 7106503
1210 2739349755 2738543031 Bacteria 5769731
1211 2753360434 2751185800 Bacteria 5467370
1212 2753463712 2751185821 Bacteria 6189929
1213 2757570306 2757320392 Bacteria 3737298
1214 2758642872 2758568016 Bacteria 5645291
1215 2765465711 2765235802 Bacteria 5618596
1216 2766064387 2765235942 Bacteria 7445910
1217 2770198334 2767802442 Bacteria 5747986
1218 2774871762 2773857925 Bacteria 6472445
1219 2776257724 2775506901 Bacteria 9631051
1220 2776269584 2775506902 Bacteria 6208009
1221 2776282515 2775506904 Bacteria 5954060
1222 2776915409 2775507049 Bacteria 6284736
1223 2778173682 2775507266 Bacteria 7392367
1224 2792582125 2791355082 Bacteria 5973319
1225 2792641343 2791355094 Bacteria 7011481
1226 2793281096 2791355253 Bacteria 5171699
1227 2793295706 2791355256 Bacteria 6798008
1228 2793313467 2791355259 Bacteria 7254731
1229 2793320641 2791355260 Bacteria 6598818
1230 2793327207 2791355261 Bacteria 6661293
1231 2793332158 2791355262 Bacteria 6774204
1232 2793338726 2791355263 Bacteria 6872478
1233 2793346529 2791355264 Bacteria 6429314
1234 2793353937 2791355265 Bacteria 6539969
1235 2793359469 2791355266 Bacteria 7116587
1236 2793365828 2791355267 Bacteria 7222458
1237 2802717349 2802428858 Bacteria 6636079
1238 2802724662 2802428859 Bacteria 6667919
1239 2802729414 2802428860 Bacteria 6525526
1240 2802736759 2802428861 Bacteria 6534206
1241 2802743165 2802428862 Bacteria 6633353
1242 2802749709 2802428863 Bacteria 6410669
1243 2804753585 2802429268 Bacteria 6094027
1244 2805926137 2802429605 Bacteria 6875453
1245 2805937164 2802429606 Bacteria 6346811
1246 2806047273 2802429633 Bacteria 7341974
1247 2806054137 2802429634 Bacteria 7083200
1248 2806060279 2802429635 Bacteria 7650140
1249 2806068899 2802429636 Bacteria 7597525
1250 2806077158 2802429637 Bacteria 7067217
1251 2808988289 2808606387 Bacteria 5697198
1252 2819244732 2818991272 Bacteria 4622173
1253 2819560897 2818991439 Bacteria 6907412
1254 2819611172 2818991448 Bacteria 6772224
1255 2819638894 2818991453 Bacteria 7181617
1256 2819687080 2818991461 Bacteria 7026071
1257 2835315683 2835312727 Bacteria 7413381
1258 2837651240 2837651117 Bacteria 3772164
1259 2837680377 2837678835 Bacteria 5252418
1260 2838018410 2838016132 Bacteria 6577831
1261 2838024091 2838022645 Bacteria 6494267
1262 2838030864 2838029111 Bacteria 6603031
1263 2838048395 2838042994 Bacteria 6046894
1264 2838050728 2838048938 Bacteria 6044578
1265 2838062494 2838061910 Bacteria 6794874
1266 2838072045 2838068647 Bacteria 6208656
1267 2838078278 2838074704 Bacteria 6785777
1268 2838672893 2838668709 Bacteria 6671819
1269 2838678740 2838675328 Bacteria 4909118
1270 2838690169 2838686498 Bacteria 7807632
1271 2838705629 2838701080 Bacteria 6669771
1272 2838718171 2838714209 Bacteria 5525906
1273 2838723037 2838719591 Bacteria 5523910
1274 2838728238 2838724970 Bacteria 4908691
1275 2838731944 2838729681 Bacteria 7400765
1276 2838741666 2838736955 Bacteria 5760694
1277 2838744840 2838742623 Bacteria 7396178
1278 2839993354 2839993093 Bacteria 5512535
1279 2840766357 2840764183 Bacteria 6358399
1280 2841766102 2841760612 Bacteria 6454112
1281 2841845500 2841840854 Bacteria 5761912
1282 2841850593 2841846520 Bacteria 5345850
1283 2841855897 2841851746 Bacteria 7532261
1284 2841863154 2841859092 Bacteria 5436171
1285 2841867835 2841864319 Bacteria 6742987
1286 2841911441 2841911363 Bacteria 6173697
1287 2841917904 2841917233 Bacteria 6173500
1288 2842116347 2842110456 Bacteria 7656360
1289 2842128897 2842124991 Bacteria 5346824
1290 2842133632 2842130223 Bacteria 4909145
1291 2842145203 2842140634 Bacteria 5759631
1292 2842149959 2842146304 Bacteria 5957337
1293 2842155456 2842152218 Bacteria 4908957
1294 2842161067 2842156927 Bacteria 6894975
1295 2842166585 2842163707 Bacteria 6916235
1296 2842174587 2842170452 Bacteria 5525737
1297 2842179246 2842175837 Bacteria 4908771
1298 2842184683 2842180545 Bacteria 6888678
1299 2842190595 2842187318 Bacteria 5524014
1300 2842194962 2842192696 Bacteria 6147454
1301 2842201685 2842198810 Bacteria 6608673
1302 2842207342 2842205361 Bacteria 6340321
1303 2842215081 2842211629 Bacteria 5523832
1304 2842223358 2842217011 Bacteria 7497767
1305 2842227802 2842224351 Bacteria 5524473
1306 2842232266 2842229732 Bacteria 7475766
1307 2842246681 2842243621 Bacteria 7421798
1308 2842255309 2842250916 Bacteria 6579627
1309 2842261217 2842257432 Bacteria 7401195
1310 2842269560 2842264693 Bacteria 6472963
1311 2842274189 2842271015 Bacteria 7807131
1312 2842280947 2842278818 Bacteria 6340002
1313 2842288437 2842285085 Bacteria 6011953
1314 2842300352 2842298080 Bacteria 6123127
1315 2842305952 2842304105 Bacteria 7023636
1316 2842311333 2842311132 Bacteria 6616990
1317 2842321032 2842317721 Bacteria 6793725
1318 2842346658 2842341865 Bacteria 7003929
1319 2842361131 2842357229 Bacteria 6485165
1320 2842366349 2842363717 Bacteria 6844742
1321 2842396034 2842395702 Bacteria 6780583
1322 2842406217 2842402390 Bacteria 6681310
1323 2842412802 2842409023 Bacteria 6687331
1324 2842419319 2842415677 Bacteria 6596907
1325 2842425677 2842422224 Bacteria 6239196
1326 2842433518 2842428310 Bacteria 6767288
1327 2842439846 2842434925 Bacteria 6502746
1328 2842446475 2842441272 Bacteria 6769273
1329 2842448858 2842447887 Bacteria 6754142
1330 2842467851 2842462802 Bacteria 6588055
1331 2842474455 2842469257 Bacteria 6752936
1332 2842477596 2842475841 Bacteria 6603183
1333 2842487965 2842482326 Bacteria 7212537
1334 2842491084 2842489311 Bacteria 6620893
1335 2842498422 2842495871 Bacteria 6820686
1336 2842504531 2842502639 Bacteria 6604161
1337 2842511781 2842509118 Bacteria 6850950
1338 2842520108 2842515876 Bacteria 5436280
1339 2842524410 2842521101 Bacteria 6569494
1340 2842696183 2842694124 Bacteria 4063419
1341 2842873972 2842871566 Bacteria 4827117
1342 2842926232 2842922631 Bacteria 5824079
1343 2844105868 2844104063 Bacteria 6440972
1344 2844457133 2844454524 Bacteria 7952546
1345 2847420719 2847417321 Bacteria 6913799
1346 2848995550 2848992105 Bacteria 6810864
1347 2850082530 2850079185 Bacteria 6848280
1348 2851186367 2851182111 Bacteria 6047226
1349 2851246224 2851246043 Bacteria 6439203
1350 2852391626 2852387548 Bacteria 8025568
1351 2854897055 2854896431 Bacteria 5869725
1352 2854913647 2854911287 Bacteria 5582813
1353 2854917201 2854916844 Bacteria 5725939
1354 2855827262 2855825444 Bacteria 6785811
1355 2855842644 2855839649 Bacteria 7135830
1356 2855878077 2855872281 Bacteria 6964271
1357 2857521074 2857516855 Bacteria 7787325
1358 2858803455 2858800743 Bacteria 6603254
1359 2882457198 2882456835 Bacteria 6863978
1360 2885427531 2885427238 Bacteria 2291351
1361 2889306899 2889306138 Bacteria 6358934
1362 2889793309 2889790730 Bacteria 5689708
1363 2889917441 2889914905 Bacteria 5702301
1364 2891373834 2891373044 Bacteria 5202277
1365 2894242829 2894232714 Bacteria 8834183
1366 2894653774 2894652903 Bacteria 4587256
1367 2894821049 2894817345 Bacteria 4892941
1368 2896387981 2896384573 Bacteria 7700774
1369 2899795253 2899792073 Bacteria 4926588
1370 2899849233 2899845264 Bacteria 5672268
1371 2902336507 2902330777 Bacteria 6395352
1372 2902411608 2902405164 Bacteria 6784948
1373 2904579997 2904578770 Bacteria 5302906
1374 2913300063 2913295892 Bacteria 6333755
1375 2915650529 2915650412 Bacteria 4288180
1376 2915982564 2915980308 Bacteria 6624279
1377 2915991158 2915986958 Bacteria 6739310
1378 2916000259 2915993759 Bacteria 7016183
1379 2916007203 2916000859 Bacteria 6865702
1380 2916014629 2916007675 Bacteria 6898660
1381 2916019699 2916014648 Bacteria 6946486
1382 2916026725 2916021584 Bacteria 6854472
1383 2916033544 2916028427 Bacteria 6748433
1384 2916039650 2916035215 Bacteria 6755766
1385 2916047010 2916041962 Bacteria 6820487
1386 2916052827 2916048683 Bacteria 6543552
1387 2916059539 2916055098 Bacteria 6758838
1388 2916065148 2916061851 Bacteria 6737736
1389 2916069469 2916068649 Bacteria 6943657
1390 2916078063 2916076590 Bacteria 6596108
1391 2917704205 2917699015 Bacteria 7043791
1392 2919105314 2919100787 Bacteria 7710546
1393 2919118571 2919114240 Bacteria 5700270
1394 2919120332 2919119836 Bacteria 5208557
1395 2919170651 2919166419 Bacteria 4952238
1396 2919410996 2919408235 Bacteria 6149349
1397 2920760459 2920760137 Bacteria 7427611
1398 2920825832 2920822456 Bacteria 6897201
1399 2921202502 2921201388 Bacteria 6926299
1400 2921210381 2921208531 Bacteria 6745326
1401 2921244022 2921237296 Bacteria 6876710
1402 2921248733 2921244191 Bacteria 6568419
1403 2921254675 2921250672 Bacteria 6677771
1404 2921262122 2921257292 Bacteria 6808382
1405 2921270668 2921263974 Bacteria 6864552
1406 2921288805 2921282425 Bacteria 6826397
1407 2921296346 2921289301 Bacteria 7316391
1408 2921298095 2921296804 Bacteria 7176999
1409 2923559565 2923556063 Bacteria 6793593
1410 2924147732 2924144063 Bacteria 6883928
1411 2924156439 2924150972 Bacteria 7169444
1412 2924160191 2924158325 Bacteria 7188855
1413 2924170227 2924165586 Bacteria 7260590
1414 2924177609 2924172951 Bacteria 6749356
1415 2924186288 2924179722 Bacteria 6843264
1416 2924191574 2924186466 Bacteria 6876637
1417 2924195246 2924193448 Bacteria 6955718
1418 2924204803 2924200457 Bacteria 6757188
1419 2924209363 2924207177 Bacteria 6917007
1420 2924228785 2924221636 Bacteria 7113495
1421 2924234387 2924228884 Bacteria 6633132
1422 2926755101 2926754445 Bacteria 5964435
1423 2926762261 2926760298 Bacteria 5505990
1424 2928522793 2928521798 Bacteria 4960112
1425 2928973499 2928972540 Bacteria 3058286
1426 2929141797 2929138655 Bacteria 5810547
1427 2932402257 2932401849 Bacteria 4262978
1428 2933010694 2933006813 Bacteria 4912075
1429 2933015632 2933011516 Bacteria 5439334
1430 2933572457 2933570622 Bacteria 7023390
1431 2933592563 2933586486 Bacteria 7667493
1432 2933597627 2933594066 Bacteria 5594265
1433 2933603102 2933599457 Bacteria 5858799
1434 2935903744 2935901341 Bacteria 7341747
1435 2936369802 2936367885 Bacteria 7324495
1436 2936378990 2936375103 Bacteria 6652732
1437 2936382036 2936381700 Bacteria 7006523
1438 2936997580 2936996657 Bacteria 6298727
1439 2937007589 2937002841 Bacteria 6934057
1440 2937013965 2937009748 Bacteria 6746052
1441 2937020903 2937016420 Bacteria 6782579
1442 2937024762 2937023124 Bacteria 6815156
1443 2937033311 2937029754 Bacteria 6424026
1444 2937036077 2937036028 Bacteria 6846469
1445 2937049248 2937042894 Bacteria 6741576
1446 2937056132 2937049772 Bacteria 6757901
1447 2937061416 2937056579 Bacteria 7107896
1448 2937069211 2937063883 Bacteria 7199456
1449 2937076315 2937071275 Bacteria 6984483
1450 2937082363 2937078374 Bacteria 6610289
1451 2937085874 2937084907 Bacteria 6618516
1452 2937097275 2937091812 Bacteria 6979387
1453 2937106245 2937098957 Bacteria 7249374
1454 2937106977 2937106411 Bacteria 6947143
1455 2937118172 2937113482 Bacteria 6505872
1456 2937121750 2937119839 Bacteria 6597547
1457 2937127845 2937126314 Bacteria 6771275
1458 2941487954 2941485952 Bacteria 3591484
1459 2941501246 2941499720 Bacteria 7599444
1460 2952253441 2952252522 Bacteria 4171745
1461 2954013841 2954011201 Bacteria 4762601
1462 2957378883 2957375807 Bacteria 6425588
1463 2957383845 2957382221 Bacteria 6737050
1464 2957391487 2957388812 Bacteria 6778072
1465 2957400537 2957395598 Bacteria 6822399
1466 2957403952 2957402308 Bacteria 6741770
1467 2957409861 2957408893 Bacteria 6558585
1468 2957420540 2957415311 Bacteria 6991633
1469 2957424476 2957422303 Bacteria 7172205
1470 2957435953 2957430029 Bacteria 7022557
1471 2957439738 2957437181 Bacteria 6568994
1472 2957449069 2957443900 Bacteria 6869977
1473 2957456768 2957450854 Bacteria 6765715
1474 2957462790 2957457609 Bacteria 6967680
1475 2957467508 2957464669 Bacteria 6568877
1476 2957477451 2957471148 Bacteria 6797643
1477 2957482488 2957478035 Bacteria 6756658
1478 2957485137 2957484790 Bacteria 6703082
1479 2957497294 2957491536 Bacteria 6695180
1480 2957504669 2957498199 Bacteria 7126688
1481 2957510707 2957505466 Bacteria 7253085
1482 2960584325 2960584000 Bacteria 6864594
1483 2960594961 2960591022 Bacteria 6622873
1484 2960599381 2960597568 Bacteria 6550735
1485 2960609051 2960603979 Bacteria 6898737
1486 2960612164 2960610863 Bacteria 6691244
1487 2960618183 2960617483 Bacteria 6727748
1488 2960629926 2960624210 Bacteria 6875384
1489 2960634747 2960631154 Bacteria 6732508
1490 2960638282 2960637947 Bacteria 7296468
1491 2960650751 2960645483 Bacteria 7211087
1492 2960655409 2960652885 Bacteria 7083688
1493 2960665730 2960660292 Bacteria 7041660
1494 2960672042 2960667422 Bacteria 6763020
1495 2960678011 2960674078 Bacteria 6609048
1496 2960684294 2960680706 Bacteria 6624464
1497 2960693689 2960687367 Bacteria 6535474
1498 2960696672 2960693952 Bacteria 6749742
1499 2964609646 2964607997 Bacteria 7101408
1500 2964619698 2964615318 Bacteria 6809089
1501 2964626228 2964621998 Bacteria 6834995
1502 2964630467 2964628898 Bacteria 7083044
1503 2964636452 2964636051 Bacteria 7091832
1504 2964645261 2964643177 Bacteria 6820887
1505 2964652702 2964649959 Bacteria 6675118
1506 2964662342 2964656573 Bacteria 7100150
1507 2964666255 2964663802 Bacteria 7019362
1508 2964672773 2964670856 Bacteria 6851364
1509 2964678270 2964678106 Bacteria 6792020
1510 2964691424 2964685014 Bacteria 6839111
1511 2964696569 2964691889 Bacteria 6802758
1512 2964702194 2964698721 Bacteria 6765331
1513 2964712474 2964705432 Bacteria 7114648
1514 2964712907 2964712639 Bacteria 6695970
1515 2964720238 2964719344 Bacteria 7286602
1516 2967670997 2967664464 Bacteria 6948836
1517 2967672025 2967671571 Bacteria 7021409
1518 2967684866 2967678726 Bacteria 7264382
1519 2967689155 2967686174 Bacteria 6678622
1520 2967695496 2967693043 Bacteria 6804451
1521 2967705888 2967699805 Bacteria 6854538
1522 2967713913 2967706974 Bacteria 7186053
1523 2967719105 2967714385 Bacteria 7000047
1524 2967727150 2967721400 Bacteria 7073753
1525 2967731946 2967728569 Bacteria 6641507
1526 2967736790 2967735183 Bacteria 6827012
1527 2967744112 2967742019 Bacteria 6794534
1528 2967749894 2967748971 Bacteria 6733771
1529 2967756278 2967755722 Bacteria 6814706
1530 2967768620 2967762386 Bacteria 6923502
1531 2967773798 2967769361 Bacteria 6587838
1532 2967778523 2967775926 Bacteria 6738189
1533 2970026280 2970019648 Bacteria 7072033
1534 2970029942 2970026789 Bacteria 6785236
1535 2970038844 2970033650 Bacteria 7118744
1536 2970045689 2970040964 Bacteria 6731123
1537 2970052374 2970047711 Bacteria 7088379
1538 2970059723 2970054988 Bacteria 6611507
1539 2970062306 2970061556 Bacteria 7099761
1540 2970075601 2970068827 Bacteria 7123112
1541 2970081672 2970076120 Bacteria 6697332
1542 2970086391 2970082768 Bacteria 6183754
1543 2970093957 2970088815 Bacteria 6933825
1544 2970101808 2970095765 Bacteria 6936963
1545 2970106869 2970102677 Bacteria 6812532
1546 2970111451 2970109326 Bacteria 6863976
1547 2970121504 2970116247 Bacteria 6501857
1548 2970125872 2970122695 Bacteria 6625855
1549 2970131905 2970129317 Bacteria 6806560
1550 2970138139 2970136068 Bacteria 7207982
1551 2970143737 2970143518 Bacteria 6446480
1552 2970154412 2970149975 Bacteria 6779706
1553 2970157576 2970156795 Bacteria 7168044
1554 2970168929 2970164137 Bacteria 6861252
1555 2970176833 2970170962 Bacteria 6876229
1556 2970180212 2970177841 Bacteria 6768001
1557 2970189610 2970184632 Bacteria 7054431
1558 2970196889 2970191845 Bacteria 7032787
1559 2977240523 2977240413 Bacteria 3191065
1560 2977522962 2977516862 Bacteria 6940108
1561 2977524521 2977523885 Bacteria 6960446
1562 2977534661 2977530762 Bacteria 6951399
1563 2977542360 2977537788 Bacteria 6929320
1564 2977551418 2977544691 Bacteria 6875412
1565 2977553318 2977551784 Bacteria 7125765
1566 2977565502 2977558990 Bacteria 6863948
1567 2977569287 2977565890 Bacteria 6901543
1568 2977579198 2977572785 Bacteria 6763888
1569 2977585471 2977579622 Bacteria 6772100
1570 2978972539 2978969890 Bacteria 5400756
1571 2979092469 2979089926 Bacteria 5670289
1572 2979100140 2979095461 Bacteria 5669583
1573 2979104440 2979100975 Bacteria 5423623
1574 2984513764 2984509177 Bacteria 5274802
1575 2984522658 2984518228 Bacteria 5277463
1576 2984541964 2984537506 Bacteria 5277481
1577 2984590792 2984587000 Bacteria 5263363
1578 2984601394 2984601300 Bacteria 5455244
1579 2989354825 2989349275 Bacteria 6349068
1580 2989771481 2989771324 Bacteria 5605128
1581 2989780010 2989776772 Bacteria 4843317
1582 2996895208 2996893221 Bacteria 5823108
1583 3003930908 3003930520 Bacteria 5667563
1584 3005409563 3005409236 Bacteria 7188837
1585 3005421693 3005416602 Bacteria 7064308
1586 3005449586 3005445848 Bacteria 6906074
1587 3005455867 3005452660 Bacteria 5889319
1588 639650318 639633055 Bacteria 7751309
1589 641642391 641522639 Bacteria 7737025
1590 648737084 648276728 Bacteria 6968865
1591 650741101 650716007 Bacteria 5573770
1592 8003403410 8003400568 Bacteria 5535898
1593 8003573841 8003570095 Bacteria 5747666
1594 8003995226 8003992118 Bacteria 7266902
1595 8004002944 8003999396 Bacteria 7063185
1596 8005249154 8005246636 Bacteria 4933972
1597 8005282341 8005275841 Bacteria 6929066
1598 8005286828 8005282627 Bacteria 6675747
1599 8005295010 8005289223 Bacteria 6634003
1600 8005305889 8005301065 Bacteria 6614431
1601 8005313590 8005307578 Bacteria 7395396
1602 8005319603 8005314921 Bacteria 7072929
1603 8005381653 8005376324 Bacteria 6590079
1604 8005387848 8005382845 Bacteria 6732062
1605 8005400884 8005395548 Bacteria 6806915
1606 8005431027 8005430974 Bacteria 6689030
1607 8005465010 8005460587 Bacteria 7157962
1608 8005490225 8005484373 Bacteria 6297373
1609 8005497595 8005497431 Bacteria 6477605
1610 8005546594 8005542996 Bacteria 7077758
1611 8005561051 8005556819 Bacteria 6908598
1612 8005565677 8005563573 Bacteria 7153261
1613 8005571748 8005570704 Bacteria 6957481
1614 8005623328 8005619151 Bacteria 7030230
1615 8005631092 8005626139 Bacteria 6534237
1616 8005646882 8005645114 Bacteria 6950293
1617 8005660741 8005658619 Bacteria 4500593
1618 8005669000 8005668836 Bacteria 6953162
1619 8005688056 8005682033 Bacteria 6726518
1620 8005694414 8005688590 Bacteria 6610080
1621 8005695643 8005695170 Bacteria 6912330
1622 8018128837 8018127388 Bacteria 7351159
1623 8018155132 8018150411 Bacteria 5549903
1624 8018165212 8018163183 Bacteria 7277977
1625 8018177070 8018176218 Bacteria 6896178
1626 8023686428 8023680758 Bacteria 7729763
1627 8024484284 8024479707 Bacteria 6954785
1628 8024490781 8024486573 Bacteria 6540512
1629 8024502404 8024501048 Bacteria 6427847
1630 8045868993 8045864390 Bacteria 5043873
1631 8046768099 8046767195 Bacteria 7547379
1632 8049296154 8049293176 Bacteria 6128433
1633 8054463701 8054460903 Bacteria 4872905
1634 8054560161 8054558443 Bacteria 5204801
1635 8055435622 8055431914 Bacteria 4551896
1636 8056380337 8056375014 Bacteria 7006639
1637 8056383873 8056382006 Bacteria 6408074
1638 8056878170 8056875544 Bacteria 4355797
1639 8057161276 8057160832 Bacteria 3268302
1640 8057531551 8057529695 Bacteria 6306553
1641 8057581541 8057575449 Bacteria 7367519
1642 Ga0439465_0104021
1643 JGI24736J21556_1005675
1644 JGI24740J21852_10006819
1645 JGI24740J21852_10015888
1646 JGI24739J22299_10001619
1647 JGI24737J22298_10000011
1648 JGI24737J22298_10021292
1649 JGI24737J22298_10044655
1650 JGI24743J22301_10021546
1651 JGI24735J21928_10020080
1652 JGI24735J21928_10042315
1653 JGI24738J21930_10013531
1654 JGI24738J21930_10015919
1655 JGI24744J21845_10001141
1656 JGI25152J39213_1022201
1657 JGI25150J39212_1000037
1658 JGI25150J39212_1000166
1659 JGI25150J39212_1015167
1660 JGI25159J45721_1000053
1661 JGI25159J45721_1001774
1662 JGI25151J46595_10001088
1663 JGI25151J46595_10036151
1664 JGI25151J46595_10039658
1665 JGI25153J46596_10005207
1666 JGI25153J46596_10010307
1667 JGI25160J50197_1000168
1668 JGI25160J50197_1000401
1669 JGI25160J50197_1003063
1670 JGI25161J50226_1000137
1671 JGI25161J50226_1001074
1672 Ga0006562J51391_1007307
1673 JGI25404J52841_10015385
1674 Ga0055542_1003610
1675 Ga0055529_1007007
1676 Ga0055526_1002810
1677 Ga0055526_1012561
1678 Ga0055526_1013430
1679 Ga0055526_1027399
1680 Ga0055524_1002041
1681 Ga0055524_1003213
1682 Ga0055524_1006675
1683 Ga0055524_1021290
1684 Ga0055524_1022932
1685 Ga0055536_1002589
1686 Ga0055536_1003952
1687 Ga0055528_1002391
1688 Ga0055528_1005252
1689 Ga0055530_10007487
1690 Ga0055540_1002246
1691 Ga0055540_1003538
1692 Ga0058692_1002874
1693 Ga0055543_1000321
1694 Ga0055543_1000412
1695 Ga0055543_1010130
1696 Ga0065165_1000133
1697 Ga0065165_1005095
1698 Ga0065712_10112331
1699 Ga0065715_10108239
1700 Ga0070658_10000013
1701 Ga0070658_10000496
1702 Ga0070658_10000877
1703 Ga0070658_10010544
1704 Ga0070658_10021906
1705 Ga0070658_10034231
1706 Ga0070658_10075736
1707 Ga0070658_10094549
1708 Ga0070658_10110946
1709 Ga0070658_10127678
1710 Ga0070658_10213983
1711 Ga0070676_10020952
1712 Ga0070676_10079603
1713 Ga0070683_100013062
1714 Ga0070683_100032926
1715 Ga0070683_100035079
1716 Ga0070670_100022214
1717 Ga0070670_100039178
1718 Ga0070670_100245911
1719 Ga0068869_100000304
1720 Ga0068869_100038708
1721 Ga0068869_100076772
1722 Ga0070666_10030363
1723 Ga0070680_100000717
1724 Ga0070680_100004343
1725 Ga0070680_100006159
1726 Ga0070680_100108293
1727 Ga0070680_100150077
1728 Ga0070682_100108088
1729 Ga0068868_100000003
1730 Ga0070660_100000024
1731 Ga0070660_100000043
1732 Ga0070660_100000688
1733 Ga0070660_100003447
1734 Ga0070660_100007819
1735 Ga0070660_100018225
1736 Ga0070660_100018756
1737 Ga0070660_100022376
1738 Ga0070660_100059012
1739 Ga0070660_100063220
1740 Ga0070660_100091671
1741 Ga0070660_100431740
1742 Ga0070691_10000453
1743 Ga0070661_100000222
1744 Ga0070661_100029590
1745 Ga0070661_100100324
1746 Ga0070668_100001661
1747 Ga0070668_100044062
1748 Ga0070668_100082309
1749 Ga0070669_100058352
1750 Ga0070669_100087908
1751 Ga0070669_100298226
1752 Ga0070675_100039469
1753 Ga0070675_100050555
1754 Ga0070675_100069921
1755 Ga0070671_100006859
1756 Ga0070671_100009179
1757 Ga0070671_100029197
1758 Ga0070671_100152128
1759 Ga0070674_100103372
1760 Ga0070673_100000008
1761 Ga0070673_100516727
1762 Ga0070659_100001101
1763 Ga0070659_100015615
1764 Ga0070659_100016397
1765 Ga0070659_100038982
1766 Ga0070659_100042549
1767 Ga0070659_100132331
1768 Ga0070659_100144824
1769 Ga0070659_100187363
1770 Ga0070659_100352796
1771 Ga0070667_100050486
1772 Ga0070667_100087748
1773 Ga0070667_100098563
1774 Ga0070667_100113036
1775 Ga0070667_100240476
1776 Ga0070667_100401031
1777 Ga0070709_10062932
1778 Ga0070714_100051049
1779 Ga0070713_100204449
1780 Ga0070711_100337227
1781 Ga0070694_100004336
1782 Ga0070663_100004718
1783 Ga0070663_100095587
1784 Ga0070663_100329921
1785 Ga0070678_100004243
1786 Ga0070678_100051010
1787 Ga0070678_100145383
1788 Ga0070678_100161933
1789 Ga0070662_100005905
1790 Ga0070662_100012171
1791 Ga0070662_100037700
1792 Ga0070662_100085967
1793 Ga0070662_100251921
1794 Ga0070681_10035926
1795 Ga0070681_10057374
1796 Ga0070681_10086993
1797 Ga0068867_100000003
1798 Ga0068867_100010880
1799 Ga0068867_100034948
1800 Ga0070698_100037255
1801 Ga0070679_100000001
1802 Ga0070679_100056354
1803 Ga0070679_100099110
1804 Ga0070684_100001796
1805 Ga0070684_100003281
1806 Ga0068853_100001903
1807 Ga0068853_100034661
1808 Ga0068853_100045661
1809 Ga0068853_100049574
1810 Ga0068853_100103953
1811 Ga0068853_100361269
1812 Ga0070672_100014210
1813 Ga0070672_100033962
1814 Ga0070672_100102087
1815 Ga0070672_100145401
1816 Ga0070696_100012851
1817 Ga0070696_100026650
1818 Ga0070665_100000157
1819 Ga0070665_100001220
1820 Ga0070665_100007394
1821 Ga0070665_100024562
1822 Ga0070665_100038358
1823 Ga0070665_100130758
1824 Ga0070665_100178349
1825 Ga0070704_100455059
1826 Ga0068855_100000292
1827 Ga0068855_100000775
1828 Ga0068855_100009958
1829 Ga0068855_100036156
1830 Ga0068855_100083901
1831 Ga0068855_100089369
1832 Ga0068855_100146040
1833 Ga0068855_100267089
1834 Ga0068855_100387039
1835 Ga0068855_100461588
1836 Ga0070664_100001794
1837 Ga0070664_100011587
1838 Ga0070664_100093319
1839 Ga0070664_100186865
1840 Ga0068857_100000315
1841 Ga0068857_100015553
1842 Ga0068857_100018103
1843 Ga0068857_100022353
1844 Ga0068857_100048518
1845 Ga0068857_100079144
1846 Ga0068857_100222964
1847 Ga0068854_100000580
1848 Ga0068854_100014030
1849 Ga0068856_100021339
1850 Ga0068856_100057360
1851 Ga0068856_100087214
1852 Ga0068856_100167670
1853 Ga0068856_100216111
1854 Ga0068856_100223238
1855 Ga0068856_100234514
1856 Ga0068852_100018675
1857 Ga0068852_100028215
1858 Ga0068852_100050217
1859 Ga0068852_100098230
1860 Ga0068852_100630221
1861 Ga0068859_100055560
1862 Ga0068859_100145190
1863 Ga0068859_100206632
1864 Ga0068864_100117537
1865 Ga0068864_100159161
1866 Ga0068863_100005102
1867 Ga0068863_100017559
1868 Ga0068863_100018723
1869 Ga0068863_100061105
1870 Ga0068860_100009476
1871 Ga0068860_100067462
1872 Ga0068860_100068354
1873 Ga0068860_100264386
1874 Ga0068862_100024314
1875 Ga0068862_100139568
1876 Ga0068862_100642694
1877 Ga0081540_1000191
1878 Ga0081539_10005453
1879 Ga0075365_10006550
1880 Ga0075365_10060552
1881 Ga0075365_10066784
1882 Ga0075368_10009715
1883 Ga0075363_100052967
1884 Ga0075364_10000195
1885 Ga0075364_10006289
1886 Ga0070715_10033869
1887 Ga0070716_100255235
1888 Ga0070712_100037236
1889 Ga0070712_100259257
1890 Ga0075362_10005902
1891 Ga0075367_10023004
1892 Ga0075367_10068048
1893 Ga0075369_10023210
1894 Ga0075369_10049112
1895 Ga0075369_10151184
1896 Ga0075366_10005542
1897 Ga0075366_10041318
1898 Ga0097621_100048846
1899 Ga0097621_100139391
1900 Ga0097621_100180350
1901 Ga0075370_10027037
1902 Ga0075370_10071843
1903 Ga0075370_10140512
1904 Ga0075370_10166313
1905 Ga0068871_100246863
1906 Ga0068871_100326794
1907 Ga0075433_10090355
1908 Ga0075434_100021786
1909 Ga0068865_100000002
1910 Ga0097620_100055558
1911 Ga0097620_100145200
1912 Ga0097620_100206643
1913 Ga0099826_10002340
1914 Ga0075435_100052467
1915 Ga0105251_10041925
1916 Ga0105240_10029449
1917 Ga0105240_10036499
1918 Ga0111539_10024579
1919 Ga0105245_10000060
1920 Ga0105243_10000031
1921 Ga0105242_10003359
1922 Ga0105242_10188358
1923 Ga0105248_10001711
1924 Ga0105248_10008016
1925 Ga0105248_10206954
1926 Ga0105248_10591262
1927 Ga0105237_10039295
1928 Ga0105238_10064109
1929 Ga0105238_10094550
1930 Ga0105249_10009802
1931 Ga0105249_10011175
1932 Ga0123340_1061837
1933 Ga0123341_1000009
1934 Ga0123341_1032128
1935 Ga0123342_1007031
1936 Ga0123342_1022906
1937 Ga0105239_10239706
1938 Ga0105246_10080315
1939 Ga0157373_10025617
1940 Ga0157373_10028164
1941 Ga0157373_10033059
1942 Ga0157373_10084069
1943 Ga0157373_10091637
1944 Ga0157373_10128667
1945 Ga0157373_10173948
1946 Ga0157371_10000108
1947 Ga0157371_10007070
1948 Ga0157371_10428545
1949 Ga0157370_10000720
1950 Ga0157370_10006359
1951 Ga0157370_10444802
1952 Ga0157370_10499872
1953 Ga0157369_10017281
1954 Ga0157369_10026069
1955 Ga0157369_10044322
1956 Ga0157369_10172969
1957 Ga0157369_10217847
1958 Ga0157369_10308314
1959 Ga0171463_1004
1960 Ga0157374_10103056
1961 Ga0157378_10001613
1962 Ga0157378_10003693
1963 Ga0163162_10261248
1964 Ga0157372_10731912
1965 Ga0163163_10021100
1966 Ga0163163_10317594
1967 Ga0182008_10138971
1968 Ga0157377_10012384
1969 Ga0157379_10119387
1970 Ga0157376_10000107
1971 Ga0183363_1287
1972 Ga0163161_10281768
1973 Ga0206353_11380738
1974 Ga0214544_1000010
1975 Ga0214542_1000023
1976 Ga0214543_1000019
1977 Ga0213873_10000017
1978 Ga0213872_10111290
1979 Ga0213876_10000071
1980 Ga0213876_10000692
1981 Ga0213876_10025158
1982 Ga0228598_1001030
1983 Ga0228598_1006720
1984 Ga0209436_106726
1985 Ga0209563_102292
1986 Ga0207425_1000034
1987 Ga0207425_1001521
1988 Ga0207425_1012395
1989 Ga0209148_1000112
1990 Ga0209148_1004789
1991 Ga0209148_1004802
1992 Ga0209129_1000094
1993 Ga0209129_1000118
1994 Ga0209129_1001625
1995 Ga0209129_1002893
1996 Ga0209129_1007832
1997 Ga0209129_1008145
1998 Ga0209455_1000347
1999 Ga0209673_1000033
2000 Ga0209673_1000052
2001 Ga0209673_1000459
2002 Ga0209673_1002376
2003 Ga0209673_1002990
2004 Ga0209673_1004965
2005 Ga0209130_1000009
2006 Ga0209130_1000027
2007 Ga0209675_1021639
2008 Ga0209676_1001384
2009 Ga0209676_1006231
2010 Ga0209025_1000184
2011 Ga0209025_1000241
2012 Ga0209025_1000245
2013 Ga0209025_1000765
2014 Ga0209025_1009149
2015 Ga0209025_1012677
2016 Ga0209025_1025313
2017 Ga0209025_1026884
2018 Ga0209025_1044051
2019 Ga0209564_1000031
2020 Ga0209564_1000111
2021 Ga0209564_1000569
2022 Ga0209564_1001292
2023 Ga0209564_1003155
2024 Ga0209564_1007729
2025 Ga0209758_1000159
2026 Ga0209758_1000323
2027 Ga0209758_1005301
2028 Ga0209758_1009330
2029 Ga0209758_1009555
2030 Ga0209758_1014923
2031 Ga0209758_1024440
2032 Ga0209050_1001966
2033 Ga0209050_1005083
2034 Ga0209050_1021945
2035 Ga0209256_1000132
2036 Ga0209256_1000361
2037 Ga0209256_1000510
2038 Ga0209256_1000762
2039 Ga0209256_1001681
2040 Ga0209256_1002153
2041 Ga0209256_1002516
2042 Ga0209256_1003192
2043 Ga0209256_1016623
2044 Ga0207426_1000041
2045 Ga0207426_1000072
2046 Ga0207426_1000595
2047 Ga0207426_1000723
2048 Ga0209051_1000561
2049 Ga0209051_1000871
2050 Ga0209051_1011343
2051 Ga0209051_1011825
2052 Ga0209051_1040535
2053 Ga0209257_1000989
2054 Ga0209257_1001613
2055 Ga0209257_1013913
2056 Ga0207697_10020216
2057 Ga0207656_10034669
2058 Ga0207682_10007236
2059 Ga0207682_10015663
2060 Ga0207642_10046017
2061 Ga0207688_10037733
2062 Ga0207680_10054522
2063 Ga0207647_10000203
2064 Ga0207647_10006191
2065 Ga0207647_10008623
2066 Ga0207647_10033796
2067 Ga0207647_10054896
2068 Ga0207647_10151579
2069 Ga0207699_10138314
2070 Ga0207699_10228646
2071 Ga0207645_10018160
2072 Ga0207645_10039623
2073 Ga0207645_10206183
2074 Ga0207643_10070298
2075 Ga0207643_10209865
2076 Ga0207705_10000002
2077 Ga0207705_10000238
2078 Ga0207705_10001215
2079 Ga0207705_10001455
2080 Ga0207705_10002699
2081 Ga0207705_10007647
2082 Ga0207705_10010693
2083 Ga0207705_10016317
2084 Ga0207705_10021247
2085 Ga0207705_10039357
2086 Ga0207705_10055660
2087 Ga0207705_10070879
2088 Ga0207705_10102733
2089 Ga0207705_10153529
2090 Ga0207705_10158885
2091 Ga0207705_10176592
2092 Ga0207707_10011740
2093 Ga0207707_10101598
2094 Ga0207707_10243957
2095 Ga0207707_10481642
2096 Ga0207695_10012312
2097 Ga0207695_10018522
2098 Ga0207695_10021564
2099 Ga0207695_10162253
2100 Ga0207671_10051830
2101 Ga0207693_10035507
2102 Ga0207660_10000372
2103 Ga0207660_10000472
2104 Ga0207660_10002158
2105 Ga0207660_10003625
2106 Ga0207660_10007649
2107 Ga0207660_10022658
2108 Ga0207660_10044133
2109 Ga0207660_10090679
2110 Ga0207660_10101123
2111 Ga0207657_10001648
2112 Ga0207657_10001718
2113 Ga0207657_10001725
2114 Ga0207657_10002408
2115 Ga0207657_10003729
2116 Ga0207657_10004043
2117 Ga0207657_10006306
2118 Ga0207657_10006994
2119 Ga0207657_10007295
2120 Ga0207657_10021945
2121 Ga0207657_10026478
2122 Ga0207657_10030264
2123 Ga0207657_10050361
2124 Ga0207657_10051544
2125 Ga0207657_10053962
2126 Ga0207657_10101267
2127 Ga0207649_10000218
2128 Ga0207649_10007281
2129 Ga0207649_10070914
2130 Ga0207652_10000003
2131 Ga0207652_10005251
2132 Ga0207652_10032826
2133 Ga0207681_10017186
2134 Ga0207681_10023695
2135 Ga0207681_10078652
2136 Ga0207681_10079573
2137 Ga0207694_10013615
2138 Ga0207694_10281725
2139 Ga0207650_10022175
2140 Ga0207650_10123375
2141 Ga0207659_10016014
2142 Ga0207659_10046222
2143 Ga0207659_10098301
2144 Ga0207687_10008578
2145 Ga0207664_10060683
2146 Ga0207664_10072522
2147 Ga0207644_10008606
2148 Ga0207644_10025390
2149 Ga0207644_10035573
2150 Ga0207644_10084803
2151 Ga0207644_10144074
2152 Ga0207644_10158317
2153 Ga0207690_10000436
2154 Ga0207690_10003780
2155 Ga0207690_10004309
2156 Ga0207690_10008895
2157 Ga0207690_10014921
2158 Ga0207690_10017012
2159 Ga0207690_10024988
2160 Ga0207690_10031819
2161 Ga0207690_10102013
2162 Ga0207690_10209797
2163 Ga0207706_10002142
2164 Ga0207706_10002499
2165 Ga0207706_10021154
2166 Ga0207706_10042941
2167 Ga0207706_10064780
2168 Ga0207706_10086218
2169 Ga0207706_10171179
2170 Ga0207706_10252037
2171 Ga0207706_10288267
2172 Ga0207686_10003536
2173 Ga0207709_10000122
2174 Ga0207709_10160089
2175 Ga0207669_10063574
2176 Ga0207669_10226467
2177 Ga0207704_10000003
2178 Ga0207665_10207231
2179 Ga0207665_10243083
2180 Ga0207691_10002983
2181 Ga0207691_10015632
2182 Ga0207691_10095628
2183 Ga0207691_10161158
2184 Ga0207691_10196869
2185 Ga0207691_10211527
2186 Ga0207711_10002983
2187 Ga0207711_10007983
2188 Ga0207711_10010233
2189 Ga0207711_10518400
2190 Ga0207689_10000125
2191 Ga0207689_10000135
2192 Ga0207689_10021419
2193 Ga0207689_10042943
2194 Ga0207689_10053228
2195 Ga0207689_10204216
2196 Ga0207661_10004111
2197 Ga0207661_10031889
2198 Ga0207661_10034010
2199 Ga0207661_10128655
2200 Ga0207679_10001651
2201 Ga0207679_10019071
2202 Ga0207679_10075726
2203 Ga0207679_10211897
2204 Ga0207679_10294438
2205 Ga0207667_10000007
2206 Ga0207667_10000576
2207 Ga0207667_10000670
2208 Ga0207667_10012721
2209 Ga0207667_10019976
2210 Ga0207667_10056946
2211 Ga0207667_10065659
2212 Ga0207667_10090133
2213 Ga0207667_10535064
2214 Ga0207667_10686111
2215 Ga0207651_10000003
2216 Ga0207651_10137447
2217 Ga0207651_10248514
2218 Ga0207651_10531435
2219 Ga0207712_10000946
2220 Ga0207712_10009797
2221 Ga0207668_10000062
2222 Ga0207640_10000106
2223 Ga0207640_10010686
2224 Ga0207640_10022063
2225 Ga0207640_10046882
2226 Ga0207658_10010217
2227 Ga0207658_10023625
2228 Ga0207658_10039013
2229 Ga0207658_10145956
2230 Ga0207658_10176760
2231 Ga0207677_10000364
2232 Ga0207677_10107895
2233 Ga0207639_10056336
2234 Ga0207639_10063209
2235 Ga0207639_10084509
2236 Ga0207639_10304816
2237 Ga0207639_10327941
2238 Ga0207639_10368480
2239 Ga0207639_10582459
2240 Ga0207639_10583772
2241 Ga0207678_10001924
2242 Ga0207678_10007717
2243 Ga0207678_10010454
2244 Ga0207678_10017805
2245 Ga0207678_10022080
2246 Ga0207678_10077712
2247 Ga0207678_10141194
2248 Ga0207678_10296500
2249 Ga0207678_10306236
2250 Ga0207678_10414884
2251 Ga0207678_10487005
2252 Ga0207702_10015725
2253 Ga0207702_10040345
2254 Ga0207702_10121643
2255 Ga0207702_10250504
2256 Ga0207702_10303289
2257 Ga0207641_10006103
2258 Ga0207641_10014928
2259 Ga0207641_10065086
2260 Ga0207641_10125490
2261 Ga0207648_10000007
2262 Ga0207648_10000530
2263 Ga0207648_10020393
2264 Ga0207676_10005993
2265 Ga0207674_10000319
2266 Ga0207674_10002750
2267 Ga0207674_10003722
2268 Ga0207674_10003878
2269 Ga0207674_10084151
2270 Ga0207674_10304040
2271 Ga0207675_100492338
2272 Ga0207683_10003639
2273 Ga0207683_10037280
2274 Ga0207683_10296593
2275 Ga0207698_10001611
2276 Ga0207698_10006210
2277 Ga0207698_10046952
2278 Ga0207698_10060729
2279 Ga0207698_10159863
2280 Ga0209371_1000037
2281 Ga0209371_1008956
2282 Ga0209282_1000283
2283 Ga0209282_1090605
2284 Ga0209813_10002017
2285 Ga0268266_10000003
2286 Ga0268266_10000437
2287 Ga0268266_10002433
2288 Ga0268266_10009696
2289 Ga0268266_10017087
2290 Ga0268266_10018637
2291 Ga0268266_10053267
2292 Ga0268266_10126335
2293 Ga0268265_10057263
2294 Ga0268265_10080919
2295 Ga0268265_10094084
2296 Ga0268265_10096504
2297 Ga0268265_10482582
2298 Ga0268265_10485082
2299 Ga0268264_10003522
2300 Ga0268264_10018767
2301 Ga0268264_10120600
2302 Ga0307515_10000377
2303 Ga0307515_10081914
2304 Ga0307515_10180265
2305 Ga0265338_10218976
2306 Ga0268256_1000039
2307 Ga0268256_1003110
2308 Ga0307513_10001888
2309 Ga0307513_10026273
2310 Ga0307513_10096554
2311 Ga0307408_100079865
2312 Ga0307408_100094177
2313 Ga0307408_100416986
2314 Ga0307408_100598925
2315 Ga0307516_10000035
2316 Ga0307405_10023372
2317 Ga0307405_10038530
2318 Ga0307405_10057393
2319 Ga0307413_10004980
2320 Ga0307413_10005334
2321 Ga0307413_10005996
2322 Ga0307413_10011075
2323 Ga0307413_10020932
2324 Ga0307413_10056553
2325 Ga0307413_10167691
2326 Ga0307413_10232281
2327 Ga0307413_10253041
2328 Ga0307410_10002232
2329 Ga0307410_10003177
2330 Ga0307410_10003979
2331 Ga0307410_10020225
2332 Ga0307410_10024866
2333 Ga0307410_10118109
2334 Ga0307410_10191489
2335 Ga0307410_10291992
2336 Ga0307406_10003270
2337 Ga0307406_10030854
2338 Ga0307406_10125683
2339 Ga0307407_10004296
2340 Ga0307407_10009408
2341 Ga0307407_10020688
2342 Ga0307407_10024400
2343 Ga0307407_10147633
2344 Ga0307412_10006437
2345 Ga0307409_100014500
2346 Ga0307409_100016675
2347 Ga0307409_100019114
2348 Ga0307409_100043597
2349 Ga0307409_100050432
2350 Ga0307409_100057413
2351 Ga0307409_100112352
2352 Ga0307416_100010519
2353 Ga0307416_100035360
2354 Ga0307416_100241481
2355 Ga0307414_10000921
2356 Ga0307414_10010373
2357 Ga0307414_10077990
2358 Ga0307414_10147443
2359 Ga0307414_10419315
2360 Ga0307411_10001400
2361 Ga0307411_10001821
2362 Ga0307411_10013162
2363 Ga0307411_10015792
2364 Ga0307411_10031239
2365 Ga0307411_10037106
2366 Ga0307411_10038322
2367 Ga0307411_10053686
2368 Ga0307411_10163078
2369 Ga0307411_10276370
2370 Ga0307411_10308469
2371 Ga0307415_100074825
2372 Ga0307415_100098511
2373 Ga0307415_100159580
2374 Ga0307415_100257547
2375 Ga0373923_0003972
2376 Ga0373936_0104065
2377 Ga0373954_0019633
2378 Ga0373957_0021557
2379 Ga0373943_0008540
2380 Ga0373943_0030042
2381 Ga0373955_0001792
2382 Ga0373935_0140118
2383 Ga0373933_0135952
2384 Ga0373947_0008998
2385 Ga0373937_0013888
2386 Ga0373937_0406219
2387 Ga0373925_0003075
2388 Ga0373925_0041499
2389 Ga0373925_0107209
2390 Ga0395899_0000112
2391 Ga0395899_0001881
2392 Ga0395899_0012750
2393 Ga0395899_0061559
2394 Ga0395899_0077095
2395 Ga0395899_0262697
2396 Ga0395899_0373842
2397 Ga0395900_0000614
2398 Ga0395900_0000956
2399 Ga0395900_0001333
2400 Ga0395900_0017290
2401 Ga0395900_0037211
2402 Ga0395900_0038837
2403 Ga0395900_0050798
2404 Ga0395900_0051787
2405 Ga0395900_0126780
2406 Ga0395900_0127502
2407 Ga0395900_0151892
2408 Ga0395900_0205426
2409 Ga0395900_0281297
2410 Ga0395900_0326414
2411 Ga0395900_0362949
2412 Ga0395900_0479445
2413 Ga0395898_0000856
2414 Ga0395898_0009114
2415 Ga0395898_0139607
2416 Ga0395898_0142087
2417 Ga0395898_0214164
2418 Ga0395898_0412694
2419 Ga0395905_0000002
2420 Ga0395905_0000756
2421 Ga0395905_0003430
2422 Ga0395905_0023768
2423 Ga0395905_0025300
2424 Ga0395905_0025479
2425 Ga0395905_0028641
2426 Ga0395905_0030591
2427 Ga0395905_0033570
2428 Ga0395905_0045251
2429 Ga0395905_0068941
2430 Ga0395905_0094956
2431 Ga0395905_0097317
2432 Ga0395905_0133699
2433 Ga0395905_0148476
2434 Ga0395905_0151278
2435 Ga0395905_0152497
2436 Ga0395905_0236269
2437 Ga0395905_0277188
2438 Ga0395905_0323777
2439 Ga0395905_0347710
2440 Ga0395905_0415720
2441 Ga0395905_0539350
2442 Ga0436364_1182124
2443 Ga0395901_0000047
2444 Ga0395901_0001266
2445 Ga0395901_0027549
2446 Ga0395901_0030907
2447 Ga0395901_0072476
2448 Ga0395901_0084889
2449 Ga0395901_0097665
2450 Ga0395901_0108881
2451 Ga0395901_0259175
2452 Ga0395901_0380113
2453 Ga0395901_0436127
2454 Ga0395901_0735731
2455 Ga0400489_61960
2456 Ga0436365_0178572
2457 Ga0436365_0575374
2458 Ga0436365_0646826
2459 Ga0436360_0218255
2460 Ga0436360_0347187
2461 Ga0436361_0843768
2462 Ga0436362_0199967
2463 Ga0439461_0061267
2464 Ga0451805_114317
2465 Ga0451807_1040591
2466 Ga0451833_0382737
2467 Ga0451836_13430
2468 Ga0451840_17616
2469 Ga0451844_01918
2470 Ga0451847_0366726
2471 Ga0451848_02292
2472 Ga0451850_34886
2473 Ga0451851_0207979
2474 Ga0451853_2415485
2475 Ga0452268_04190
2476 Ga0439442_022337
2477 Ga0450920_010858
2478 Ga0439458_0001563
2479 Ga0439464_0006897
2480 Ga0450918_022643
2481 Ga0466972_0044050
2482 Ga0466966_0021123
2483 Ga0466966_0026104
2484 Ga0466966_0103860
2485 Ga0466961_0002991
2486 Ga0466961_0272458
2487 Ga0466963_0095059
2488 Ga0466963_0156045
2489 Ga0466963_0180524
2490 Ga0466963_0256461
2491 Ga0453684_0077525
2492 Ga0466968_0057464
2493 Ga0466968_0112096
2494 Ga0466970_0211897
2495 Ga0466960_0069981
2496 Ga0466959_0051129
2497 Ga0466958_0005444
2498 Ga0466967_0016516
2499 Ga0466967_0053146
2500 Ga0466967_0172907
2501 Ga0466967_0189161
2502 Ga0466967_0223230
2503 Ga0466967_0250988
2504 Ga0495629_0309947
2505 Ga0495650_0054491
2506 Ga0495584_0198223
2507 Ga0495606_0000842
2508 Ga0495606_0006190
2509 Ga0495610_0023020
2510 Ga0495610_0027830
2511 Ga0495618_0109772
2512 Ga0495632_0029818
2513 Ga0495643_0030806
2514 Ga0495643_0049214
2515 Ga0495648_0063982
2516 Ga0495663_0001575
2517 Ga0495586_0092693
2518 Ga0495621_0019233
2519 Ga0495621_0080541
2520 Ga0495668_0025865
2521 Ga0495623_0032843
2522 Ga0495669_0004244
2523 Ga0495669_0073522
2524 Ga0495670_0002753
2525 Ga0495671_0027198
2526 Ga0495649_0131529
2527 Ga0495581_0001641
2528 Ga0495672_0019292
2529 Ga0495684_0280826
2530 Ga0495686_0095614
2531 Ga0495686_0173413
2532 Ga0495602_0027123
2533 Ga0496101_0059302
2534 Ga0496102_0020912
2535 Ga0496102_0501878
2536 Ga0496103_0019417
2537 Ga0496103_0062160
2538 Ga0496104_0005087
2539 Ga0496105_0029761
2540 Ga0496105_0124152
2541 Ga0496105_0288302
2542 Ga0496106_0019237
2543 Ga0496106_0109486
2544 Ga0496107_0010761
2545 Ga0496107_0014006
2546 Ga0496107_0280966
2547 Ga0496108_0007128
2548 Ga0496108_0027624
2549 Ga0496109_0006219
2550 Ga0496109_0053030
2551 Ga0496109_0090275
2552 Ga0496110_0011342
2553 Ga0496110_0093295
2554 Ga0496111_0013893
2555 Ga0496111_0022256
2556 Ga0496111_0034277
2557 Ga0496111_0156243
2558 Ga0496112_0056815
2559 Ga0496112_0061115
2560 Ga0496112_0184074
2561 Ga0496112_0300058
2562 Ga0496112_0329469
2563 Ga0496113_0004502
2564 Ga0496113_0035281
2565 Ga0496114_0508298
2566 Ga0496115_0002304
2567 Ga0496115_0216444
2568 Ga0496115_0286737
2569 Ga0496116_0036603
2570 Ga0496116_0046785
2571 Ga0496117_0000031
2572 Ga0496117_0010158
2573 Ga0496117_0046354
2574 Ga0496117_0072181
2575 Ga0496117_0123635
2576 Ga0496118_0009453
2577 Ga0496118_0047506
2578 Ga0496118_0050212
2579 Ga0496118_0111548
2580 Ga0496119_0016219
2581 Ga0496119_0022765
2582 Ga0496119_0065871
2583 Ga0496119_0068627
2584 Ga0496120_0002214
2585 Ga0496120_0008737
2586 Ga0496121_0000034
2587 Ga0496121_0037228
2588 Ga0496121_0100280
2589 Ga0496122_0000023
2590 Ga0496122_0000074
2591 Ga0496122_0002284
2592 Ga0496122_0049974
2593 Ga0496122_0054751
2594 Ga0496122_0077694
2595 Ga0496123_0000027
2596 Ga0496123_0000062
2597 Ga0496123_0000290
2598 Ga0496123_0017447
2599 Ga0496123_0045104
2600 Ga0496123_0060366
2601 Ga0496123_0084091
2602 Ga0496124_0000130
2603 Ga0496124_0132682
2604 Ga0496124_0157216
2605 Ga0496124_0192753
2606 Ga0496125_0000030
2607 Ga0496125_0000191
2608 Ga0496125_0043497
2609 Ga0496125_0043789
2610 Ga0496125_0046609
2611 Ga0496125_0083656
2612 Ga0496125_0308991
2613 Ga0496126_0002183
2614 Ga0496126_0110669
2615 Ga0496126_0215911
2616 Ga0496126_0515506
2617 Ga0501031_0062249
2618 Ga0501032_0017999
2619 Ga0501032_0059538
2620 Ga0501033_0001390
2621 Ga0501033_0293730
2622 Ga0501034_0027245
2623 Ga0501034_0043144
2624 Ga0501034_0053984
2625 Ga0501034_0064642
2626 Ga0501034_0100185
2627 Ga0501036_0008099
2628 Ga0501037_0055182
2629 Ga0501037_0103708
2630 Ga0501037_0148244
2631 Ga0501038_0008659
2632 Ga0501038_0075372
2633 Ga0501038_0309836
2634 Ga0501038_0401126
2635 Ga0501039_0244631
2636 Ga0501043_0025032
2637 Ga0501043_0130198
2638 Ga0501047_0059274
2639 Ga0501047_0081910
2640 Ga0501047_0225063
2641 Ga0501067_0157526
2642 Ga0501069_0116597
2643 Ga0501070_0269989
2644 Ga0501071_0182854
2645 Ga0501071_0311564
2646 Ga0501073_0042928
2647 Ga0501073_0076554
2648 Ga0501074_0164020
2649 Ga0501075_0055494
2650 Ga0501075_0294804
2651 Ga0501076_0002832
2652 Ga0501076_0526787
2653 Ga0501077_0014202
2654 Ga0501238_008432
2655 Ga0501079_0014267
2656 Ga0501080_0080082
2657 Ga0501080_0090942
2658 Ga0501080_0103533
2659 Ga0501081_0011512
2660 Ga0501083_0038424
2661 Ga0501083_0103072
2662 Ga0501035_0000316
2663 Ga0501035_0056084
2664 Ga0501035_0205223
2665 Ga0501044_0032533
2666 Ga0501044_0078832
2667 Ga0501044_0296335
2668 Ga0501044_0506104
2669 Ga0501044_0545136
2670 nmdc:mga03n38_159935_c1
2671 nmdc:mga00v17_117335_c1
2672 nmdc:mga00v17_360_c1
2673 nmdc:mga00v17_9201_c1
2674 nmdc:mga06z11_162722_c1
2675 nmdc:mga06z11_195420_c1
2676 nmdc:mga07m45_10486_c1
2677 nmdc:mga07m45_33705_c1
2678 nmdc:mga07m45_39862_c1
2679 nmdc:mga07m45_44016_c1
2680 nmdc:mga07m45_97233_c1
2681 nmdc:mga05p37_4690_c1
2682 nmdc:mga08y16_75638_c1
2683 nmdc:mga0n895_400699_c1
2684 nmdc:mga0rr50_94491_c1
2685 nmdc:mga0a205_3134_c1
2686 nmdc:mga0sz30_2754_c1
2687 Ga0500643_040966
2688 Ga0500641_0073152
2689 Ga0500572_005072
2690 Ga0500658_0000023
2691 Ga0500658_0043369
2692 Ga0500616_0070123
2693 Ga0500622_0032643
2694 Ga0500627_0020379
2695 Ga0500636_0000025
2696 Ga0501084_0023191
2697 Ga0587066_005314
2698 Ga0587083_0015354
2699 Ga0587086_001890
2700 Ga0587090_000117
2701 Ga0587091_006347
2702 Ga0587067_000537
2703 Ga0587068_008100
2704 Ga0501082_0016884
2705 Ga0466962_0069291
2706 Ga0530510_0197617
2707 2508734362
2708 2509079271
2709 2509109470
2710 2509378220
2711 2509389485
2712 2509446103
2713 2510135164
2714 2510307621
2715 2510841293
2716 2510896590
2717 2511174119
2718 2511184861
2719 2511503204
2720 2512534478
2721 2512973713
2722 2513571532
2723 2513578555
2724 2513585187
2725 2513598130
2726 2513601769
2727 2513616954
2728 2513630266
2729 2513713125
2730 2513869188
2731 2513884170
2732 2513903499
2733 2513984043
2734 2513998559
2735 2514003647
2736 2514019286
2737 2515114317
2738 2515610942
2739 2515636208
2740 2515643298
2741 2515660785
2742 2515741482
2743 2516894636
2744 2517078203
2745 2517096972
2746 2517408623
2747 2517571284
2748 2520376381
2749 2523468749
2750 2524450570
2751 2524458392
2752 2530647420
2753 2535485381
2754 2535518944
2755 2537876656
2756 2551679638
2757 2551687381
2758 2551691541
2759 2551698012
2760 2551711053
2761 2551720239
2762 2551725364
2763 2551738054
2764 2551743515
2765 2554248799
2766 2558867294
2767 2559295887
2768 2561467043
2769 2585166796
2770 2585223853
2771 2585228813
2772 2585257429
2773 2585266856
2774 2585280655
2775 2585387899
2776 2585395993
2777 2585399676
2778 2585526152
2779 2585531589
2780 2585540694
2781 2585549076
2782 2585551464
2783 2585820763
2784 2585838963
2785 2585844816
2786 2585997707
2787 2586002293
2788 2599335043
2789 2599603321
2790 2600373303
2791 2601610773
2792 2601747547
2793 2616296385
2794 2616306800
2795 2616557651
2796 2617383319
2797 2643813685
2798 2643855015
2799 2643882566
2800 2643921412
2801 2643964712
2802 2644002396
2803 2644051968
2804 2644194895
2805 2644209403
2806 2644240576
2807 2644299948
2808 2644353598
2809 2644484420
2810 2644492429
2811 2644499849
2812 2644521465
2813 2644652931
2814 2644658175
2815 2644677193
2816 2644728610
2817 2644736999
2818 2644746155
2819 2657682524
2820 2671113546
2821 2687579578
2822 2692320205
2823 2719182892
2824 2719387587
2825 2719667232
2826 2719733609
2827 2720493652
2828 2720615106
2829 2720621899
2830 2720633249
2831 2720776948
2832 2721149004
2833 2721160402
2834 2721165817
2835 2721401221
2836 2722841987
2837 2723028547
2838 2723562149
2839 2723568852
2840 2724040035
2841 2724046365
2842 2724091555
2843 2724106117
2844 2724111923
2845 2725947421
2846 2730109483
2847 2730166127
2848 2730300034
2849 2738805369
2850 2739037182
2851 2739349755
2852 2753360434
2853 2753463712
2854 2757570306
2855 2758642872
2856 2765465711
2857 2766064387
2858 2770198334
2859 2774871762
2860 2776257724
2861 2776269584
2862 2776282515
2863 2776915409
2864 2778173682
2865 2792582125
2866 2792641343
2867 2793281096
2868 2793295706
2869 2793313467
2870 2793320641
2871 2793327207
2872 2793332158
2873 2793338726
2874 2793346529
2875 2793353937
2876 2793359469
2877 2793365828
2878 2802717349
2879 2802724662
2880 2802729414
2881 2802736759
2882 2802743165
2883 2802749709
2884 2804753585
2885 2805926137
2886 2805937164
2887 2806047273
2888 2806054137
2889 2806060279
2890 2806068899
2891 2806077158
2892 2808988289
2893 2819244732
2894 2819560897
2895 2819611172
2896 2819638894
2897 2819687080
2898 2835315683
2899 2837651240
2900 2837680377
2901 2838018410
2902 2838024091
2903 2838030864
2904 2838048395
2905 2838050728
2906 2838062494
2907 2838072045
2908 2838078278
2909 2838672893
2910 2838678740
2911 2838690169
2912 2838705629
2913 2838718171
2914 2838723037
2915 2838728238
2916 2838731944
2917 2838741666
2918 2838744840
2919 2839993354
2920 2840766357
2921 2841766102
2922 2841845500
2923 2841850593
2924 2841855897
2925 2841863154
2926 2841867835
2927 2841911441
2928 2841917904
2929 2842116347
2930 2842128897
2931 2842133632
2932 2842145203
2933 2842149959
2934 2842155456
2935 2842161067
2936 2842166585
2937 2842174587
2938 2842179246
2939 2842184683
2940 2842190595
2941 2842194962
2942 2842201685
2943 2842207342
2944 2842215081
2945 2842223358
2946 2842227802
2947 2842232266
2948 2842246681
2949 2842255309
2950 2842261217
2951 2842269560
2952 2842274189
2953 2842280947
2954 2842288437
2955 2842300352
2956 2842305952
2957 2842311333
2958 2842321032
2959 2842346658
2960 2842361131
2961 2842366349
2962 2842396034
2963 2842406217
2964 2842412802
2965 2842419319
2966 2842425677
2967 2842433518
2968 2842439846
2969 2842446475
2970 2842448858
2971 2842467851
2972 2842474455
2973 2842477596
2974 2842487965
2975 2842491084
2976 2842498422
2977 2842504531
2978 2842511781
2979 2842520108
2980 2842524410
2981 2842696183
2982 2842873972
2983 2842926232
2984 2844105868
2985 2844457133
2986 2847420719
2987 2848995550
2988 2850082530
2989 2851186367
2990 2851246224
2991 2852391626
2992 2854897055
2993 2854913647
2994 2854917201
2995 2855827262
2996 2855842644
2997 2855878077
2998 2857521074
2999 2858803455
3000 2882457198
3001 2885427531
3002 2889306899
3003 2889793309
3004 2889917441
3005 2891373834
3006 2894242829
3007 2894653774
3008 2894821049
3009 2896387981
3010 2899795253
3011 2899849233
3012 2902336507
3013 2902411608
3014 2904579997
3015 2913300063
3016 2915650529
3017 2915982564
3018 2915991158
3019 2916000259
3020 2916007203
3021 2916014629
3022 2916019699
3023 2916026725
3024 2916033544
3025 2916039650
3026 2916047010
3027 2916052827
3028 2916059539
3029 2916065148
3030 2916069469
3031 2916078063
3032 2917704205
3033 2919105314
3034 2919118571
3035 2919120332
3036 2919170651
3037 2919410996
3038 2920760459
3039 2920825832
3040 2921202502
3041 2921210381
3042 2921244022
3043 2921248733
3044 2921254675
3045 2921262122
3046 2921270668
3047 2921288805
3048 2921296346
3049 2921298095
3050 2923559565
3051 2924147732
3052 2924156439
3053 2924160191
3054 2924170227
3055 2924177609
3056 2924186288
3057 2924191574
3058 2924195246
3059 2924204803
3060 2924209363
3061 2924228785
3062 2924234387
3063 2926755101
3064 2926762261
3065 2928522793
3066 2928973499
3067 2929141797
3068 2932402257
3069 2933010694
3070 2933015632
3071 2933572457
3072 2933592563
3073 2933597627
3074 2933603102
3075 2935903744
3076 2936369802
3077 2936378990
3078 2936382036
3079 2936997580
3080 2937007589
3081 2937013965
3082 2937020903
3083 2937024762
3084 2937033311
3085 2937036077
3086 2937049248
3087 2937056132
3088 2937061416
3089 2937069211
3090 2937076315
3091 2937082363
3092 2937085874
3093 2937097275
3094 2937106245
3095 2937106977
3096 2937118172
3097 2937121750
3098 2937127845
3099 2941487954
3100 2941501246
3101 2952253441
3102 2954013841
3103 2957378883
3104 2957383845
3105 2957391487
3106 2957400537
3107 2957403952
3108 2957409861
3109 2957420540
3110 2957424476
3111 2957435953
3112 2957439738
3113 2957449069
3114 2957456768
3115 2957462790
3116 2957467508
3117 2957477451
3118 2957482488
3119 2957485137
3120 2957497294
3121 2957504669
3122 2957510707
3123 2960584325
3124 2960594961
3125 2960599381
3126 2960609051
3127 2960612164
3128 2960618183
3129 2960629926
3130 2960634747
3131 2960638282
3132 2960650751
3133 2960655409
3134 2960665730
3135 2960672042
3136 2960678011
3137 2960684294
3138 2960693689
3139 2960696672
3140 2964609646
3141 2964619698
3142 2964626228
3143 2964630467
3144 2964636452
3145 2964645261
3146 2964652702
3147 2964662342
3148 2964666255
3149 2964672773
3150 2964678270
3151 2964691424
3152 2964696569
3153 2964702194
3154 2964712474
3155 2964712907
3156 2964720238
3157 2967670997
3158 2967672025
3159 2967684866
3160 2967689155
3161 2967695496
3162 2967705888
3163 2967713913
3164 2967719105
3165 2967727150
3166 2967731946
3167 2967736790
3168 2967744112
3169 2967749894
3170 2967756278
3171 2967768620
3172 2967773798
3173 2967778523
3174 2970026280
3175 2970029942
3176 2970038844
3177 2970045689
3178 2970052374
3179 2970059723
3180 2970062306
3181 2970075601
3182 2970081672
3183 2970086391
3184 2970093957
3185 2970101808
3186 2970106869
3187 2970111451
3188 2970121504
3189 2970125872
3190 2970131905
3191 2970138139
3192 2970143737
3193 2970154412
3194 2970157576
3195 2970168929
3196 2970176833
3197 2970180212
3198 2970189610
3199 2970196889
3200 2977240523
3201 2977522962
3202 2977524521
3203 2977534661
3204 2977542360
3205 2977551418
3206 2977553318
3207 2977565502
3208 2977569287
3209 2977579198
3210 2977585471
3211 2978972539
3212 2979092469
3213 2979100140
3214 2979104440
3215 2984513764
3216 2984522658
3217 2984541964
3218 2984590792
3219 2984601394
3220 2989354825
3221 2989771481
3222 2989780010
3223 2996895208
3224 3003930908
3225 3005409563
3226 3005421693
3227 3005449586
3228 3005455867
3229 639650318
3230 641642391
3231 648737084
3232 650741101
3233 8003403410
3234 8003573841
3235 8003995226
3236 8004002944
3237 8005249154
3238 8005282341
3239 8005286828
3240 8005295010
3241 8005305889
3242 8005313590
3243 8005319603
3244 8005381653
3245 8005387848
3246 8005400884
3247 8005431027
3248 8005465010
3249 8005490225
3250 8005497595
3251 8005546594
3252 8005561051
3253 8005565677
3254 8005571748
3255 8005623328
3256 8005631092
3257 8005646882
3258 8005660741
3259 8005669000
3260 8005688056
3261 8005694414
3262 8005695643
3263 8018128837
3264 8018155132
3265 8018165212
3266 8018177070
3267 8023686428
3268 8024484284
3269 8024490781
3270 8024502404
3271 8045868993
3272 8046768099
3273 8049296154
3274 8054463701
3275 8054560161
3276 8055435622
3277 8056380337
3278 8056383873
3279 8056878170
3280 8057161276
3281 8057531551
3282 8057581541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02629

CoA_binding

CoA binding domain

6

99

0.99

PF00549

Ligase_CoA

CoA-ligase

151

276

0.97

PF13607

Succ_CoA_lig

Succinyl-CoA ligase like flavodoxin domain

145

281

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mss-assembly1.cif.gz_A human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa 0.9792 5 294
2nu6-assembly1.cif.gz_A c123aa mutant of e. coli succinyl-coa synthetase 0.9774 2 291
2scu-assembly1.cif.gz_A a detailed description of the structure of succinyl-coa synthetase from escherichia coli 0.9773 2 290
1jkj-assembly1.cif.gz_A e. coli scs 0.9766 2 290
2nu9-assembly1.cif.gz_A c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form 0.9764 2 290
ID Description Score Start End Superfamily
af_A0A1D6EZI1_156_262_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.9794 121 206 3.40.50.261
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.974 2 123 3.40.50.720
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9663 2 123 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9589 4 123 3.40.50.720
af_Q8IIR8_149_327_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.9567 121 294 3.40.50.261
ID Description Score Start End GO Terms
AF-E4YXI4-F1-model_v4 CoA-binding domain-containing protein 1.005 5 74 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A5Q4GNX7-F1-model_v4 Succinate--CoA ligase subunit alpha (EC 6.2.1.5) 1.004 1 73 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A227J1N4-F1-model_v4 Succinate--CoA ligase subunit alpha (EC 6.2.1.5) 1.004 1 69 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A442F9I0-F1-model_v4 Succinate--CoA ligase subunit alpha 1.002 1 85 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A382HHT4-F1-model_v4 CoA-binding domain-containing protein 1 1 93 GO:0004775
GO:0004776
GO:0006099
GO:0009361

Map