F495176

General Info

Members Datasets Scaffolds Average Seq Length
1643 755 3286 195

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876810941
Length 229
Sequence NYDDNYIRGILNGVKSIAMVGASPVNVRPSYFAFKYLAQRGYDMIPVNPGHVGKSLLGKPFVASLSDIGRPVDMIDIFRNSSHIMPVVDEALTLSPPPKVIWMQLGARDDAAAEKAEAAGLKVVMNRCPKIEYGRLSSEISWMGVNSRTLSSKRAPIPTQGMRLSLNRTSVGGGATAASDRAAKNKSEXXXXXXXXXXXXXXXXDVTQYETIVSNTPQEEADAFLIHDM

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
109 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
126 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
127 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
128 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
224 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
225 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
251 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
252 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
256 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
257 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
285 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
286 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
287 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
288 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
289 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
290 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
291 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
292 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
293 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
294 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
295 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
296 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
297 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
298 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
301 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
302 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
308 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
311 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
312 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
315 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
322 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
326 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
327 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
328 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
355 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
372 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
373 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
376 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
377 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
378 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
379 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
380 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
381 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
437 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
438 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
439 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
440 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
446 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
447 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
448 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
455 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
456 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
457 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
458 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
459 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
460 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
461 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
462 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
463 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
464 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
465 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
466 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
467 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
468 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
469 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
470 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
471 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
472 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
473 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
474 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
475 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
476 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
477 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
478 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
479 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
480 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
481 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
482 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
483 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
484 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
485 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
486 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
487 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
488 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
489 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
490 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
491 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
492 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
493 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
494 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
495 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
496 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
499 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
500 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
501 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
502 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
503 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
504 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
507 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
508 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
509 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
510 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
511 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
512 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
513 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
514 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
515 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
516 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
517 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
518 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
519 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
520 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
521 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
522 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
523 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
524 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
525 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
526 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
527 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
528 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
529 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
530 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
531 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
532 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
533 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
534 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
535 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
536 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
537 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
538 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
539 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
540 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
541 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
542 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
543 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
544 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
545 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
546 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
547 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
548 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
549 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
550 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
551 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
552 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
553 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
554 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
555 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
556 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
557 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
558 2791355199
559 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
560 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
561 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
562 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
563 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
564 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
565 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
566 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
567 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
568 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
569 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
570 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
571 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
572 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
573 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
574 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
575 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
576 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
577 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
578 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
579 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
580 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
581 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
582 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
583 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
584 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
585 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
586 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
587 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
588 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
589 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
590 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
591 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
592 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
593 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
594 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
595 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
596 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
597 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
598 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
599 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
600 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
601 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
602 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
603 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
604 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
605 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
606 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
607 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
608 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
609 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
610 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
611 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
612 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
613 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
614 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
615 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
616 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
617 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
618 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
619 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
620 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
621 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
622 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
623 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
624 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
625 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
626 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
627 2904699407
628 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
629 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
630 2906610324
631 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
632 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
633 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
634 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
635 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
636 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
637 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
638 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
639 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
640 2922368715
641 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
642 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
643 2922425934
644 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
645 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
646 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
647 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
648 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
649 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
650 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
651 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
652 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
653 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
654 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
655 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
656 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
657 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
658 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
659 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
660 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
661 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
662 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
663 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
664 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
665 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
666 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
667 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
668 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
669 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
670 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
671 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
672 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
673 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
674 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
675 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
676 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
677 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
678 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
679 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
680 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
681 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
682 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
683 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
684 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
685 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
686 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
687 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
688 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
689 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
690 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
691 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
692 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
693 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
694 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
695 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
696 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
697 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
698 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
699 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
700 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
701 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
702 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
703 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
704 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
705 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
706 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
707 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
708 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
709 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
710 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
711 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
712 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
713 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
714 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
715 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
716 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
717 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
718 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
719 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
720 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
721 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
722 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
723 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
724 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
725 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
726 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
727 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
728 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
729 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
730 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
731 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
732 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
733 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
734 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
735 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
736 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
737 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
738 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
739 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
740 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
741 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
742 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
743 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
744 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
745 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
746 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
747 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
748 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
749 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
750 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
751 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
752 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
753 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
754 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
755 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0.12
Isolates 13.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 11.02
Rhizoplane 5.84
Rhizosphere 58.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C651 2010549000 Bacteria 1116
2 JGI25406J46586_10014911 3300003203 Bacteria 3291
3 JGI25406J46586_10094120 3300003203 Bacteria 900
4 JGI25165J46597_1006252 3300003214 Bacteria 2134
5 JGI25153J46596_10003518 3300003215 Bacteria 8738
6 JGI25153J46596_10006847 3300003215 Bacteria 5697
7 JGI25153J46596_10012797 3300003215 Bacteria 3593
8 JGI25153J46596_10016522 3300003215 Bacteria 2950
9 JGI25160J50197_1003097 3300003354 Bacteria 7586
10 JGI25160J50197_1005052 3300003354 Bacteria 5574
11 JGI25160J50197_1044907 3300003354 Bacteria 982
12 JGI25404J52841_10007374 3300003659 Bacteria 2324
13 JGI25404J52841_10040120 3300003659 Bacteria 991
14 Ga0055542_1011767 3300003762 Bacteria 1539
15 Ga0055526_1064162 3300003771 Bacteria 770
16 Ga0055531_10008796 3300003794 Bacteria 5262
17 Ga0055543_1003302 3300004625 Bacteria 4840
18 Ga0065165_1001864 3300005262 Bacteria 20463
19 Ga0065165_1019808 3300005262 Bacteria 2389
20 Ga0065165_1020382 3300005262 Bacteria 2333
21 Ga0070658_10230450 3300005327 Bacteria 1568
22 Ga0070676_10153610 3300005328 Bacteria 1475
23 Ga0070683_100029863 3300005329 Bacteria 4942
24 Ga0070683_100689422 3300005329 Bacteria 978
25 Ga0070670_100508728 3300005331 Bacteria 1072
26 Ga0068869_100111795 3300005334 Bacteria 2079
27 Ga0068869_100335859 3300005334 Bacteria 1229
28 Ga0068869_100467874 3300005334 Bacteria 1048
29 Ga0070680_100018923 3300005336 Bacteria 5449
30 Ga0070680_100187668 3300005336 Bacteria 1742
31 Ga0070680_100463579 3300005336 Bacteria 1083
32 Ga0070680_100492177 3300005336 Bacteria 1049
33 Ga0070682_100026401 3300005337 Bacteria 3475
34 Ga0070682_100162523 3300005337 Bacteria 1544
35 Ga0070682_100362253 3300005337 Bacteria 1085
36 Ga0070682_100542480 3300005337 Bacteria 909
37 Ga0068868_100589656 3300005338 Bacteria 983
38 Ga0070660_100010416 3300005339 Bacteria 6570
39 Ga0070660_100253469 3300005339 Bacteria 1436
40 Ga0070660_100299299 3300005339 Bacteria 1319
41 Ga0070687_100206945 3300005343 Bacteria 1193
42 Ga0070661_100006251 3300005344 Bacteria 8217
43 Ga0070661_100377068 3300005344 Bacteria 1118
44 Ga0070668_100067207 3300005347 Bacteria 2784
45 Ga0070668_100089962 3300005347 Bacteria 2418
46 Ga0070668_100138774 3300005347 Bacteria 1957
47 Ga0070669_100378212 3300005353 Bacteria 1154
48 Ga0070669_100843392 3300005353 Bacteria 780
49 Ga0070675_100065137 3300005354 Bacteria 3012
50 Ga0070675_101244157 3300005354 Bacteria 686
51 Ga0070671_100276120 3300005355 Bacteria 1429
52 Ga0070671_100531100 3300005355 Bacteria 1013
53 Ga0070671_100706021 3300005355 Bacteria 875
54 Ga0070674_100078595 3300005356 Bacteria 2351
55 Ga0070674_100111556 3300005356 Bacteria 2009
56 Ga0070659_100177733 3300005366 Bacteria 1746
57 Ga0070659_100375862 3300005366 Bacteria 1196
58 Ga0070659_100448417 3300005366 Bacteria 1094
59 Ga0070667_100134781 3300005367 Bacteria 2159
60 Ga0070709_10000951 3300005434 Bacteria 16067
61 Ga0070709_10076815 3300005434 Bacteria 2170
62 Ga0070709_10172145 3300005434 Bacteria 1514
63 Ga0070714_100010720 3300005435 Bacteria 7252
64 Ga0070714_100074142 3300005435 Bacteria 2950
65 Ga0070714_100226980 3300005435 Bacteria 1719
66 Ga0070714_100386619 3300005435 Bacteria 1320
67 Ga0070713_100000936 3300005436 Bacteria 18647
68 Ga0070713_100005223 3300005436 Bacteria 8847
69 Ga0070713_100066626 3300005436 Bacteria 3028
70 Ga0070713_100098866 3300005436 Bacteria 2524
71 Ga0070713_100294418 3300005436 Bacteria 1493
72 Ga0070710_10002437 3300005437 Bacteria 8807
73 Ga0070710_10372108 3300005437 Bacteria 951
74 Ga0070711_100003765 3300005439 Bacteria 8895
75 Ga0070711_100010373 3300005439 Bacteria 5763
76 Ga0070711_100133712 3300005439 Bacteria 1850
77 Ga0070705_100788869 3300005440 Bacteria 755
78 Ga0070663_100028775 3300005455 Bacteria 3788
79 Ga0070663_100033215 3300005455 Bacteria 3563
80 Ga0070663_100051889 3300005455 Bacteria 2924
81 Ga0070663_100153154 3300005455 Bacteria 1769
82 Ga0070678_100038290 3300005456 Bacteria 3375
83 Ga0070678_100046100 3300005456 Bacteria 3123
84 Ga0070678_100050632 3300005456 Bacteria 3006
85 Ga0070678_100622586 3300005456 Bacteria 966
86 Ga0070662_100017777 3300005457 Bacteria 4797
87 Ga0070662_100462378 3300005457 Bacteria 1055
88 Ga0070662_100473847 3300005457 Bacteria 1042
89 Ga0070681_10013529 3300005458 Bacteria 8113
90 Ga0070681_10024245 3300005458 Bacteria 6107
91 Ga0070681_10034302 3300005458 Bacteria 5096
92 Ga0070681_10147981 3300005458 Bacteria 2276
93 Ga0070681_10189850 3300005458 Bacteria 1974
94 Ga0070681_10200951 3300005458 Bacteria 1911
95 Ga0070681_10531280 3300005458 Bacteria 1090
96 Ga0068867_100452316 3300005459 Bacteria 1094
97 Ga0070698_100415922 3300005471 Bacteria 1279
98 Ga0070699_100742334 3300005518 Bacteria 898
99 Ga0070699_101106830 3300005518 Bacteria 727
100 Ga0070679_100007218 3300005530 Bacteria 10377
101 Ga0070679_100095395 3300005530 Bacteria 2962
102 Ga0070679_100136758 3300005530 Bacteria 2431
103 Ga0070679_100418008 3300005530 Bacteria 1286
104 Ga0070679_100485784 3300005530 Bacteria 1179
105 Ga0070679_100526022 3300005530 Bacteria 1126
106 Ga0070684_100018029 3300005535 Bacteria 5805
107 Ga0070684_100036613 3300005535 Bacteria 4205
108 Ga0070684_100064431 3300005535 Bacteria 3215
109 Ga0070684_100084021 3300005535 Bacteria 2821
110 Ga0070684_100456942 3300005535 Bacteria 1181
111 Ga0070697_100056309 3300005536 Bacteria 3199
112 Ga0068853_100004481 3300005539 Bacteria 10832
113 Ga0068853_100263379 3300005539 Bacteria 1585
114 Ga0068853_100422717 3300005539 Bacteria 1250
115 Ga0068853_100435135 3300005539 Bacteria 1232
116 Ga0070672_100651502 3300005543 Bacteria 920
117 Ga0070693_100060897 3300005547 Bacteria 2192
118 Ga0070693_100390176 3300005547 Bacteria 963
119 Ga0070665_100062885 3300005548 Bacteria 3722
120 Ga0070665_100094386 3300005548 Bacteria 2996
121 Ga0070665_100100681 3300005548 Bacteria 2894
122 Ga0070665_100139357 3300005548 Bacteria 2429
123 Ga0070665_100290721 3300005548 Bacteria 1637
124 Ga0070665_100335848 3300005548 Bacteria 1515
125 Ga0070665_100475332 3300005548 Bacteria 1260
126 Ga0070665_100839981 3300005548 Bacteria 931
127 Ga0070704_100205904 3300005549 Bacteria 1591
128 Ga0068855_100026568 3300005563 Bacteria 6926
129 Ga0068855_100067965 3300005563 Bacteria 4150
130 Ga0068855_100121768 3300005563 Bacteria 2985
131 Ga0068855_100202775 3300005563 Bacteria 2232
132 Ga0068855_100221112 3300005563 Bacteria 2123
133 Ga0068855_100325301 3300005563 Bacteria 1698
134 Ga0068855_100446345 3300005563 Bacteria 1412
135 Ga0068855_100505285 3300005563 Bacteria 1313
136 Ga0068855_100610859 3300005563 Bacteria 1175
137 Ga0070664_100074373 3300005564 Bacteria 2916
138 Ga0070664_100631390 3300005564 Bacteria 995
139 Ga0068857_100017569 3300005577 Bacteria 6271
140 Ga0068857_100145722 3300005577 Bacteria 2143
141 Ga0068857_100921285 3300005577 Bacteria 839
142 Ga0068857_101371698 3300005577 Bacteria 687
143 Ga0068854_100177549 3300005578 Bacteria 1661
144 Ga0068856_100006094 3300005614 Bacteria 11843
145 Ga0068856_100185539 3300005614 Bacteria 2094
146 Ga0068856_100253901 3300005614 Bacteria 1773
147 Ga0068856_100519403 3300005614 Bacteria 1212
148 Ga0068856_100547175 3300005614 Bacteria 1179
149 Ga0068856_100984659 3300005614 Bacteria 862
150 Ga0068852_100002018 3300005616 Bacteria 13824
151 Ga0068852_100082448 3300005616 Bacteria 2857
152 Ga0068852_100103345 3300005616 Bacteria 2577
153 Ga0068852_100141834 3300005616 Bacteria 2225
154 Ga0068852_100218320 3300005616 Bacteria 1812
155 Ga0068852_100312610 3300005616 Bacteria 1524
156 Ga0068852_100641887 3300005616 Bacteria 1069
157 Ga0068852_101445009 3300005616 Bacteria 710
158 Ga0068859_100251619 3300005617 Bacteria 1857
159 Ga0068859_100414858 3300005617 Bacteria 1442
160 Ga0068859_100474485 3300005617 Bacteria 1346
161 Ga0068864_100546987 3300005618 Bacteria 1118
162 Ga0068861_100195399 3300005719 Bacteria 1694
163 Ga0068861_100354350 3300005719 Bacteria 1288
164 Ga0068851_10013775 3300005834 Bacteria 3829
165 Ga0068851_10201064 3300005834 Bacteria 1112
166 Ga0068863_100318014 3300005841 Bacteria 1511
167 Ga0068863_100905256 3300005841 Bacteria 882
168 Ga0068858_100248395 3300005842 Bacteria 1690
169 Ga0068858_100313002 3300005842 Bacteria 1499
170 Ga0068858_100355497 3300005842 Bacteria 1404
171 Ga0068858_100444577 3300005842 Bacteria 1249
172 Ga0068860_100000058 3300005843 Bacteria 197181
173 Ga0068860_100204938 3300005843 Bacteria 1912
174 Ga0068860_100353409 3300005843 Bacteria 1446
175 Ga0068860_100692530 3300005843 Bacteria 1028
176 Ga0068862_100037323 3300005844 Bacteria 4118
177 Ga0068862_100105591 3300005844 Bacteria 2468
178 Ga0068862_100626257 3300005844 Bacteria 1035
179 Ga0068862_100943347 3300005844 Bacteria 850
180 Ga0081455_10009084 3300005937 Bacteria 10254
181 Ga0081455_10018953 3300005937 Bacteria 6526
182 Ga0081455_10059666 3300005937 Bacteria 3220
183 Ga0081455_10074357 3300005937 Bacteria 2807
184 Ga0081455_10202229 3300005937 Bacteria 1487
185 Ga0081455_10251739 3300005937 Bacteria 1291
186 Ga0081538_10043006 3300005981 Bacteria 2843
187 Ga0081538_10176859 3300005981 Bacteria 920
188 Ga0081540_1001631 3300005983 Bacteria 19125
189 Ga0081540_1004115 3300005983 Bacteria 11230
190 Ga0081540_1009209 3300005983 Bacteria 6810
191 Ga0081540_1009520 3300005983 Bacteria 6689
192 Ga0081540_1024605 3300005983 Bacteria 3491
193 Ga0081540_1031069 3300005983 Bacteria 2945
194 Ga0081540_1037550 3300005983 Bacteria 2566
195 Ga0081540_1040575 3300005983 Bacteria 2425
196 Ga0081540_1122431 3300005983 Bacteria 1077
197 Ga0081539_10000250 3300005985 Bacteria 125352
198 Ga0081539_10000269 3300005985 Bacteria 119082
199 Ga0081539_10017984 3300005985 Bacteria 4930
200 Ga0081539_10176671 3300005985 Bacteria 1005
201 Ga0070717_10001774 3300006028 Bacteria 15044
202 Ga0070717_10049640 3300006028 Bacteria 3445
203 Ga0070717_10304250 3300006028 Bacteria 1418
204 Ga0075365_10015428 3300006038 Bacteria 4623
205 Ga0075365_10040951 3300006038 Bacteria 3023
206 Ga0075365_10053219 3300006038 Bacteria 2680
207 Ga0075365_10059845 3300006038 Bacteria 2540
208 Ga0075365_10130996 3300006038 Bacteria 1736
209 Ga0075365_10148307 3300006038 Bacteria 1631
210 Ga0075365_10236657 3300006038 Bacteria 1282
211 Ga0075365_10406974 3300006038 Bacteria 960
212 Ga0075368_10017232 3300006042 Bacteria 2702
213 Ga0075368_10096813 3300006042 Bacteria 1210
214 Ga0075368_10124387 3300006042 Bacteria 1069
215 Ga0075368_10168457 3300006042 Bacteria 920
216 Ga0075363_100012935 3300006048 Bacteria 4030
217 Ga0075363_100086970 3300006048 Bacteria 1717
218 Ga0075363_100201765 3300006048 Bacteria 1136
219 Ga0075364_10090682 3300006051 Bacteria 2027
220 Ga0075364_10106011 3300006051 Bacteria 1873
221 Ga0075364_10378106 3300006051 Bacteria 966
222 Ga0070715_10000514 3300006163 Bacteria 10119
223 Ga0070715_10044050 3300006163 Bacteria 1885
224 Ga0070716_100004285 3300006173 Bacteria 6796
225 Ga0070716_100179140 3300006173 Bacteria 1390
226 Ga0070712_100072591 3300006175 Bacteria 2466
227 Ga0070712_100089027 3300006175 Bacteria 2257
228 Ga0070712_100575789 3300006175 Bacteria 951
229 Ga0075362_10229066 3300006177 Bacteria 910
230 Ga0075367_10026323 3300006178 Bacteria 3298
231 Ga0075367_10056089 3300006178 Bacteria 2340
232 Ga0075367_10215730 3300006178 Bacteria 1200
233 Ga0075369_10073960 3300006186 Bacteria 1503
234 Ga0075366_10056404 3300006195 Bacteria 2333
235 Ga0075366_10105423 3300006195 Bacteria 1694
236 Ga0075366_10253032 3300006195 Bacteria 1074
237 Ga0075366_10405609 3300006195 Bacteria 839
238 Ga0097621_100698839 3300006237 Bacteria 934
239 Ga0097621_101048862 3300006237 Bacteria 764
240 Ga0075370_10030042 3300006353 Bacteria 3031
241 Ga0075370_10065298 3300006353 Bacteria 2076
242 Ga0075370_10112231 3300006353 Bacteria 1583
243 Ga0075370_10225902 3300006353 Bacteria 1107
244 Ga0075370_10334931 3300006353 Bacteria 903
245 Ga0075433_10628661 3300006852 Bacteria 942
246 Ga0075434_100008873 3300006871 Bacteria 9361
247 Ga0075434_100915210 3300006871 Bacteria 892
248 Ga0075434_101575156 3300006871 Bacteria 666
249 Ga0068865_100075446 3300006881 Bacteria 2404
250 Ga0097620_100251646 3300006931 Bacteria 1857
251 Ga0097620_100414853 3300006931 Bacteria 1442
252 Ga0097620_100474452 3300006931 Bacteria 1346
253 Ga0099825_1017862 3300006941 Bacteria 5680
254 Ga0099824_1004496 3300006942 Bacteria 20072
255 Ga0099822_1001205 3300006943 Bacteria 29230
256 Ga0099823_1074998 3300006944 Bacteria 1417
257 Ga0099794_10111599 3300007265 Bacteria 1370
258 Ga0099794_10247543 3300007265 Bacteria 919
259 Ga0099795_10028277 3300007788 Bacteria 1905
260 Ga0099795_10043937 3300007788 Bacteria 1601
261 Ga0099795_10117800 3300007788 Bacteria 1059
262 Ga0105250_10146291 3300009092 Bacteria 981
263 Ga0105240_10037185 3300009093 Bacteria 6257
264 Ga0105240_10060299 3300009093 Bacteria 4730
265 Ga0105240_10147223 3300009093 Bacteria 2809
266 Ga0105240_10170959 3300009093 Bacteria 2574
267 Ga0105240_10216390 3300009093 Bacteria 2235
268 Ga0111539_10054668 3300009094 Bacteria 4749
269 Ga0105245_10018719 3300009098 Bacteria 6058
270 Ga0105245_10083841 3300009098 Bacteria 2918
271 Ga0105245_10132382 3300009098 Bacteria 2340
272 Ga0105247_10005197 3300009101 Bacteria 8229
273 Ga0105247_10043201 3300009101 Bacteria 2761
274 Ga0105247_10120425 3300009101 Bacteria 1700
275 Ga0105247_10122234 3300009101 Bacteria 1688
276 Ga0105247_10534453 3300009101 Bacteria 860
277 Ga0105247_10766575 3300009101 Bacteria 733
278 Ga0105247_10808356 3300009101 Bacteria 716
279 Ga0105243_10023714 3300009148 Bacteria 4676
280 Ga0105243_10246899 3300009148 Bacteria 1591
281 Ga0105241_10022043 3300009174 Bacteria 4715
282 Ga0105241_10022614 3300009174 Bacteria 4657
283 Ga0105241_10244997 3300009174 Bacteria 1517
284 Ga0105241_10351808 3300009174 Bacteria 1279
285 Ga0105241_10447478 3300009174 Bacteria 1142
286 Ga0105242_10193943 3300009176 Bacteria 1800
287 Ga0105242_10279996 3300009176 Bacteria 1515
288 Ga0105248_10199489 3300009177 Bacteria 2254
289 Ga0105248_10489643 3300009177 Bacteria 1386
290 Ga0105248_10614982 3300009177 Bacteria 1226
291 Ga0105248_10836986 3300009177 Bacteria 1039
292 Ga0105248_10858407 3300009177 Bacteria 1025
293 Ga0105248_10989480 3300009177 Bacteria 950
294 Ga0105248_11095786 3300009177 Bacteria 900
295 Ga0105237_10003757 3300009545 Bacteria 17883
296 Ga0105237_10013957 3300009545 Bacteria 8407
297 Ga0105237_10108092 3300009545 Bacteria 2773
298 Ga0105237_10154651 3300009545 Bacteria 2290
299 Ga0105237_10207611 3300009545 Bacteria 1959
300 Ga0105237_10355262 3300009545 Bacteria 1470
301 Ga0105238_10012843 3300009551 Bacteria 8450
302 Ga0105238_10087356 3300009551 Bacteria 3105
303 Ga0105238_10108517 3300009551 Bacteria 2757
304 Ga0105238_10355678 3300009551 Bacteria 1454
305 Ga0105238_10378419 3300009551 Bacteria 1407
306 Ga0105238_10431818 3300009551 Bacteria 1313
307 Ga0105238_10991369 3300009551 Bacteria 861
308 Ga0105249_10548931 3300009553 Bacteria 1206
309 Ga0099796_10007070 3300010159 Bacteria 2914
310 Ga0105239_10083730 3300010375 Bacteria 3513
311 Ga0105239_10095378 3300010375 Bacteria 3286
312 Ga0105239_10099271 3300010375 Bacteria 3219
313 Ga0105239_10132392 3300010375 Bacteria 2774
314 Ga0105239_10168407 3300010375 Bacteria 2450
315 Ga0105239_10300527 3300010375 Bacteria 1807
316 Ga0105239_10489871 3300010375 Bacteria 1397
317 Ga0105239_10608053 3300010375 Bacteria 1247
318 Ga0105239_10734397 3300010375 Bacteria 1130
319 Ga0105246_10121996 3300011119 Bacteria 1933
320 Ga0105246_10388004 3300011119 Bacteria 1156
321 Ga0105246_10416012 3300011119 Bacteria 1120
322 Ga0157325_1010924 3300012485 Bacteria 675
323 Ga0157313_1006498 3300012503 Bacteria 881
324 Ga0157373_10114711 3300013100 Bacteria 1894
325 Ga0157371_10127012 3300013102 Bacteria 1814
326 Ga0157370_10076545 3300013104 Bacteria 3152
327 Ga0157370_10358922 3300013104 Bacteria 1343
328 Ga0157370_10375147 3300013104 Bacteria 1310
329 Ga0157370_10562780 3300013104 Bacteria 1045
330 Ga0157370_10970339 3300013104 Bacteria 770
331 Ga0157369_10008435 3300013105 Bacteria 11819
332 Ga0157369_10030907 3300013105 Bacteria 5902
333 Ga0157369_10163132 3300013105 Bacteria 2351
334 Ga0157369_10455646 3300013105 Bacteria 1324
335 Ga0157369_10830928 3300013105 Bacteria 948
336 Ga0157374_10073477 3300013296 Bacteria 3228
337 Ga0157374_10161238 3300013296 Bacteria 2184
338 Ga0157374_10172122 3300013296 Bacteria 2113
339 Ga0157374_11494353 3300013296 Bacteria 699
340 Ga0157378_10015347 3300013297 Bacteria 6709
341 Ga0157378_10375595 3300013297 Bacteria 1395
342 Ga0163162_10413533 3300013306 Bacteria 1481
343 Ga0163162_10605167 3300013306 Bacteria 1222
344 Ga0157372_10096728 3300013307 Bacteria 3365
345 Ga0157372_10447920 3300013307 Bacteria 1505
346 Ga0157372_10756641 3300013307 Bacteria 1130
347 Ga0157372_11580295 3300013307 Bacteria 755
348 Ga0157375_10022349 3300013308 Bacteria 5821
349 Ga0157375_10191028 3300013308 Bacteria 2202
350 Ga0157375_10247572 3300013308 Bacteria 1943
351 Ga0157375_10312102 3300013308 Bacteria 1737
352 Ga0157375_10529595 3300013308 Bacteria 1341
353 Ga0157375_10586051 3300013308 Bacteria 1275
354 Ga0157375_11317625 3300013308 Bacteria 849
355 Ga0163163_10017322 3300014325 Bacteria 6718
356 Ga0163163_10048111 3300014325 Bacteria 4192
357 Ga0163163_10420635 3300014325 Bacteria 1395
358 Ga0163163_10549931 3300014325 Bacteria 1217
359 Ga0163163_11066205 3300014325 Bacteria 871
360 Ga0157380_10126713 3300014326 Bacteria 2171
361 Ga0157380_10338062 3300014326 Bacteria 1403
362 Ga0157380_10358136 3300014326 Bacteria 1368
363 Ga0157380_11479962 3300014326 Bacteria 731
364 Ga0157377_10198201 3300014745 Bacteria 1273
365 Ga0157379_10250131 3300014968 Bacteria 1609
366 Ga0157379_10434627 3300014968 Bacteria 1210
367 Ga0157379_10631896 3300014968 Bacteria 1001
368 Ga0157376_10054586 3300014969 Bacteria 3331
369 Ga0157376_10247875 3300014969 Bacteria 1662
370 Ga0157376_10438937 3300014969 Bacteria 1271
371 Ga0157376_10550588 3300014969 Bacteria 1142
372 Ga0163161_10180473 3300017792 Bacteria 1618
373 Ga0163161_10414456 3300017792 Bacteria 1082
374 Ga0214544_1000009 3300021320 Bacteria 285865
375 Ga0214542_1000002 3300021321 Bacteria 720798
376 Ga0214545_1000002 3300021324 Bacteria 727485
377 Ga0214543_1000013 3300021327 Bacteria 329117
378 Ga0213873_10038419 3300021358 Bacteria 1223
379 Ga0213874_10051145 3300021377 Bacteria 1268
380 Ga0213876_10001848 3300021384 Bacteria 12750
381 Ga0213876_10011429 3300021384 Bacteria 4740
382 Ga0213875_10035810 3300021388 Bacteria 2341
383 Ga0213875_10269927 3300021388 Bacteria 803
384 Ga0209563_101045 3300025230 Bacteria 7993
385 Ga0209677_102385 3300025253 Bacteria 7158
386 Ga0209677_102571 3300025253 Bacteria 6678
387 Ga0209148_1000446 3300025254 Bacteria 45354
388 Ga0209233_1001302 3300025261 Bacteria 9962
389 Ga0209233_1001367 3300025261 Bacteria 9687
390 Ga0209233_1031508 3300025261 Bacteria 1237
391 Ga0209455_1006256 3300025272 Bacteria 3543
392 Ga0209673_1049900 3300025273 Bacteria 1115
393 Ga0209564_1009891 3300025295 Bacteria 4467
394 Ga0209564_1024293 3300025295 Bacteria 2074
395 Ga0209758_1000100 3300025297 Bacteria 227948
396 Ga0209758_1000160 3300025297 Bacteria 154304
397 Ga0209758_1002793 3300025297 Bacteria 17073
398 Ga0209758_1003932 3300025297 Bacteria 12945
399 Ga0209758_1005852 3300025297 Bacteria 9179
400 Ga0209758_1016663 3300025297 Bacteria 3715
401 Ga0209758_1030410 3300025297 Bacteria 2237
402 Ga0209758_1031291 3300025297 Bacteria 2185
403 Ga0209050_1050100 3300025298 Bacteria 1064
404 Ga0209256_1010637 3300025299 Bacteria 3820
405 Ga0207426_1001094 3300025302 Bacteria 25012
406 Ga0207426_1002241 3300025302 Bacteria 12874
407 Ga0207426_1021409 3300025302 Bacteria 2236
408 Ga0209257_1005571 3300025304 Bacteria 8758
409 Ga0207697_10040240 3300025315 Bacteria 1919
410 Ga0207697_10137630 3300025315 Bacteria 1058
411 Ga0207697_10307825 3300025315 Bacteria 703
412 Ga0207656_10212297 3300025321 Bacteria 938
413 Ga0207696_1077977 3300025711 Bacteria 917
414 Ga0207692_10000308 3300025898 Bacteria 16906
415 Ga0207692_10002064 3300025898 Bacteria 7672
416 Ga0207692_10095563 3300025898 Bacteria 1621
417 Ga0207642_10018415 3300025899 Bacteria 2680
418 Ga0207710_10005066 3300025900 Bacteria 5706
419 Ga0207710_10011801 3300025900 Bacteria 3674
420 Ga0207688_10224906 3300025901 Bacteria 1131
421 Ga0207680_10359672 3300025903 Bacteria 1023
422 Ga0207647_10015173 3300025904 Bacteria 5291
423 Ga0207647_10066702 3300025904 Bacteria 2182
424 Ga0207647_10150208 3300025904 Bacteria 1362
425 Ga0207647_10173629 3300025904 Bacteria 1254
426 Ga0207685_10000468 3300025905 Bacteria 6799
427 Ga0207685_10068762 3300025905 Bacteria 1428
428 Ga0207699_10001291 3300025906 Bacteria 11902
429 Ga0207699_10010647 3300025906 Bacteria 4624
430 Ga0207699_10128528 3300025906 Bacteria 1649
431 Ga0207645_10027775 3300025907 Bacteria 3653
432 Ga0207645_10030138 3300025907 Bacteria 3496
433 Ga0207643_10223284 3300025908 Bacteria 1154
434 Ga0207705_10274616 3300025909 Bacteria 1289
435 Ga0207684_10085353 3300025910 Bacteria 2689
436 Ga0207654_10070600 3300025911 Bacteria 2074
437 Ga0207654_10077759 3300025911 Bacteria 1990
438 Ga0207654_10185810 3300025911 Bacteria 1359
439 Ga0207707_10000494 3300025912 Bacteria 40531
440 Ga0207707_10000896 3300025912 Bacteria 29115
441 Ga0207707_10026257 3300025912 Bacteria 5091
442 Ga0207707_10109574 3300025912 Bacteria 2414
443 Ga0207707_10304168 3300025912 Bacteria 1379
444 Ga0207695_10000278 3300025913 Bacteria 127446
445 Ga0207695_10080608 3300025913 Bacteria 3296
446 Ga0207695_10184308 3300025913 Bacteria 2007
447 Ga0207695_10254696 3300025913 Bacteria 1654
448 Ga0207695_10340327 3300025913 Bacteria 1388
449 Ga0207695_10752725 3300025913 Bacteria 854
450 Ga0207671_10006710 3300025914 Bacteria 10194
451 Ga0207671_10062495 3300025914 Bacteria 2765
452 Ga0207671_10128103 3300025914 Bacteria 1946
453 Ga0207671_10187699 3300025914 Bacteria 1611
454 Ga0207671_10222555 3300025914 Bacteria 1479
455 Ga0207671_10388735 3300025914 Bacteria 1109
456 Ga0207693_10001932 3300025915 Bacteria 18147
457 Ga0207693_10006236 3300025915 Bacteria 9891
458 Ga0207693_10012373 3300025915 Bacteria 6893
459 Ga0207693_10013898 3300025915 Bacteria 6483
460 Ga0207693_10105956 3300025915 Bacteria 2205
461 Ga0207663_10000365 3300025916 Bacteria 19715
462 Ga0207663_10007002 3300025916 Bacteria 5817
463 Ga0207663_10027757 3300025916 Bacteria 3304
464 Ga0207663_10129357 3300025916 Bacteria 1742
465 Ga0207660_10001052 3300025917 Bacteria 18273
466 Ga0207660_10017659 3300025917 Bacteria 4744
467 Ga0207660_10065377 3300025917 Bacteria 2628
468 Ga0207660_10082459 3300025917 Bacteria 2366
469 Ga0207657_10011901 3300025919 Bacteria 8609
470 Ga0207657_10199380 3300025919 Bacteria 1611
471 Ga0207657_10348207 3300025919 Bacteria 1168
472 Ga0207657_10349687 3300025919 Bacteria 1166
473 Ga0207657_10416926 3300025919 Bacteria 1056
474 Ga0207649_10891177 3300025920 Bacteria 697
475 Ga0207652_10001721 3300025921 Bacteria 19093
476 Ga0207652_10002542 3300025921 Bacteria 15319
477 Ga0207652_10029879 3300025921 Bacteria 4561
478 Ga0207652_10033319 3300025921 Bacteria 4337
479 Ga0207652_10255219 3300025921 Bacteria 1581
480 Ga0207652_10264232 3300025921 Bacteria 1552
481 Ga0207652_10346860 3300025921 Bacteria 1340
482 Ga0207646_10052414 3300025922 Bacteria 3651
483 Ga0207681_10237112 3300025923 Bacteria 1418
484 Ga0207694_10046441 3300025924 Bacteria 3356
485 Ga0207694_10115281 3300025924 Bacteria 2140
486 Ga0207694_10195200 3300025924 Bacteria 1646
487 Ga0207694_10239753 3300025924 Bacteria 1482
488 Ga0207694_10272737 3300025924 Bacteria 1388
489 Ga0207694_10671562 3300025924 Bacteria 873
490 Ga0207694_11045332 3300025924 Bacteria 691
491 Ga0207650_10105342 3300025925 Bacteria 2177
492 Ga0207687_10012698 3300025927 Bacteria 5503
493 Ga0207687_10086909 3300025927 Bacteria 2271
494 Ga0207687_10355679 3300025927 Bacteria 1194
495 Ga0207700_10000752 3300025928 Bacteria 18675
496 Ga0207700_10076249 3300025928 Bacteria 2601
497 Ga0207700_10209162 3300025928 Bacteria 1648
498 Ga0207700_10639121 3300025928 Bacteria 948
499 Ga0207664_10023582 3300025929 Bacteria 4613
500 Ga0207664_10143318 3300025929 Bacteria 2024
501 Ga0207664_10843445 3300025929 Bacteria 824
502 Ga0207644_10058994 3300025931 Bacteria 2775
503 Ga0207644_10244542 3300025931 Bacteria 1429
504 Ga0207690_10197654 3300025932 Bacteria 1525
505 Ga0207690_10291979 3300025932 Bacteria 1273
506 Ga0207690_10358604 3300025932 Bacteria 1154
507 Ga0207706_10114484 3300025933 Bacteria 2372
508 Ga0207686_10173751 3300025934 Bacteria 1522
509 Ga0207686_10373665 3300025934 Bacteria 1079
510 Ga0207709_10052805 3300025935 Bacteria 2498
511 Ga0207709_10369126 3300025935 Bacteria 1089
512 Ga0207669_10052815 3300025937 Bacteria 2444
513 Ga0207669_10086954 3300025937 Bacteria 2023
514 Ga0207669_10258533 3300025937 Bacteria 1301
515 Ga0207669_10447611 3300025937 Bacteria 1023
516 Ga0207669_10572483 3300025937 Bacteria 914
517 Ga0207704_10014890 3300025938 Bacteria 3945
518 Ga0207665_10000957 3300025939 Bacteria 19547
519 Ga0207665_10004741 3300025939 Bacteria 9038
520 Ga0207665_10539715 3300025939 Bacteria 905
521 Ga0207691_10033524 3300025940 Bacteria 4780
522 Ga0207691_10034661 3300025940 Bacteria 4692
523 Ga0207691_10824720 3300025940 Bacteria 779
524 Ga0207711_10396851 3300025941 Bacteria 1281
525 Ga0207711_10430120 3300025941 Bacteria 1228
526 Ga0207711_10931781 3300025941 Bacteria 807
527 Ga0207689_10188972 3300025942 Bacteria 1699
528 Ga0207689_10240079 3300025942 Bacteria 1498
529 Ga0207689_10365900 3300025942 Bacteria 1199
530 Ga0207661_10015207 3300025944 Bacteria 5658
531 Ga0207661_10223074 3300025944 Bacteria 1666
532 Ga0207661_10390469 3300025944 Bacteria 1261
533 Ga0207679_10054680 3300025945 Bacteria 2940
534 Ga0207679_10541624 3300025945 Bacteria 1043
535 Ga0207679_10565554 3300025945 Bacteria 1021
536 Ga0207667_10003512 3300025949 Bacteria 19383
537 Ga0207667_10010956 3300025949 Bacteria 10568
538 Ga0207667_10184363 3300025949 Bacteria 2143
539 Ga0207667_10215470 3300025949 Bacteria 1968
540 Ga0207667_10330631 3300025949 Bacteria 1556
541 Ga0207667_10521761 3300025949 Bacteria 1203
542 Ga0207667_11267521 3300025949 Bacteria 714
543 Ga0207651_10307059 3300025960 Bacteria 1321
544 Ga0207651_10650690 3300025960 Bacteria 925
545 Ga0207712_10215242 3300025961 Bacteria 1533
546 Ga0207712_10687044 3300025961 Bacteria 892
547 Ga0207668_10106980 3300025972 Bacteria 2090
548 Ga0207668_10191611 3300025972 Bacteria 1620
549 Ga0207668_10193574 3300025972 Bacteria 1613
550 Ga0207668_10221896 3300025972 Bacteria 1518
551 Ga0207668_11005197 3300025972 Bacteria 745
552 Ga0207658_10255064 3300025986 Bacteria 1492
553 Ga0207658_10258570 3300025986 Bacteria 1483
554 Ga0207658_11234830 3300025986 Bacteria 683
555 Ga0207677_10194612 3300026023 Bacteria 1607
556 Ga0207677_10602621 3300026023 Bacteria 964
557 Ga0207703_10093548 3300026035 Bacteria 2532
558 Ga0207703_10131827 3300026035 Bacteria 2159
559 Ga0207703_10204380 3300026035 Bacteria 1757
560 Ga0207703_10263644 3300026035 Bacteria 1558
561 Ga0207703_11031884 3300026035 Bacteria 789
562 Ga0207639_10007089 3300026041 Bacteria 7645
563 Ga0207639_10149273 3300026041 Bacteria 1956
564 Ga0207639_10358067 3300026041 Bacteria 1305
565 Ga0207639_10685993 3300026041 Bacteria 950
566 Ga0207639_10903925 3300026041 Bacteria 825
567 Ga0207678_10060617 3300026067 Bacteria 3254
568 Ga0207678_10066555 3300026067 Bacteria 3094
569 Ga0207678_10091282 3300026067 Bacteria 2603
570 Ga0207678_10126493 3300026067 Bacteria 2180
571 Ga0207678_10399880 3300026067 Bacteria 1189
572 Ga0207678_10798733 3300026067 Bacteria 833
573 Ga0207702_10004908 3300026078 Bacteria 11764
574 Ga0207702_10291263 3300026078 Bacteria 1547
575 Ga0207702_10300882 3300026078 Bacteria 1522
576 Ga0207702_10577360 3300026078 Bacteria 1102
577 Ga0207702_10683171 3300026078 Bacteria 1011
578 Ga0207702_10768230 3300026078 Bacteria 952
579 Ga0207641_10458860 3300026088 Bacteria 1232
580 Ga0207648_10027013 3300026089 Bacteria 5097
581 Ga0207676_10121979 3300026095 Bacteria 2200
582 Ga0207676_10183059 3300026095 Bacteria 1836
583 Ga0207676_10572198 3300026095 Bacteria 1082
584 Ga0207676_10635248 3300026095 Bacteria 1029
585 Ga0207674_10016819 3300026116 Bacteria 7994
586 Ga0207674_10076950 3300026116 Bacteria 3343
587 Ga0207674_10078158 3300026116 Bacteria 3314
588 Ga0207674_10812741 3300026116 Bacteria 902
589 Ga0207675_100193953 3300026118 Bacteria 1949
590 Ga0207675_100196150 3300026118 Bacteria 1938
591 Ga0207683_10036246 3300026121 Bacteria 4294
592 Ga0207683_10075265 3300026121 Bacteria 2988
593 Ga0207683_10262697 3300026121 Bacteria 1576
594 Ga0207698_10033235 3300026142 Bacteria 3746
595 Ga0207698_10094835 3300026142 Bacteria 2455
596 Ga0207698_10384358 3300026142 Bacteria 1336
597 Ga0209389_1000113 3300027296 Bacteria 72242
598 Ga0209589_1000023 3300027357 Bacteria 177856
599 Ga0209589_1000041 3300027357 Bacteria 125191
600 Ga0209489_100032 3300027361 Bacteria 177856
601 Ga0209489_100070 3300027361 Bacteria 138580
602 Ga0209489_107143 3300027361 Bacteria 17020
603 Ga0209700_100021 3300027363 Bacteria 230859
604 Ga0209700_100040 3300027363 Bacteria 177856
605 Ga0209588_1027013 3300027671 Bacteria 1825
606 Ga0209813_10016723 3300027866 Bacteria 2005
607 Ga0209813_10059055 3300027866 Bacteria 1220
608 Ga0268266_10063942 3300028379 Bacteria 3177
609 Ga0268266_10097492 3300028379 Bacteria 2585
610 Ga0268266_10149445 3300028379 Bacteria 2104
611 Ga0268266_10272122 3300028379 Bacteria 1572
612 Ga0268265_10044540 3300028380 Bacteria 3304
613 Ga0268265_10069413 3300028380 Bacteria 2736
614 Ga0268265_10267710 3300028380 Bacteria 1522
615 Ga0268265_10268890 3300028380 Bacteria 1519
616 Ga0268264_10000022 3300028381 Bacteria 476624
617 Ga0268264_10094942 3300028381 Bacteria 2579
618 Ga0268264_10294537 3300028381 Bacteria 1525
619 Ga0268264_10872588 3300028381 Bacteria 902
620 Ga0265337_1010612 3300028556 Bacteria 3215
621 Ga0265334_10033498 3300028573 Bacteria 2044
622 Ga0265334_10034598 3300028573 Bacteria 2004
623 Ga0265318_10123634 3300028577 Bacteria 951
624 Ga0265323_10019751 3300028653 Bacteria 2597
625 Ga0307517_10001054 3300028786 Bacteria 46731
626 Ga0307515_10073527 3300028794 Bacteria 4592
627 Ga0265338_10000337 3300028800 Bacteria 85427
628 Ga0265338_10611853 3300028800 Bacteria 758
629 Ga0265324_10010988 3300029957 Bacteria 3468
630 Ga0307511_10214421 3300030521 Bacteria 977
631 Ga0265762_1021662 3300030760 Bacteria 1186
632 Ga0265760_10119633 3300031090 Bacteria 844
633 Ga0265325_10017156 3300031241 Bacteria 4029
634 Ga0265340_10011816 3300031247 Bacteria 4627
635 Ga0265340_10128737 3300031247 Bacteria 1162
636 Ga0265339_10021644 3300031249 Bacteria 3736
637 Ga0265339_10071611 3300031249 Bacteria 1846
638 Ga0265331_10080665 3300031250 Bacteria 1512
639 Ga0265331_10151928 3300031250 Bacteria 1051
640 Ga0265331_10197745 3300031250 Bacteria 906
641 Ga0265316_10120452 3300031344 Bacteria 1982
642 Ga0307513_10242240 3300031456 Bacteria 1607
643 Ga0307513_10539348 3300031456 Bacteria 880
644 Ga0307509_10069489 3300031507 Bacteria 3681
645 Ga0307509_10248383 3300031507 Bacteria 1565
646 Ga0307509_10276692 3300031507 Bacteria 1442
647 Ga0307408_100624601 3300031548 Bacteria 960
648 Ga0307408_100812913 3300031548 Bacteria 849
649 Ga0265313_10241970 3300031595 Bacteria 738
650 Ga0307508_10000038 3300031616 Bacteria 150186
651 Ga0307508_10011952 3300031616 Bacteria 7942
652 Ga0307508_10049566 3300031616 Bacteria 3740
653 Ga0307508_10179027 3300031616 Bacteria 1722
654 Ga0307508_10231295 3300031616 Bacteria 1447
655 Ga0307508_10484184 3300031616 Bacteria 831
656 Ga0265314_10010719 3300031711 Bacteria 7626
657 Ga0265314_10416874 3300031711 Bacteria 722
658 Ga0265342_10005896 3300031712 Bacteria 9239
659 Ga0265342_10027683 3300031712 Bacteria 3537
660 Ga0307516_10021961 3300031730 Bacteria 6557
661 Ga0307516_10218372 3300031730 Bacteria 1617
662 Ga0307516_10253433 3300031730 Bacteria 1453
663 Ga0307516_10452957 3300031730 Bacteria 939
664 Ga0307405_10334448 3300031731 Bacteria 1162
665 Ga0307405_10486612 3300031731 Bacteria 986
666 Ga0307413_10128964 3300031824 Bacteria 1727
667 Ga0307518_10237817 3300031838 Bacteria 1172
668 Ga0307407_10086172 3300031903 Bacteria 1913
669 Ga0307409_100135783 3300031995 Bacteria 2110
670 Ga0307416_100096572 3300032002 Bacteria 2556
671 Ga0307414_10211996 3300032004 Bacteria 1584
672 Ga0307415_100298446 3300032126 Bacteria 1333
673 Ga0307507_10006782 3300033179 Bacteria 17185
674 Ga0307510_10046892 3300033180 Bacteria 4640
675 Ga0307510_10059591 3300033180 Bacteria 3939
676 Ga0315911_1000001 3300033442 Bacteria 1088602
677 Ga0316215_1008573 3300033544 Bacteria 1005
678 Ga0373958_0094615 3300034819 Bacteria 694
679 Ga0373926_0001023 3300035083 Bacteria 8192
680 Ga0373926_0042922 3300035083 Bacteria 1618
681 Ga0373934_0059515 3300035086 Bacteria 1520
682 Ga0373944_0055536 3300035089 Bacteria 1258
683 Ga0373952_0032660 3300035092 Bacteria 1164
684 Ga0373923_0000923 3300035111 Bacteria 7846
685 Ga0373923_0033913 3300035111 Bacteria 2069
686 Ga0373932_0079158 3300035112 Bacteria 1035
687 Ga0373936_0026216 3300035113 Bacteria 2283
688 Ga0373936_0036592 3300035113 Bacteria 1958
689 Ga0373936_0214801 3300035113 Bacteria 852
690 Ga0373939_0073328 3300035114 Bacteria 1120
691 Ga0373941_0010495 3300035115 Bacteria 2368
692 Ga0373945_0011559 3300035116 Bacteria 2921
693 Ga0373945_0056625 3300035116 Bacteria 1454
694 Ga0373953_0007891 3300035117 Bacteria 3588
695 Ga0373953_0015186 3300035117 Bacteria 2785
696 Ga0373953_0067556 3300035117 Bacteria 1471
697 Ga0373954_0041893 3300035118 Bacteria 2135
698 Ga0373954_0102801 3300035118 Bacteria 1379
699 Ga0373954_0158867 3300035118 Bacteria 1105
700 Ga0373957_0000375 3300035120 Bacteria 11330
701 Ga0373943_0039246 3300035170 Bacteria 2281
702 Ga0373946_0025361 3300035171 Bacteria 2331
703 Ga0373955_0001328 3300035172 Bacteria 10490
704 Ga0373924_0001614 3300035410 Bacteria 7396
705 Ga0373924_0110706 3300035410 Bacteria 1187
706 Ga0373931_0014501 3300035691 Bacteria 3853
707 Ga0373935_0284639 3300035692 Bacteria 1164
708 Ga0373935_0296239 3300035692 Bacteria 1142
709 Ga0373935_0450177 3300035692 Bacteria 930
710 Ga0373935_0525089 3300035692 Bacteria 861
711 Ga0373927_0000225 3300035695 Bacteria 44840
712 Ga0373927_0027925 3300035695 Bacteria 3683
713 Ga0373927_0032601 3300035695 Bacteria 3393
714 Ga0373927_0061827 3300035695 Bacteria 2422
715 Ga0373927_0092919 3300035695 Bacteria 1960
716 Ga0373927_0141451 3300035695 Bacteria 1574
717 Ga0373927_0166913 3300035695 Bacteria 1442
718 Ga0373933_0001518 3300035724 Bacteria 13555
719 Ga0373933_0043637 3300035724 Bacteria 2654
720 Ga0373933_0047712 3300035724 Bacteria 2548
721 Ga0373933_0142763 3300035724 Bacteria 1512
722 Ga0373947_0023122 3300035725 Bacteria 3613
723 Ga0373947_0137064 3300035725 Bacteria 1567
724 Ga0373947_0263604 3300035725 Bacteria 1142
725 Ga0373947_0406711 3300035725 Bacteria 918
726 Ga0373937_0091905 3300036401 Bacteria 2812
727 Ga0373937_0196775 3300036401 Bacteria 1894
728 Ga0373925_0000711 3300037068 Bacteria 31078
729 Ga0373925_0057892 3300037068 Bacteria 2905
730 Ga0373925_0101408 3300037068 Bacteria 2213
731 Ga0373925_0197535 3300037068 Bacteria 1598
732 Ga0373925_0209187 3300037068 Bacteria 1554
733 Ga0395899_0140917 3300037312 Bacteria 1715
734 Ga0395900_0000860 3300037418 Bacteria 40028
735 Ga0395900_0323770 3300037418 Bacteria 1521
736 Ga0395900_0483145 3300037418 Bacteria 1191
737 Ga0395898_0046012 3300037466 Bacteria 4287
738 Ga0395905_0056855 3300037471 Bacteria 3659
739 Ga0395905_0123786 3300037471 Bacteria 2431
740 Ga0436364_0267346 3300037853 Bacteria 1497
741 Ga0436364_0500303 3300037853 Bacteria 3660
742 Ga0436364_1340351 3300037853 Bacteria 1989
743 Ga0395901_0057535 3300038443 Bacteria 4044
744 Ga0395901_0974883 3300038443 Bacteria 825
745 Ga0436365_0151039 3300039437 Bacteria 2043
746 Ga0436365_0268210 3300039437 Bacteria 9455
747 Ga0436365_0710303 3300039437 Bacteria 1014
748 Ga0436365_1095310 3300039437 Bacteria 3618
749 Ga0436365_1396402 3300039437 Bacteria 1602
750 Ga0436365_1591893 3300039437 Bacteria 688
751 Ga0436365_1655446 3300039437 Bacteria 1705
752 Ga0436365_1817893 3300039437 Bacteria 1337
753 Ga0436365_1870953 3300039437 Bacteria 1609
754 Ga0436360_0660865 3300039438 Bacteria 1247
755 Ga0436363_0772753 3300039450 Bacteria 4670
756 Ga0436363_0894926 3300039450 Bacteria 838
757 Ga0436363_1201079 3300039450 Bacteria 3284
758 Ga0436363_1223665 3300039450 Bacteria 1105
759 Ga0436362_0332326 3300039453 Bacteria 2918
760 Ga0439465_0108277 3300041413 Bacteria 965
761 Ga0451791_0964902 3300041451 Bacteria 700
762 Ga0451797_0764166 3300041453 Bacteria 807
763 Ga0451802_0611095 3300041460 Bacteria 696
764 Ga0451839_1631068 3300041496 Bacteria 958
765 Ga0451839_1657451 3300041496 Bacteria 2269
766 Ga0451841_0572120 3300041498 Bacteria 742
767 Ga0451849_0054097 3300041505 Bacteria 1846
768 Ga0451853_2886446 3300041512 Bacteria 695
769 Ga0451853_3008790 3300041512 Bacteria 648
770 Ga0451853_3547507 3300041512 Bacteria 893
771 Ga0439463_049467 3300042016 Bacteria 1072
772 Ga0439458_0079320 3300042157 Bacteria 836
773 Ga0466972_0000660 3300044658 Bacteria 16624
774 Ga0466972_0004579 3300044658 Bacteria 6928
775 Ga0466972_0109388 3300044658 Bacteria 1306
776 Ga0466965_0099463 3300044683 Bacteria 1486
777 Ga0466966_0000932 3300044684 Bacteria 18644
778 Ga0466966_0102237 3300044684 Bacteria 1772
779 Ga0466961_0000488 3300044693 Bacteria 25223
780 Ga0466963_0074240 3300044694 Bacteria 2293
781 Ga0466963_0121993 3300044694 Bacteria 1794
782 Ga0466964_0352582 3300044706 Bacteria 756
783 Ga0466964_0411657 3300044706 Bacteria 709
784 Ga0466968_0002010 3300044735 Bacteria 7392
785 Ga0466957_0079290 3300044842 Bacteria 2043
786 Ga0466957_0159408 3300044842 Bacteria 1465
787 Ga0466957_0407282 3300044842 Bacteria 931
788 Ga0466967_0031184 3300045976 Bacteria 4485
789 Ga0466967_0115452 3300045976 Bacteria 2472
790 Ga0495617_042503 3300046452 Bacteria 1519
791 Ga0495617_077806 3300046452 Bacteria 1088
792 Ga0495592_0002531 3300046454 Bacteria 12897
793 Ga0495592_0018338 3300046454 Bacteria 5321
794 Ga0495592_0395432 3300046454 Bacteria 876
795 Ga0495592_0603616 3300046454 Bacteria 669
796 Ga0495603_0001221 3300046455 Bacteria 14993
797 Ga0495603_0026173 3300046455 Bacteria 3525
798 Ga0495603_0191071 3300046455 Bacteria 1184
799 Ga0495629_0000179 3300046459 Bacteria 56885
800 Ga0495629_0001007 3300046459 Bacteria 22607
801 Ga0495629_0005795 3300046459 Bacteria 9214
802 Ga0495638_0012856 3300046460 Bacteria 5719
803 Ga0495638_0066840 3300046460 Bacteria 2208
804 Ga0495638_0258927 3300046460 Bacteria 955
805 Ga0495651_0013292 3300046462 Bacteria 6367
806 Ga0495651_0157426 3300046462 Bacteria 1631
807 Ga0495651_0162720 3300046462 Bacteria 1597
808 Ga0495651_0272952 3300046462 Bacteria 1146
809 Ga0495651_0323804 3300046462 Bacteria 1026
810 Ga0495651_0360313 3300046462 Bacteria 958
811 Ga0495651_0482053 3300046462 Bacteria 797
812 Ga0495653_0211587 3300046463 Bacteria 1309
813 Ga0495650_0207173 3300046471 Bacteria 679
814 Ga0495580_0000280 3300046472 Bacteria 41385
815 Ga0495580_0029169 3300046472 Bacteria 4005
816 Ga0495582_0000061 3300046473 Bacteria 55522
817 Ga0495582_0143590 3300046473 Bacteria 1353
818 Ga0495639_0000102 3300046475 Bacteria 42249
819 Ga0495639_0036398 3300046475 Bacteria 2204
820 Ga0495662_0000074 3300046476 Bacteria 35316
821 Ga0495662_0021975 3300046476 Bacteria 3083
822 Ga0495664_0077067 3300046477 Bacteria 1996
823 Ga0495664_0116766 3300046477 Bacteria 1613
824 Ga0495584_0367079 3300046491 Bacteria 731
825 Ga0495585_0200184 3300046492 Bacteria 1017
826 Ga0495594_0000378 3300046499 Bacteria 22340
827 Ga0495594_0188928 3300046499 Bacteria 1173
828 Ga0495594_0310518 3300046499 Bacteria 898
829 Ga0495594_0332067 3300046499 Bacteria 866
830 Ga0495583_0038104 3300046506 Bacteria 2274
831 Ga0495606_0003007 3300046507 Bacteria 18477
832 Ga0495606_0094118 3300046507 Bacteria 1837
833 Ga0495606_0296470 3300046507 Bacteria 878
834 Ga0495608_0017019 3300046511 Bacteria 5029
835 Ga0495608_0410528 3300046511 Bacteria 827
836 Ga0495610_0086587 3300046512 Bacteria 1427
837 Ga0495610_0116191 3300046512 Bacteria 1179
838 Ga0495616_0254761 3300046513 Bacteria 753
839 Ga0495618_0007907 3300046514 Bacteria 6435
840 Ga0495618_0039412 3300046514 Bacteria 2970
841 Ga0495618_0245563 3300046514 Bacteria 1124
842 Ga0495620_0035877 3300046515 Bacteria 2225
843 Ga0495628_0004580 3300046516 Bacteria 12233
844 Ga0495628_0058989 3300046516 Bacteria 3015
845 Ga0495628_0078743 3300046516 Bacteria 2563
846 Ga0495628_0393307 3300046516 Bacteria 1014
847 Ga0495630_0001032 3300046517 Bacteria 19216
848 Ga0495630_0037229 3300046517 Bacteria 3638
849 Ga0495631_0105640 3300046518 Bacteria 1211
850 Ga0495632_0049316 3300046519 Bacteria 2081
851 Ga0495632_0214786 3300046519 Bacteria 871
852 Ga0495643_0019680 3300046522 Bacteria 3901
853 Ga0495648_0002612 3300046524 Bacteria 16461
854 Ga0495648_0002918 3300046524 Bacteria 15363
855 Ga0495648_0030845 3300046524 Bacteria 3538
856 Ga0495648_0030855 3300046524 Bacteria 3537
857 Ga0495648_0044101 3300046524 Bacteria 2787
858 Ga0495648_0118640 3300046524 Bacteria 1426
859 Ga0495648_0147774 3300046524 Bacteria 1229
860 Ga0495648_0207891 3300046524 Bacteria 975
861 Ga0495666_0007696 3300046526 Bacteria 5389
862 Ga0495642_0245168 3300046528 Bacteria 783
863 Ga0495652_0003857 3300046529 Bacteria 14624
864 Ga0495652_0032487 3300046529 Bacteria 4564
865 Ga0495652_0075661 3300046529 Bacteria 2795
866 Ga0495652_0249787 3300046529 Bacteria 1315
867 Ga0495654_0178950 3300046530 Bacteria 919
868 Ga0495665_0000261 3300046531 Bacteria 26625
869 Ga0495665_0011427 3300046531 Bacteria 4804
870 Ga0495640_0040108 3300046533 Bacteria 3280
871 Ga0495640_0060166 3300046533 Bacteria 2584
872 Ga0495640_0116764 3300046533 Bacteria 1738
873 Ga0495640_0270334 3300046533 Bacteria 1060
874 Ga0495586_0239141 3300046535 Bacteria 1035
875 Ga0495587_0012126 3300046536 Bacteria 5441
876 Ga0495587_0079430 3300046536 Bacteria 1902
877 Ga0495587_0181922 3300046536 Bacteria 1192
878 Ga0495621_0022283 3300046539 Bacteria 2098
879 Ga0495597_0138775 3300046542 Bacteria 1004
880 Ga0495597_0159820 3300046542 Bacteria 920
881 Ga0495645_0025567 3300046543 Bacteria 4286
882 Ga0495645_0147373 3300046543 Bacteria 1638
883 Ga0495645_0258674 3300046543 Bacteria 1154
884 Ga0495645_0277518 3300046543 Bacteria 1103
885 Ga0495645_0335358 3300046543 Bacteria 978
886 Ga0495622_0016935 3300046557 Bacteria 3392
887 Ga0495622_0101574 3300046557 Bacteria 1318
888 Ga0495633_0127435 3300046558 Bacteria 1178
889 Ga0495667_0004202 3300046559 Bacteria 9704
890 Ga0495667_0036521 3300046559 Bacteria 3279
891 Ga0495667_0124599 3300046559 Bacteria 1663
892 Ga0495667_0136614 3300046559 Bacteria 1580
893 Ga0495656_0096587 3300046615 Bacteria 1360
894 Ga0495668_0050083 3300046616 Bacteria 2315
895 Ga0495668_0053210 3300046616 Bacteria 2239
896 Ga0495668_0231398 3300046616 Bacteria 1012
897 Ga0495634_0000161 3300046642 Bacteria 60925
898 Ga0495634_0022358 3300046642 Bacteria 4457
899 Ga0495634_0195081 3300046642 Bacteria 1260
900 Ga0495625_0048156 3300046660 Bacteria 3070
901 Ga0495625_0331278 3300046660 Bacteria 967
902 Ga0495635_0008716 3300046663 Bacteria 7083
903 Ga0495635_0033710 3300046663 Bacteria 3552
904 Ga0495635_0037786 3300046663 Bacteria 3342
905 Ga0495635_0054592 3300046663 Bacteria 2752
906 Ga0495635_0071655 3300046663 Bacteria 2375
907 Ga0495659_0014177 3300046664 Bacteria 2606
908 Ga0495659_0203320 3300046664 Bacteria 813
909 Ga0495661_0181418 3300046665 Bacteria 1115
910 Ga0495588_0020981 3300046674 Bacteria 3215
911 Ga0495588_0025233 3300046674 Bacteria 2960
912 Ga0495588_0321470 3300046674 Bacteria 814
913 Ga0495588_0323936 3300046674 Bacteria 810
914 Ga0495588_0427306 3300046674 Bacteria 695
915 Ga0495657_0015740 3300046675 Bacteria 5526
916 Ga0495657_0019424 3300046675 Bacteria 4901
917 Ga0495657_0064717 3300046675 Bacteria 2407
918 Ga0495599_0009174 3300046678 Bacteria 6035
919 Ga0495599_0084427 3300046678 Bacteria 1983
920 Ga0495599_0183929 3300046678 Bacteria 1287
921 Ga0495599_0309661 3300046678 Bacteria 952
922 Ga0495623_0023186 3300046679 Bacteria 4006
923 Ga0495623_0035017 3300046679 Bacteria 3218
924 Ga0495623_0082545 3300046679 Bacteria 1986
925 Ga0495623_0115991 3300046679 Bacteria 1618
926 Ga0495623_0145015 3300046679 Bacteria 1409
927 Ga0495623_0159907 3300046679 Bacteria 1325
928 Ga0495623_0248044 3300046679 Bacteria 1003
929 Ga0495646_0040870 3300046680 Bacteria 2853
930 Ga0495646_0086315 3300046680 Bacteria 1820
931 Ga0495646_0097016 3300046680 Bacteria 1694
932 Ga0495647_0028695 3300046681 Bacteria 2053
933 Ga0495658_0000315 3300046683 Bacteria 27478
934 Ga0495658_0109624 3300046683 Bacteria 1658
935 Ga0495669_0281291 3300046684 Bacteria 800
936 Ga0495613_0002949 3300046689 Bacteria 12727
937 Ga0495613_0218703 3300046689 Bacteria 1338
938 Ga0495613_0373042 3300046689 Bacteria 977
939 Ga0495624_0029489 3300046690 Bacteria 3580
940 Ga0495624_0058579 3300046690 Bacteria 2418
941 Ga0495624_0379776 3300046690 Bacteria 849
942 Ga0495670_0020190 3300046691 Bacteria 3283
943 Ga0495671_0147083 3300046692 Bacteria 1147
944 Ga0495649_0040180 3300046694 Bacteria 2563
945 Ga0495649_0247943 3300046694 Bacteria 915
946 Ga0495589_0314519 3300046794 Bacteria 724
947 Ga0495600_0006120 3300046809 Bacteria 7288
948 Ga0495600_0010630 3300046809 Bacteria 5718
949 Ga0495600_0042515 3300046809 Bacteria 2962
950 Ga0495600_0048711 3300046809 Bacteria 2764
951 Ga0495660_0080346 3300046810 Bacteria 1711
952 Ga0495581_0000255 3300047315 Bacteria 25578
953 Ga0495581_0062966 3300047315 Bacteria 2143
954 Ga0495581_0226685 3300047315 Bacteria 1093
955 Ga0495604_0015795 3300047317 Bacteria 6025
956 Ga0495604_0066179 3300047317 Bacteria 2749
957 Ga0495604_0096882 3300047317 Bacteria 2176
958 Ga0495604_0200105 3300047317 Bacteria 1386
959 Ga0495674_0000117 3300047319 Bacteria 60130
960 Ga0495674_0027042 3300047319 Bacteria 5247
961 Ga0495674_0039883 3300047319 Bacteria 4204
962 Ga0495674_0067676 3300047319 Bacteria 3093
963 Ga0495674_0123813 3300047319 Bacteria 2183
964 Ga0495674_0298004 3300047319 Bacteria 1317
965 Ga0495672_0008790 3300047320 Bacteria 7398
966 Ga0495672_0011329 3300047320 Bacteria 6299
967 Ga0495672_0058411 3300047320 Bacteria 2236
968 Ga0495672_0128851 3300047320 Bacteria 1334
969 Ga0495672_0131965 3300047320 Bacteria 1313
970 Ga0495676_0051519 3300047321 Bacteria 3292
971 Ga0495676_0119809 3300047321 Bacteria 1916
972 Ga0495676_0312874 3300047321 Bacteria 1056
973 Ga0495676_0730243 3300047321 Bacteria 640
974 Ga0495680_0000688 3300047322 Bacteria 37864
975 Ga0495680_0004171 3300047322 Bacteria 13893
976 Ga0495680_0072956 3300047322 Bacteria 2610
977 Ga0495680_0176306 3300047322 Bacteria 1545
978 Ga0495687_015006 3300047443 Bacteria 3956
979 Ga0495675_0006128 3300047444 Bacteria 7361
980 Ga0495675_0061318 3300047444 Bacteria 2382
981 Ga0495675_0361093 3300047444 Bacteria 852
982 Ga0495677_0044745 3300047445 Bacteria 1623
983 Ga0495684_0000633 3300047471 Bacteria 28283
984 Ga0495684_0020139 3300047471 Bacteria 5137
985 Ga0495684_0060136 3300047471 Bacteria 2893
986 Ga0495684_0145984 3300047471 Bacteria 1772
987 Ga0495684_0212357 3300047471 Bacteria 1422
988 Ga0495593_0000086 3300047673 Bacteria 40986
989 Ga0495593_0002322 3300047673 Bacteria 11426
990 Ga0495593_0028926 3300047673 Bacteria 3042
991 Ga0495593_0149102 3300047673 Bacteria 1183
992 Ga0495602_0004737 3300048088 Bacteria 14223
993 Ga0495602_0029828 3300048088 Bacteria 5185
994 Ga0495602_0204155 3300048088 Bacteria 1505
995 Ga0495602_0234176 3300048088 Bacteria 1377
996 Ga0495602_0357159 3300048088 Bacteria 1053
997 Ga0495602_0369283 3300048088 Bacteria 1031
998 Ga0495626_0120996 3300048091 Bacteria 1125
999 Ga0496100_0098944 3300048903 Bacteria 2006
1000 Ga0496100_0112296 3300048903 Bacteria 1895
1001 Ga0496100_0570969 3300048903 Bacteria 876
1002 Ga0496100_0665719 3300048903 Bacteria 811
1003 Ga0496101_0023934 3300048904 Bacteria 4222
1004 Ga0496101_0444885 3300048904 Bacteria 1022
1005 Ga0496101_0780065 3300048904 Bacteria 754
1006 Ga0496102_0013632 3300048905 Bacteria 7045
1007 Ga0496102_0051025 3300048905 Bacteria 3768
1008 Ga0496102_0097921 3300048905 Bacteria 2721
1009 Ga0496102_0106172 3300048905 Bacteria 2613
1010 Ga0496102_0132304 3300048905 Bacteria 2336
1011 Ga0496102_0506723 3300048905 Bacteria 1129
1012 Ga0496102_0706217 3300048905 Bacteria 931
1013 Ga0496102_0807003 3300048905 Bacteria 861
1014 Ga0496103_0194972 3300048906 Bacteria 1302
1015 Ga0496104_0011141 3300048907 Bacteria 8046
1016 Ga0496104_0049613 3300048907 Bacteria 3958
1017 Ga0496104_0064542 3300048907 Bacteria 3473
1018 Ga0496104_0097842 3300048907 Bacteria 2808
1019 Ga0496104_0126823 3300048907 Bacteria 2451
1020 Ga0496104_0131997 3300048907 Bacteria 2399
1021 Ga0496105_0003203 3300048908 Bacteria 12051
1022 Ga0496105_0008366 3300048908 Bacteria 8038
1023 Ga0496105_0016607 3300048908 Bacteria 5878
1024 Ga0496105_0088755 3300048908 Bacteria 2554
1025 Ga0496105_0305289 3300048908 Bacteria 1278
1026 Ga0496105_0377082 3300048908 Bacteria 1129
1027 Ga0496106_0000546 3300048909 Bacteria 26747
1028 Ga0496106_0005548 3300048909 Bacteria 9340
1029 Ga0496106_0010390 3300048909 Bacteria 6878
1030 Ga0496106_0040671 3300048909 Bacteria 3482
1031 Ga0496106_0165675 3300048909 Bacteria 1749
1032 Ga0496106_0566529 3300048909 Bacteria 911
1033 Ga0496107_0002937 3300048910 Bacteria 11278
1034 Ga0496107_0004305 3300048910 Bacteria 9634
1035 Ga0496107_0017612 3300048910 Bacteria 5026
1036 Ga0496107_0057818 3300048910 Bacteria 2803
1037 Ga0496107_0094496 3300048910 Bacteria 2187
1038 Ga0496107_0130263 3300048910 Bacteria 1857
1039 Ga0496107_0258456 3300048910 Bacteria 1296
1040 Ga0496108_0001440 3300048911 Bacteria 18797
1041 Ga0496108_0501445 3300048911 Bacteria 1060
1042 Ga0496109_0001610 3300048912 Bacteria 18841
1043 Ga0496109_0015876 3300048912 Bacteria 6575
1044 Ga0496109_0081792 3300048912 Bacteria 2976
1045 Ga0496109_0103673 3300048912 Bacteria 2640
1046 Ga0496109_0131305 3300048912 Bacteria 2338
1047 Ga0496109_0292592 3300048912 Bacteria 1535
1048 Ga0496110_0012816 3300048913 Bacteria 6906
1049 Ga0496110_0017787 3300048913 Bacteria 5949
1050 Ga0496110_0050143 3300048913 Bacteria 3664
1051 Ga0496110_0088331 3300048913 Bacteria 2768
1052 Ga0496110_0119358 3300048913 Bacteria 2375
1053 Ga0496110_0856248 3300048913 Bacteria 814
1054 Ga0496110_1123985 3300048913 Bacteria 694
1055 Ga0496111_0021964 3300048914 Bacteria 4462
1056 Ga0496111_0040806 3300048914 Bacteria 3329
1057 Ga0496111_0141440 3300048914 Bacteria 1783
1058 Ga0496111_0369969 3300048914 Bacteria 1060
1059 Ga0496111_0420705 3300048914 Bacteria 987
1060 Ga0496112_0000079 3300048915 Bacteria 64101
1061 Ga0496112_0007905 3300048915 Bacteria 9474
1062 Ga0496112_0009200 3300048915 Bacteria 8878
1063 Ga0496112_0028997 3300048915 Bacteria 5348
1064 Ga0496112_0032003 3300048915 Bacteria 5106
1065 Ga0496112_0033853 3300048915 Bacteria 4970
1066 Ga0496112_0046075 3300048915 Bacteria 4275
1067 Ga0496112_0069563 3300048915 Bacteria 3477
1068 Ga0496112_0085641 3300048915 Bacteria 3118
1069 Ga0496113_0018743 3300048916 Bacteria 4826
1070 Ga0496113_0034316 3300048916 Bacteria 3702
1071 Ga0496113_0070124 3300048916 Bacteria 2663
1072 Ga0496113_0364465 3300048916 Bacteria 1159
1073 Ga0496114_0019840 3300048917 Bacteria 5451
1074 Ga0496114_0026302 3300048917 Bacteria 4763
1075 Ga0496114_0239484 3300048917 Bacteria 1595
1076 Ga0496114_0255707 3300048917 Bacteria 1541
1077 Ga0496114_0383421 3300048917 Bacteria 1244
1078 Ga0496114_0522738 3300048917 Bacteria 1049
1079 Ga0496114_0787329 3300048917 Bacteria 829
1080 Ga0496115_0030579 3300048918 Bacteria 4237
1081 Ga0496115_0034088 3300048918 Bacteria 4023
1082 Ga0496115_0039040 3300048918 Bacteria 3770
1083 Ga0496115_0050911 3300048918 Bacteria 3320
1084 Ga0496115_0056445 3300048918 Bacteria 3156
1085 Ga0496115_0121603 3300048918 Bacteria 2149
1086 Ga0496115_0216268 3300048918 Bacteria 1582
1087 Ga0496115_0300131 3300048918 Bacteria 1316
1088 Ga0496115_0436859 3300048918 Bacteria 1059
1089 Ga0496115_0544837 3300048918 Bacteria 928
1090 Ga0496116_0119249 3300048919 Bacteria 1531
1091 Ga0496116_0132314 3300048919 Bacteria 1419
1092 Ga0496117_0041834 3300048920 Bacteria 3351
1093 Ga0496117_0086770 3300048920 Bacteria 2032
1094 Ga0496117_0103769 3300048920 Bacteria 1791
1095 Ga0496117_0198089 3300048920 Bacteria 1137
1096 Ga0496117_0229638 3300048920 Bacteria 1027
1097 Ga0496118_0003967 3300048921 Bacteria 18059
1098 Ga0496118_0046546 3300048921 Bacteria 3373
1099 Ga0496118_0070050 3300048921 Bacteria 2535
1100 Ga0496118_0072285 3300048921 Bacteria 2478
1101 Ga0496119_0020659 3300048922 Bacteria 4792
1102 Ga0496119_0051144 3300048922 Bacteria 2542
1103 Ga0496119_0096053 3300048922 Bacteria 1673
1104 Ga0496119_0130553 3300048922 Bacteria 1370
1105 Ga0496120_0008075 3300048923 Bacteria 7735
1106 Ga0496120_0017144 3300048923 Bacteria 4705
1107 Ga0496121_0000495 3300048924 Bacteria 75339
1108 Ga0496121_0000576 3300048924 Bacteria 69005
1109 Ga0496121_0001789 3300048924 Bacteria 34756
1110 Ga0496121_0003477 3300048924 Bacteria 22425
1111 Ga0496121_0005072 3300048924 Bacteria 17180
1112 Ga0496121_0023876 3300048924 Bacteria 5867
1113 Ga0496121_0024511 3300048924 Bacteria 5765
1114 Ga0496121_0084412 3300048924 Bacteria 2504
1115 Ga0496121_0085565 3300048924 Bacteria 2481
1116 Ga0496121_0177005 3300048924 Bacteria 1544
1117 Ga0496121_0185412 3300048924 Bacteria 1497
1118 Ga0496121_0320823 3300048924 Bacteria 1043
1119 Ga0496121_0383172 3300048924 Bacteria 926
1120 Ga0496122_0126372 3300048925 Bacteria 1636
1121 Ga0496123_0023903 3300048926 Bacteria 4664
1122 Ga0496123_0045334 3300048926 Bacteria 2997
1123 Ga0496124_0055299 3300048927 Bacteria 3354
1124 Ga0496124_0112519 3300048927 Bacteria 2189
1125 Ga0496124_0125827 3300048927 Bacteria 2042
1126 Ga0496124_0351760 3300048927 Bacteria 1042
1127 Ga0496125_0003570 3300048928 Bacteria 18732
1128 Ga0496125_0034194 3300048928 Bacteria 4484
1129 Ga0496125_0037412 3300048928 Bacteria 4220
1130 Ga0496125_0042128 3300048928 Bacteria 3894
1131 Ga0496125_0045546 3300048928 Bacteria 3690
1132 Ga0496125_0060992 3300048928 Bacteria 3027
1133 Ga0496125_0076578 3300048928 Bacteria 2582
1134 Ga0496125_0167892 3300048928 Bacteria 1480
1135 Ga0496125_0318590 3300048928 Bacteria 944
1136 Ga0496126_0002315 3300048929 Bacteria 26122
1137 Ga0496126_0006641 3300048929 Bacteria 12873
1138 Ga0496126_0007687 3300048929 Bacteria 11766
1139 Ga0496126_0008516 3300048929 Bacteria 11055
1140 Ga0496126_0030050 3300048929 Bacteria 5155
1141 Ga0496126_0041989 3300048929 Bacteria 4228
1142 Ga0496126_0061749 3300048929 Bacteria 3365
1143 Ga0496126_0078368 3300048929 Bacteria 2928
1144 Ga0496126_0094451 3300048929 Bacteria 2624
1145 Ga0496126_0104047 3300048929 Bacteria 2480
1146 Ga0496126_0112266 3300048929 Bacteria 2373
1147 Ga0496126_0138804 3300048929 Bacteria 2094
1148 Ga0496126_0141356 3300048929 Bacteria 2071
1149 Ga0496126_0142335 3300048929 Bacteria 2063
1150 Ga0496126_0151861 3300048929 Bacteria 1984
1151 Ga0496126_0175123 3300048929 Bacteria 1825
1152 Ga0496126_0177784 3300048929 Bacteria 1809
1153 Ga0496126_0229460 3300048929 Bacteria 1556
1154 Ga0496126_0292981 3300048929 Bacteria 1345
1155 Ga0496126_0303240 3300048929 Bacteria 1317
1156 Ga0496126_0380180 3300048929 Bacteria 1150
1157 Ga0496126_0452266 3300048929 Bacteria 1033
1158 Ga0496126_0456066 3300048929 Bacteria 1028
1159 Ga0496126_0526203 3300048929 Bacteria 941
1160 Ga0496126_0603044 3300048929 Bacteria 865
1161 Ga0495678_096604 3300049459 Bacteria 1031
1162 Ga0501031_0004261 3300049568 Bacteria 9240
1163 Ga0501031_0150707 3300049568 Bacteria 1519
1164 Ga0501032_0005554 3300049569 Bacteria 9354
1165 Ga0501032_0138626 3300049569 Bacteria 1602
1166 Ga0501032_0244123 3300049569 Bacteria 1166
1167 Ga0501032_0313647 3300049569 Bacteria 1013
1168 Ga0501033_0000256 3300049570 Bacteria 50977
1169 Ga0501033_0136088 3300049570 Bacteria 1777
1170 Ga0501034_0000175 3300049571 Bacteria 119465
1171 Ga0501034_0354427 3300049571 Bacteria 1395
1172 Ga0501034_0368998 3300049571 Bacteria 1362
1173 Ga0501034_0713679 3300049571 Bacteria 900
1174 Ga0501036_0000032 3300049572 Bacteria 91370
1175 Ga0501036_0656210 3300049572 Bacteria 868
1176 Ga0501037_0001755 3300049573 Bacteria 15758
1177 Ga0501037_0092867 3300049573 Bacteria 2182
1178 Ga0501037_0147015 3300049573 Bacteria 1685
1179 Ga0501038_0000114 3300049574 Bacteria 68140
1180 Ga0501038_0025774 3300049574 Bacteria 5238
1181 Ga0501038_0110509 3300049574 Bacteria 2277
1182 Ga0501039_0001954 3300049575 Bacteria 15288
1183 Ga0501039_0487062 3300049575 Bacteria 968
1184 Ga0501040_0025761 3300049576 Bacteria 3956
1185 Ga0501041_0541366 3300049577 Bacteria 742
1186 Ga0501042_0251438 3300049578 Bacteria 1275
1187 Ga0501043_0002389 3300049579 Bacteria 15913
1188 Ga0501046_0004110 3300049580 Bacteria 13261
1189 Ga0501046_0188243 3300049580 Bacteria 1540
1190 Ga0501047_0000085 3300049581 Bacteria 118617
1191 Ga0501047_0116791 3300049581 Bacteria 2550
1192 Ga0501047_0178053 3300049581 Bacteria 1993
1193 Ga0501047_0179361 3300049581 Bacteria 1984
1194 Ga0501047_0196472 3300049581 Bacteria 1879
1195 Ga0501048_0001859 3300049582 Bacteria 16028
1196 Ga0501048_0039196 3300049582 Bacteria 3399
1197 Ga0501048_0185910 3300049582 Bacteria 1473
1198 Ga0501067_0000096 3300049583 Bacteria 50761
1199 Ga0501067_0007715 3300049583 Bacteria 5984
1200 Ga0501068_0000220 3300049584 Bacteria 27785
1201 Ga0501068_0002790 3300049584 Bacteria 9289
1202 Ga0501069_0003655 3300049585 Bacteria 7913
1203 Ga0501069_0040056 3300049585 Bacteria 2589
1204 Ga0501069_0161040 3300049585 Bacteria 1292
1205 Ga0501070_0005720 3300049586 Bacteria 10600
1206 Ga0501070_0262510 3300049586 Bacteria 1411
1207 Ga0501070_0264154 3300049586 Bacteria 1406
1208 Ga0501070_0474754 3300049586 Bacteria 1006
1209 Ga0501071_0076396 3300049587 Bacteria 2446
1210 Ga0501071_0092212 3300049587 Bacteria 2226
1211 Ga0501072_0003496 3300049588 Bacteria 11831
1212 Ga0501073_0000026 3300049589 Bacteria 124358
1213 Ga0501073_0193431 3300049589 Bacteria 1407
1214 Ga0501074_0000878 3300049590 Bacteria 19194
1215 Ga0501074_0065877 3300049590 Bacteria 2606
1216 Ga0501076_0188248 3300049592 Bacteria 1684
1217 Ga0501077_0225687 3300049593 Bacteria 1191
1218 Ga0501079_0007708 3300049741 Bacteria 8148
1219 Ga0501080_0005240 3300049742 Bacteria 11553
1220 Ga0501080_0333878 3300049742 Bacteria 1370
1221 Ga0501081_0167660 3300049743 Bacteria 1585
1222 Ga0501083_0012775 3300049744 Bacteria 5873
1223 Ga0501083_0378157 3300049744 Bacteria 921
1224 Ga0501035_0003195 3300049822 Bacteria 15713
1225 Ga0501035_0027489 3300049822 Bacteria 5199
1226 Ga0501044_0000061 3300049823 Bacteria 133207
1227 Ga0501044_0111623 3300049823 Bacteria 2741
1228 Ga0501044_0143992 3300049823 Bacteria 2370
1229 Ga0501044_0357216 3300049823 Bacteria 1379
1230 Ga0501044_0381715 3300049823 Bacteria 1324
1231 Ga0501044_0435807 3300049823 Bacteria 1219
1232 Ga0501044_0601617 3300049823 Bacteria 992
1233 Ga0501045_0090535 3300049824 Bacteria 2261
1234 Ga0501045_0387975 3300049824 Bacteria 1039
1235 nmdc:mga03n38_23321_c1 3300050490 Bacteria 2516
1236 nmdc:mga03n38_3983_c1 3300050490 Bacteria 4822
1237 nmdc:mga00v17_107230_c1 3300050491 Bacteria 1769
1238 nmdc:mga0yw44_109677_c1 3300050492 Bacteria 1767
1239 nmdc:mga0yw44_156432_c1 3300050492 Bacteria 1490
1240 nmdc:mga0yw44_163960_c1 3300050492 Bacteria 1456
1241 nmdc:mga0yw44_35589_c1 3300050492 Bacteria 2927
1242 nmdc:mga0yw44_384637_c1 3300050492 Bacteria 948
1243 nmdc:mga0yw44_385394_c1 3300050492 Bacteria 947
1244 nmdc:mga0yw44_55380_c1 3300050492 Bacteria 2413
1245 nmdc:mga0yw44_58163_c1 3300050492 Bacteria 2361
1246 nmdc:mga0k408_102575_c1 3300050493 Bacteria 1687
1247 nmdc:mga0k408_103595_c1 3300050493 Bacteria 1679
1248 nmdc:mga0k408_290809_c1 3300050493 Bacteria 975
1249 nmdc:mga06z11_109098_c1 3300050494 Bacteria 1530
1250 nmdc:mga06z11_22801_c2 3300050494 Bacteria 2530
1251 nmdc:mga06z11_30063_c1 3300050494 Bacteria 2625
1252 nmdc:mga06z11_526816_c1 3300050494 Bacteria 717
1253 nmdc:mga04h51_23345_c1 3300050495 Bacteria 1578
1254 nmdc:mga04h51_27163_c1 3300050495 Bacteria 1776
1255 nmdc:mga04h51_70640_c1 3300050495 Bacteria 1218
1256 nmdc:mga04h51_89026_c1 3300050495 Bacteria 1108
1257 nmdc:mga07m45_145517_c1 3300050496 Bacteria 1374
1258 nmdc:mga07m45_186513_c1 3300050496 Bacteria 1206
1259 nmdc:mga07m45_224211_c1 3300050496 Bacteria 1094
1260 nmdc:mga07m45_243653_c1 3300050496 Bacteria 1046
1261 nmdc:mga07m45_41716_c1 3300050496 Bacteria 2570
1262 nmdc:mga07m45_73605_c1 3300050496 Bacteria 1945
1263 nmdc:mga07m45_7361_c2 3300050496 Bacteria 2360
1264 nmdc:mga05p37_704993_c1 3300050507 Bacteria 1120
1265 nmdc:mga08y16_904525_c1 3300050511 Bacteria 868
1266 nmdc:mga0n895_337869_c1 3300050512 Bacteria 1526
1267 nmdc:mga0n895_581500_c1 3300050512 Bacteria 1124
1268 nmdc:mga0n895_804835_c1 3300050512 Bacteria 930
1269 nmdc:mga0rr50_83404_c1 3300050513 Bacteria 2471
1270 nmdc:mga08x19_40402_c2 3300050514 Bacteria 2555
1271 nmdc:mga0sz30_6811_c1 3300050516 Bacteria 3981
1272 nmdc:mga0sz30_71801_c2 3300050516 Bacteria 955
1273 Ga0495601_0069967 3300053077 Bacteria 2239
1274 Ga0495601_0200514 3300053077 Bacteria 1304
1275 Ga0495601_0371688 3300053077 Bacteria 928
1276 Ga0495601_0463683 3300053077 Bacteria 819
1277 Ga0495612_0002860 3300053078 Bacteria 7142
1278 Ga0495612_0065484 3300053078 Bacteria 1509
1279 Ga0500610_0043837 3300053079 Bacteria 2319
1280 Ga0500635_0002252 3300053080 Bacteria 4746
1281 Ga0495655_0004246 3300053083 Bacteria 2436
1282 Ga0495595_0004246 3300053084 Bacteria 5762
1283 Ga0495595_0028104 3300053084 Bacteria 2510
1284 Ga0495595_0314909 3300053084 Bacteria 788
1285 Ga0495619_0000182 3300053085 Bacteria 46524
1286 Ga0495619_0012568 3300053085 Bacteria 5331
1287 Ga0495619_0046963 3300053085 Bacteria 2841
1288 Ga0500578_0036475 3300053086 Bacteria 3158
1289 Ga0500578_0069467 3300053086 Bacteria 2245
1290 Ga0500643_000025 3300053087 Bacteria 259605
1291 Ga0500643_047421 3300053087 Bacteria 1238
1292 Ga0500647_0108689 3300053091 Bacteria 1320
1293 Ga0500647_0186634 3300053091 Bacteria 948
1294 Ga0500583_0041181 3300053092 Bacteria 2096
1295 Ga0500583_0098211 3300053092 Bacteria 1432
1296 Ga0500651_0047257 3300053093 Bacteria 2706
1297 Ga0500651_0076618 3300053093 Bacteria 2076
1298 Ga0500651_0128774 3300053093 Bacteria 1532
1299 Ga0500651_0256279 3300053093 Bacteria 1015
1300 Ga0500566_0000038 3300053094 Bacteria 66925
1301 Ga0500566_0000184 3300053094 Bacteria 32281
1302 Ga0500566_0020577 3300053094 Bacteria 3878
1303 Ga0500566_0215292 3300053094 Bacteria 959
1304 Ga0500640_000523 3300053095 Bacteria 9660
1305 Ga0500641_0017528 3300053096 Bacteria 2680
1306 Ga0500641_0076312 3300053096 Bacteria 1417
1307 Ga0500641_0264403 3300053096 Bacteria 717
1308 Ga0500648_209530 3300053097 Bacteria 969
1309 Ga0500650_0154791 3300053098 Bacteria 1058
1310 Ga0500554_060816 3300053102 Bacteria 1211
1311 Ga0500554_061704 3300053102 Bacteria 1204
1312 Ga0500556_0000002 3300053104 Bacteria 773626
1313 Ga0500556_0017722 3300053104 Bacteria 2236
1314 Ga0500557_000001 3300053105 Bacteria 241298
1315 Ga0500562_027472 3300053108 Bacteria 1493
1316 Ga0500569_000655 3300053109 Bacteria 5943
1317 Ga0500569_022048 3300053109 Bacteria 1691
1318 Ga0500569_089516 3300053109 Bacteria 995
1319 Ga0500572_000010 3300053111 Bacteria 67071
1320 Ga0500572_000333 3300053111 Bacteria 16915
1321 Ga0500572_004350 3300053111 Bacteria 3217
1322 Ga0500582_155590 3300053114 Bacteria 789
1323 Ga0500591_075170 3300053115 Bacteria 1519
1324 Ga0500592_002487 3300053116 Bacteria 2968
1325 Ga0500592_015695 3300053116 Bacteria 1216
1326 Ga0500595_000143 3300053119 Bacteria 46542
1327 Ga0500595_004985 3300053119 Bacteria 5860
1328 Ga0500595_005633 3300053119 Bacteria 5445
1329 Ga0500595_007784 3300053119 Bacteria 4420
1330 Ga0500595_008041 3300053119 Bacteria 4327
1331 Ga0500595_012396 3300053119 Bacteria 3300
1332 Ga0500595_052155 3300053119 Bacteria 1264
1333 Ga0500607_045996 3300053121 Bacteria 2340
1334 Ga0500607_097384 3300053121 Bacteria 1467
1335 Ga0500608_000393 3300053122 Bacteria 16801
1336 Ga0500614_012695 3300053123 Bacteria 1843
1337 Ga0500642_0000058 3300053130 Bacteria 66200
1338 Ga0500642_0000703 3300053130 Bacteria 9894
1339 Ga0500652_000711 3300053131 Bacteria 11297
1340 Ga0500652_140659 3300053131 Bacteria 1005
1341 Ga0500655_022180 3300053133 Bacteria 1193
1342 Ga0500658_0080186 3300053134 Bacteria 1394
1343 Ga0500559_0000366 3300053136 Bacteria 33251
1344 Ga0500559_0001403 3300053136 Bacteria 13686
1345 Ga0500559_0004662 3300053136 Bacteria 6458
1346 Ga0500559_0007008 3300053136 Bacteria 5037
1347 Ga0500559_0029053 3300053136 Bacteria 2365
1348 Ga0500559_0157801 3300053136 Bacteria 1066
1349 Ga0500568_0000603 3300053139 Bacteria 26129
1350 Ga0500568_0007229 3300053139 Bacteria 5472
1351 Ga0500568_0024624 3300053139 Bacteria 2547
1352 Ga0500568_0030896 3300053139 Bacteria 2215
1353 Ga0500568_0071299 3300053139 Bacteria 1330
1354 Ga0500568_0109911 3300053139 Bacteria 1031
1355 Ga0500573_0003825 3300053140 Bacteria 7851
1356 Ga0500577_0000616 3300053142 Bacteria 9140
1357 Ga0500586_036153 3300053145 Bacteria 1655
1358 Ga0500588_0151055 3300053146 Bacteria 840
1359 Ga0500588_0158355 3300053146 Bacteria 823
1360 Ga0500589_194989 3300053147 Bacteria 783
1361 Ga0500590_114939 3300053148 Bacteria 1270
1362 Ga0500603_000664 3300053150 Bacteria 8371
1363 Ga0500603_009507 3300053150 Bacteria 2178
1364 Ga0500603_054625 3300053150 Bacteria 1102
1365 Ga0500604_0013483 3300053151 Bacteria 2215
1366 Ga0500616_0000069 3300053153 Bacteria 234334
1367 Ga0500616_0002365 3300053153 Bacteria 15857
1368 Ga0500616_0010971 3300053153 Bacteria 5394
1369 Ga0500619_022328 3300053154 Bacteria 1835
1370 Ga0500619_090401 3300053154 Bacteria 1034
1371 Ga0500620_003266 3300053155 Bacteria 3437
1372 Ga0500622_0003891 3300053156 Bacteria 9671
1373 Ga0500622_0006990 3300053156 Bacteria 6461
1374 Ga0500622_0115937 3300053156 Bacteria 1304
1375 Ga0500627_0023382 3300053158 Bacteria 2519
1376 Ga0500627_0075119 3300053158 Bacteria 1501
1377 Ga0500630_003535 3300053159 Bacteria 7555
1378 Ga0500633_0052223 3300053160 Bacteria 1414
1379 Ga0500634_0118415 3300053161 Bacteria 1293
1380 Ga0500638_006438 3300053162 Bacteria 4805
1381 Ga0500638_206743 3300053162 Bacteria 825
1382 Ga0500638_234419 3300053162 Bacteria 751
1383 Ga0500639_000034 3300053163 Bacteria 66994
1384 Ga0500639_001800 3300053163 Bacteria 10755
1385 Ga0500639_148350 3300053163 Bacteria 1085
1386 Ga0500636_0006585 3300053177 Bacteria 6672
1387 Ga0500636_0015558 3300053177 Bacteria 4483
1388 Ga0500636_0046600 3300053177 Bacteria 2555
1389 Ga0500636_0072915 3300053177 Bacteria 1989
1390 Ga0500636_0205952 3300053177 Bacteria 1036
1391 Ga0500637_0000742 3300053178 Bacteria 13043
1392 Ga0500637_0080859 3300053178 Bacteria 1877
1393 Ga0500637_0097654 3300053178 Bacteria 1702
1394 Ga0500637_0293199 3300053178 Bacteria 890
1395 Ga0500567_177423 3300053723 Bacteria 750
1396 Ga0500576_078959 3300053725 Bacteria 1395
1397 Ga0500645_014699 3300053730 Bacteria 2490
1398 Ga0500596_002867 3300053735 Bacteria 3358
1399 Ga0500596_004222 3300053735 Bacteria 2658
1400 Ga0500599_001531 3300053736 Bacteria 2674
1401 Ga0500601_000312 3300053737 Bacteria 9081
1402 Ga0500601_009495 3300053737 Bacteria 1085
1403 Ga0501084_0043628 3300054114 Bacteria 3751
1404 Ga0501084_0460317 3300054114 Bacteria 1075
1405 Ga0500661_002298 3300055283 Bacteria 3611
1406 Ga0500661_007866 3300055283 Bacteria 1966
1407 Ga0500661_025072 3300055283 Bacteria 1054
1408 Ga0501082_0006469 3300060353 Bacteria 10161
1409 Ga0501082_0165372 3300060353 Bacteria 1922
1410 Ga0501082_0399895 3300060353 Bacteria 1199
1411 Ga0466962_0162410 3300061719 Bacteria 1086
1412 Ga0530510_0338280 3300061734 Bacteria 1130
1413 2876810941 2876808645 Bacteria 8824342
1414 2507509406 2507262055 Bacteria 8048963
1415 2508543448 2508501009 Bacteria 7784016
1416 2508698775 2508501042 Bacteria 8719808
1417 2511397822 2511231028 Bacteria 8046582
1418 2513628257 2513237092 Bacteria 8341956
1419 2513637970 2513237094 Bacteria 8789602
1420 2513646591 2513237095 Bacteria 8976980
1421 2513656639 2513237096 Bacteria 8722461
1422 2513672317 2513237098 Bacteria 9902361
1423 2513691789 2513237101 Bacteria 7952346
1424 2513702035 2513237102 Bacteria 7703324
1425 2513717491 2513237104 Bacteria 10034502
1426 2513858571 2513237137 Bacteria 9558895
1427 2513876398 2513237139 Bacteria 8737671
1428 2513917824 2513237145 Bacteria 8979722
1429 2514010738 2513237161 Bacteria 8871253
1430 2515628984 2515154112 Bacteria 8294334
1431 2517102064 2517093001 Bacteria 9002274
1432 2517893128 2517572143 Bacteria 9484767
1433 2524436496 2524023205 Bacteria 8918781
1434 2524466880 2524023210 Bacteria 9029266
1435 2524539346 2524023228 Bacteria 10118060
1436 2528851504 2528768022 Bacteria 10457665
1437 2603858836 2602042107 Bacteria 6226103
1438 2617352250 2617270735 Bacteria 9163226
1439 2617376527 2617270741 Bacteria 8201522
1440 2671117762 2667528175 Bacteria 7532676
1441 2723845797 2721755755 Bacteria 8322773
1442 2728754636 2728368998 Bacteria 8720350
1443 2745077131 2744054633 Bacteria 8678936
1444 2793064848 2791355196 Bacteria 7323613
1445 2793070002 2791355197 Bacteria 8420563
1446 2793077210
1447 2805920124 2802429603 Bacteria 8777136
1448 2818240216 2816332527 Bacteria 8933356
1449 2824604223 2824600985 Bacteria 8488197
1450 2824617453 2824609381 Bacteria 8672835
1451 2824619773 2824617872 Bacteria 8814715
1452 2824629381 2824626560 Bacteria 8813858
1453 2824642140 2824635225 Bacteria 8785348
1454 2824651175 2824644064 Bacteria 8743947
1455 2824660045 2824653114 Bacteria 8493680
1456 2824666640 2824661429 Bacteria 9877870
1457 2824676999 2824671348 Bacteria 8369588
1458 2824683712 2824679649 Bacteria 8248951
1459 2824694975 2824687955 Bacteria 8360029
1460 2824703619 2824696289 Bacteria 8335049
1461 2824712616 2824704595 Bacteria 9667483
1462 2824721229 2824714736 Bacteria 8717648
1463 2824731268 2824723954 Bacteria 8758240
1464 2824739459 2824732956 Bacteria 7810675
1465 2824749638 2824746037 Bacteria 7911610
1466 2824760192 2824753945 Bacteria 9787441
1467 2824767181 2824763712 Bacteria 9792355
1468 2824780647 2824773399 Bacteria 8360218
1469 2838126605 2838122688 Bacteria 8803140
1470 2841947259 2841941048 Bacteria 8688029
1471 2841950704 2841949485 Bacteria 8680857
1472 2841964392 2841957949 Bacteria 8652217
1473 2841967021 2841966195 Bacteria 8673214
1474 2841975766 2841974524 Bacteria 8931498
1475 2841990133 2841983080 Bacteria 8395090
1476 2842039814 2842038055 Bacteria 8002051
1477 2842047240 2842045827 Bacteria 8006841
1478 2844318327 2844315083 Bacteria 8138177
1479 2847935203 2847930680 Bacteria 9342022
1480 2847945802 2847939898 Bacteria 8606328
1481 2849080057 2849076700 Bacteria 7039503
1482 2857510567 2857509624 Bacteria 7472071
1483 2857528058 2857524615 Bacteria 6615449
1484 2874597500 2874590934 Bacteria 8299676
1485 2874609553 2874604998 Bacteria 7834745
1486 2874612788 2874612657 Bacteria 8252029
1487 2874627835 2874620515 Bacteria 8290088
1488 2874636316 2874628541 Bacteria 8630250
1489 2874648576 2874645413 Bacteria 8214782
1490 2876770796 2876761206 Bacteria 10111113
1491 2876777703 2876771140 Bacteria 8287509
1492 2876822538 2876818435 Bacteria 8274608
1493 2879078111 2879074833 Bacteria 8279565
1494 2879089107 2879083081 Bacteria 8587928
1495 2879102931 2879099564 Bacteria 10442239
1496 2879115669 2879110137 Bacteria 8907982
1497 2879134548 2879127579 Bacteria 8294491
1498 2879149917 2879142872 Bacteria 8267021
1499 2881366649 2881364244 Bacteria 7710352
1500 2881669597 2881665667 Bacteria 8175609
1501 2885373287 2885366525 Bacteria 8326213
1502 2885378309 2885374607 Bacteria 8927485
1503 2885390637 2885383462 Bacteria 9473874
1504 2885417424 2885409591 Bacteria 9235467
1505 2888383263 2888378607 Bacteria 9652610
1506 2888394647 2888388044 Bacteria 7304136
1507 2888423646 2888419890 Bacteria 7857137
1508 2889040638 2889033259 Bacteria 9099371
1509 2893068479 2893066018 Bacteria 6158120
1510 2903729274 2903727486 Bacteria 8281579
1511 2903753062 2903748898 Bacteria 9972761
1512 2903775120 2903768456 Bacteria 9749579
1513 2904672845 2904666416 Bacteria 8226587
1514 2904696537 2904690495 Bacteria 9412302
1515 2904703982
1516 2904717102 2904711408 Bacteria 9771557
1517 2906609430 2906602504 Bacteria 8295279
1518 2906617661
1519 2906634677 2906626472 Bacteria 8826946
1520 2906636792 2906635258 Bacteria 8601019
1521 2906645906 2906643746 Bacteria 8722424
1522 2906661360 2906660503 Bacteria 8595048
1523 2908743521 2908739725 Bacteria 8628932
1524 2908760391 2908756301 Bacteria 8864324
1525 2908779367 2908775508 Bacteria 8092255
1526 2919075457 2919073203 Bacteria 6531949
1527 2922367743 2922361189 Bacteria 7436256
1528 2922373426
1529 2922392353 2922386360 Bacteria 7017218
1530 2922395577 2922393267 Bacteria 8285685
1531 2922429358
1532 2929617173 2929615660 Bacteria 9193770
1533 2929626877 2929624759 Bacteria 9339455
1534 2932793197 2932784394 Bacteria 9704911
1535 2932796445 2932794094 Bacteria 7915132
1536 2932808934 2932801729 Bacteria 7987968
1537 2932813036 2932809354 Bacteria 9135765
1538 2932821113 2932818245 Bacteria 9955613
1539 2932836779 2932828146 Bacteria 9745859
1540 2933579130 2933577622 Bacteria 9116884
1541 2935611709 2935608549 Bacteria 8203142
1542 2935621544 2935616580 Bacteria 9032984
1543 2935634067 2935630451 Bacteria 8169952
1544 2935645477 2935638405 Bacteria 10015038
1545 2935651786 2935648319 Bacteria 8801166
1546 2935660596 2935656913 Bacteria 8965014
1547 2935667595 2935665750 Bacteria 9571747
1548 2935681757 2935675223 Bacteria 9928132
1549 2935688343 2935684952 Bacteria 9590419
1550 2935699026 2935694250 Bacteria 9291695
1551 2935706407 2935703347 Bacteria 10242284
1552 2935715362 2935713505 Bacteria 9608509
1553 2935726074 2935722832 Bacteria 9608746
1554 2935734181 2935732158 Bacteria 9706831
1555 2935743560 2935741537 Bacteria 9707219
1556 2935754403 2935750917 Bacteria 9590372
1557 2935768481 2935760218 Bacteria 9817913
1558 2935774079 2935769743 Bacteria 7878163
1559 2935780601 2935777560 Bacteria 8077691
1560 2935789551 2935785616 Bacteria 7962367
1561 2935797328 2935793552 Bacteria 8012592
1562 2935806598 2935801545 Bacteria 9301974
1563 2935813190 2935810662 Bacteria 9401221
1564 2935821187 2935819856 Bacteria 8261050
1565 2935830843 2935827899 Bacteria 10038562
1566 2935840869 2935837841 Bacteria 9454360
1567 2935850553 2935847175 Bacteria 8228321
1568 2935859791 2935855204 Bacteria 9035059
1569 2935869136 2935864058 Bacteria 9784707
1570 2935880671 2935873716 Bacteria 9632195
1571 2935886646 2935883170 Bacteria 7964738
1572 2935914153 2935908558 Bacteria 8568796
1573 2935921323 2935916978 Bacteria 9113783
1574 2935931658 2935926038 Bacteria 8601059
1575 2935940407 2935934488 Bacteria 8602579
1576 2935947768 2935942939 Bacteria 8599779
1577 2935956691 2935951376 Bacteria 8602333
1578 2935965750 2935959822 Bacteria 7869783
1579 2935973484 2935967501 Bacteria 8603075
1580 2935980907 2935975950 Bacteria 8347125
1581 2935990395 2935984226 Bacteria 8302647
1582 2936000947 2935992306 Bacteria 9802711
1583 2936010189 2936002035 Bacteria 9362176
1584 2936014652 2936011229 Bacteria 8801034
1585 2936023551 2936019824 Bacteria 8804134
1586 2936032579 2936028420 Bacteria 8965941
1587 2936043742 2936037263 Bacteria 9446081
1588 2936050393 2936046547 Bacteria 8903709
1589 2936059115 2936055302 Bacteria 8785755
1590 2940560221 2940556831 Bacteria 9590747
1591 2941510958 2941507105 Bacteria 8166816
1592 2941518342 2941515067 Bacteria 8166720
1593 2941527395 2941523033 Bacteria 8169134
1594 2941534083 2941531003 Bacteria 7653939
1595 2941541000 2941538514 Bacteria 9402094
1596 3005479526 3005474847 Bacteria 9259049
1597 3005489410 3005483717 Bacteria 7877331
1598 3005511828 3005506211 Bacteria 6943378
1599 3005588545 3005587118 Bacteria 7794411
1600 3005598419 3005594810 Bacteria 8716512
1601 3005714110 3005710791 Bacteria 7622528
1602 3005721584 3005718088 Bacteria 8283608
1603 8006932117 8006926726 Bacteria 6749210
1604 8006941613 8006933436 Bacteria 10410654
1605 8006967447 8006964411 Bacteria 8966052
1606 8006981323 8006973647 Bacteria 10679141
1607 8006988073 8006984368 Bacteria 9651211
1608 8006996441 8006994254 Bacteria 8309700
1609 8016514252 8016511872 Bacteria 9921665
1610 8016530441 8016522445 Bacteria 8156687
1611 8016535712 8016530956 Bacteria 8155261
1612 8016553240 8016548790 Bacteria 8155074
1613 8016561618 8016557553 Bacteria 8154380
1614 8016578164 8016575299 Bacteria 8154085
1615 8016592831 8016583857 Bacteria 10421953
1616 8016599456 8016595262 Bacteria 8149947
1617 8016611533 8016603502 Bacteria 8731218
1618 8016622264 8016613128 Bacteria 8794220
1619 8016627631 8016622563 Bacteria 7999408
1620 8016631848 8016630954 Bacteria 9217207
1621 8017062171 8017057580 Bacteria 10023680
1622 8019535438 8019530166 Bacteria 8155624
1623 8019544067 8019538911 Bacteria 7872763
1624 8019554736 8019547302 Bacteria 7996444
1625 8019557533 8019555841 Bacteria 9642137
1626 8019567763 8019565922 Bacteria 9639779
1627 8019581621 8019576017 Bacteria 10049540
1628 8019589256 8019586578 Bacteria 10212056
1629 8019601976 8019597564 Bacteria 10041141
1630 8019616574 8019608314 Bacteria 10042931
1631 8019627290 8019619141 Bacteria 9218857
1632 8019635281 8019629233 Bacteria 8687553
1633 8019644419 8019638758 Bacteria 9062356
1634 8019657456 8019648815 Bacteria 10014479
1635 8019663120 8019659431 Bacteria 8577854
1636 8019672719 8019668869 Bacteria 8791617
1637 8019683442 8019678201 Bacteria 8863603
1638 8019689177 8019687851 Bacteria 8712826
1639 8055747212 8055742211 Bacteria 9226248
1640 8056674557 8056673599 Bacteria 7871253
1641 8056685298 8056681323 Bacteria 8472857
1642 8056690212 8056689827 Bacteria 6712655
1643 8056972687 8056967851 Bacteria 9038162
1644 RicEn_C651
1645 JGI25406J46586_10014911
1646 JGI25406J46586_10094120
1647 JGI25165J46597_1006252
1648 JGI25153J46596_10003518
1649 JGI25153J46596_10006847
1650 JGI25153J46596_10012797
1651 JGI25153J46596_10016522
1652 JGI25160J50197_1003097
1653 JGI25160J50197_1005052
1654 JGI25160J50197_1044907
1655 JGI25404J52841_10007374
1656 JGI25404J52841_10040120
1657 Ga0055542_1011767
1658 Ga0055526_1064162
1659 Ga0055531_10008796
1660 Ga0055543_1003302
1661 Ga0065165_1001864
1662 Ga0065165_1019808
1663 Ga0065165_1020382
1664 Ga0070658_10230450
1665 Ga0070676_10153610
1666 Ga0070683_100029863
1667 Ga0070683_100689422
1668 Ga0070670_100508728
1669 Ga0068869_100111795
1670 Ga0068869_100335859
1671 Ga0068869_100467874
1672 Ga0070680_100018923
1673 Ga0070680_100187668
1674 Ga0070680_100463579
1675 Ga0070680_100492177
1676 Ga0070682_100026401
1677 Ga0070682_100162523
1678 Ga0070682_100362253
1679 Ga0070682_100542480
1680 Ga0068868_100589656
1681 Ga0070660_100010416
1682 Ga0070660_100253469
1683 Ga0070660_100299299
1684 Ga0070687_100206945
1685 Ga0070661_100006251
1686 Ga0070661_100377068
1687 Ga0070668_100067207
1688 Ga0070668_100089962
1689 Ga0070668_100138774
1690 Ga0070669_100378212
1691 Ga0070669_100843392
1692 Ga0070675_100065137
1693 Ga0070675_101244157
1694 Ga0070671_100276120
1695 Ga0070671_100531100
1696 Ga0070671_100706021
1697 Ga0070674_100078595
1698 Ga0070674_100111556
1699 Ga0070659_100177733
1700 Ga0070659_100375862
1701 Ga0070659_100448417
1702 Ga0070667_100134781
1703 Ga0070709_10000951
1704 Ga0070709_10076815
1705 Ga0070709_10172145
1706 Ga0070714_100010720
1707 Ga0070714_100074142
1708 Ga0070714_100226980
1709 Ga0070714_100386619
1710 Ga0070713_100000936
1711 Ga0070713_100005223
1712 Ga0070713_100066626
1713 Ga0070713_100098866
1714 Ga0070713_100294418
1715 Ga0070710_10002437
1716 Ga0070710_10372108
1717 Ga0070711_100003765
1718 Ga0070711_100010373
1719 Ga0070711_100133712
1720 Ga0070705_100788869
1721 Ga0070663_100028775
1722 Ga0070663_100033215
1723 Ga0070663_100051889
1724 Ga0070663_100153154
1725 Ga0070678_100038290
1726 Ga0070678_100046100
1727 Ga0070678_100050632
1728 Ga0070678_100622586
1729 Ga0070662_100017777
1730 Ga0070662_100462378
1731 Ga0070662_100473847
1732 Ga0070681_10013529
1733 Ga0070681_10024245
1734 Ga0070681_10034302
1735 Ga0070681_10147981
1736 Ga0070681_10189850
1737 Ga0070681_10200951
1738 Ga0070681_10531280
1739 Ga0068867_100452316
1740 Ga0070698_100415922
1741 Ga0070699_100742334
1742 Ga0070699_101106830
1743 Ga0070679_100007218
1744 Ga0070679_100095395
1745 Ga0070679_100136758
1746 Ga0070679_100418008
1747 Ga0070679_100485784
1748 Ga0070679_100526022
1749 Ga0070684_100018029
1750 Ga0070684_100036613
1751 Ga0070684_100064431
1752 Ga0070684_100084021
1753 Ga0070684_100456942
1754 Ga0070697_100056309
1755 Ga0068853_100004481
1756 Ga0068853_100263379
1757 Ga0068853_100422717
1758 Ga0068853_100435135
1759 Ga0070672_100651502
1760 Ga0070693_100060897
1761 Ga0070693_100390176
1762 Ga0070665_100062885
1763 Ga0070665_100094386
1764 Ga0070665_100100681
1765 Ga0070665_100139357
1766 Ga0070665_100290721
1767 Ga0070665_100335848
1768 Ga0070665_100475332
1769 Ga0070665_100839981
1770 Ga0070704_100205904
1771 Ga0068855_100026568
1772 Ga0068855_100067965
1773 Ga0068855_100121768
1774 Ga0068855_100202775
1775 Ga0068855_100221112
1776 Ga0068855_100325301
1777 Ga0068855_100446345
1778 Ga0068855_100505285
1779 Ga0068855_100610859
1780 Ga0070664_100074373
1781 Ga0070664_100631390
1782 Ga0068857_100017569
1783 Ga0068857_100145722
1784 Ga0068857_100921285
1785 Ga0068857_101371698
1786 Ga0068854_100177549
1787 Ga0068856_100006094
1788 Ga0068856_100185539
1789 Ga0068856_100253901
1790 Ga0068856_100519403
1791 Ga0068856_100547175
1792 Ga0068856_100984659
1793 Ga0068852_100002018
1794 Ga0068852_100082448
1795 Ga0068852_100103345
1796 Ga0068852_100141834
1797 Ga0068852_100218320
1798 Ga0068852_100312610
1799 Ga0068852_100641887
1800 Ga0068852_101445009
1801 Ga0068859_100251619
1802 Ga0068859_100414858
1803 Ga0068859_100474485
1804 Ga0068864_100546987
1805 Ga0068861_100195399
1806 Ga0068861_100354350
1807 Ga0068851_10013775
1808 Ga0068851_10201064
1809 Ga0068863_100318014
1810 Ga0068863_100905256
1811 Ga0068858_100248395
1812 Ga0068858_100313002
1813 Ga0068858_100355497
1814 Ga0068858_100444577
1815 Ga0068860_100000058
1816 Ga0068860_100204938
1817 Ga0068860_100353409
1818 Ga0068860_100692530
1819 Ga0068862_100037323
1820 Ga0068862_100105591
1821 Ga0068862_100626257
1822 Ga0068862_100943347
1823 Ga0081455_10009084
1824 Ga0081455_10018953
1825 Ga0081455_10059666
1826 Ga0081455_10074357
1827 Ga0081455_10202229
1828 Ga0081455_10251739
1829 Ga0081538_10043006
1830 Ga0081538_10176859
1831 Ga0081540_1001631
1832 Ga0081540_1004115
1833 Ga0081540_1009209
1834 Ga0081540_1009520
1835 Ga0081540_1024605
1836 Ga0081540_1031069
1837 Ga0081540_1037550
1838 Ga0081540_1040575
1839 Ga0081540_1122431
1840 Ga0081539_10000250
1841 Ga0081539_10000269
1842 Ga0081539_10017984
1843 Ga0081539_10176671
1844 Ga0070717_10001774
1845 Ga0070717_10049640
1846 Ga0070717_10304250
1847 Ga0075365_10015428
1848 Ga0075365_10040951
1849 Ga0075365_10053219
1850 Ga0075365_10059845
1851 Ga0075365_10130996
1852 Ga0075365_10148307
1853 Ga0075365_10236657
1854 Ga0075365_10406974
1855 Ga0075368_10017232
1856 Ga0075368_10096813
1857 Ga0075368_10124387
1858 Ga0075368_10168457
1859 Ga0075363_100012935
1860 Ga0075363_100086970
1861 Ga0075363_100201765
1862 Ga0075364_10090682
1863 Ga0075364_10106011
1864 Ga0075364_10378106
1865 Ga0070715_10000514
1866 Ga0070715_10044050
1867 Ga0070716_100004285
1868 Ga0070716_100179140
1869 Ga0070712_100072591
1870 Ga0070712_100089027
1871 Ga0070712_100575789
1872 Ga0075362_10229066
1873 Ga0075367_10026323
1874 Ga0075367_10056089
1875 Ga0075367_10215730
1876 Ga0075369_10073960
1877 Ga0075366_10056404
1878 Ga0075366_10105423
1879 Ga0075366_10253032
1880 Ga0075366_10405609
1881 Ga0097621_100698839
1882 Ga0097621_101048862
1883 Ga0075370_10030042
1884 Ga0075370_10065298
1885 Ga0075370_10112231
1886 Ga0075370_10225902
1887 Ga0075370_10334931
1888 Ga0075433_10628661
1889 Ga0075434_100008873
1890 Ga0075434_100915210
1891 Ga0075434_101575156
1892 Ga0068865_100075446
1893 Ga0097620_100251646
1894 Ga0097620_100414853
1895 Ga0097620_100474452
1896 Ga0099825_1017862
1897 Ga0099824_1004496
1898 Ga0099822_1001205
1899 Ga0099823_1074998
1900 Ga0099794_10111599
1901 Ga0099794_10247543
1902 Ga0099795_10028277
1903 Ga0099795_10043937
1904 Ga0099795_10117800
1905 Ga0105250_10146291
1906 Ga0105240_10037185
1907 Ga0105240_10060299
1908 Ga0105240_10147223
1909 Ga0105240_10170959
1910 Ga0105240_10216390
1911 Ga0111539_10054668
1912 Ga0105245_10018719
1913 Ga0105245_10083841
1914 Ga0105245_10132382
1915 Ga0105247_10005197
1916 Ga0105247_10043201
1917 Ga0105247_10120425
1918 Ga0105247_10122234
1919 Ga0105247_10534453
1920 Ga0105247_10766575
1921 Ga0105247_10808356
1922 Ga0105243_10023714
1923 Ga0105243_10246899
1924 Ga0105241_10022043
1925 Ga0105241_10022614
1926 Ga0105241_10244997
1927 Ga0105241_10351808
1928 Ga0105241_10447478
1929 Ga0105242_10193943
1930 Ga0105242_10279996
1931 Ga0105248_10199489
1932 Ga0105248_10489643
1933 Ga0105248_10614982
1934 Ga0105248_10836986
1935 Ga0105248_10858407
1936 Ga0105248_10989480
1937 Ga0105248_11095786
1938 Ga0105237_10003757
1939 Ga0105237_10013957
1940 Ga0105237_10108092
1941 Ga0105237_10154651
1942 Ga0105237_10207611
1943 Ga0105237_10355262
1944 Ga0105238_10012843
1945 Ga0105238_10087356
1946 Ga0105238_10108517
1947 Ga0105238_10355678
1948 Ga0105238_10378419
1949 Ga0105238_10431818
1950 Ga0105238_10991369
1951 Ga0105249_10548931
1952 Ga0099796_10007070
1953 Ga0105239_10083730
1954 Ga0105239_10095378
1955 Ga0105239_10099271
1956 Ga0105239_10132392
1957 Ga0105239_10168407
1958 Ga0105239_10300527
1959 Ga0105239_10489871
1960 Ga0105239_10608053
1961 Ga0105239_10734397
1962 Ga0105246_10121996
1963 Ga0105246_10388004
1964 Ga0105246_10416012
1965 Ga0157325_1010924
1966 Ga0157313_1006498
1967 Ga0157373_10114711
1968 Ga0157371_10127012
1969 Ga0157370_10076545
1970 Ga0157370_10358922
1971 Ga0157370_10375147
1972 Ga0157370_10562780
1973 Ga0157370_10970339
1974 Ga0157369_10008435
1975 Ga0157369_10030907
1976 Ga0157369_10163132
1977 Ga0157369_10455646
1978 Ga0157369_10830928
1979 Ga0157374_10073477
1980 Ga0157374_10161238
1981 Ga0157374_10172122
1982 Ga0157374_11494353
1983 Ga0157378_10015347
1984 Ga0157378_10375595
1985 Ga0163162_10413533
1986 Ga0163162_10605167
1987 Ga0157372_10096728
1988 Ga0157372_10447920
1989 Ga0157372_10756641
1990 Ga0157372_11580295
1991 Ga0157375_10022349
1992 Ga0157375_10191028
1993 Ga0157375_10247572
1994 Ga0157375_10312102
1995 Ga0157375_10529595
1996 Ga0157375_10586051
1997 Ga0157375_11317625
1998 Ga0163163_10017322
1999 Ga0163163_10048111
2000 Ga0163163_10420635
2001 Ga0163163_10549931
2002 Ga0163163_11066205
2003 Ga0157380_10126713
2004 Ga0157380_10338062
2005 Ga0157380_10358136
2006 Ga0157380_11479962
2007 Ga0157377_10198201
2008 Ga0157379_10250131
2009 Ga0157379_10434627
2010 Ga0157379_10631896
2011 Ga0157376_10054586
2012 Ga0157376_10247875
2013 Ga0157376_10438937
2014 Ga0157376_10550588
2015 Ga0163161_10180473
2016 Ga0163161_10414456
2017 Ga0214544_1000009
2018 Ga0214542_1000002
2019 Ga0214545_1000002
2020 Ga0214543_1000013
2021 Ga0213873_10038419
2022 Ga0213874_10051145
2023 Ga0213876_10001848
2024 Ga0213876_10011429
2025 Ga0213875_10035810
2026 Ga0213875_10269927
2027 Ga0209563_101045
2028 Ga0209677_102385
2029 Ga0209677_102571
2030 Ga0209148_1000446
2031 Ga0209233_1001302
2032 Ga0209233_1001367
2033 Ga0209233_1031508
2034 Ga0209455_1006256
2035 Ga0209673_1049900
2036 Ga0209564_1009891
2037 Ga0209564_1024293
2038 Ga0209758_1000100
2039 Ga0209758_1000160
2040 Ga0209758_1002793
2041 Ga0209758_1003932
2042 Ga0209758_1005852
2043 Ga0209758_1016663
2044 Ga0209758_1030410
2045 Ga0209758_1031291
2046 Ga0209050_1050100
2047 Ga0209256_1010637
2048 Ga0207426_1001094
2049 Ga0207426_1002241
2050 Ga0207426_1021409
2051 Ga0209257_1005571
2052 Ga0207697_10040240
2053 Ga0207697_10137630
2054 Ga0207697_10307825
2055 Ga0207656_10212297
2056 Ga0207696_1077977
2057 Ga0207692_10000308
2058 Ga0207692_10002064
2059 Ga0207692_10095563
2060 Ga0207642_10018415
2061 Ga0207710_10005066
2062 Ga0207710_10011801
2063 Ga0207688_10224906
2064 Ga0207680_10359672
2065 Ga0207647_10015173
2066 Ga0207647_10066702
2067 Ga0207647_10150208
2068 Ga0207647_10173629
2069 Ga0207685_10000468
2070 Ga0207685_10068762
2071 Ga0207699_10001291
2072 Ga0207699_10010647
2073 Ga0207699_10128528
2074 Ga0207645_10027775
2075 Ga0207645_10030138
2076 Ga0207643_10223284
2077 Ga0207705_10274616
2078 Ga0207684_10085353
2079 Ga0207654_10070600
2080 Ga0207654_10077759
2081 Ga0207654_10185810
2082 Ga0207707_10000494
2083 Ga0207707_10000896
2084 Ga0207707_10026257
2085 Ga0207707_10109574
2086 Ga0207707_10304168
2087 Ga0207695_10000278
2088 Ga0207695_10080608
2089 Ga0207695_10184308
2090 Ga0207695_10254696
2091 Ga0207695_10340327
2092 Ga0207695_10752725
2093 Ga0207671_10006710
2094 Ga0207671_10062495
2095 Ga0207671_10128103
2096 Ga0207671_10187699
2097 Ga0207671_10222555
2098 Ga0207671_10388735
2099 Ga0207693_10001932
2100 Ga0207693_10006236
2101 Ga0207693_10012373
2102 Ga0207693_10013898
2103 Ga0207693_10105956
2104 Ga0207663_10000365
2105 Ga0207663_10007002
2106 Ga0207663_10027757
2107 Ga0207663_10129357
2108 Ga0207660_10001052
2109 Ga0207660_10017659
2110 Ga0207660_10065377
2111 Ga0207660_10082459
2112 Ga0207657_10011901
2113 Ga0207657_10199380
2114 Ga0207657_10348207
2115 Ga0207657_10349687
2116 Ga0207657_10416926
2117 Ga0207649_10891177
2118 Ga0207652_10001721
2119 Ga0207652_10002542
2120 Ga0207652_10029879
2121 Ga0207652_10033319
2122 Ga0207652_10255219
2123 Ga0207652_10264232
2124 Ga0207652_10346860
2125 Ga0207646_10052414
2126 Ga0207681_10237112
2127 Ga0207694_10046441
2128 Ga0207694_10115281
2129 Ga0207694_10195200
2130 Ga0207694_10239753
2131 Ga0207694_10272737
2132 Ga0207694_10671562
2133 Ga0207694_11045332
2134 Ga0207650_10105342
2135 Ga0207687_10012698
2136 Ga0207687_10086909
2137 Ga0207687_10355679
2138 Ga0207700_10000752
2139 Ga0207700_10076249
2140 Ga0207700_10209162
2141 Ga0207700_10639121
2142 Ga0207664_10023582
2143 Ga0207664_10143318
2144 Ga0207664_10843445
2145 Ga0207644_10058994
2146 Ga0207644_10244542
2147 Ga0207690_10197654
2148 Ga0207690_10291979
2149 Ga0207690_10358604
2150 Ga0207706_10114484
2151 Ga0207686_10173751
2152 Ga0207686_10373665
2153 Ga0207709_10052805
2154 Ga0207709_10369126
2155 Ga0207669_10052815
2156 Ga0207669_10086954
2157 Ga0207669_10258533
2158 Ga0207669_10447611
2159 Ga0207669_10572483
2160 Ga0207704_10014890
2161 Ga0207665_10000957
2162 Ga0207665_10004741
2163 Ga0207665_10539715
2164 Ga0207691_10033524
2165 Ga0207691_10034661
2166 Ga0207691_10824720
2167 Ga0207711_10396851
2168 Ga0207711_10430120
2169 Ga0207711_10931781
2170 Ga0207689_10188972
2171 Ga0207689_10240079
2172 Ga0207689_10365900
2173 Ga0207661_10015207
2174 Ga0207661_10223074
2175 Ga0207661_10390469
2176 Ga0207679_10054680
2177 Ga0207679_10541624
2178 Ga0207679_10565554
2179 Ga0207667_10003512
2180 Ga0207667_10010956
2181 Ga0207667_10184363
2182 Ga0207667_10215470
2183 Ga0207667_10330631
2184 Ga0207667_10521761
2185 Ga0207667_11267521
2186 Ga0207651_10307059
2187 Ga0207651_10650690
2188 Ga0207712_10215242
2189 Ga0207712_10687044
2190 Ga0207668_10106980
2191 Ga0207668_10191611
2192 Ga0207668_10193574
2193 Ga0207668_10221896
2194 Ga0207668_11005197
2195 Ga0207658_10255064
2196 Ga0207658_10258570
2197 Ga0207658_11234830
2198 Ga0207677_10194612
2199 Ga0207677_10602621
2200 Ga0207703_10093548
2201 Ga0207703_10131827
2202 Ga0207703_10204380
2203 Ga0207703_10263644
2204 Ga0207703_11031884
2205 Ga0207639_10007089
2206 Ga0207639_10149273
2207 Ga0207639_10358067
2208 Ga0207639_10685993
2209 Ga0207639_10903925
2210 Ga0207678_10060617
2211 Ga0207678_10066555
2212 Ga0207678_10091282
2213 Ga0207678_10126493
2214 Ga0207678_10399880
2215 Ga0207678_10798733
2216 Ga0207702_10004908
2217 Ga0207702_10291263
2218 Ga0207702_10300882
2219 Ga0207702_10577360
2220 Ga0207702_10683171
2221 Ga0207702_10768230
2222 Ga0207641_10458860
2223 Ga0207648_10027013
2224 Ga0207676_10121979
2225 Ga0207676_10183059
2226 Ga0207676_10572198
2227 Ga0207676_10635248
2228 Ga0207674_10016819
2229 Ga0207674_10076950
2230 Ga0207674_10078158
2231 Ga0207674_10812741
2232 Ga0207675_100193953
2233 Ga0207675_100196150
2234 Ga0207683_10036246
2235 Ga0207683_10075265
2236 Ga0207683_10262697
2237 Ga0207698_10033235
2238 Ga0207698_10094835
2239 Ga0207698_10384358
2240 Ga0209389_1000113
2241 Ga0209589_1000023
2242 Ga0209589_1000041
2243 Ga0209489_100032
2244 Ga0209489_100070
2245 Ga0209489_107143
2246 Ga0209700_100021
2247 Ga0209700_100040
2248 Ga0209588_1027013
2249 Ga0209813_10016723
2250 Ga0209813_10059055
2251 Ga0268266_10063942
2252 Ga0268266_10097492
2253 Ga0268266_10149445
2254 Ga0268266_10272122
2255 Ga0268265_10044540
2256 Ga0268265_10069413
2257 Ga0268265_10267710
2258 Ga0268265_10268890
2259 Ga0268264_10000022
2260 Ga0268264_10094942
2261 Ga0268264_10294537
2262 Ga0268264_10872588
2263 Ga0265337_1010612
2264 Ga0265334_10033498
2265 Ga0265334_10034598
2266 Ga0265318_10123634
2267 Ga0265323_10019751
2268 Ga0307517_10001054
2269 Ga0307515_10073527
2270 Ga0265338_10000337
2271 Ga0265338_10611853
2272 Ga0265324_10010988
2273 Ga0307511_10214421
2274 Ga0265762_1021662
2275 Ga0265760_10119633
2276 Ga0265325_10017156
2277 Ga0265340_10011816
2278 Ga0265340_10128737
2279 Ga0265339_10021644
2280 Ga0265339_10071611
2281 Ga0265331_10080665
2282 Ga0265331_10151928
2283 Ga0265331_10197745
2284 Ga0265316_10120452
2285 Ga0307513_10242240
2286 Ga0307513_10539348
2287 Ga0307509_10069489
2288 Ga0307509_10248383
2289 Ga0307509_10276692
2290 Ga0307408_100624601
2291 Ga0307408_100812913
2292 Ga0265313_10241970
2293 Ga0307508_10000038
2294 Ga0307508_10011952
2295 Ga0307508_10049566
2296 Ga0307508_10179027
2297 Ga0307508_10231295
2298 Ga0307508_10484184
2299 Ga0265314_10010719
2300 Ga0265314_10416874
2301 Ga0265342_10005896
2302 Ga0265342_10027683
2303 Ga0307516_10021961
2304 Ga0307516_10218372
2305 Ga0307516_10253433
2306 Ga0307516_10452957
2307 Ga0307405_10334448
2308 Ga0307405_10486612
2309 Ga0307413_10128964
2310 Ga0307518_10237817
2311 Ga0307407_10086172
2312 Ga0307409_100135783
2313 Ga0307416_100096572
2314 Ga0307414_10211996
2315 Ga0307415_100298446
2316 Ga0307507_10006782
2317 Ga0307510_10046892
2318 Ga0307510_10059591
2319 Ga0315911_1000001
2320 Ga0316215_1008573
2321 Ga0373958_0094615
2322 Ga0373926_0001023
2323 Ga0373926_0042922
2324 Ga0373934_0059515
2325 Ga0373944_0055536
2326 Ga0373952_0032660
2327 Ga0373923_0000923
2328 Ga0373923_0033913
2329 Ga0373932_0079158
2330 Ga0373936_0026216
2331 Ga0373936_0036592
2332 Ga0373936_0214801
2333 Ga0373939_0073328
2334 Ga0373941_0010495
2335 Ga0373945_0011559
2336 Ga0373945_0056625
2337 Ga0373953_0007891
2338 Ga0373953_0015186
2339 Ga0373953_0067556
2340 Ga0373954_0041893
2341 Ga0373954_0102801
2342 Ga0373954_0158867
2343 Ga0373957_0000375
2344 Ga0373943_0039246
2345 Ga0373946_0025361
2346 Ga0373955_0001328
2347 Ga0373924_0001614
2348 Ga0373924_0110706
2349 Ga0373931_0014501
2350 Ga0373935_0284639
2351 Ga0373935_0296239
2352 Ga0373935_0450177
2353 Ga0373935_0525089
2354 Ga0373927_0000225
2355 Ga0373927_0027925
2356 Ga0373927_0032601
2357 Ga0373927_0061827
2358 Ga0373927_0092919
2359 Ga0373927_0141451
2360 Ga0373927_0166913
2361 Ga0373933_0001518
2362 Ga0373933_0043637
2363 Ga0373933_0047712
2364 Ga0373933_0142763
2365 Ga0373947_0023122
2366 Ga0373947_0137064
2367 Ga0373947_0263604
2368 Ga0373947_0406711
2369 Ga0373937_0091905
2370 Ga0373937_0196775
2371 Ga0373925_0000711
2372 Ga0373925_0057892
2373 Ga0373925_0101408
2374 Ga0373925_0197535
2375 Ga0373925_0209187
2376 Ga0395899_0140917
2377 Ga0395900_0000860
2378 Ga0395900_0323770
2379 Ga0395900_0483145
2380 Ga0395898_0046012
2381 Ga0395905_0056855
2382 Ga0395905_0123786
2383 Ga0436364_0267346
2384 Ga0436364_0500303
2385 Ga0436364_1340351
2386 Ga0395901_0057535
2387 Ga0395901_0974883
2388 Ga0436365_0151039
2389 Ga0436365_0268210
2390 Ga0436365_0710303
2391 Ga0436365_1095310
2392 Ga0436365_1396402
2393 Ga0436365_1591893
2394 Ga0436365_1655446
2395 Ga0436365_1817893
2396 Ga0436365_1870953
2397 Ga0436360_0660865
2398 Ga0436363_0772753
2399 Ga0436363_0894926
2400 Ga0436363_1201079
2401 Ga0436363_1223665
2402 Ga0436362_0332326
2403 Ga0439465_0108277
2404 Ga0451791_0964902
2405 Ga0451797_0764166
2406 Ga0451802_0611095
2407 Ga0451839_1631068
2408 Ga0451839_1657451
2409 Ga0451841_0572120
2410 Ga0451849_0054097
2411 Ga0451853_2886446
2412 Ga0451853_3008790
2413 Ga0451853_3547507
2414 Ga0439463_049467
2415 Ga0439458_0079320
2416 Ga0466972_0000660
2417 Ga0466972_0004579
2418 Ga0466972_0109388
2419 Ga0466965_0099463
2420 Ga0466966_0000932
2421 Ga0466966_0102237
2422 Ga0466961_0000488
2423 Ga0466963_0074240
2424 Ga0466963_0121993
2425 Ga0466964_0352582
2426 Ga0466964_0411657
2427 Ga0466968_0002010
2428 Ga0466957_0079290
2429 Ga0466957_0159408
2430 Ga0466957_0407282
2431 Ga0466967_0031184
2432 Ga0466967_0115452
2433 Ga0495617_042503
2434 Ga0495617_077806
2435 Ga0495592_0002531
2436 Ga0495592_0018338
2437 Ga0495592_0395432
2438 Ga0495592_0603616
2439 Ga0495603_0001221
2440 Ga0495603_0026173
2441 Ga0495603_0191071
2442 Ga0495629_0000179
2443 Ga0495629_0001007
2444 Ga0495629_0005795
2445 Ga0495638_0012856
2446 Ga0495638_0066840
2447 Ga0495638_0258927
2448 Ga0495651_0013292
2449 Ga0495651_0157426
2450 Ga0495651_0162720
2451 Ga0495651_0272952
2452 Ga0495651_0323804
2453 Ga0495651_0360313
2454 Ga0495651_0482053
2455 Ga0495653_0211587
2456 Ga0495650_0207173
2457 Ga0495580_0000280
2458 Ga0495580_0029169
2459 Ga0495582_0000061
2460 Ga0495582_0143590
2461 Ga0495639_0000102
2462 Ga0495639_0036398
2463 Ga0495662_0000074
2464 Ga0495662_0021975
2465 Ga0495664_0077067
2466 Ga0495664_0116766
2467 Ga0495584_0367079
2468 Ga0495585_0200184
2469 Ga0495594_0000378
2470 Ga0495594_0188928
2471 Ga0495594_0310518
2472 Ga0495594_0332067
2473 Ga0495583_0038104
2474 Ga0495606_0003007
2475 Ga0495606_0094118
2476 Ga0495606_0296470
2477 Ga0495608_0017019
2478 Ga0495608_0410528
2479 Ga0495610_0086587
2480 Ga0495610_0116191
2481 Ga0495616_0254761
2482 Ga0495618_0007907
2483 Ga0495618_0039412
2484 Ga0495618_0245563
2485 Ga0495620_0035877
2486 Ga0495628_0004580
2487 Ga0495628_0058989
2488 Ga0495628_0078743
2489 Ga0495628_0393307
2490 Ga0495630_0001032
2491 Ga0495630_0037229
2492 Ga0495631_0105640
2493 Ga0495632_0049316
2494 Ga0495632_0214786
2495 Ga0495643_0019680
2496 Ga0495648_0002612
2497 Ga0495648_0002918
2498 Ga0495648_0030845
2499 Ga0495648_0030855
2500 Ga0495648_0044101
2501 Ga0495648_0118640
2502 Ga0495648_0147774
2503 Ga0495648_0207891
2504 Ga0495666_0007696
2505 Ga0495642_0245168
2506 Ga0495652_0003857
2507 Ga0495652_0032487
2508 Ga0495652_0075661
2509 Ga0495652_0249787
2510 Ga0495654_0178950
2511 Ga0495665_0000261
2512 Ga0495665_0011427
2513 Ga0495640_0040108
2514 Ga0495640_0060166
2515 Ga0495640_0116764
2516 Ga0495640_0270334
2517 Ga0495586_0239141
2518 Ga0495587_0012126
2519 Ga0495587_0079430
2520 Ga0495587_0181922
2521 Ga0495621_0022283
2522 Ga0495597_0138775
2523 Ga0495597_0159820
2524 Ga0495645_0025567
2525 Ga0495645_0147373
2526 Ga0495645_0258674
2527 Ga0495645_0277518
2528 Ga0495645_0335358
2529 Ga0495622_0016935
2530 Ga0495622_0101574
2531 Ga0495633_0127435
2532 Ga0495667_0004202
2533 Ga0495667_0036521
2534 Ga0495667_0124599
2535 Ga0495667_0136614
2536 Ga0495656_0096587
2537 Ga0495668_0050083
2538 Ga0495668_0053210
2539 Ga0495668_0231398
2540 Ga0495634_0000161
2541 Ga0495634_0022358
2542 Ga0495634_0195081
2543 Ga0495625_0048156
2544 Ga0495625_0331278
2545 Ga0495635_0008716
2546 Ga0495635_0033710
2547 Ga0495635_0037786
2548 Ga0495635_0054592
2549 Ga0495635_0071655
2550 Ga0495659_0014177
2551 Ga0495659_0203320
2552 Ga0495661_0181418
2553 Ga0495588_0020981
2554 Ga0495588_0025233
2555 Ga0495588_0321470
2556 Ga0495588_0323936
2557 Ga0495588_0427306
2558 Ga0495657_0015740
2559 Ga0495657_0019424
2560 Ga0495657_0064717
2561 Ga0495599_0009174
2562 Ga0495599_0084427
2563 Ga0495599_0183929
2564 Ga0495599_0309661
2565 Ga0495623_0023186
2566 Ga0495623_0035017
2567 Ga0495623_0082545
2568 Ga0495623_0115991
2569 Ga0495623_0145015
2570 Ga0495623_0159907
2571 Ga0495623_0248044
2572 Ga0495646_0040870
2573 Ga0495646_0086315
2574 Ga0495646_0097016
2575 Ga0495647_0028695
2576 Ga0495658_0000315
2577 Ga0495658_0109624
2578 Ga0495669_0281291
2579 Ga0495613_0002949
2580 Ga0495613_0218703
2581 Ga0495613_0373042
2582 Ga0495624_0029489
2583 Ga0495624_0058579
2584 Ga0495624_0379776
2585 Ga0495670_0020190
2586 Ga0495671_0147083
2587 Ga0495649_0040180
2588 Ga0495649_0247943
2589 Ga0495589_0314519
2590 Ga0495600_0006120
2591 Ga0495600_0010630
2592 Ga0495600_0042515
2593 Ga0495600_0048711
2594 Ga0495660_0080346
2595 Ga0495581_0000255
2596 Ga0495581_0062966
2597 Ga0495581_0226685
2598 Ga0495604_0015795
2599 Ga0495604_0066179
2600 Ga0495604_0096882
2601 Ga0495604_0200105
2602 Ga0495674_0000117
2603 Ga0495674_0027042
2604 Ga0495674_0039883
2605 Ga0495674_0067676
2606 Ga0495674_0123813
2607 Ga0495674_0298004
2608 Ga0495672_0008790
2609 Ga0495672_0011329
2610 Ga0495672_0058411
2611 Ga0495672_0128851
2612 Ga0495672_0131965
2613 Ga0495676_0051519
2614 Ga0495676_0119809
2615 Ga0495676_0312874
2616 Ga0495676_0730243
2617 Ga0495680_0000688
2618 Ga0495680_0004171
2619 Ga0495680_0072956
2620 Ga0495680_0176306
2621 Ga0495687_015006
2622 Ga0495675_0006128
2623 Ga0495675_0061318
2624 Ga0495675_0361093
2625 Ga0495677_0044745
2626 Ga0495684_0000633
2627 Ga0495684_0020139
2628 Ga0495684_0060136
2629 Ga0495684_0145984
2630 Ga0495684_0212357
2631 Ga0495593_0000086
2632 Ga0495593_0002322
2633 Ga0495593_0028926
2634 Ga0495593_0149102
2635 Ga0495602_0004737
2636 Ga0495602_0029828
2637 Ga0495602_0204155
2638 Ga0495602_0234176
2639 Ga0495602_0357159
2640 Ga0495602_0369283
2641 Ga0495626_0120996
2642 Ga0496100_0098944
2643 Ga0496100_0112296
2644 Ga0496100_0570969
2645 Ga0496100_0665719
2646 Ga0496101_0023934
2647 Ga0496101_0444885
2648 Ga0496101_0780065
2649 Ga0496102_0013632
2650 Ga0496102_0051025
2651 Ga0496102_0097921
2652 Ga0496102_0106172
2653 Ga0496102_0132304
2654 Ga0496102_0506723
2655 Ga0496102_0706217
2656 Ga0496102_0807003
2657 Ga0496103_0194972
2658 Ga0496104_0011141
2659 Ga0496104_0049613
2660 Ga0496104_0064542
2661 Ga0496104_0097842
2662 Ga0496104_0126823
2663 Ga0496104_0131997
2664 Ga0496105_0003203
2665 Ga0496105_0008366
2666 Ga0496105_0016607
2667 Ga0496105_0088755
2668 Ga0496105_0305289
2669 Ga0496105_0377082
2670 Ga0496106_0000546
2671 Ga0496106_0005548
2672 Ga0496106_0010390
2673 Ga0496106_0040671
2674 Ga0496106_0165675
2675 Ga0496106_0566529
2676 Ga0496107_0002937
2677 Ga0496107_0004305
2678 Ga0496107_0017612
2679 Ga0496107_0057818
2680 Ga0496107_0094496
2681 Ga0496107_0130263
2682 Ga0496107_0258456
2683 Ga0496108_0001440
2684 Ga0496108_0501445
2685 Ga0496109_0001610
2686 Ga0496109_0015876
2687 Ga0496109_0081792
2688 Ga0496109_0103673
2689 Ga0496109_0131305
2690 Ga0496109_0292592
2691 Ga0496110_0012816
2692 Ga0496110_0017787
2693 Ga0496110_0050143
2694 Ga0496110_0088331
2695 Ga0496110_0119358
2696 Ga0496110_0856248
2697 Ga0496110_1123985
2698 Ga0496111_0021964
2699 Ga0496111_0040806
2700 Ga0496111_0141440
2701 Ga0496111_0369969
2702 Ga0496111_0420705
2703 Ga0496112_0000079
2704 Ga0496112_0007905
2705 Ga0496112_0009200
2706 Ga0496112_0028997
2707 Ga0496112_0032003
2708 Ga0496112_0033853
2709 Ga0496112_0046075
2710 Ga0496112_0069563
2711 Ga0496112_0085641
2712 Ga0496113_0018743
2713 Ga0496113_0034316
2714 Ga0496113_0070124
2715 Ga0496113_0364465
2716 Ga0496114_0019840
2717 Ga0496114_0026302
2718 Ga0496114_0239484
2719 Ga0496114_0255707
2720 Ga0496114_0383421
2721 Ga0496114_0522738
2722 Ga0496114_0787329
2723 Ga0496115_0030579
2724 Ga0496115_0034088
2725 Ga0496115_0039040
2726 Ga0496115_0050911
2727 Ga0496115_0056445
2728 Ga0496115_0121603
2729 Ga0496115_0216268
2730 Ga0496115_0300131
2731 Ga0496115_0436859
2732 Ga0496115_0544837
2733 Ga0496116_0119249
2734 Ga0496116_0132314
2735 Ga0496117_0041834
2736 Ga0496117_0086770
2737 Ga0496117_0103769
2738 Ga0496117_0198089
2739 Ga0496117_0229638
2740 Ga0496118_0003967
2741 Ga0496118_0046546
2742 Ga0496118_0070050
2743 Ga0496118_0072285
2744 Ga0496119_0020659
2745 Ga0496119_0051144
2746 Ga0496119_0096053
2747 Ga0496119_0130553
2748 Ga0496120_0008075
2749 Ga0496120_0017144
2750 Ga0496121_0000495
2751 Ga0496121_0000576
2752 Ga0496121_0001789
2753 Ga0496121_0003477
2754 Ga0496121_0005072
2755 Ga0496121_0023876
2756 Ga0496121_0024511
2757 Ga0496121_0084412
2758 Ga0496121_0085565
2759 Ga0496121_0177005
2760 Ga0496121_0185412
2761 Ga0496121_0320823
2762 Ga0496121_0383172
2763 Ga0496122_0126372
2764 Ga0496123_0023903
2765 Ga0496123_0045334
2766 Ga0496124_0055299
2767 Ga0496124_0112519
2768 Ga0496124_0125827
2769 Ga0496124_0351760
2770 Ga0496125_0003570
2771 Ga0496125_0034194
2772 Ga0496125_0037412
2773 Ga0496125_0042128
2774 Ga0496125_0045546
2775 Ga0496125_0060992
2776 Ga0496125_0076578
2777 Ga0496125_0167892
2778 Ga0496125_0318590
2779 Ga0496126_0002315
2780 Ga0496126_0006641
2781 Ga0496126_0007687
2782 Ga0496126_0008516
2783 Ga0496126_0030050
2784 Ga0496126_0041989
2785 Ga0496126_0061749
2786 Ga0496126_0078368
2787 Ga0496126_0094451
2788 Ga0496126_0104047
2789 Ga0496126_0112266
2790 Ga0496126_0138804
2791 Ga0496126_0141356
2792 Ga0496126_0142335
2793 Ga0496126_0151861
2794 Ga0496126_0175123
2795 Ga0496126_0177784
2796 Ga0496126_0229460
2797 Ga0496126_0292981
2798 Ga0496126_0303240
2799 Ga0496126_0380180
2800 Ga0496126_0452266
2801 Ga0496126_0456066
2802 Ga0496126_0526203
2803 Ga0496126_0603044
2804 Ga0495678_096604
2805 Ga0501031_0004261
2806 Ga0501031_0150707
2807 Ga0501032_0005554
2808 Ga0501032_0138626
2809 Ga0501032_0244123
2810 Ga0501032_0313647
2811 Ga0501033_0000256
2812 Ga0501033_0136088
2813 Ga0501034_0000175
2814 Ga0501034_0354427
2815 Ga0501034_0368998
2816 Ga0501034_0713679
2817 Ga0501036_0000032
2818 Ga0501036_0656210
2819 Ga0501037_0001755
2820 Ga0501037_0092867
2821 Ga0501037_0147015
2822 Ga0501038_0000114
2823 Ga0501038_0025774
2824 Ga0501038_0110509
2825 Ga0501039_0001954
2826 Ga0501039_0487062
2827 Ga0501040_0025761
2828 Ga0501041_0541366
2829 Ga0501042_0251438
2830 Ga0501043_0002389
2831 Ga0501046_0004110
2832 Ga0501046_0188243
2833 Ga0501047_0000085
2834 Ga0501047_0116791
2835 Ga0501047_0178053
2836 Ga0501047_0179361
2837 Ga0501047_0196472
2838 Ga0501048_0001859
2839 Ga0501048_0039196
2840 Ga0501048_0185910
2841 Ga0501067_0000096
2842 Ga0501067_0007715
2843 Ga0501068_0000220
2844 Ga0501068_0002790
2845 Ga0501069_0003655
2846 Ga0501069_0040056
2847 Ga0501069_0161040
2848 Ga0501070_0005720
2849 Ga0501070_0262510
2850 Ga0501070_0264154
2851 Ga0501070_0474754
2852 Ga0501071_0076396
2853 Ga0501071_0092212
2854 Ga0501072_0003496
2855 Ga0501073_0000026
2856 Ga0501073_0193431
2857 Ga0501074_0000878
2858 Ga0501074_0065877
2859 Ga0501076_0188248
2860 Ga0501077_0225687
2861 Ga0501079_0007708
2862 Ga0501080_0005240
2863 Ga0501080_0333878
2864 Ga0501081_0167660
2865 Ga0501083_0012775
2866 Ga0501083_0378157
2867 Ga0501035_0003195
2868 Ga0501035_0027489
2869 Ga0501044_0000061
2870 Ga0501044_0111623
2871 Ga0501044_0143992
2872 Ga0501044_0357216
2873 Ga0501044_0381715
2874 Ga0501044_0435807
2875 Ga0501044_0601617
2876 Ga0501045_0090535
2877 Ga0501045_0387975
2878 nmdc:mga03n38_23321_c1
2879 nmdc:mga03n38_3983_c1
2880 nmdc:mga00v17_107230_c1
2881 nmdc:mga0yw44_109677_c1
2882 nmdc:mga0yw44_156432_c1
2883 nmdc:mga0yw44_163960_c1
2884 nmdc:mga0yw44_35589_c1
2885 nmdc:mga0yw44_384637_c1
2886 nmdc:mga0yw44_385394_c1
2887 nmdc:mga0yw44_55380_c1
2888 nmdc:mga0yw44_58163_c1
2889 nmdc:mga0k408_102575_c1
2890 nmdc:mga0k408_103595_c1
2891 nmdc:mga0k408_290809_c1
2892 nmdc:mga06z11_109098_c1
2893 nmdc:mga06z11_22801_c2
2894 nmdc:mga06z11_30063_c1
2895 nmdc:mga06z11_526816_c1
2896 nmdc:mga04h51_23345_c1
2897 nmdc:mga04h51_27163_c1
2898 nmdc:mga04h51_70640_c1
2899 nmdc:mga04h51_89026_c1
2900 nmdc:mga07m45_145517_c1
2901 nmdc:mga07m45_186513_c1
2902 nmdc:mga07m45_224211_c1
2903 nmdc:mga07m45_243653_c1
2904 nmdc:mga07m45_41716_c1
2905 nmdc:mga07m45_73605_c1
2906 nmdc:mga07m45_7361_c2
2907 nmdc:mga05p37_704993_c1
2908 nmdc:mga08y16_904525_c1
2909 nmdc:mga0n895_337869_c1
2910 nmdc:mga0n895_581500_c1
2911 nmdc:mga0n895_804835_c1
2912 nmdc:mga0rr50_83404_c1
2913 nmdc:mga08x19_40402_c2
2914 nmdc:mga0sz30_6811_c1
2915 nmdc:mga0sz30_71801_c2
2916 Ga0495601_0069967
2917 Ga0495601_0200514
2918 Ga0495601_0371688
2919 Ga0495601_0463683
2920 Ga0495612_0002860
2921 Ga0495612_0065484
2922 Ga0500610_0043837
2923 Ga0500635_0002252
2924 Ga0495655_0004246
2925 Ga0495595_0004246
2926 Ga0495595_0028104
2927 Ga0495595_0314909
2928 Ga0495619_0000182
2929 Ga0495619_0012568
2930 Ga0495619_0046963
2931 Ga0500578_0036475
2932 Ga0500578_0069467
2933 Ga0500643_000025
2934 Ga0500643_047421
2935 Ga0500647_0108689
2936 Ga0500647_0186634
2937 Ga0500583_0041181
2938 Ga0500583_0098211
2939 Ga0500651_0047257
2940 Ga0500651_0076618
2941 Ga0500651_0128774
2942 Ga0500651_0256279
2943 Ga0500566_0000038
2944 Ga0500566_0000184
2945 Ga0500566_0020577
2946 Ga0500566_0215292
2947 Ga0500640_000523
2948 Ga0500641_0017528
2949 Ga0500641_0076312
2950 Ga0500641_0264403
2951 Ga0500648_209530
2952 Ga0500650_0154791
2953 Ga0500554_060816
2954 Ga0500554_061704
2955 Ga0500556_0000002
2956 Ga0500556_0017722
2957 Ga0500557_000001
2958 Ga0500562_027472
2959 Ga0500569_000655
2960 Ga0500569_022048
2961 Ga0500569_089516
2962 Ga0500572_000010
2963 Ga0500572_000333
2964 Ga0500572_004350
2965 Ga0500582_155590
2966 Ga0500591_075170
2967 Ga0500592_002487
2968 Ga0500592_015695
2969 Ga0500595_000143
2970 Ga0500595_004985
2971 Ga0500595_005633
2972 Ga0500595_007784
2973 Ga0500595_008041
2974 Ga0500595_012396
2975 Ga0500595_052155
2976 Ga0500607_045996
2977 Ga0500607_097384
2978 Ga0500608_000393
2979 Ga0500614_012695
2980 Ga0500642_0000058
2981 Ga0500642_0000703
2982 Ga0500652_000711
2983 Ga0500652_140659
2984 Ga0500655_022180
2985 Ga0500658_0080186
2986 Ga0500559_0000366
2987 Ga0500559_0001403
2988 Ga0500559_0004662
2989 Ga0500559_0007008
2990 Ga0500559_0029053
2991 Ga0500559_0157801
2992 Ga0500568_0000603
2993 Ga0500568_0007229
2994 Ga0500568_0024624
2995 Ga0500568_0030896
2996 Ga0500568_0071299
2997 Ga0500568_0109911
2998 Ga0500573_0003825
2999 Ga0500577_0000616
3000 Ga0500586_036153
3001 Ga0500588_0151055
3002 Ga0500588_0158355
3003 Ga0500589_194989
3004 Ga0500590_114939
3005 Ga0500603_000664
3006 Ga0500603_009507
3007 Ga0500603_054625
3008 Ga0500604_0013483
3009 Ga0500616_0000069
3010 Ga0500616_0002365
3011 Ga0500616_0010971
3012 Ga0500619_022328
3013 Ga0500619_090401
3014 Ga0500620_003266
3015 Ga0500622_0003891
3016 Ga0500622_0006990
3017 Ga0500622_0115937
3018 Ga0500627_0023382
3019 Ga0500627_0075119
3020 Ga0500630_003535
3021 Ga0500633_0052223
3022 Ga0500634_0118415
3023 Ga0500638_006438
3024 Ga0500638_206743
3025 Ga0500638_234419
3026 Ga0500639_000034
3027 Ga0500639_001800
3028 Ga0500639_148350
3029 Ga0500636_0006585
3030 Ga0500636_0015558
3031 Ga0500636_0046600
3032 Ga0500636_0072915
3033 Ga0500636_0205952
3034 Ga0500637_0000742
3035 Ga0500637_0080859
3036 Ga0500637_0097654
3037 Ga0500637_0293199
3038 Ga0500567_177423
3039 Ga0500576_078959
3040 Ga0500645_014699
3041 Ga0500596_002867
3042 Ga0500596_004222
3043 Ga0500599_001531
3044 Ga0500601_000312
3045 Ga0500601_009495
3046 Ga0501084_0043628
3047 Ga0501084_0460317
3048 Ga0500661_002298
3049 Ga0500661_007866
3050 Ga0500661_025072
3051 Ga0501082_0006469
3052 Ga0501082_0165372
3053 Ga0501082_0399895
3054 Ga0466962_0162410
3055 Ga0530510_0338280
3056 2876810941
3057 2507509406
3058 2508543448
3059 2508698775
3060 2511397822
3061 2513628257
3062 2513637970
3063 2513646591
3064 2513656639
3065 2513672317
3066 2513691789
3067 2513702035
3068 2513717491
3069 2513858571
3070 2513876398
3071 2513917824
3072 2514010738
3073 2515628984
3074 2517102064
3075 2517893128
3076 2524436496
3077 2524466880
3078 2524539346
3079 2528851504
3080 2603858836
3081 2617352250
3082 2617376527
3083 2671117762
3084 2723845797
3085 2728754636
3086 2745077131
3087 2793064848
3088 2793070002
3089 2793077210
3090 2805920124
3091 2818240216
3092 2824604223
3093 2824617453
3094 2824619773
3095 2824629381
3096 2824642140
3097 2824651175
3098 2824660045
3099 2824666640
3100 2824676999
3101 2824683712
3102 2824694975
3103 2824703619
3104 2824712616
3105 2824721229
3106 2824731268
3107 2824739459
3108 2824749638
3109 2824760192
3110 2824767181
3111 2824780647
3112 2838126605
3113 2841947259
3114 2841950704
3115 2841964392
3116 2841967021
3117 2841975766
3118 2841990133
3119 2842039814
3120 2842047240
3121 2844318327
3122 2847935203
3123 2847945802
3124 2849080057
3125 2857510567
3126 2857528058
3127 2874597500
3128 2874609553
3129 2874612788
3130 2874627835
3131 2874636316
3132 2874648576
3133 2876770796
3134 2876777703
3135 2876822538
3136 2879078111
3137 2879089107
3138 2879102931
3139 2879115669
3140 2879134548
3141 2879149917
3142 2881366649
3143 2881669597
3144 2885373287
3145 2885378309
3146 2885390637
3147 2885417424
3148 2888383263
3149 2888394647
3150 2888423646
3151 2889040638
3152 2893068479
3153 2903729274
3154 2903753062
3155 2903775120
3156 2904672845
3157 2904696537
3158 2904703982
3159 2904717102
3160 2906609430
3161 2906617661
3162 2906634677
3163 2906636792
3164 2906645906
3165 2906661360
3166 2908743521
3167 2908760391
3168 2908779367
3169 2919075457
3170 2922367743
3171 2922373426
3172 2922392353
3173 2922395577
3174 2922429358
3175 2929617173
3176 2929626877
3177 2932793197
3178 2932796445
3179 2932808934
3180 2932813036
3181 2932821113
3182 2932836779
3183 2933579130
3184 2935611709
3185 2935621544
3186 2935634067
3187 2935645477
3188 2935651786
3189 2935660596
3190 2935667595
3191 2935681757
3192 2935688343
3193 2935699026
3194 2935706407
3195 2935715362
3196 2935726074
3197 2935734181
3198 2935743560
3199 2935754403
3200 2935768481
3201 2935774079
3202 2935780601
3203 2935789551
3204 2935797328
3205 2935806598
3206 2935813190
3207 2935821187
3208 2935830843
3209 2935840869
3210 2935850553
3211 2935859791
3212 2935869136
3213 2935880671
3214 2935886646
3215 2935914153
3216 2935921323
3217 2935931658
3218 2935940407
3219 2935947768
3220 2935956691
3221 2935965750
3222 2935973484
3223 2935980907
3224 2935990395
3225 2936000947
3226 2936010189
3227 2936014652
3228 2936023551
3229 2936032579
3230 2936043742
3231 2936050393
3232 2936059115
3233 2940560221
3234 2941510958
3235 2941518342
3236 2941527395
3237 2941534083
3238 2941541000
3239 3005479526
3240 3005489410
3241 3005511828
3242 3005588545
3243 3005598419
3244 3005714110
3245 3005721584
3246 8006932117
3247 8006941613
3248 8006967447
3249 8006981323
3250 8006988073
3251 8006996441
3252 8016514252
3253 8016530441
3254 8016535712
3255 8016553240
3256 8016561618
3257 8016578164
3258 8016592831
3259 8016599456
3260 8016611533
3261 8016622264
3262 8016627631
3263 8016631848
3264 8017062171
3265 8019535438
3266 8019544067
3267 8019554736
3268 8019557533
3269 8019567763
3270 8019581621
3271 8019589256
3272 8019601976
3273 8019616574
3274 8019627290
3275 8019635281
3276 8019644419
3277 8019657456
3278 8019663120
3279 8019672719
3280 8019683442
3281 8019689177
3282 8055747212
3283 8056674557
3284 8056685298
3285 8056690212
3286 8056972687

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

15

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9629 4 140
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9559 4 140
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9511 6 139
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9473 4 140
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9452 4 140
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 6 139 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 4 140 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9307 6 139 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8969 19 132 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8914 4 140 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V8KJL4-F1-model_v4 deleted 0.9926 1 140
AF-A0A526S3G7-F1-model_v4 CoA-binding protein 0.9919 1 128
AF-A0A7W9ZRZ4-F1-model_v4 CoA-binding domain-containing protein 0.9914 1 140
AF-A0A2N8B2T8-F1-model_v4 deleted 0.991 23 130
AF-A0A292E4Q2-F1-model_v4 CoA-binding protein 0.9905 1 139

Map