F495176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1643 | 755 | 3286 | 195 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2876808645|2876810941 |
| Length | 229 |
| Sequence | NYDDNYIRGILNGVKSIAMVGASPVNVRPSYFAFKYLAQRGYDMIPVNPGHVGKSLLGKPFVASLSDIGRPVDMIDIFRNSSHIMPVVDEALTLSPPPKVIWMQLGARDDAAAEKAEAAGLKVVMNRCPKIEYGRLSSEISWMGVNSRTLSSKRAPIPTQGMRLSLNRTSVGGGATAASDRAAKNKSEXXXXXXXXXXXXXXXXDVTQYETIVSNTPQEEADAFLIHDM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 90 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 109 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 126 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 127 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 128 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 225 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 251 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 252 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 257 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 285 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 286 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 287 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 288 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 292 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 293 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 294 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 295 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 296 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 297 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 298 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 299 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 300 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 301 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 302 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 303 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 388 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 389 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 390 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 391 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 392 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 393 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 396 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 446 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 449 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 462 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 467 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 468 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 469 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 470 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 472 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 473 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 474 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 475 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 476 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 478 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 479 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 480 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 482 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 483 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 484 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 486 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 488 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 490 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 491 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 494 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 495 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 496 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 499 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 500 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 504 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 505 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 506 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 508 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 509 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 510 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 512 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 514 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 515 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 518 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 519 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 520 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 522 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 524 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 525 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 526 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 527 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 528 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 529 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 530 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 531 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 532 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 533 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 534 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 535 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 536 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 537 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 538 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 539 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 540 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 541 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 542 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 543 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 544 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 545 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 546 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 547 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 548 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 549 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 550 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 551 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 552 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 553 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 554 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 555 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 556 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 557 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 558 | 2791355199 | |||
| 559 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 560 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 561 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 562 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 563 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 564 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 565 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 566 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 567 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 568 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 569 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 570 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 571 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 572 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 573 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 574 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 575 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 576 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 577 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 578 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 579 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 580 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 581 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 582 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 583 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 584 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 585 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 586 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 587 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 588 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 589 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 590 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 591 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 592 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 593 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 594 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 595 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 596 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 597 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 598 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 599 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 600 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 601 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 602 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 603 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 604 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 605 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 606 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 607 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 608 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 609 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 610 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 611 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 612 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 613 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 614 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 615 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 616 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 617 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 618 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 619 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 620 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 621 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 622 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 623 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 624 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 625 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 626 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 627 | 2904699407 | |||
| 628 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 629 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 630 | 2906610324 | |||
| 631 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 632 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 633 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 634 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 635 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 636 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 637 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 638 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 639 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 640 | 2922368715 | |||
| 641 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 642 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 643 | 2922425934 | |||
| 644 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 645 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 646 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 647 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 648 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 649 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 650 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 651 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 652 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 653 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 654 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 655 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 656 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 657 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 658 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 659 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 660 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 661 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 662 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 663 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 664 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 665 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 666 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 667 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 668 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 669 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 670 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 671 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 672 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 673 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 674 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 675 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 676 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 677 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 678 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 679 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 680 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 681 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 682 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 683 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 684 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 685 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 686 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 687 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 688 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 689 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 690 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 691 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 692 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 693 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 694 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 695 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 696 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 697 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 698 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 699 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 700 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 701 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 702 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 703 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 704 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 705 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 706 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 707 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 708 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 709 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 710 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 711 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 712 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 713 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 714 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 715 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 716 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 717 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 718 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 719 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 720 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 721 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 722 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 723 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 724 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 725 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 726 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 727 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 728 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 729 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 730 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 731 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 732 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 733 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 734 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 735 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 736 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 737 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 738 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 739 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 740 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 741 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 742 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 743 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 744 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 745 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 746 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 747 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 748 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 749 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 750 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 751 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 752 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 753 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 754 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 755 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.08 |
| Metatranscriptomes | 0.12 |
| Isolates | 13.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.76 |
| Nodule | 11.02 |
| Rhizoplane | 5.84 |
| Rhizosphere | 58.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C651 | 2010549000 | Bacteria | 1116 |
| 2 | JGI25406J46586_10014911 | 3300003203 | Bacteria | 3291 |
| 3 | JGI25406J46586_10094120 | 3300003203 | Bacteria | 900 |
| 4 | JGI25165J46597_1006252 | 3300003214 | Bacteria | 2134 |
| 5 | JGI25153J46596_10003518 | 3300003215 | Bacteria | 8738 |
| 6 | JGI25153J46596_10006847 | 3300003215 | Bacteria | 5697 |
| 7 | JGI25153J46596_10012797 | 3300003215 | Bacteria | 3593 |
| 8 | JGI25153J46596_10016522 | 3300003215 | Bacteria | 2950 |
| 9 | JGI25160J50197_1003097 | 3300003354 | Bacteria | 7586 |
| 10 | JGI25160J50197_1005052 | 3300003354 | Bacteria | 5574 |
| 11 | JGI25160J50197_1044907 | 3300003354 | Bacteria | 982 |
| 12 | JGI25404J52841_10007374 | 3300003659 | Bacteria | 2324 |
| 13 | JGI25404J52841_10040120 | 3300003659 | Bacteria | 991 |
| 14 | Ga0055542_1011767 | 3300003762 | Bacteria | 1539 |
| 15 | Ga0055526_1064162 | 3300003771 | Bacteria | 770 |
| 16 | Ga0055531_10008796 | 3300003794 | Bacteria | 5262 |
| 17 | Ga0055543_1003302 | 3300004625 | Bacteria | 4840 |
| 18 | Ga0065165_1001864 | 3300005262 | Bacteria | 20463 |
| 19 | Ga0065165_1019808 | 3300005262 | Bacteria | 2389 |
| 20 | Ga0065165_1020382 | 3300005262 | Bacteria | 2333 |
| 21 | Ga0070658_10230450 | 3300005327 | Bacteria | 1568 |
| 22 | Ga0070676_10153610 | 3300005328 | Bacteria | 1475 |
| 23 | Ga0070683_100029863 | 3300005329 | Bacteria | 4942 |
| 24 | Ga0070683_100689422 | 3300005329 | Bacteria | 978 |
| 25 | Ga0070670_100508728 | 3300005331 | Bacteria | 1072 |
| 26 | Ga0068869_100111795 | 3300005334 | Bacteria | 2079 |
| 27 | Ga0068869_100335859 | 3300005334 | Bacteria | 1229 |
| 28 | Ga0068869_100467874 | 3300005334 | Bacteria | 1048 |
| 29 | Ga0070680_100018923 | 3300005336 | Bacteria | 5449 |
| 30 | Ga0070680_100187668 | 3300005336 | Bacteria | 1742 |
| 31 | Ga0070680_100463579 | 3300005336 | Bacteria | 1083 |
| 32 | Ga0070680_100492177 | 3300005336 | Bacteria | 1049 |
| 33 | Ga0070682_100026401 | 3300005337 | Bacteria | 3475 |
| 34 | Ga0070682_100162523 | 3300005337 | Bacteria | 1544 |
| 35 | Ga0070682_100362253 | 3300005337 | Bacteria | 1085 |
| 36 | Ga0070682_100542480 | 3300005337 | Bacteria | 909 |
| 37 | Ga0068868_100589656 | 3300005338 | Bacteria | 983 |
| 38 | Ga0070660_100010416 | 3300005339 | Bacteria | 6570 |
| 39 | Ga0070660_100253469 | 3300005339 | Bacteria | 1436 |
| 40 | Ga0070660_100299299 | 3300005339 | Bacteria | 1319 |
| 41 | Ga0070687_100206945 | 3300005343 | Bacteria | 1193 |
| 42 | Ga0070661_100006251 | 3300005344 | Bacteria | 8217 |
| 43 | Ga0070661_100377068 | 3300005344 | Bacteria | 1118 |
| 44 | Ga0070668_100067207 | 3300005347 | Bacteria | 2784 |
| 45 | Ga0070668_100089962 | 3300005347 | Bacteria | 2418 |
| 46 | Ga0070668_100138774 | 3300005347 | Bacteria | 1957 |
| 47 | Ga0070669_100378212 | 3300005353 | Bacteria | 1154 |
| 48 | Ga0070669_100843392 | 3300005353 | Bacteria | 780 |
| 49 | Ga0070675_100065137 | 3300005354 | Bacteria | 3012 |
| 50 | Ga0070675_101244157 | 3300005354 | Bacteria | 686 |
| 51 | Ga0070671_100276120 | 3300005355 | Bacteria | 1429 |
| 52 | Ga0070671_100531100 | 3300005355 | Bacteria | 1013 |
| 53 | Ga0070671_100706021 | 3300005355 | Bacteria | 875 |
| 54 | Ga0070674_100078595 | 3300005356 | Bacteria | 2351 |
| 55 | Ga0070674_100111556 | 3300005356 | Bacteria | 2009 |
| 56 | Ga0070659_100177733 | 3300005366 | Bacteria | 1746 |
| 57 | Ga0070659_100375862 | 3300005366 | Bacteria | 1196 |
| 58 | Ga0070659_100448417 | 3300005366 | Bacteria | 1094 |
| 59 | Ga0070667_100134781 | 3300005367 | Bacteria | 2159 |
| 60 | Ga0070709_10000951 | 3300005434 | Bacteria | 16067 |
| 61 | Ga0070709_10076815 | 3300005434 | Bacteria | 2170 |
| 62 | Ga0070709_10172145 | 3300005434 | Bacteria | 1514 |
| 63 | Ga0070714_100010720 | 3300005435 | Bacteria | 7252 |
| 64 | Ga0070714_100074142 | 3300005435 | Bacteria | 2950 |
| 65 | Ga0070714_100226980 | 3300005435 | Bacteria | 1719 |
| 66 | Ga0070714_100386619 | 3300005435 | Bacteria | 1320 |
| 67 | Ga0070713_100000936 | 3300005436 | Bacteria | 18647 |
| 68 | Ga0070713_100005223 | 3300005436 | Bacteria | 8847 |
| 69 | Ga0070713_100066626 | 3300005436 | Bacteria | 3028 |
| 70 | Ga0070713_100098866 | 3300005436 | Bacteria | 2524 |
| 71 | Ga0070713_100294418 | 3300005436 | Bacteria | 1493 |
| 72 | Ga0070710_10002437 | 3300005437 | Bacteria | 8807 |
| 73 | Ga0070710_10372108 | 3300005437 | Bacteria | 951 |
| 74 | Ga0070711_100003765 | 3300005439 | Bacteria | 8895 |
| 75 | Ga0070711_100010373 | 3300005439 | Bacteria | 5763 |
| 76 | Ga0070711_100133712 | 3300005439 | Bacteria | 1850 |
| 77 | Ga0070705_100788869 | 3300005440 | Bacteria | 755 |
| 78 | Ga0070663_100028775 | 3300005455 | Bacteria | 3788 |
| 79 | Ga0070663_100033215 | 3300005455 | Bacteria | 3563 |
| 80 | Ga0070663_100051889 | 3300005455 | Bacteria | 2924 |
| 81 | Ga0070663_100153154 | 3300005455 | Bacteria | 1769 |
| 82 | Ga0070678_100038290 | 3300005456 | Bacteria | 3375 |
| 83 | Ga0070678_100046100 | 3300005456 | Bacteria | 3123 |
| 84 | Ga0070678_100050632 | 3300005456 | Bacteria | 3006 |
| 85 | Ga0070678_100622586 | 3300005456 | Bacteria | 966 |
| 86 | Ga0070662_100017777 | 3300005457 | Bacteria | 4797 |
| 87 | Ga0070662_100462378 | 3300005457 | Bacteria | 1055 |
| 88 | Ga0070662_100473847 | 3300005457 | Bacteria | 1042 |
| 89 | Ga0070681_10013529 | 3300005458 | Bacteria | 8113 |
| 90 | Ga0070681_10024245 | 3300005458 | Bacteria | 6107 |
| 91 | Ga0070681_10034302 | 3300005458 | Bacteria | 5096 |
| 92 | Ga0070681_10147981 | 3300005458 | Bacteria | 2276 |
| 93 | Ga0070681_10189850 | 3300005458 | Bacteria | 1974 |
| 94 | Ga0070681_10200951 | 3300005458 | Bacteria | 1911 |
| 95 | Ga0070681_10531280 | 3300005458 | Bacteria | 1090 |
| 96 | Ga0068867_100452316 | 3300005459 | Bacteria | 1094 |
| 97 | Ga0070698_100415922 | 3300005471 | Bacteria | 1279 |
| 98 | Ga0070699_100742334 | 3300005518 | Bacteria | 898 |
| 99 | Ga0070699_101106830 | 3300005518 | Bacteria | 727 |
| 100 | Ga0070679_100007218 | 3300005530 | Bacteria | 10377 |
| 101 | Ga0070679_100095395 | 3300005530 | Bacteria | 2962 |
| 102 | Ga0070679_100136758 | 3300005530 | Bacteria | 2431 |
| 103 | Ga0070679_100418008 | 3300005530 | Bacteria | 1286 |
| 104 | Ga0070679_100485784 | 3300005530 | Bacteria | 1179 |
| 105 | Ga0070679_100526022 | 3300005530 | Bacteria | 1126 |
| 106 | Ga0070684_100018029 | 3300005535 | Bacteria | 5805 |
| 107 | Ga0070684_100036613 | 3300005535 | Bacteria | 4205 |
| 108 | Ga0070684_100064431 | 3300005535 | Bacteria | 3215 |
| 109 | Ga0070684_100084021 | 3300005535 | Bacteria | 2821 |
| 110 | Ga0070684_100456942 | 3300005535 | Bacteria | 1181 |
| 111 | Ga0070697_100056309 | 3300005536 | Bacteria | 3199 |
| 112 | Ga0068853_100004481 | 3300005539 | Bacteria | 10832 |
| 113 | Ga0068853_100263379 | 3300005539 | Bacteria | 1585 |
| 114 | Ga0068853_100422717 | 3300005539 | Bacteria | 1250 |
| 115 | Ga0068853_100435135 | 3300005539 | Bacteria | 1232 |
| 116 | Ga0070672_100651502 | 3300005543 | Bacteria | 920 |
| 117 | Ga0070693_100060897 | 3300005547 | Bacteria | 2192 |
| 118 | Ga0070693_100390176 | 3300005547 | Bacteria | 963 |
| 119 | Ga0070665_100062885 | 3300005548 | Bacteria | 3722 |
| 120 | Ga0070665_100094386 | 3300005548 | Bacteria | 2996 |
| 121 | Ga0070665_100100681 | 3300005548 | Bacteria | 2894 |
| 122 | Ga0070665_100139357 | 3300005548 | Bacteria | 2429 |
| 123 | Ga0070665_100290721 | 3300005548 | Bacteria | 1637 |
| 124 | Ga0070665_100335848 | 3300005548 | Bacteria | 1515 |
| 125 | Ga0070665_100475332 | 3300005548 | Bacteria | 1260 |
| 126 | Ga0070665_100839981 | 3300005548 | Bacteria | 931 |
| 127 | Ga0070704_100205904 | 3300005549 | Bacteria | 1591 |
| 128 | Ga0068855_100026568 | 3300005563 | Bacteria | 6926 |
| 129 | Ga0068855_100067965 | 3300005563 | Bacteria | 4150 |
| 130 | Ga0068855_100121768 | 3300005563 | Bacteria | 2985 |
| 131 | Ga0068855_100202775 | 3300005563 | Bacteria | 2232 |
| 132 | Ga0068855_100221112 | 3300005563 | Bacteria | 2123 |
| 133 | Ga0068855_100325301 | 3300005563 | Bacteria | 1698 |
| 134 | Ga0068855_100446345 | 3300005563 | Bacteria | 1412 |
| 135 | Ga0068855_100505285 | 3300005563 | Bacteria | 1313 |
| 136 | Ga0068855_100610859 | 3300005563 | Bacteria | 1175 |
| 137 | Ga0070664_100074373 | 3300005564 | Bacteria | 2916 |
| 138 | Ga0070664_100631390 | 3300005564 | Bacteria | 995 |
| 139 | Ga0068857_100017569 | 3300005577 | Bacteria | 6271 |
| 140 | Ga0068857_100145722 | 3300005577 | Bacteria | 2143 |
| 141 | Ga0068857_100921285 | 3300005577 | Bacteria | 839 |
| 142 | Ga0068857_101371698 | 3300005577 | Bacteria | 687 |
| 143 | Ga0068854_100177549 | 3300005578 | Bacteria | 1661 |
| 144 | Ga0068856_100006094 | 3300005614 | Bacteria | 11843 |
| 145 | Ga0068856_100185539 | 3300005614 | Bacteria | 2094 |
| 146 | Ga0068856_100253901 | 3300005614 | Bacteria | 1773 |
| 147 | Ga0068856_100519403 | 3300005614 | Bacteria | 1212 |
| 148 | Ga0068856_100547175 | 3300005614 | Bacteria | 1179 |
| 149 | Ga0068856_100984659 | 3300005614 | Bacteria | 862 |
| 150 | Ga0068852_100002018 | 3300005616 | Bacteria | 13824 |
| 151 | Ga0068852_100082448 | 3300005616 | Bacteria | 2857 |
| 152 | Ga0068852_100103345 | 3300005616 | Bacteria | 2577 |
| 153 | Ga0068852_100141834 | 3300005616 | Bacteria | 2225 |
| 154 | Ga0068852_100218320 | 3300005616 | Bacteria | 1812 |
| 155 | Ga0068852_100312610 | 3300005616 | Bacteria | 1524 |
| 156 | Ga0068852_100641887 | 3300005616 | Bacteria | 1069 |
| 157 | Ga0068852_101445009 | 3300005616 | Bacteria | 710 |
| 158 | Ga0068859_100251619 | 3300005617 | Bacteria | 1857 |
| 159 | Ga0068859_100414858 | 3300005617 | Bacteria | 1442 |
| 160 | Ga0068859_100474485 | 3300005617 | Bacteria | 1346 |
| 161 | Ga0068864_100546987 | 3300005618 | Bacteria | 1118 |
| 162 | Ga0068861_100195399 | 3300005719 | Bacteria | 1694 |
| 163 | Ga0068861_100354350 | 3300005719 | Bacteria | 1288 |
| 164 | Ga0068851_10013775 | 3300005834 | Bacteria | 3829 |
| 165 | Ga0068851_10201064 | 3300005834 | Bacteria | 1112 |
| 166 | Ga0068863_100318014 | 3300005841 | Bacteria | 1511 |
| 167 | Ga0068863_100905256 | 3300005841 | Bacteria | 882 |
| 168 | Ga0068858_100248395 | 3300005842 | Bacteria | 1690 |
| 169 | Ga0068858_100313002 | 3300005842 | Bacteria | 1499 |
| 170 | Ga0068858_100355497 | 3300005842 | Bacteria | 1404 |
| 171 | Ga0068858_100444577 | 3300005842 | Bacteria | 1249 |
| 172 | Ga0068860_100000058 | 3300005843 | Bacteria | 197181 |
| 173 | Ga0068860_100204938 | 3300005843 | Bacteria | 1912 |
| 174 | Ga0068860_100353409 | 3300005843 | Bacteria | 1446 |
| 175 | Ga0068860_100692530 | 3300005843 | Bacteria | 1028 |
| 176 | Ga0068862_100037323 | 3300005844 | Bacteria | 4118 |
| 177 | Ga0068862_100105591 | 3300005844 | Bacteria | 2468 |
| 178 | Ga0068862_100626257 | 3300005844 | Bacteria | 1035 |
| 179 | Ga0068862_100943347 | 3300005844 | Bacteria | 850 |
| 180 | Ga0081455_10009084 | 3300005937 | Bacteria | 10254 |
| 181 | Ga0081455_10018953 | 3300005937 | Bacteria | 6526 |
| 182 | Ga0081455_10059666 | 3300005937 | Bacteria | 3220 |
| 183 | Ga0081455_10074357 | 3300005937 | Bacteria | 2807 |
| 184 | Ga0081455_10202229 | 3300005937 | Bacteria | 1487 |
| 185 | Ga0081455_10251739 | 3300005937 | Bacteria | 1291 |
| 186 | Ga0081538_10043006 | 3300005981 | Bacteria | 2843 |
| 187 | Ga0081538_10176859 | 3300005981 | Bacteria | 920 |
| 188 | Ga0081540_1001631 | 3300005983 | Bacteria | 19125 |
| 189 | Ga0081540_1004115 | 3300005983 | Bacteria | 11230 |
| 190 | Ga0081540_1009209 | 3300005983 | Bacteria | 6810 |
| 191 | Ga0081540_1009520 | 3300005983 | Bacteria | 6689 |
| 192 | Ga0081540_1024605 | 3300005983 | Bacteria | 3491 |
| 193 | Ga0081540_1031069 | 3300005983 | Bacteria | 2945 |
| 194 | Ga0081540_1037550 | 3300005983 | Bacteria | 2566 |
| 195 | Ga0081540_1040575 | 3300005983 | Bacteria | 2425 |
| 196 | Ga0081540_1122431 | 3300005983 | Bacteria | 1077 |
| 197 | Ga0081539_10000250 | 3300005985 | Bacteria | 125352 |
| 198 | Ga0081539_10000269 | 3300005985 | Bacteria | 119082 |
| 199 | Ga0081539_10017984 | 3300005985 | Bacteria | 4930 |
| 200 | Ga0081539_10176671 | 3300005985 | Bacteria | 1005 |
| 201 | Ga0070717_10001774 | 3300006028 | Bacteria | 15044 |
| 202 | Ga0070717_10049640 | 3300006028 | Bacteria | 3445 |
| 203 | Ga0070717_10304250 | 3300006028 | Bacteria | 1418 |
| 204 | Ga0075365_10015428 | 3300006038 | Bacteria | 4623 |
| 205 | Ga0075365_10040951 | 3300006038 | Bacteria | 3023 |
| 206 | Ga0075365_10053219 | 3300006038 | Bacteria | 2680 |
| 207 | Ga0075365_10059845 | 3300006038 | Bacteria | 2540 |
| 208 | Ga0075365_10130996 | 3300006038 | Bacteria | 1736 |
| 209 | Ga0075365_10148307 | 3300006038 | Bacteria | 1631 |
| 210 | Ga0075365_10236657 | 3300006038 | Bacteria | 1282 |
| 211 | Ga0075365_10406974 | 3300006038 | Bacteria | 960 |
| 212 | Ga0075368_10017232 | 3300006042 | Bacteria | 2702 |
| 213 | Ga0075368_10096813 | 3300006042 | Bacteria | 1210 |
| 214 | Ga0075368_10124387 | 3300006042 | Bacteria | 1069 |
| 215 | Ga0075368_10168457 | 3300006042 | Bacteria | 920 |
| 216 | Ga0075363_100012935 | 3300006048 | Bacteria | 4030 |
| 217 | Ga0075363_100086970 | 3300006048 | Bacteria | 1717 |
| 218 | Ga0075363_100201765 | 3300006048 | Bacteria | 1136 |
| 219 | Ga0075364_10090682 | 3300006051 | Bacteria | 2027 |
| 220 | Ga0075364_10106011 | 3300006051 | Bacteria | 1873 |
| 221 | Ga0075364_10378106 | 3300006051 | Bacteria | 966 |
| 222 | Ga0070715_10000514 | 3300006163 | Bacteria | 10119 |
| 223 | Ga0070715_10044050 | 3300006163 | Bacteria | 1885 |
| 224 | Ga0070716_100004285 | 3300006173 | Bacteria | 6796 |
| 225 | Ga0070716_100179140 | 3300006173 | Bacteria | 1390 |
| 226 | Ga0070712_100072591 | 3300006175 | Bacteria | 2466 |
| 227 | Ga0070712_100089027 | 3300006175 | Bacteria | 2257 |
| 228 | Ga0070712_100575789 | 3300006175 | Bacteria | 951 |
| 229 | Ga0075362_10229066 | 3300006177 | Bacteria | 910 |
| 230 | Ga0075367_10026323 | 3300006178 | Bacteria | 3298 |
| 231 | Ga0075367_10056089 | 3300006178 | Bacteria | 2340 |
| 232 | Ga0075367_10215730 | 3300006178 | Bacteria | 1200 |
| 233 | Ga0075369_10073960 | 3300006186 | Bacteria | 1503 |
| 234 | Ga0075366_10056404 | 3300006195 | Bacteria | 2333 |
| 235 | Ga0075366_10105423 | 3300006195 | Bacteria | 1694 |
| 236 | Ga0075366_10253032 | 3300006195 | Bacteria | 1074 |
| 237 | Ga0075366_10405609 | 3300006195 | Bacteria | 839 |
| 238 | Ga0097621_100698839 | 3300006237 | Bacteria | 934 |
| 239 | Ga0097621_101048862 | 3300006237 | Bacteria | 764 |
| 240 | Ga0075370_10030042 | 3300006353 | Bacteria | 3031 |
| 241 | Ga0075370_10065298 | 3300006353 | Bacteria | 2076 |
| 242 | Ga0075370_10112231 | 3300006353 | Bacteria | 1583 |
| 243 | Ga0075370_10225902 | 3300006353 | Bacteria | 1107 |
| 244 | Ga0075370_10334931 | 3300006353 | Bacteria | 903 |
| 245 | Ga0075433_10628661 | 3300006852 | Bacteria | 942 |
| 246 | Ga0075434_100008873 | 3300006871 | Bacteria | 9361 |
| 247 | Ga0075434_100915210 | 3300006871 | Bacteria | 892 |
| 248 | Ga0075434_101575156 | 3300006871 | Bacteria | 666 |
| 249 | Ga0068865_100075446 | 3300006881 | Bacteria | 2404 |
| 250 | Ga0097620_100251646 | 3300006931 | Bacteria | 1857 |
| 251 | Ga0097620_100414853 | 3300006931 | Bacteria | 1442 |
| 252 | Ga0097620_100474452 | 3300006931 | Bacteria | 1346 |
| 253 | Ga0099825_1017862 | 3300006941 | Bacteria | 5680 |
| 254 | Ga0099824_1004496 | 3300006942 | Bacteria | 20072 |
| 255 | Ga0099822_1001205 | 3300006943 | Bacteria | 29230 |
| 256 | Ga0099823_1074998 | 3300006944 | Bacteria | 1417 |
| 257 | Ga0099794_10111599 | 3300007265 | Bacteria | 1370 |
| 258 | Ga0099794_10247543 | 3300007265 | Bacteria | 919 |
| 259 | Ga0099795_10028277 | 3300007788 | Bacteria | 1905 |
| 260 | Ga0099795_10043937 | 3300007788 | Bacteria | 1601 |
| 261 | Ga0099795_10117800 | 3300007788 | Bacteria | 1059 |
| 262 | Ga0105250_10146291 | 3300009092 | Bacteria | 981 |
| 263 | Ga0105240_10037185 | 3300009093 | Bacteria | 6257 |
| 264 | Ga0105240_10060299 | 3300009093 | Bacteria | 4730 |
| 265 | Ga0105240_10147223 | 3300009093 | Bacteria | 2809 |
| 266 | Ga0105240_10170959 | 3300009093 | Bacteria | 2574 |
| 267 | Ga0105240_10216390 | 3300009093 | Bacteria | 2235 |
| 268 | Ga0111539_10054668 | 3300009094 | Bacteria | 4749 |
| 269 | Ga0105245_10018719 | 3300009098 | Bacteria | 6058 |
| 270 | Ga0105245_10083841 | 3300009098 | Bacteria | 2918 |
| 271 | Ga0105245_10132382 | 3300009098 | Bacteria | 2340 |
| 272 | Ga0105247_10005197 | 3300009101 | Bacteria | 8229 |
| 273 | Ga0105247_10043201 | 3300009101 | Bacteria | 2761 |
| 274 | Ga0105247_10120425 | 3300009101 | Bacteria | 1700 |
| 275 | Ga0105247_10122234 | 3300009101 | Bacteria | 1688 |
| 276 | Ga0105247_10534453 | 3300009101 | Bacteria | 860 |
| 277 | Ga0105247_10766575 | 3300009101 | Bacteria | 733 |
| 278 | Ga0105247_10808356 | 3300009101 | Bacteria | 716 |
| 279 | Ga0105243_10023714 | 3300009148 | Bacteria | 4676 |
| 280 | Ga0105243_10246899 | 3300009148 | Bacteria | 1591 |
| 281 | Ga0105241_10022043 | 3300009174 | Bacteria | 4715 |
| 282 | Ga0105241_10022614 | 3300009174 | Bacteria | 4657 |
| 283 | Ga0105241_10244997 | 3300009174 | Bacteria | 1517 |
| 284 | Ga0105241_10351808 | 3300009174 | Bacteria | 1279 |
| 285 | Ga0105241_10447478 | 3300009174 | Bacteria | 1142 |
| 286 | Ga0105242_10193943 | 3300009176 | Bacteria | 1800 |
| 287 | Ga0105242_10279996 | 3300009176 | Bacteria | 1515 |
| 288 | Ga0105248_10199489 | 3300009177 | Bacteria | 2254 |
| 289 | Ga0105248_10489643 | 3300009177 | Bacteria | 1386 |
| 290 | Ga0105248_10614982 | 3300009177 | Bacteria | 1226 |
| 291 | Ga0105248_10836986 | 3300009177 | Bacteria | 1039 |
| 292 | Ga0105248_10858407 | 3300009177 | Bacteria | 1025 |
| 293 | Ga0105248_10989480 | 3300009177 | Bacteria | 950 |
| 294 | Ga0105248_11095786 | 3300009177 | Bacteria | 900 |
| 295 | Ga0105237_10003757 | 3300009545 | Bacteria | 17883 |
| 296 | Ga0105237_10013957 | 3300009545 | Bacteria | 8407 |
| 297 | Ga0105237_10108092 | 3300009545 | Bacteria | 2773 |
| 298 | Ga0105237_10154651 | 3300009545 | Bacteria | 2290 |
| 299 | Ga0105237_10207611 | 3300009545 | Bacteria | 1959 |
| 300 | Ga0105237_10355262 | 3300009545 | Bacteria | 1470 |
| 301 | Ga0105238_10012843 | 3300009551 | Bacteria | 8450 |
| 302 | Ga0105238_10087356 | 3300009551 | Bacteria | 3105 |
| 303 | Ga0105238_10108517 | 3300009551 | Bacteria | 2757 |
| 304 | Ga0105238_10355678 | 3300009551 | Bacteria | 1454 |
| 305 | Ga0105238_10378419 | 3300009551 | Bacteria | 1407 |
| 306 | Ga0105238_10431818 | 3300009551 | Bacteria | 1313 |
| 307 | Ga0105238_10991369 | 3300009551 | Bacteria | 861 |
| 308 | Ga0105249_10548931 | 3300009553 | Bacteria | 1206 |
| 309 | Ga0099796_10007070 | 3300010159 | Bacteria | 2914 |
| 310 | Ga0105239_10083730 | 3300010375 | Bacteria | 3513 |
| 311 | Ga0105239_10095378 | 3300010375 | Bacteria | 3286 |
| 312 | Ga0105239_10099271 | 3300010375 | Bacteria | 3219 |
| 313 | Ga0105239_10132392 | 3300010375 | Bacteria | 2774 |
| 314 | Ga0105239_10168407 | 3300010375 | Bacteria | 2450 |
| 315 | Ga0105239_10300527 | 3300010375 | Bacteria | 1807 |
| 316 | Ga0105239_10489871 | 3300010375 | Bacteria | 1397 |
| 317 | Ga0105239_10608053 | 3300010375 | Bacteria | 1247 |
| 318 | Ga0105239_10734397 | 3300010375 | Bacteria | 1130 |
| 319 | Ga0105246_10121996 | 3300011119 | Bacteria | 1933 |
| 320 | Ga0105246_10388004 | 3300011119 | Bacteria | 1156 |
| 321 | Ga0105246_10416012 | 3300011119 | Bacteria | 1120 |
| 322 | Ga0157325_1010924 | 3300012485 | Bacteria | 675 |
| 323 | Ga0157313_1006498 | 3300012503 | Bacteria | 881 |
| 324 | Ga0157373_10114711 | 3300013100 | Bacteria | 1894 |
| 325 | Ga0157371_10127012 | 3300013102 | Bacteria | 1814 |
| 326 | Ga0157370_10076545 | 3300013104 | Bacteria | 3152 |
| 327 | Ga0157370_10358922 | 3300013104 | Bacteria | 1343 |
| 328 | Ga0157370_10375147 | 3300013104 | Bacteria | 1310 |
| 329 | Ga0157370_10562780 | 3300013104 | Bacteria | 1045 |
| 330 | Ga0157370_10970339 | 3300013104 | Bacteria | 770 |
| 331 | Ga0157369_10008435 | 3300013105 | Bacteria | 11819 |
| 332 | Ga0157369_10030907 | 3300013105 | Bacteria | 5902 |
| 333 | Ga0157369_10163132 | 3300013105 | Bacteria | 2351 |
| 334 | Ga0157369_10455646 | 3300013105 | Bacteria | 1324 |
| 335 | Ga0157369_10830928 | 3300013105 | Bacteria | 948 |
| 336 | Ga0157374_10073477 | 3300013296 | Bacteria | 3228 |
| 337 | Ga0157374_10161238 | 3300013296 | Bacteria | 2184 |
| 338 | Ga0157374_10172122 | 3300013296 | Bacteria | 2113 |
| 339 | Ga0157374_11494353 | 3300013296 | Bacteria | 699 |
| 340 | Ga0157378_10015347 | 3300013297 | Bacteria | 6709 |
| 341 | Ga0157378_10375595 | 3300013297 | Bacteria | 1395 |
| 342 | Ga0163162_10413533 | 3300013306 | Bacteria | 1481 |
| 343 | Ga0163162_10605167 | 3300013306 | Bacteria | 1222 |
| 344 | Ga0157372_10096728 | 3300013307 | Bacteria | 3365 |
| 345 | Ga0157372_10447920 | 3300013307 | Bacteria | 1505 |
| 346 | Ga0157372_10756641 | 3300013307 | Bacteria | 1130 |
| 347 | Ga0157372_11580295 | 3300013307 | Bacteria | 755 |
| 348 | Ga0157375_10022349 | 3300013308 | Bacteria | 5821 |
| 349 | Ga0157375_10191028 | 3300013308 | Bacteria | 2202 |
| 350 | Ga0157375_10247572 | 3300013308 | Bacteria | 1943 |
| 351 | Ga0157375_10312102 | 3300013308 | Bacteria | 1737 |
| 352 | Ga0157375_10529595 | 3300013308 | Bacteria | 1341 |
| 353 | Ga0157375_10586051 | 3300013308 | Bacteria | 1275 |
| 354 | Ga0157375_11317625 | 3300013308 | Bacteria | 849 |
| 355 | Ga0163163_10017322 | 3300014325 | Bacteria | 6718 |
| 356 | Ga0163163_10048111 | 3300014325 | Bacteria | 4192 |
| 357 | Ga0163163_10420635 | 3300014325 | Bacteria | 1395 |
| 358 | Ga0163163_10549931 | 3300014325 | Bacteria | 1217 |
| 359 | Ga0163163_11066205 | 3300014325 | Bacteria | 871 |
| 360 | Ga0157380_10126713 | 3300014326 | Bacteria | 2171 |
| 361 | Ga0157380_10338062 | 3300014326 | Bacteria | 1403 |
| 362 | Ga0157380_10358136 | 3300014326 | Bacteria | 1368 |
| 363 | Ga0157380_11479962 | 3300014326 | Bacteria | 731 |
| 364 | Ga0157377_10198201 | 3300014745 | Bacteria | 1273 |
| 365 | Ga0157379_10250131 | 3300014968 | Bacteria | 1609 |
| 366 | Ga0157379_10434627 | 3300014968 | Bacteria | 1210 |
| 367 | Ga0157379_10631896 | 3300014968 | Bacteria | 1001 |
| 368 | Ga0157376_10054586 | 3300014969 | Bacteria | 3331 |
| 369 | Ga0157376_10247875 | 3300014969 | Bacteria | 1662 |
| 370 | Ga0157376_10438937 | 3300014969 | Bacteria | 1271 |
| 371 | Ga0157376_10550588 | 3300014969 | Bacteria | 1142 |
| 372 | Ga0163161_10180473 | 3300017792 | Bacteria | 1618 |
| 373 | Ga0163161_10414456 | 3300017792 | Bacteria | 1082 |
| 374 | Ga0214544_1000009 | 3300021320 | Bacteria | 285865 |
| 375 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 376 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 377 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 378 | Ga0213873_10038419 | 3300021358 | Bacteria | 1223 |
| 379 | Ga0213874_10051145 | 3300021377 | Bacteria | 1268 |
| 380 | Ga0213876_10001848 | 3300021384 | Bacteria | 12750 |
| 381 | Ga0213876_10011429 | 3300021384 | Bacteria | 4740 |
| 382 | Ga0213875_10035810 | 3300021388 | Bacteria | 2341 |
| 383 | Ga0213875_10269927 | 3300021388 | Bacteria | 803 |
| 384 | Ga0209563_101045 | 3300025230 | Bacteria | 7993 |
| 385 | Ga0209677_102385 | 3300025253 | Bacteria | 7158 |
| 386 | Ga0209677_102571 | 3300025253 | Bacteria | 6678 |
| 387 | Ga0209148_1000446 | 3300025254 | Bacteria | 45354 |
| 388 | Ga0209233_1001302 | 3300025261 | Bacteria | 9962 |
| 389 | Ga0209233_1001367 | 3300025261 | Bacteria | 9687 |
| 390 | Ga0209233_1031508 | 3300025261 | Bacteria | 1237 |
| 391 | Ga0209455_1006256 | 3300025272 | Bacteria | 3543 |
| 392 | Ga0209673_1049900 | 3300025273 | Bacteria | 1115 |
| 393 | Ga0209564_1009891 | 3300025295 | Bacteria | 4467 |
| 394 | Ga0209564_1024293 | 3300025295 | Bacteria | 2074 |
| 395 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 396 | Ga0209758_1000160 | 3300025297 | Bacteria | 154304 |
| 397 | Ga0209758_1002793 | 3300025297 | Bacteria | 17073 |
| 398 | Ga0209758_1003932 | 3300025297 | Bacteria | 12945 |
| 399 | Ga0209758_1005852 | 3300025297 | Bacteria | 9179 |
| 400 | Ga0209758_1016663 | 3300025297 | Bacteria | 3715 |
| 401 | Ga0209758_1030410 | 3300025297 | Bacteria | 2237 |
| 402 | Ga0209758_1031291 | 3300025297 | Bacteria | 2185 |
| 403 | Ga0209050_1050100 | 3300025298 | Bacteria | 1064 |
| 404 | Ga0209256_1010637 | 3300025299 | Bacteria | 3820 |
| 405 | Ga0207426_1001094 | 3300025302 | Bacteria | 25012 |
| 406 | Ga0207426_1002241 | 3300025302 | Bacteria | 12874 |
| 407 | Ga0207426_1021409 | 3300025302 | Bacteria | 2236 |
| 408 | Ga0209257_1005571 | 3300025304 | Bacteria | 8758 |
| 409 | Ga0207697_10040240 | 3300025315 | Bacteria | 1919 |
| 410 | Ga0207697_10137630 | 3300025315 | Bacteria | 1058 |
| 411 | Ga0207697_10307825 | 3300025315 | Bacteria | 703 |
| 412 | Ga0207656_10212297 | 3300025321 | Bacteria | 938 |
| 413 | Ga0207696_1077977 | 3300025711 | Bacteria | 917 |
| 414 | Ga0207692_10000308 | 3300025898 | Bacteria | 16906 |
| 415 | Ga0207692_10002064 | 3300025898 | Bacteria | 7672 |
| 416 | Ga0207692_10095563 | 3300025898 | Bacteria | 1621 |
| 417 | Ga0207642_10018415 | 3300025899 | Bacteria | 2680 |
| 418 | Ga0207710_10005066 | 3300025900 | Bacteria | 5706 |
| 419 | Ga0207710_10011801 | 3300025900 | Bacteria | 3674 |
| 420 | Ga0207688_10224906 | 3300025901 | Bacteria | 1131 |
| 421 | Ga0207680_10359672 | 3300025903 | Bacteria | 1023 |
| 422 | Ga0207647_10015173 | 3300025904 | Bacteria | 5291 |
| 423 | Ga0207647_10066702 | 3300025904 | Bacteria | 2182 |
| 424 | Ga0207647_10150208 | 3300025904 | Bacteria | 1362 |
| 425 | Ga0207647_10173629 | 3300025904 | Bacteria | 1254 |
| 426 | Ga0207685_10000468 | 3300025905 | Bacteria | 6799 |
| 427 | Ga0207685_10068762 | 3300025905 | Bacteria | 1428 |
| 428 | Ga0207699_10001291 | 3300025906 | Bacteria | 11902 |
| 429 | Ga0207699_10010647 | 3300025906 | Bacteria | 4624 |
| 430 | Ga0207699_10128528 | 3300025906 | Bacteria | 1649 |
| 431 | Ga0207645_10027775 | 3300025907 | Bacteria | 3653 |
| 432 | Ga0207645_10030138 | 3300025907 | Bacteria | 3496 |
| 433 | Ga0207643_10223284 | 3300025908 | Bacteria | 1154 |
| 434 | Ga0207705_10274616 | 3300025909 | Bacteria | 1289 |
| 435 | Ga0207684_10085353 | 3300025910 | Bacteria | 2689 |
| 436 | Ga0207654_10070600 | 3300025911 | Bacteria | 2074 |
| 437 | Ga0207654_10077759 | 3300025911 | Bacteria | 1990 |
| 438 | Ga0207654_10185810 | 3300025911 | Bacteria | 1359 |
| 439 | Ga0207707_10000494 | 3300025912 | Bacteria | 40531 |
| 440 | Ga0207707_10000896 | 3300025912 | Bacteria | 29115 |
| 441 | Ga0207707_10026257 | 3300025912 | Bacteria | 5091 |
| 442 | Ga0207707_10109574 | 3300025912 | Bacteria | 2414 |
| 443 | Ga0207707_10304168 | 3300025912 | Bacteria | 1379 |
| 444 | Ga0207695_10000278 | 3300025913 | Bacteria | 127446 |
| 445 | Ga0207695_10080608 | 3300025913 | Bacteria | 3296 |
| 446 | Ga0207695_10184308 | 3300025913 | Bacteria | 2007 |
| 447 | Ga0207695_10254696 | 3300025913 | Bacteria | 1654 |
| 448 | Ga0207695_10340327 | 3300025913 | Bacteria | 1388 |
| 449 | Ga0207695_10752725 | 3300025913 | Bacteria | 854 |
| 450 | Ga0207671_10006710 | 3300025914 | Bacteria | 10194 |
| 451 | Ga0207671_10062495 | 3300025914 | Bacteria | 2765 |
| 452 | Ga0207671_10128103 | 3300025914 | Bacteria | 1946 |
| 453 | Ga0207671_10187699 | 3300025914 | Bacteria | 1611 |
| 454 | Ga0207671_10222555 | 3300025914 | Bacteria | 1479 |
| 455 | Ga0207671_10388735 | 3300025914 | Bacteria | 1109 |
| 456 | Ga0207693_10001932 | 3300025915 | Bacteria | 18147 |
| 457 | Ga0207693_10006236 | 3300025915 | Bacteria | 9891 |
| 458 | Ga0207693_10012373 | 3300025915 | Bacteria | 6893 |
| 459 | Ga0207693_10013898 | 3300025915 | Bacteria | 6483 |
| 460 | Ga0207693_10105956 | 3300025915 | Bacteria | 2205 |
| 461 | Ga0207663_10000365 | 3300025916 | Bacteria | 19715 |
| 462 | Ga0207663_10007002 | 3300025916 | Bacteria | 5817 |
| 463 | Ga0207663_10027757 | 3300025916 | Bacteria | 3304 |
| 464 | Ga0207663_10129357 | 3300025916 | Bacteria | 1742 |
| 465 | Ga0207660_10001052 | 3300025917 | Bacteria | 18273 |
| 466 | Ga0207660_10017659 | 3300025917 | Bacteria | 4744 |
| 467 | Ga0207660_10065377 | 3300025917 | Bacteria | 2628 |
| 468 | Ga0207660_10082459 | 3300025917 | Bacteria | 2366 |
| 469 | Ga0207657_10011901 | 3300025919 | Bacteria | 8609 |
| 470 | Ga0207657_10199380 | 3300025919 | Bacteria | 1611 |
| 471 | Ga0207657_10348207 | 3300025919 | Bacteria | 1168 |
| 472 | Ga0207657_10349687 | 3300025919 | Bacteria | 1166 |
| 473 | Ga0207657_10416926 | 3300025919 | Bacteria | 1056 |
| 474 | Ga0207649_10891177 | 3300025920 | Bacteria | 697 |
| 475 | Ga0207652_10001721 | 3300025921 | Bacteria | 19093 |
| 476 | Ga0207652_10002542 | 3300025921 | Bacteria | 15319 |
| 477 | Ga0207652_10029879 | 3300025921 | Bacteria | 4561 |
| 478 | Ga0207652_10033319 | 3300025921 | Bacteria | 4337 |
| 479 | Ga0207652_10255219 | 3300025921 | Bacteria | 1581 |
| 480 | Ga0207652_10264232 | 3300025921 | Bacteria | 1552 |
| 481 | Ga0207652_10346860 | 3300025921 | Bacteria | 1340 |
| 482 | Ga0207646_10052414 | 3300025922 | Bacteria | 3651 |
| 483 | Ga0207681_10237112 | 3300025923 | Bacteria | 1418 |
| 484 | Ga0207694_10046441 | 3300025924 | Bacteria | 3356 |
| 485 | Ga0207694_10115281 | 3300025924 | Bacteria | 2140 |
| 486 | Ga0207694_10195200 | 3300025924 | Bacteria | 1646 |
| 487 | Ga0207694_10239753 | 3300025924 | Bacteria | 1482 |
| 488 | Ga0207694_10272737 | 3300025924 | Bacteria | 1388 |
| 489 | Ga0207694_10671562 | 3300025924 | Bacteria | 873 |
| 490 | Ga0207694_11045332 | 3300025924 | Bacteria | 691 |
| 491 | Ga0207650_10105342 | 3300025925 | Bacteria | 2177 |
| 492 | Ga0207687_10012698 | 3300025927 | Bacteria | 5503 |
| 493 | Ga0207687_10086909 | 3300025927 | Bacteria | 2271 |
| 494 | Ga0207687_10355679 | 3300025927 | Bacteria | 1194 |
| 495 | Ga0207700_10000752 | 3300025928 | Bacteria | 18675 |
| 496 | Ga0207700_10076249 | 3300025928 | Bacteria | 2601 |
| 497 | Ga0207700_10209162 | 3300025928 | Bacteria | 1648 |
| 498 | Ga0207700_10639121 | 3300025928 | Bacteria | 948 |
| 499 | Ga0207664_10023582 | 3300025929 | Bacteria | 4613 |
| 500 | Ga0207664_10143318 | 3300025929 | Bacteria | 2024 |
| 501 | Ga0207664_10843445 | 3300025929 | Bacteria | 824 |
| 502 | Ga0207644_10058994 | 3300025931 | Bacteria | 2775 |
| 503 | Ga0207644_10244542 | 3300025931 | Bacteria | 1429 |
| 504 | Ga0207690_10197654 | 3300025932 | Bacteria | 1525 |
| 505 | Ga0207690_10291979 | 3300025932 | Bacteria | 1273 |
| 506 | Ga0207690_10358604 | 3300025932 | Bacteria | 1154 |
| 507 | Ga0207706_10114484 | 3300025933 | Bacteria | 2372 |
| 508 | Ga0207686_10173751 | 3300025934 | Bacteria | 1522 |
| 509 | Ga0207686_10373665 | 3300025934 | Bacteria | 1079 |
| 510 | Ga0207709_10052805 | 3300025935 | Bacteria | 2498 |
| 511 | Ga0207709_10369126 | 3300025935 | Bacteria | 1089 |
| 512 | Ga0207669_10052815 | 3300025937 | Bacteria | 2444 |
| 513 | Ga0207669_10086954 | 3300025937 | Bacteria | 2023 |
| 514 | Ga0207669_10258533 | 3300025937 | Bacteria | 1301 |
| 515 | Ga0207669_10447611 | 3300025937 | Bacteria | 1023 |
| 516 | Ga0207669_10572483 | 3300025937 | Bacteria | 914 |
| 517 | Ga0207704_10014890 | 3300025938 | Bacteria | 3945 |
| 518 | Ga0207665_10000957 | 3300025939 | Bacteria | 19547 |
| 519 | Ga0207665_10004741 | 3300025939 | Bacteria | 9038 |
| 520 | Ga0207665_10539715 | 3300025939 | Bacteria | 905 |
| 521 | Ga0207691_10033524 | 3300025940 | Bacteria | 4780 |
| 522 | Ga0207691_10034661 | 3300025940 | Bacteria | 4692 |
| 523 | Ga0207691_10824720 | 3300025940 | Bacteria | 779 |
| 524 | Ga0207711_10396851 | 3300025941 | Bacteria | 1281 |
| 525 | Ga0207711_10430120 | 3300025941 | Bacteria | 1228 |
| 526 | Ga0207711_10931781 | 3300025941 | Bacteria | 807 |
| 527 | Ga0207689_10188972 | 3300025942 | Bacteria | 1699 |
| 528 | Ga0207689_10240079 | 3300025942 | Bacteria | 1498 |
| 529 | Ga0207689_10365900 | 3300025942 | Bacteria | 1199 |
| 530 | Ga0207661_10015207 | 3300025944 | Bacteria | 5658 |
| 531 | Ga0207661_10223074 | 3300025944 | Bacteria | 1666 |
| 532 | Ga0207661_10390469 | 3300025944 | Bacteria | 1261 |
| 533 | Ga0207679_10054680 | 3300025945 | Bacteria | 2940 |
| 534 | Ga0207679_10541624 | 3300025945 | Bacteria | 1043 |
| 535 | Ga0207679_10565554 | 3300025945 | Bacteria | 1021 |
| 536 | Ga0207667_10003512 | 3300025949 | Bacteria | 19383 |
| 537 | Ga0207667_10010956 | 3300025949 | Bacteria | 10568 |
| 538 | Ga0207667_10184363 | 3300025949 | Bacteria | 2143 |
| 539 | Ga0207667_10215470 | 3300025949 | Bacteria | 1968 |
| 540 | Ga0207667_10330631 | 3300025949 | Bacteria | 1556 |
| 541 | Ga0207667_10521761 | 3300025949 | Bacteria | 1203 |
| 542 | Ga0207667_11267521 | 3300025949 | Bacteria | 714 |
| 543 | Ga0207651_10307059 | 3300025960 | Bacteria | 1321 |
| 544 | Ga0207651_10650690 | 3300025960 | Bacteria | 925 |
| 545 | Ga0207712_10215242 | 3300025961 | Bacteria | 1533 |
| 546 | Ga0207712_10687044 | 3300025961 | Bacteria | 892 |
| 547 | Ga0207668_10106980 | 3300025972 | Bacteria | 2090 |
| 548 | Ga0207668_10191611 | 3300025972 | Bacteria | 1620 |
| 549 | Ga0207668_10193574 | 3300025972 | Bacteria | 1613 |
| 550 | Ga0207668_10221896 | 3300025972 | Bacteria | 1518 |
| 551 | Ga0207668_11005197 | 3300025972 | Bacteria | 745 |
| 552 | Ga0207658_10255064 | 3300025986 | Bacteria | 1492 |
| 553 | Ga0207658_10258570 | 3300025986 | Bacteria | 1483 |
| 554 | Ga0207658_11234830 | 3300025986 | Bacteria | 683 |
| 555 | Ga0207677_10194612 | 3300026023 | Bacteria | 1607 |
| 556 | Ga0207677_10602621 | 3300026023 | Bacteria | 964 |
| 557 | Ga0207703_10093548 | 3300026035 | Bacteria | 2532 |
| 558 | Ga0207703_10131827 | 3300026035 | Bacteria | 2159 |
| 559 | Ga0207703_10204380 | 3300026035 | Bacteria | 1757 |
| 560 | Ga0207703_10263644 | 3300026035 | Bacteria | 1558 |
| 561 | Ga0207703_11031884 | 3300026035 | Bacteria | 789 |
| 562 | Ga0207639_10007089 | 3300026041 | Bacteria | 7645 |
| 563 | Ga0207639_10149273 | 3300026041 | Bacteria | 1956 |
| 564 | Ga0207639_10358067 | 3300026041 | Bacteria | 1305 |
| 565 | Ga0207639_10685993 | 3300026041 | Bacteria | 950 |
| 566 | Ga0207639_10903925 | 3300026041 | Bacteria | 825 |
| 567 | Ga0207678_10060617 | 3300026067 | Bacteria | 3254 |
| 568 | Ga0207678_10066555 | 3300026067 | Bacteria | 3094 |
| 569 | Ga0207678_10091282 | 3300026067 | Bacteria | 2603 |
| 570 | Ga0207678_10126493 | 3300026067 | Bacteria | 2180 |
| 571 | Ga0207678_10399880 | 3300026067 | Bacteria | 1189 |
| 572 | Ga0207678_10798733 | 3300026067 | Bacteria | 833 |
| 573 | Ga0207702_10004908 | 3300026078 | Bacteria | 11764 |
| 574 | Ga0207702_10291263 | 3300026078 | Bacteria | 1547 |
| 575 | Ga0207702_10300882 | 3300026078 | Bacteria | 1522 |
| 576 | Ga0207702_10577360 | 3300026078 | Bacteria | 1102 |
| 577 | Ga0207702_10683171 | 3300026078 | Bacteria | 1011 |
| 578 | Ga0207702_10768230 | 3300026078 | Bacteria | 952 |
| 579 | Ga0207641_10458860 | 3300026088 | Bacteria | 1232 |
| 580 | Ga0207648_10027013 | 3300026089 | Bacteria | 5097 |
| 581 | Ga0207676_10121979 | 3300026095 | Bacteria | 2200 |
| 582 | Ga0207676_10183059 | 3300026095 | Bacteria | 1836 |
| 583 | Ga0207676_10572198 | 3300026095 | Bacteria | 1082 |
| 584 | Ga0207676_10635248 | 3300026095 | Bacteria | 1029 |
| 585 | Ga0207674_10016819 | 3300026116 | Bacteria | 7994 |
| 586 | Ga0207674_10076950 | 3300026116 | Bacteria | 3343 |
| 587 | Ga0207674_10078158 | 3300026116 | Bacteria | 3314 |
| 588 | Ga0207674_10812741 | 3300026116 | Bacteria | 902 |
| 589 | Ga0207675_100193953 | 3300026118 | Bacteria | 1949 |
| 590 | Ga0207675_100196150 | 3300026118 | Bacteria | 1938 |
| 591 | Ga0207683_10036246 | 3300026121 | Bacteria | 4294 |
| 592 | Ga0207683_10075265 | 3300026121 | Bacteria | 2988 |
| 593 | Ga0207683_10262697 | 3300026121 | Bacteria | 1576 |
| 594 | Ga0207698_10033235 | 3300026142 | Bacteria | 3746 |
| 595 | Ga0207698_10094835 | 3300026142 | Bacteria | 2455 |
| 596 | Ga0207698_10384358 | 3300026142 | Bacteria | 1336 |
| 597 | Ga0209389_1000113 | 3300027296 | Bacteria | 72242 |
| 598 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 599 | Ga0209589_1000041 | 3300027357 | Bacteria | 125191 |
| 600 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 601 | Ga0209489_100070 | 3300027361 | Bacteria | 138580 |
| 602 | Ga0209489_107143 | 3300027361 | Bacteria | 17020 |
| 603 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 604 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 605 | Ga0209588_1027013 | 3300027671 | Bacteria | 1825 |
| 606 | Ga0209813_10016723 | 3300027866 | Bacteria | 2005 |
| 607 | Ga0209813_10059055 | 3300027866 | Bacteria | 1220 |
| 608 | Ga0268266_10063942 | 3300028379 | Bacteria | 3177 |
| 609 | Ga0268266_10097492 | 3300028379 | Bacteria | 2585 |
| 610 | Ga0268266_10149445 | 3300028379 | Bacteria | 2104 |
| 611 | Ga0268266_10272122 | 3300028379 | Bacteria | 1572 |
| 612 | Ga0268265_10044540 | 3300028380 | Bacteria | 3304 |
| 613 | Ga0268265_10069413 | 3300028380 | Bacteria | 2736 |
| 614 | Ga0268265_10267710 | 3300028380 | Bacteria | 1522 |
| 615 | Ga0268265_10268890 | 3300028380 | Bacteria | 1519 |
| 616 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 617 | Ga0268264_10094942 | 3300028381 | Bacteria | 2579 |
| 618 | Ga0268264_10294537 | 3300028381 | Bacteria | 1525 |
| 619 | Ga0268264_10872588 | 3300028381 | Bacteria | 902 |
| 620 | Ga0265337_1010612 | 3300028556 | Bacteria | 3215 |
| 621 | Ga0265334_10033498 | 3300028573 | Bacteria | 2044 |
| 622 | Ga0265334_10034598 | 3300028573 | Bacteria | 2004 |
| 623 | Ga0265318_10123634 | 3300028577 | Bacteria | 951 |
| 624 | Ga0265323_10019751 | 3300028653 | Bacteria | 2597 |
| 625 | Ga0307517_10001054 | 3300028786 | Bacteria | 46731 |
| 626 | Ga0307515_10073527 | 3300028794 | Bacteria | 4592 |
| 627 | Ga0265338_10000337 | 3300028800 | Bacteria | 85427 |
| 628 | Ga0265338_10611853 | 3300028800 | Bacteria | 758 |
| 629 | Ga0265324_10010988 | 3300029957 | Bacteria | 3468 |
| 630 | Ga0307511_10214421 | 3300030521 | Bacteria | 977 |
| 631 | Ga0265762_1021662 | 3300030760 | Bacteria | 1186 |
| 632 | Ga0265760_10119633 | 3300031090 | Bacteria | 844 |
| 633 | Ga0265325_10017156 | 3300031241 | Bacteria | 4029 |
| 634 | Ga0265340_10011816 | 3300031247 | Bacteria | 4627 |
| 635 | Ga0265340_10128737 | 3300031247 | Bacteria | 1162 |
| 636 | Ga0265339_10021644 | 3300031249 | Bacteria | 3736 |
| 637 | Ga0265339_10071611 | 3300031249 | Bacteria | 1846 |
| 638 | Ga0265331_10080665 | 3300031250 | Bacteria | 1512 |
| 639 | Ga0265331_10151928 | 3300031250 | Bacteria | 1051 |
| 640 | Ga0265331_10197745 | 3300031250 | Bacteria | 906 |
| 641 | Ga0265316_10120452 | 3300031344 | Bacteria | 1982 |
| 642 | Ga0307513_10242240 | 3300031456 | Bacteria | 1607 |
| 643 | Ga0307513_10539348 | 3300031456 | Bacteria | 880 |
| 644 | Ga0307509_10069489 | 3300031507 | Bacteria | 3681 |
| 645 | Ga0307509_10248383 | 3300031507 | Bacteria | 1565 |
| 646 | Ga0307509_10276692 | 3300031507 | Bacteria | 1442 |
| 647 | Ga0307408_100624601 | 3300031548 | Bacteria | 960 |
| 648 | Ga0307408_100812913 | 3300031548 | Bacteria | 849 |
| 649 | Ga0265313_10241970 | 3300031595 | Bacteria | 738 |
| 650 | Ga0307508_10000038 | 3300031616 | Bacteria | 150186 |
| 651 | Ga0307508_10011952 | 3300031616 | Bacteria | 7942 |
| 652 | Ga0307508_10049566 | 3300031616 | Bacteria | 3740 |
| 653 | Ga0307508_10179027 | 3300031616 | Bacteria | 1722 |
| 654 | Ga0307508_10231295 | 3300031616 | Bacteria | 1447 |
| 655 | Ga0307508_10484184 | 3300031616 | Bacteria | 831 |
| 656 | Ga0265314_10010719 | 3300031711 | Bacteria | 7626 |
| 657 | Ga0265314_10416874 | 3300031711 | Bacteria | 722 |
| 658 | Ga0265342_10005896 | 3300031712 | Bacteria | 9239 |
| 659 | Ga0265342_10027683 | 3300031712 | Bacteria | 3537 |
| 660 | Ga0307516_10021961 | 3300031730 | Bacteria | 6557 |
| 661 | Ga0307516_10218372 | 3300031730 | Bacteria | 1617 |
| 662 | Ga0307516_10253433 | 3300031730 | Bacteria | 1453 |
| 663 | Ga0307516_10452957 | 3300031730 | Bacteria | 939 |
| 664 | Ga0307405_10334448 | 3300031731 | Bacteria | 1162 |
| 665 | Ga0307405_10486612 | 3300031731 | Bacteria | 986 |
| 666 | Ga0307413_10128964 | 3300031824 | Bacteria | 1727 |
| 667 | Ga0307518_10237817 | 3300031838 | Bacteria | 1172 |
| 668 | Ga0307407_10086172 | 3300031903 | Bacteria | 1913 |
| 669 | Ga0307409_100135783 | 3300031995 | Bacteria | 2110 |
| 670 | Ga0307416_100096572 | 3300032002 | Bacteria | 2556 |
| 671 | Ga0307414_10211996 | 3300032004 | Bacteria | 1584 |
| 672 | Ga0307415_100298446 | 3300032126 | Bacteria | 1333 |
| 673 | Ga0307507_10006782 | 3300033179 | Bacteria | 17185 |
| 674 | Ga0307510_10046892 | 3300033180 | Bacteria | 4640 |
| 675 | Ga0307510_10059591 | 3300033180 | Bacteria | 3939 |
| 676 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 677 | Ga0316215_1008573 | 3300033544 | Bacteria | 1005 |
| 678 | Ga0373958_0094615 | 3300034819 | Bacteria | 694 |
| 679 | Ga0373926_0001023 | 3300035083 | Bacteria | 8192 |
| 680 | Ga0373926_0042922 | 3300035083 | Bacteria | 1618 |
| 681 | Ga0373934_0059515 | 3300035086 | Bacteria | 1520 |
| 682 | Ga0373944_0055536 | 3300035089 | Bacteria | 1258 |
| 683 | Ga0373952_0032660 | 3300035092 | Bacteria | 1164 |
| 684 | Ga0373923_0000923 | 3300035111 | Bacteria | 7846 |
| 685 | Ga0373923_0033913 | 3300035111 | Bacteria | 2069 |
| 686 | Ga0373932_0079158 | 3300035112 | Bacteria | 1035 |
| 687 | Ga0373936_0026216 | 3300035113 | Bacteria | 2283 |
| 688 | Ga0373936_0036592 | 3300035113 | Bacteria | 1958 |
| 689 | Ga0373936_0214801 | 3300035113 | Bacteria | 852 |
| 690 | Ga0373939_0073328 | 3300035114 | Bacteria | 1120 |
| 691 | Ga0373941_0010495 | 3300035115 | Bacteria | 2368 |
| 692 | Ga0373945_0011559 | 3300035116 | Bacteria | 2921 |
| 693 | Ga0373945_0056625 | 3300035116 | Bacteria | 1454 |
| 694 | Ga0373953_0007891 | 3300035117 | Bacteria | 3588 |
| 695 | Ga0373953_0015186 | 3300035117 | Bacteria | 2785 |
| 696 | Ga0373953_0067556 | 3300035117 | Bacteria | 1471 |
| 697 | Ga0373954_0041893 | 3300035118 | Bacteria | 2135 |
| 698 | Ga0373954_0102801 | 3300035118 | Bacteria | 1379 |
| 699 | Ga0373954_0158867 | 3300035118 | Bacteria | 1105 |
| 700 | Ga0373957_0000375 | 3300035120 | Bacteria | 11330 |
| 701 | Ga0373943_0039246 | 3300035170 | Bacteria | 2281 |
| 702 | Ga0373946_0025361 | 3300035171 | Bacteria | 2331 |
| 703 | Ga0373955_0001328 | 3300035172 | Bacteria | 10490 |
| 704 | Ga0373924_0001614 | 3300035410 | Bacteria | 7396 |
| 705 | Ga0373924_0110706 | 3300035410 | Bacteria | 1187 |
| 706 | Ga0373931_0014501 | 3300035691 | Bacteria | 3853 |
| 707 | Ga0373935_0284639 | 3300035692 | Bacteria | 1164 |
| 708 | Ga0373935_0296239 | 3300035692 | Bacteria | 1142 |
| 709 | Ga0373935_0450177 | 3300035692 | Bacteria | 930 |
| 710 | Ga0373935_0525089 | 3300035692 | Bacteria | 861 |
| 711 | Ga0373927_0000225 | 3300035695 | Bacteria | 44840 |
| 712 | Ga0373927_0027925 | 3300035695 | Bacteria | 3683 |
| 713 | Ga0373927_0032601 | 3300035695 | Bacteria | 3393 |
| 714 | Ga0373927_0061827 | 3300035695 | Bacteria | 2422 |
| 715 | Ga0373927_0092919 | 3300035695 | Bacteria | 1960 |
| 716 | Ga0373927_0141451 | 3300035695 | Bacteria | 1574 |
| 717 | Ga0373927_0166913 | 3300035695 | Bacteria | 1442 |
| 718 | Ga0373933_0001518 | 3300035724 | Bacteria | 13555 |
| 719 | Ga0373933_0043637 | 3300035724 | Bacteria | 2654 |
| 720 | Ga0373933_0047712 | 3300035724 | Bacteria | 2548 |
| 721 | Ga0373933_0142763 | 3300035724 | Bacteria | 1512 |
| 722 | Ga0373947_0023122 | 3300035725 | Bacteria | 3613 |
| 723 | Ga0373947_0137064 | 3300035725 | Bacteria | 1567 |
| 724 | Ga0373947_0263604 | 3300035725 | Bacteria | 1142 |
| 725 | Ga0373947_0406711 | 3300035725 | Bacteria | 918 |
| 726 | Ga0373937_0091905 | 3300036401 | Bacteria | 2812 |
| 727 | Ga0373937_0196775 | 3300036401 | Bacteria | 1894 |
| 728 | Ga0373925_0000711 | 3300037068 | Bacteria | 31078 |
| 729 | Ga0373925_0057892 | 3300037068 | Bacteria | 2905 |
| 730 | Ga0373925_0101408 | 3300037068 | Bacteria | 2213 |
| 731 | Ga0373925_0197535 | 3300037068 | Bacteria | 1598 |
| 732 | Ga0373925_0209187 | 3300037068 | Bacteria | 1554 |
| 733 | Ga0395899_0140917 | 3300037312 | Bacteria | 1715 |
| 734 | Ga0395900_0000860 | 3300037418 | Bacteria | 40028 |
| 735 | Ga0395900_0323770 | 3300037418 | Bacteria | 1521 |
| 736 | Ga0395900_0483145 | 3300037418 | Bacteria | 1191 |
| 737 | Ga0395898_0046012 | 3300037466 | Bacteria | 4287 |
| 738 | Ga0395905_0056855 | 3300037471 | Bacteria | 3659 |
| 739 | Ga0395905_0123786 | 3300037471 | Bacteria | 2431 |
| 740 | Ga0436364_0267346 | 3300037853 | Bacteria | 1497 |
| 741 | Ga0436364_0500303 | 3300037853 | Bacteria | 3660 |
| 742 | Ga0436364_1340351 | 3300037853 | Bacteria | 1989 |
| 743 | Ga0395901_0057535 | 3300038443 | Bacteria | 4044 |
| 744 | Ga0395901_0974883 | 3300038443 | Bacteria | 825 |
| 745 | Ga0436365_0151039 | 3300039437 | Bacteria | 2043 |
| 746 | Ga0436365_0268210 | 3300039437 | Bacteria | 9455 |
| 747 | Ga0436365_0710303 | 3300039437 | Bacteria | 1014 |
| 748 | Ga0436365_1095310 | 3300039437 | Bacteria | 3618 |
| 749 | Ga0436365_1396402 | 3300039437 | Bacteria | 1602 |
| 750 | Ga0436365_1591893 | 3300039437 | Bacteria | 688 |
| 751 | Ga0436365_1655446 | 3300039437 | Bacteria | 1705 |
| 752 | Ga0436365_1817893 | 3300039437 | Bacteria | 1337 |
| 753 | Ga0436365_1870953 | 3300039437 | Bacteria | 1609 |
| 754 | Ga0436360_0660865 | 3300039438 | Bacteria | 1247 |
| 755 | Ga0436363_0772753 | 3300039450 | Bacteria | 4670 |
| 756 | Ga0436363_0894926 | 3300039450 | Bacteria | 838 |
| 757 | Ga0436363_1201079 | 3300039450 | Bacteria | 3284 |
| 758 | Ga0436363_1223665 | 3300039450 | Bacteria | 1105 |
| 759 | Ga0436362_0332326 | 3300039453 | Bacteria | 2918 |
| 760 | Ga0439465_0108277 | 3300041413 | Bacteria | 965 |
| 761 | Ga0451791_0964902 | 3300041451 | Bacteria | 700 |
| 762 | Ga0451797_0764166 | 3300041453 | Bacteria | 807 |
| 763 | Ga0451802_0611095 | 3300041460 | Bacteria | 696 |
| 764 | Ga0451839_1631068 | 3300041496 | Bacteria | 958 |
| 765 | Ga0451839_1657451 | 3300041496 | Bacteria | 2269 |
| 766 | Ga0451841_0572120 | 3300041498 | Bacteria | 742 |
| 767 | Ga0451849_0054097 | 3300041505 | Bacteria | 1846 |
| 768 | Ga0451853_2886446 | 3300041512 | Bacteria | 695 |
| 769 | Ga0451853_3008790 | 3300041512 | Bacteria | 648 |
| 770 | Ga0451853_3547507 | 3300041512 | Bacteria | 893 |
| 771 | Ga0439463_049467 | 3300042016 | Bacteria | 1072 |
| 772 | Ga0439458_0079320 | 3300042157 | Bacteria | 836 |
| 773 | Ga0466972_0000660 | 3300044658 | Bacteria | 16624 |
| 774 | Ga0466972_0004579 | 3300044658 | Bacteria | 6928 |
| 775 | Ga0466972_0109388 | 3300044658 | Bacteria | 1306 |
| 776 | Ga0466965_0099463 | 3300044683 | Bacteria | 1486 |
| 777 | Ga0466966_0000932 | 3300044684 | Bacteria | 18644 |
| 778 | Ga0466966_0102237 | 3300044684 | Bacteria | 1772 |
| 779 | Ga0466961_0000488 | 3300044693 | Bacteria | 25223 |
| 780 | Ga0466963_0074240 | 3300044694 | Bacteria | 2293 |
| 781 | Ga0466963_0121993 | 3300044694 | Bacteria | 1794 |
| 782 | Ga0466964_0352582 | 3300044706 | Bacteria | 756 |
| 783 | Ga0466964_0411657 | 3300044706 | Bacteria | 709 |
| 784 | Ga0466968_0002010 | 3300044735 | Bacteria | 7392 |
| 785 | Ga0466957_0079290 | 3300044842 | Bacteria | 2043 |
| 786 | Ga0466957_0159408 | 3300044842 | Bacteria | 1465 |
| 787 | Ga0466957_0407282 | 3300044842 | Bacteria | 931 |
| 788 | Ga0466967_0031184 | 3300045976 | Bacteria | 4485 |
| 789 | Ga0466967_0115452 | 3300045976 | Bacteria | 2472 |
| 790 | Ga0495617_042503 | 3300046452 | Bacteria | 1519 |
| 791 | Ga0495617_077806 | 3300046452 | Bacteria | 1088 |
| 792 | Ga0495592_0002531 | 3300046454 | Bacteria | 12897 |
| 793 | Ga0495592_0018338 | 3300046454 | Bacteria | 5321 |
| 794 | Ga0495592_0395432 | 3300046454 | Bacteria | 876 |
| 795 | Ga0495592_0603616 | 3300046454 | Bacteria | 669 |
| 796 | Ga0495603_0001221 | 3300046455 | Bacteria | 14993 |
| 797 | Ga0495603_0026173 | 3300046455 | Bacteria | 3525 |
| 798 | Ga0495603_0191071 | 3300046455 | Bacteria | 1184 |
| 799 | Ga0495629_0000179 | 3300046459 | Bacteria | 56885 |
| 800 | Ga0495629_0001007 | 3300046459 | Bacteria | 22607 |
| 801 | Ga0495629_0005795 | 3300046459 | Bacteria | 9214 |
| 802 | Ga0495638_0012856 | 3300046460 | Bacteria | 5719 |
| 803 | Ga0495638_0066840 | 3300046460 | Bacteria | 2208 |
| 804 | Ga0495638_0258927 | 3300046460 | Bacteria | 955 |
| 805 | Ga0495651_0013292 | 3300046462 | Bacteria | 6367 |
| 806 | Ga0495651_0157426 | 3300046462 | Bacteria | 1631 |
| 807 | Ga0495651_0162720 | 3300046462 | Bacteria | 1597 |
| 808 | Ga0495651_0272952 | 3300046462 | Bacteria | 1146 |
| 809 | Ga0495651_0323804 | 3300046462 | Bacteria | 1026 |
| 810 | Ga0495651_0360313 | 3300046462 | Bacteria | 958 |
| 811 | Ga0495651_0482053 | 3300046462 | Bacteria | 797 |
| 812 | Ga0495653_0211587 | 3300046463 | Bacteria | 1309 |
| 813 | Ga0495650_0207173 | 3300046471 | Bacteria | 679 |
| 814 | Ga0495580_0000280 | 3300046472 | Bacteria | 41385 |
| 815 | Ga0495580_0029169 | 3300046472 | Bacteria | 4005 |
| 816 | Ga0495582_0000061 | 3300046473 | Bacteria | 55522 |
| 817 | Ga0495582_0143590 | 3300046473 | Bacteria | 1353 |
| 818 | Ga0495639_0000102 | 3300046475 | Bacteria | 42249 |
| 819 | Ga0495639_0036398 | 3300046475 | Bacteria | 2204 |
| 820 | Ga0495662_0000074 | 3300046476 | Bacteria | 35316 |
| 821 | Ga0495662_0021975 | 3300046476 | Bacteria | 3083 |
| 822 | Ga0495664_0077067 | 3300046477 | Bacteria | 1996 |
| 823 | Ga0495664_0116766 | 3300046477 | Bacteria | 1613 |
| 824 | Ga0495584_0367079 | 3300046491 | Bacteria | 731 |
| 825 | Ga0495585_0200184 | 3300046492 | Bacteria | 1017 |
| 826 | Ga0495594_0000378 | 3300046499 | Bacteria | 22340 |
| 827 | Ga0495594_0188928 | 3300046499 | Bacteria | 1173 |
| 828 | Ga0495594_0310518 | 3300046499 | Bacteria | 898 |
| 829 | Ga0495594_0332067 | 3300046499 | Bacteria | 866 |
| 830 | Ga0495583_0038104 | 3300046506 | Bacteria | 2274 |
| 831 | Ga0495606_0003007 | 3300046507 | Bacteria | 18477 |
| 832 | Ga0495606_0094118 | 3300046507 | Bacteria | 1837 |
| 833 | Ga0495606_0296470 | 3300046507 | Bacteria | 878 |
| 834 | Ga0495608_0017019 | 3300046511 | Bacteria | 5029 |
| 835 | Ga0495608_0410528 | 3300046511 | Bacteria | 827 |
| 836 | Ga0495610_0086587 | 3300046512 | Bacteria | 1427 |
| 837 | Ga0495610_0116191 | 3300046512 | Bacteria | 1179 |
| 838 | Ga0495616_0254761 | 3300046513 | Bacteria | 753 |
| 839 | Ga0495618_0007907 | 3300046514 | Bacteria | 6435 |
| 840 | Ga0495618_0039412 | 3300046514 | Bacteria | 2970 |
| 841 | Ga0495618_0245563 | 3300046514 | Bacteria | 1124 |
| 842 | Ga0495620_0035877 | 3300046515 | Bacteria | 2225 |
| 843 | Ga0495628_0004580 | 3300046516 | Bacteria | 12233 |
| 844 | Ga0495628_0058989 | 3300046516 | Bacteria | 3015 |
| 845 | Ga0495628_0078743 | 3300046516 | Bacteria | 2563 |
| 846 | Ga0495628_0393307 | 3300046516 | Bacteria | 1014 |
| 847 | Ga0495630_0001032 | 3300046517 | Bacteria | 19216 |
| 848 | Ga0495630_0037229 | 3300046517 | Bacteria | 3638 |
| 849 | Ga0495631_0105640 | 3300046518 | Bacteria | 1211 |
| 850 | Ga0495632_0049316 | 3300046519 | Bacteria | 2081 |
| 851 | Ga0495632_0214786 | 3300046519 | Bacteria | 871 |
| 852 | Ga0495643_0019680 | 3300046522 | Bacteria | 3901 |
| 853 | Ga0495648_0002612 | 3300046524 | Bacteria | 16461 |
| 854 | Ga0495648_0002918 | 3300046524 | Bacteria | 15363 |
| 855 | Ga0495648_0030845 | 3300046524 | Bacteria | 3538 |
| 856 | Ga0495648_0030855 | 3300046524 | Bacteria | 3537 |
| 857 | Ga0495648_0044101 | 3300046524 | Bacteria | 2787 |
| 858 | Ga0495648_0118640 | 3300046524 | Bacteria | 1426 |
| 859 | Ga0495648_0147774 | 3300046524 | Bacteria | 1229 |
| 860 | Ga0495648_0207891 | 3300046524 | Bacteria | 975 |
| 861 | Ga0495666_0007696 | 3300046526 | Bacteria | 5389 |
| 862 | Ga0495642_0245168 | 3300046528 | Bacteria | 783 |
| 863 | Ga0495652_0003857 | 3300046529 | Bacteria | 14624 |
| 864 | Ga0495652_0032487 | 3300046529 | Bacteria | 4564 |
| 865 | Ga0495652_0075661 | 3300046529 | Bacteria | 2795 |
| 866 | Ga0495652_0249787 | 3300046529 | Bacteria | 1315 |
| 867 | Ga0495654_0178950 | 3300046530 | Bacteria | 919 |
| 868 | Ga0495665_0000261 | 3300046531 | Bacteria | 26625 |
| 869 | Ga0495665_0011427 | 3300046531 | Bacteria | 4804 |
| 870 | Ga0495640_0040108 | 3300046533 | Bacteria | 3280 |
| 871 | Ga0495640_0060166 | 3300046533 | Bacteria | 2584 |
| 872 | Ga0495640_0116764 | 3300046533 | Bacteria | 1738 |
| 873 | Ga0495640_0270334 | 3300046533 | Bacteria | 1060 |
| 874 | Ga0495586_0239141 | 3300046535 | Bacteria | 1035 |
| 875 | Ga0495587_0012126 | 3300046536 | Bacteria | 5441 |
| 876 | Ga0495587_0079430 | 3300046536 | Bacteria | 1902 |
| 877 | Ga0495587_0181922 | 3300046536 | Bacteria | 1192 |
| 878 | Ga0495621_0022283 | 3300046539 | Bacteria | 2098 |
| 879 | Ga0495597_0138775 | 3300046542 | Bacteria | 1004 |
| 880 | Ga0495597_0159820 | 3300046542 | Bacteria | 920 |
| 881 | Ga0495645_0025567 | 3300046543 | Bacteria | 4286 |
| 882 | Ga0495645_0147373 | 3300046543 | Bacteria | 1638 |
| 883 | Ga0495645_0258674 | 3300046543 | Bacteria | 1154 |
| 884 | Ga0495645_0277518 | 3300046543 | Bacteria | 1103 |
| 885 | Ga0495645_0335358 | 3300046543 | Bacteria | 978 |
| 886 | Ga0495622_0016935 | 3300046557 | Bacteria | 3392 |
| 887 | Ga0495622_0101574 | 3300046557 | Bacteria | 1318 |
| 888 | Ga0495633_0127435 | 3300046558 | Bacteria | 1178 |
| 889 | Ga0495667_0004202 | 3300046559 | Bacteria | 9704 |
| 890 | Ga0495667_0036521 | 3300046559 | Bacteria | 3279 |
| 891 | Ga0495667_0124599 | 3300046559 | Bacteria | 1663 |
| 892 | Ga0495667_0136614 | 3300046559 | Bacteria | 1580 |
| 893 | Ga0495656_0096587 | 3300046615 | Bacteria | 1360 |
| 894 | Ga0495668_0050083 | 3300046616 | Bacteria | 2315 |
| 895 | Ga0495668_0053210 | 3300046616 | Bacteria | 2239 |
| 896 | Ga0495668_0231398 | 3300046616 | Bacteria | 1012 |
| 897 | Ga0495634_0000161 | 3300046642 | Bacteria | 60925 |
| 898 | Ga0495634_0022358 | 3300046642 | Bacteria | 4457 |
| 899 | Ga0495634_0195081 | 3300046642 | Bacteria | 1260 |
| 900 | Ga0495625_0048156 | 3300046660 | Bacteria | 3070 |
| 901 | Ga0495625_0331278 | 3300046660 | Bacteria | 967 |
| 902 | Ga0495635_0008716 | 3300046663 | Bacteria | 7083 |
| 903 | Ga0495635_0033710 | 3300046663 | Bacteria | 3552 |
| 904 | Ga0495635_0037786 | 3300046663 | Bacteria | 3342 |
| 905 | Ga0495635_0054592 | 3300046663 | Bacteria | 2752 |
| 906 | Ga0495635_0071655 | 3300046663 | Bacteria | 2375 |
| 907 | Ga0495659_0014177 | 3300046664 | Bacteria | 2606 |
| 908 | Ga0495659_0203320 | 3300046664 | Bacteria | 813 |
| 909 | Ga0495661_0181418 | 3300046665 | Bacteria | 1115 |
| 910 | Ga0495588_0020981 | 3300046674 | Bacteria | 3215 |
| 911 | Ga0495588_0025233 | 3300046674 | Bacteria | 2960 |
| 912 | Ga0495588_0321470 | 3300046674 | Bacteria | 814 |
| 913 | Ga0495588_0323936 | 3300046674 | Bacteria | 810 |
| 914 | Ga0495588_0427306 | 3300046674 | Bacteria | 695 |
| 915 | Ga0495657_0015740 | 3300046675 | Bacteria | 5526 |
| 916 | Ga0495657_0019424 | 3300046675 | Bacteria | 4901 |
| 917 | Ga0495657_0064717 | 3300046675 | Bacteria | 2407 |
| 918 | Ga0495599_0009174 | 3300046678 | Bacteria | 6035 |
| 919 | Ga0495599_0084427 | 3300046678 | Bacteria | 1983 |
| 920 | Ga0495599_0183929 | 3300046678 | Bacteria | 1287 |
| 921 | Ga0495599_0309661 | 3300046678 | Bacteria | 952 |
| 922 | Ga0495623_0023186 | 3300046679 | Bacteria | 4006 |
| 923 | Ga0495623_0035017 | 3300046679 | Bacteria | 3218 |
| 924 | Ga0495623_0082545 | 3300046679 | Bacteria | 1986 |
| 925 | Ga0495623_0115991 | 3300046679 | Bacteria | 1618 |
| 926 | Ga0495623_0145015 | 3300046679 | Bacteria | 1409 |
| 927 | Ga0495623_0159907 | 3300046679 | Bacteria | 1325 |
| 928 | Ga0495623_0248044 | 3300046679 | Bacteria | 1003 |
| 929 | Ga0495646_0040870 | 3300046680 | Bacteria | 2853 |
| 930 | Ga0495646_0086315 | 3300046680 | Bacteria | 1820 |
| 931 | Ga0495646_0097016 | 3300046680 | Bacteria | 1694 |
| 932 | Ga0495647_0028695 | 3300046681 | Bacteria | 2053 |
| 933 | Ga0495658_0000315 | 3300046683 | Bacteria | 27478 |
| 934 | Ga0495658_0109624 | 3300046683 | Bacteria | 1658 |
| 935 | Ga0495669_0281291 | 3300046684 | Bacteria | 800 |
| 936 | Ga0495613_0002949 | 3300046689 | Bacteria | 12727 |
| 937 | Ga0495613_0218703 | 3300046689 | Bacteria | 1338 |
| 938 | Ga0495613_0373042 | 3300046689 | Bacteria | 977 |
| 939 | Ga0495624_0029489 | 3300046690 | Bacteria | 3580 |
| 940 | Ga0495624_0058579 | 3300046690 | Bacteria | 2418 |
| 941 | Ga0495624_0379776 | 3300046690 | Bacteria | 849 |
| 942 | Ga0495670_0020190 | 3300046691 | Bacteria | 3283 |
| 943 | Ga0495671_0147083 | 3300046692 | Bacteria | 1147 |
| 944 | Ga0495649_0040180 | 3300046694 | Bacteria | 2563 |
| 945 | Ga0495649_0247943 | 3300046694 | Bacteria | 915 |
| 946 | Ga0495589_0314519 | 3300046794 | Bacteria | 724 |
| 947 | Ga0495600_0006120 | 3300046809 | Bacteria | 7288 |
| 948 | Ga0495600_0010630 | 3300046809 | Bacteria | 5718 |
| 949 | Ga0495600_0042515 | 3300046809 | Bacteria | 2962 |
| 950 | Ga0495600_0048711 | 3300046809 | Bacteria | 2764 |
| 951 | Ga0495660_0080346 | 3300046810 | Bacteria | 1711 |
| 952 | Ga0495581_0000255 | 3300047315 | Bacteria | 25578 |
| 953 | Ga0495581_0062966 | 3300047315 | Bacteria | 2143 |
| 954 | Ga0495581_0226685 | 3300047315 | Bacteria | 1093 |
| 955 | Ga0495604_0015795 | 3300047317 | Bacteria | 6025 |
| 956 | Ga0495604_0066179 | 3300047317 | Bacteria | 2749 |
| 957 | Ga0495604_0096882 | 3300047317 | Bacteria | 2176 |
| 958 | Ga0495604_0200105 | 3300047317 | Bacteria | 1386 |
| 959 | Ga0495674_0000117 | 3300047319 | Bacteria | 60130 |
| 960 | Ga0495674_0027042 | 3300047319 | Bacteria | 5247 |
| 961 | Ga0495674_0039883 | 3300047319 | Bacteria | 4204 |
| 962 | Ga0495674_0067676 | 3300047319 | Bacteria | 3093 |
| 963 | Ga0495674_0123813 | 3300047319 | Bacteria | 2183 |
| 964 | Ga0495674_0298004 | 3300047319 | Bacteria | 1317 |
| 965 | Ga0495672_0008790 | 3300047320 | Bacteria | 7398 |
| 966 | Ga0495672_0011329 | 3300047320 | Bacteria | 6299 |
| 967 | Ga0495672_0058411 | 3300047320 | Bacteria | 2236 |
| 968 | Ga0495672_0128851 | 3300047320 | Bacteria | 1334 |
| 969 | Ga0495672_0131965 | 3300047320 | Bacteria | 1313 |
| 970 | Ga0495676_0051519 | 3300047321 | Bacteria | 3292 |
| 971 | Ga0495676_0119809 | 3300047321 | Bacteria | 1916 |
| 972 | Ga0495676_0312874 | 3300047321 | Bacteria | 1056 |
| 973 | Ga0495676_0730243 | 3300047321 | Bacteria | 640 |
| 974 | Ga0495680_0000688 | 3300047322 | Bacteria | 37864 |
| 975 | Ga0495680_0004171 | 3300047322 | Bacteria | 13893 |
| 976 | Ga0495680_0072956 | 3300047322 | Bacteria | 2610 |
| 977 | Ga0495680_0176306 | 3300047322 | Bacteria | 1545 |
| 978 | Ga0495687_015006 | 3300047443 | Bacteria | 3956 |
| 979 | Ga0495675_0006128 | 3300047444 | Bacteria | 7361 |
| 980 | Ga0495675_0061318 | 3300047444 | Bacteria | 2382 |
| 981 | Ga0495675_0361093 | 3300047444 | Bacteria | 852 |
| 982 | Ga0495677_0044745 | 3300047445 | Bacteria | 1623 |
| 983 | Ga0495684_0000633 | 3300047471 | Bacteria | 28283 |
| 984 | Ga0495684_0020139 | 3300047471 | Bacteria | 5137 |
| 985 | Ga0495684_0060136 | 3300047471 | Bacteria | 2893 |
| 986 | Ga0495684_0145984 | 3300047471 | Bacteria | 1772 |
| 987 | Ga0495684_0212357 | 3300047471 | Bacteria | 1422 |
| 988 | Ga0495593_0000086 | 3300047673 | Bacteria | 40986 |
| 989 | Ga0495593_0002322 | 3300047673 | Bacteria | 11426 |
| 990 | Ga0495593_0028926 | 3300047673 | Bacteria | 3042 |
| 991 | Ga0495593_0149102 | 3300047673 | Bacteria | 1183 |
| 992 | Ga0495602_0004737 | 3300048088 | Bacteria | 14223 |
| 993 | Ga0495602_0029828 | 3300048088 | Bacteria | 5185 |
| 994 | Ga0495602_0204155 | 3300048088 | Bacteria | 1505 |
| 995 | Ga0495602_0234176 | 3300048088 | Bacteria | 1377 |
| 996 | Ga0495602_0357159 | 3300048088 | Bacteria | 1053 |
| 997 | Ga0495602_0369283 | 3300048088 | Bacteria | 1031 |
| 998 | Ga0495626_0120996 | 3300048091 | Bacteria | 1125 |
| 999 | Ga0496100_0098944 | 3300048903 | Bacteria | 2006 |
| 1000 | Ga0496100_0112296 | 3300048903 | Bacteria | 1895 |
| 1001 | Ga0496100_0570969 | 3300048903 | Bacteria | 876 |
| 1002 | Ga0496100_0665719 | 3300048903 | Bacteria | 811 |
| 1003 | Ga0496101_0023934 | 3300048904 | Bacteria | 4222 |
| 1004 | Ga0496101_0444885 | 3300048904 | Bacteria | 1022 |
| 1005 | Ga0496101_0780065 | 3300048904 | Bacteria | 754 |
| 1006 | Ga0496102_0013632 | 3300048905 | Bacteria | 7045 |
| 1007 | Ga0496102_0051025 | 3300048905 | Bacteria | 3768 |
| 1008 | Ga0496102_0097921 | 3300048905 | Bacteria | 2721 |
| 1009 | Ga0496102_0106172 | 3300048905 | Bacteria | 2613 |
| 1010 | Ga0496102_0132304 | 3300048905 | Bacteria | 2336 |
| 1011 | Ga0496102_0506723 | 3300048905 | Bacteria | 1129 |
| 1012 | Ga0496102_0706217 | 3300048905 | Bacteria | 931 |
| 1013 | Ga0496102_0807003 | 3300048905 | Bacteria | 861 |
| 1014 | Ga0496103_0194972 | 3300048906 | Bacteria | 1302 |
| 1015 | Ga0496104_0011141 | 3300048907 | Bacteria | 8046 |
| 1016 | Ga0496104_0049613 | 3300048907 | Bacteria | 3958 |
| 1017 | Ga0496104_0064542 | 3300048907 | Bacteria | 3473 |
| 1018 | Ga0496104_0097842 | 3300048907 | Bacteria | 2808 |
| 1019 | Ga0496104_0126823 | 3300048907 | Bacteria | 2451 |
| 1020 | Ga0496104_0131997 | 3300048907 | Bacteria | 2399 |
| 1021 | Ga0496105_0003203 | 3300048908 | Bacteria | 12051 |
| 1022 | Ga0496105_0008366 | 3300048908 | Bacteria | 8038 |
| 1023 | Ga0496105_0016607 | 3300048908 | Bacteria | 5878 |
| 1024 | Ga0496105_0088755 | 3300048908 | Bacteria | 2554 |
| 1025 | Ga0496105_0305289 | 3300048908 | Bacteria | 1278 |
| 1026 | Ga0496105_0377082 | 3300048908 | Bacteria | 1129 |
| 1027 | Ga0496106_0000546 | 3300048909 | Bacteria | 26747 |
| 1028 | Ga0496106_0005548 | 3300048909 | Bacteria | 9340 |
| 1029 | Ga0496106_0010390 | 3300048909 | Bacteria | 6878 |
| 1030 | Ga0496106_0040671 | 3300048909 | Bacteria | 3482 |
| 1031 | Ga0496106_0165675 | 3300048909 | Bacteria | 1749 |
| 1032 | Ga0496106_0566529 | 3300048909 | Bacteria | 911 |
| 1033 | Ga0496107_0002937 | 3300048910 | Bacteria | 11278 |
| 1034 | Ga0496107_0004305 | 3300048910 | Bacteria | 9634 |
| 1035 | Ga0496107_0017612 | 3300048910 | Bacteria | 5026 |
| 1036 | Ga0496107_0057818 | 3300048910 | Bacteria | 2803 |
| 1037 | Ga0496107_0094496 | 3300048910 | Bacteria | 2187 |
| 1038 | Ga0496107_0130263 | 3300048910 | Bacteria | 1857 |
| 1039 | Ga0496107_0258456 | 3300048910 | Bacteria | 1296 |
| 1040 | Ga0496108_0001440 | 3300048911 | Bacteria | 18797 |
| 1041 | Ga0496108_0501445 | 3300048911 | Bacteria | 1060 |
| 1042 | Ga0496109_0001610 | 3300048912 | Bacteria | 18841 |
| 1043 | Ga0496109_0015876 | 3300048912 | Bacteria | 6575 |
| 1044 | Ga0496109_0081792 | 3300048912 | Bacteria | 2976 |
| 1045 | Ga0496109_0103673 | 3300048912 | Bacteria | 2640 |
| 1046 | Ga0496109_0131305 | 3300048912 | Bacteria | 2338 |
| 1047 | Ga0496109_0292592 | 3300048912 | Bacteria | 1535 |
| 1048 | Ga0496110_0012816 | 3300048913 | Bacteria | 6906 |
| 1049 | Ga0496110_0017787 | 3300048913 | Bacteria | 5949 |
| 1050 | Ga0496110_0050143 | 3300048913 | Bacteria | 3664 |
| 1051 | Ga0496110_0088331 | 3300048913 | Bacteria | 2768 |
| 1052 | Ga0496110_0119358 | 3300048913 | Bacteria | 2375 |
| 1053 | Ga0496110_0856248 | 3300048913 | Bacteria | 814 |
| 1054 | Ga0496110_1123985 | 3300048913 | Bacteria | 694 |
| 1055 | Ga0496111_0021964 | 3300048914 | Bacteria | 4462 |
| 1056 | Ga0496111_0040806 | 3300048914 | Bacteria | 3329 |
| 1057 | Ga0496111_0141440 | 3300048914 | Bacteria | 1783 |
| 1058 | Ga0496111_0369969 | 3300048914 | Bacteria | 1060 |
| 1059 | Ga0496111_0420705 | 3300048914 | Bacteria | 987 |
| 1060 | Ga0496112_0000079 | 3300048915 | Bacteria | 64101 |
| 1061 | Ga0496112_0007905 | 3300048915 | Bacteria | 9474 |
| 1062 | Ga0496112_0009200 | 3300048915 | Bacteria | 8878 |
| 1063 | Ga0496112_0028997 | 3300048915 | Bacteria | 5348 |
| 1064 | Ga0496112_0032003 | 3300048915 | Bacteria | 5106 |
| 1065 | Ga0496112_0033853 | 3300048915 | Bacteria | 4970 |
| 1066 | Ga0496112_0046075 | 3300048915 | Bacteria | 4275 |
| 1067 | Ga0496112_0069563 | 3300048915 | Bacteria | 3477 |
| 1068 | Ga0496112_0085641 | 3300048915 | Bacteria | 3118 |
| 1069 | Ga0496113_0018743 | 3300048916 | Bacteria | 4826 |
| 1070 | Ga0496113_0034316 | 3300048916 | Bacteria | 3702 |
| 1071 | Ga0496113_0070124 | 3300048916 | Bacteria | 2663 |
| 1072 | Ga0496113_0364465 | 3300048916 | Bacteria | 1159 |
| 1073 | Ga0496114_0019840 | 3300048917 | Bacteria | 5451 |
| 1074 | Ga0496114_0026302 | 3300048917 | Bacteria | 4763 |
| 1075 | Ga0496114_0239484 | 3300048917 | Bacteria | 1595 |
| 1076 | Ga0496114_0255707 | 3300048917 | Bacteria | 1541 |
| 1077 | Ga0496114_0383421 | 3300048917 | Bacteria | 1244 |
| 1078 | Ga0496114_0522738 | 3300048917 | Bacteria | 1049 |
| 1079 | Ga0496114_0787329 | 3300048917 | Bacteria | 829 |
| 1080 | Ga0496115_0030579 | 3300048918 | Bacteria | 4237 |
| 1081 | Ga0496115_0034088 | 3300048918 | Bacteria | 4023 |
| 1082 | Ga0496115_0039040 | 3300048918 | Bacteria | 3770 |
| 1083 | Ga0496115_0050911 | 3300048918 | Bacteria | 3320 |
| 1084 | Ga0496115_0056445 | 3300048918 | Bacteria | 3156 |
| 1085 | Ga0496115_0121603 | 3300048918 | Bacteria | 2149 |
| 1086 | Ga0496115_0216268 | 3300048918 | Bacteria | 1582 |
| 1087 | Ga0496115_0300131 | 3300048918 | Bacteria | 1316 |
| 1088 | Ga0496115_0436859 | 3300048918 | Bacteria | 1059 |
| 1089 | Ga0496115_0544837 | 3300048918 | Bacteria | 928 |
| 1090 | Ga0496116_0119249 | 3300048919 | Bacteria | 1531 |
| 1091 | Ga0496116_0132314 | 3300048919 | Bacteria | 1419 |
| 1092 | Ga0496117_0041834 | 3300048920 | Bacteria | 3351 |
| 1093 | Ga0496117_0086770 | 3300048920 | Bacteria | 2032 |
| 1094 | Ga0496117_0103769 | 3300048920 | Bacteria | 1791 |
| 1095 | Ga0496117_0198089 | 3300048920 | Bacteria | 1137 |
| 1096 | Ga0496117_0229638 | 3300048920 | Bacteria | 1027 |
| 1097 | Ga0496118_0003967 | 3300048921 | Bacteria | 18059 |
| 1098 | Ga0496118_0046546 | 3300048921 | Bacteria | 3373 |
| 1099 | Ga0496118_0070050 | 3300048921 | Bacteria | 2535 |
| 1100 | Ga0496118_0072285 | 3300048921 | Bacteria | 2478 |
| 1101 | Ga0496119_0020659 | 3300048922 | Bacteria | 4792 |
| 1102 | Ga0496119_0051144 | 3300048922 | Bacteria | 2542 |
| 1103 | Ga0496119_0096053 | 3300048922 | Bacteria | 1673 |
| 1104 | Ga0496119_0130553 | 3300048922 | Bacteria | 1370 |
| 1105 | Ga0496120_0008075 | 3300048923 | Bacteria | 7735 |
| 1106 | Ga0496120_0017144 | 3300048923 | Bacteria | 4705 |
| 1107 | Ga0496121_0000495 | 3300048924 | Bacteria | 75339 |
| 1108 | Ga0496121_0000576 | 3300048924 | Bacteria | 69005 |
| 1109 | Ga0496121_0001789 | 3300048924 | Bacteria | 34756 |
| 1110 | Ga0496121_0003477 | 3300048924 | Bacteria | 22425 |
| 1111 | Ga0496121_0005072 | 3300048924 | Bacteria | 17180 |
| 1112 | Ga0496121_0023876 | 3300048924 | Bacteria | 5867 |
| 1113 | Ga0496121_0024511 | 3300048924 | Bacteria | 5765 |
| 1114 | Ga0496121_0084412 | 3300048924 | Bacteria | 2504 |
| 1115 | Ga0496121_0085565 | 3300048924 | Bacteria | 2481 |
| 1116 | Ga0496121_0177005 | 3300048924 | Bacteria | 1544 |
| 1117 | Ga0496121_0185412 | 3300048924 | Bacteria | 1497 |
| 1118 | Ga0496121_0320823 | 3300048924 | Bacteria | 1043 |
| 1119 | Ga0496121_0383172 | 3300048924 | Bacteria | 926 |
| 1120 | Ga0496122_0126372 | 3300048925 | Bacteria | 1636 |
| 1121 | Ga0496123_0023903 | 3300048926 | Bacteria | 4664 |
| 1122 | Ga0496123_0045334 | 3300048926 | Bacteria | 2997 |
| 1123 | Ga0496124_0055299 | 3300048927 | Bacteria | 3354 |
| 1124 | Ga0496124_0112519 | 3300048927 | Bacteria | 2189 |
| 1125 | Ga0496124_0125827 | 3300048927 | Bacteria | 2042 |
| 1126 | Ga0496124_0351760 | 3300048927 | Bacteria | 1042 |
| 1127 | Ga0496125_0003570 | 3300048928 | Bacteria | 18732 |
| 1128 | Ga0496125_0034194 | 3300048928 | Bacteria | 4484 |
| 1129 | Ga0496125_0037412 | 3300048928 | Bacteria | 4220 |
| 1130 | Ga0496125_0042128 | 3300048928 | Bacteria | 3894 |
| 1131 | Ga0496125_0045546 | 3300048928 | Bacteria | 3690 |
| 1132 | Ga0496125_0060992 | 3300048928 | Bacteria | 3027 |
| 1133 | Ga0496125_0076578 | 3300048928 | Bacteria | 2582 |
| 1134 | Ga0496125_0167892 | 3300048928 | Bacteria | 1480 |
| 1135 | Ga0496125_0318590 | 3300048928 | Bacteria | 944 |
| 1136 | Ga0496126_0002315 | 3300048929 | Bacteria | 26122 |
| 1137 | Ga0496126_0006641 | 3300048929 | Bacteria | 12873 |
| 1138 | Ga0496126_0007687 | 3300048929 | Bacteria | 11766 |
| 1139 | Ga0496126_0008516 | 3300048929 | Bacteria | 11055 |
| 1140 | Ga0496126_0030050 | 3300048929 | Bacteria | 5155 |
| 1141 | Ga0496126_0041989 | 3300048929 | Bacteria | 4228 |
| 1142 | Ga0496126_0061749 | 3300048929 | Bacteria | 3365 |
| 1143 | Ga0496126_0078368 | 3300048929 | Bacteria | 2928 |
| 1144 | Ga0496126_0094451 | 3300048929 | Bacteria | 2624 |
| 1145 | Ga0496126_0104047 | 3300048929 | Bacteria | 2480 |
| 1146 | Ga0496126_0112266 | 3300048929 | Bacteria | 2373 |
| 1147 | Ga0496126_0138804 | 3300048929 | Bacteria | 2094 |
| 1148 | Ga0496126_0141356 | 3300048929 | Bacteria | 2071 |
| 1149 | Ga0496126_0142335 | 3300048929 | Bacteria | 2063 |
| 1150 | Ga0496126_0151861 | 3300048929 | Bacteria | 1984 |
| 1151 | Ga0496126_0175123 | 3300048929 | Bacteria | 1825 |
| 1152 | Ga0496126_0177784 | 3300048929 | Bacteria | 1809 |
| 1153 | Ga0496126_0229460 | 3300048929 | Bacteria | 1556 |
| 1154 | Ga0496126_0292981 | 3300048929 | Bacteria | 1345 |
| 1155 | Ga0496126_0303240 | 3300048929 | Bacteria | 1317 |
| 1156 | Ga0496126_0380180 | 3300048929 | Bacteria | 1150 |
| 1157 | Ga0496126_0452266 | 3300048929 | Bacteria | 1033 |
| 1158 | Ga0496126_0456066 | 3300048929 | Bacteria | 1028 |
| 1159 | Ga0496126_0526203 | 3300048929 | Bacteria | 941 |
| 1160 | Ga0496126_0603044 | 3300048929 | Bacteria | 865 |
| 1161 | Ga0495678_096604 | 3300049459 | Bacteria | 1031 |
| 1162 | Ga0501031_0004261 | 3300049568 | Bacteria | 9240 |
| 1163 | Ga0501031_0150707 | 3300049568 | Bacteria | 1519 |
| 1164 | Ga0501032_0005554 | 3300049569 | Bacteria | 9354 |
| 1165 | Ga0501032_0138626 | 3300049569 | Bacteria | 1602 |
| 1166 | Ga0501032_0244123 | 3300049569 | Bacteria | 1166 |
| 1167 | Ga0501032_0313647 | 3300049569 | Bacteria | 1013 |
| 1168 | Ga0501033_0000256 | 3300049570 | Bacteria | 50977 |
| 1169 | Ga0501033_0136088 | 3300049570 | Bacteria | 1777 |
| 1170 | Ga0501034_0000175 | 3300049571 | Bacteria | 119465 |
| 1171 | Ga0501034_0354427 | 3300049571 | Bacteria | 1395 |
| 1172 | Ga0501034_0368998 | 3300049571 | Bacteria | 1362 |
| 1173 | Ga0501034_0713679 | 3300049571 | Bacteria | 900 |
| 1174 | Ga0501036_0000032 | 3300049572 | Bacteria | 91370 |
| 1175 | Ga0501036_0656210 | 3300049572 | Bacteria | 868 |
| 1176 | Ga0501037_0001755 | 3300049573 | Bacteria | 15758 |
| 1177 | Ga0501037_0092867 | 3300049573 | Bacteria | 2182 |
| 1178 | Ga0501037_0147015 | 3300049573 | Bacteria | 1685 |
| 1179 | Ga0501038_0000114 | 3300049574 | Bacteria | 68140 |
| 1180 | Ga0501038_0025774 | 3300049574 | Bacteria | 5238 |
| 1181 | Ga0501038_0110509 | 3300049574 | Bacteria | 2277 |
| 1182 | Ga0501039_0001954 | 3300049575 | Bacteria | 15288 |
| 1183 | Ga0501039_0487062 | 3300049575 | Bacteria | 968 |
| 1184 | Ga0501040_0025761 | 3300049576 | Bacteria | 3956 |
| 1185 | Ga0501041_0541366 | 3300049577 | Bacteria | 742 |
| 1186 | Ga0501042_0251438 | 3300049578 | Bacteria | 1275 |
| 1187 | Ga0501043_0002389 | 3300049579 | Bacteria | 15913 |
| 1188 | Ga0501046_0004110 | 3300049580 | Bacteria | 13261 |
| 1189 | Ga0501046_0188243 | 3300049580 | Bacteria | 1540 |
| 1190 | Ga0501047_0000085 | 3300049581 | Bacteria | 118617 |
| 1191 | Ga0501047_0116791 | 3300049581 | Bacteria | 2550 |
| 1192 | Ga0501047_0178053 | 3300049581 | Bacteria | 1993 |
| 1193 | Ga0501047_0179361 | 3300049581 | Bacteria | 1984 |
| 1194 | Ga0501047_0196472 | 3300049581 | Bacteria | 1879 |
| 1195 | Ga0501048_0001859 | 3300049582 | Bacteria | 16028 |
| 1196 | Ga0501048_0039196 | 3300049582 | Bacteria | 3399 |
| 1197 | Ga0501048_0185910 | 3300049582 | Bacteria | 1473 |
| 1198 | Ga0501067_0000096 | 3300049583 | Bacteria | 50761 |
| 1199 | Ga0501067_0007715 | 3300049583 | Bacteria | 5984 |
| 1200 | Ga0501068_0000220 | 3300049584 | Bacteria | 27785 |
| 1201 | Ga0501068_0002790 | 3300049584 | Bacteria | 9289 |
| 1202 | Ga0501069_0003655 | 3300049585 | Bacteria | 7913 |
| 1203 | Ga0501069_0040056 | 3300049585 | Bacteria | 2589 |
| 1204 | Ga0501069_0161040 | 3300049585 | Bacteria | 1292 |
| 1205 | Ga0501070_0005720 | 3300049586 | Bacteria | 10600 |
| 1206 | Ga0501070_0262510 | 3300049586 | Bacteria | 1411 |
| 1207 | Ga0501070_0264154 | 3300049586 | Bacteria | 1406 |
| 1208 | Ga0501070_0474754 | 3300049586 | Bacteria | 1006 |
| 1209 | Ga0501071_0076396 | 3300049587 | Bacteria | 2446 |
| 1210 | Ga0501071_0092212 | 3300049587 | Bacteria | 2226 |
| 1211 | Ga0501072_0003496 | 3300049588 | Bacteria | 11831 |
| 1212 | Ga0501073_0000026 | 3300049589 | Bacteria | 124358 |
| 1213 | Ga0501073_0193431 | 3300049589 | Bacteria | 1407 |
| 1214 | Ga0501074_0000878 | 3300049590 | Bacteria | 19194 |
| 1215 | Ga0501074_0065877 | 3300049590 | Bacteria | 2606 |
| 1216 | Ga0501076_0188248 | 3300049592 | Bacteria | 1684 |
| 1217 | Ga0501077_0225687 | 3300049593 | Bacteria | 1191 |
| 1218 | Ga0501079_0007708 | 3300049741 | Bacteria | 8148 |
| 1219 | Ga0501080_0005240 | 3300049742 | Bacteria | 11553 |
| 1220 | Ga0501080_0333878 | 3300049742 | Bacteria | 1370 |
| 1221 | Ga0501081_0167660 | 3300049743 | Bacteria | 1585 |
| 1222 | Ga0501083_0012775 | 3300049744 | Bacteria | 5873 |
| 1223 | Ga0501083_0378157 | 3300049744 | Bacteria | 921 |
| 1224 | Ga0501035_0003195 | 3300049822 | Bacteria | 15713 |
| 1225 | Ga0501035_0027489 | 3300049822 | Bacteria | 5199 |
| 1226 | Ga0501044_0000061 | 3300049823 | Bacteria | 133207 |
| 1227 | Ga0501044_0111623 | 3300049823 | Bacteria | 2741 |
| 1228 | Ga0501044_0143992 | 3300049823 | Bacteria | 2370 |
| 1229 | Ga0501044_0357216 | 3300049823 | Bacteria | 1379 |
| 1230 | Ga0501044_0381715 | 3300049823 | Bacteria | 1324 |
| 1231 | Ga0501044_0435807 | 3300049823 | Bacteria | 1219 |
| 1232 | Ga0501044_0601617 | 3300049823 | Bacteria | 992 |
| 1233 | Ga0501045_0090535 | 3300049824 | Bacteria | 2261 |
| 1234 | Ga0501045_0387975 | 3300049824 | Bacteria | 1039 |
| 1235 | nmdc:mga03n38_23321_c1 | 3300050490 | Bacteria | 2516 |
| 1236 | nmdc:mga03n38_3983_c1 | 3300050490 | Bacteria | 4822 |
| 1237 | nmdc:mga00v17_107230_c1 | 3300050491 | Bacteria | 1769 |
| 1238 | nmdc:mga0yw44_109677_c1 | 3300050492 | Bacteria | 1767 |
| 1239 | nmdc:mga0yw44_156432_c1 | 3300050492 | Bacteria | 1490 |
| 1240 | nmdc:mga0yw44_163960_c1 | 3300050492 | Bacteria | 1456 |
| 1241 | nmdc:mga0yw44_35589_c1 | 3300050492 | Bacteria | 2927 |
| 1242 | nmdc:mga0yw44_384637_c1 | 3300050492 | Bacteria | 948 |
| 1243 | nmdc:mga0yw44_385394_c1 | 3300050492 | Bacteria | 947 |
| 1244 | nmdc:mga0yw44_55380_c1 | 3300050492 | Bacteria | 2413 |
| 1245 | nmdc:mga0yw44_58163_c1 | 3300050492 | Bacteria | 2361 |
| 1246 | nmdc:mga0k408_102575_c1 | 3300050493 | Bacteria | 1687 |
| 1247 | nmdc:mga0k408_103595_c1 | 3300050493 | Bacteria | 1679 |
| 1248 | nmdc:mga0k408_290809_c1 | 3300050493 | Bacteria | 975 |
| 1249 | nmdc:mga06z11_109098_c1 | 3300050494 | Bacteria | 1530 |
| 1250 | nmdc:mga06z11_22801_c2 | 3300050494 | Bacteria | 2530 |
| 1251 | nmdc:mga06z11_30063_c1 | 3300050494 | Bacteria | 2625 |
| 1252 | nmdc:mga06z11_526816_c1 | 3300050494 | Bacteria | 717 |
| 1253 | nmdc:mga04h51_23345_c1 | 3300050495 | Bacteria | 1578 |
| 1254 | nmdc:mga04h51_27163_c1 | 3300050495 | Bacteria | 1776 |
| 1255 | nmdc:mga04h51_70640_c1 | 3300050495 | Bacteria | 1218 |
| 1256 | nmdc:mga04h51_89026_c1 | 3300050495 | Bacteria | 1108 |
| 1257 | nmdc:mga07m45_145517_c1 | 3300050496 | Bacteria | 1374 |
| 1258 | nmdc:mga07m45_186513_c1 | 3300050496 | Bacteria | 1206 |
| 1259 | nmdc:mga07m45_224211_c1 | 3300050496 | Bacteria | 1094 |
| 1260 | nmdc:mga07m45_243653_c1 | 3300050496 | Bacteria | 1046 |
| 1261 | nmdc:mga07m45_41716_c1 | 3300050496 | Bacteria | 2570 |
| 1262 | nmdc:mga07m45_73605_c1 | 3300050496 | Bacteria | 1945 |
| 1263 | nmdc:mga07m45_7361_c2 | 3300050496 | Bacteria | 2360 |
| 1264 | nmdc:mga05p37_704993_c1 | 3300050507 | Bacteria | 1120 |
| 1265 | nmdc:mga08y16_904525_c1 | 3300050511 | Bacteria | 868 |
| 1266 | nmdc:mga0n895_337869_c1 | 3300050512 | Bacteria | 1526 |
| 1267 | nmdc:mga0n895_581500_c1 | 3300050512 | Bacteria | 1124 |
| 1268 | nmdc:mga0n895_804835_c1 | 3300050512 | Bacteria | 930 |
| 1269 | nmdc:mga0rr50_83404_c1 | 3300050513 | Bacteria | 2471 |
| 1270 | nmdc:mga08x19_40402_c2 | 3300050514 | Bacteria | 2555 |
| 1271 | nmdc:mga0sz30_6811_c1 | 3300050516 | Bacteria | 3981 |
| 1272 | nmdc:mga0sz30_71801_c2 | 3300050516 | Bacteria | 955 |
| 1273 | Ga0495601_0069967 | 3300053077 | Bacteria | 2239 |
| 1274 | Ga0495601_0200514 | 3300053077 | Bacteria | 1304 |
| 1275 | Ga0495601_0371688 | 3300053077 | Bacteria | 928 |
| 1276 | Ga0495601_0463683 | 3300053077 | Bacteria | 819 |
| 1277 | Ga0495612_0002860 | 3300053078 | Bacteria | 7142 |
| 1278 | Ga0495612_0065484 | 3300053078 | Bacteria | 1509 |
| 1279 | Ga0500610_0043837 | 3300053079 | Bacteria | 2319 |
| 1280 | Ga0500635_0002252 | 3300053080 | Bacteria | 4746 |
| 1281 | Ga0495655_0004246 | 3300053083 | Bacteria | 2436 |
| 1282 | Ga0495595_0004246 | 3300053084 | Bacteria | 5762 |
| 1283 | Ga0495595_0028104 | 3300053084 | Bacteria | 2510 |
| 1284 | Ga0495595_0314909 | 3300053084 | Bacteria | 788 |
| 1285 | Ga0495619_0000182 | 3300053085 | Bacteria | 46524 |
| 1286 | Ga0495619_0012568 | 3300053085 | Bacteria | 5331 |
| 1287 | Ga0495619_0046963 | 3300053085 | Bacteria | 2841 |
| 1288 | Ga0500578_0036475 | 3300053086 | Bacteria | 3158 |
| 1289 | Ga0500578_0069467 | 3300053086 | Bacteria | 2245 |
| 1290 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 1291 | Ga0500643_047421 | 3300053087 | Bacteria | 1238 |
| 1292 | Ga0500647_0108689 | 3300053091 | Bacteria | 1320 |
| 1293 | Ga0500647_0186634 | 3300053091 | Bacteria | 948 |
| 1294 | Ga0500583_0041181 | 3300053092 | Bacteria | 2096 |
| 1295 | Ga0500583_0098211 | 3300053092 | Bacteria | 1432 |
| 1296 | Ga0500651_0047257 | 3300053093 | Bacteria | 2706 |
| 1297 | Ga0500651_0076618 | 3300053093 | Bacteria | 2076 |
| 1298 | Ga0500651_0128774 | 3300053093 | Bacteria | 1532 |
| 1299 | Ga0500651_0256279 | 3300053093 | Bacteria | 1015 |
| 1300 | Ga0500566_0000038 | 3300053094 | Bacteria | 66925 |
| 1301 | Ga0500566_0000184 | 3300053094 | Bacteria | 32281 |
| 1302 | Ga0500566_0020577 | 3300053094 | Bacteria | 3878 |
| 1303 | Ga0500566_0215292 | 3300053094 | Bacteria | 959 |
| 1304 | Ga0500640_000523 | 3300053095 | Bacteria | 9660 |
| 1305 | Ga0500641_0017528 | 3300053096 | Bacteria | 2680 |
| 1306 | Ga0500641_0076312 | 3300053096 | Bacteria | 1417 |
| 1307 | Ga0500641_0264403 | 3300053096 | Bacteria | 717 |
| 1308 | Ga0500648_209530 | 3300053097 | Bacteria | 969 |
| 1309 | Ga0500650_0154791 | 3300053098 | Bacteria | 1058 |
| 1310 | Ga0500554_060816 | 3300053102 | Bacteria | 1211 |
| 1311 | Ga0500554_061704 | 3300053102 | Bacteria | 1204 |
| 1312 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1313 | Ga0500556_0017722 | 3300053104 | Bacteria | 2236 |
| 1314 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 1315 | Ga0500562_027472 | 3300053108 | Bacteria | 1493 |
| 1316 | Ga0500569_000655 | 3300053109 | Bacteria | 5943 |
| 1317 | Ga0500569_022048 | 3300053109 | Bacteria | 1691 |
| 1318 | Ga0500569_089516 | 3300053109 | Bacteria | 995 |
| 1319 | Ga0500572_000010 | 3300053111 | Bacteria | 67071 |
| 1320 | Ga0500572_000333 | 3300053111 | Bacteria | 16915 |
| 1321 | Ga0500572_004350 | 3300053111 | Bacteria | 3217 |
| 1322 | Ga0500582_155590 | 3300053114 | Bacteria | 789 |
| 1323 | Ga0500591_075170 | 3300053115 | Bacteria | 1519 |
| 1324 | Ga0500592_002487 | 3300053116 | Bacteria | 2968 |
| 1325 | Ga0500592_015695 | 3300053116 | Bacteria | 1216 |
| 1326 | Ga0500595_000143 | 3300053119 | Bacteria | 46542 |
| 1327 | Ga0500595_004985 | 3300053119 | Bacteria | 5860 |
| 1328 | Ga0500595_005633 | 3300053119 | Bacteria | 5445 |
| 1329 | Ga0500595_007784 | 3300053119 | Bacteria | 4420 |
| 1330 | Ga0500595_008041 | 3300053119 | Bacteria | 4327 |
| 1331 | Ga0500595_012396 | 3300053119 | Bacteria | 3300 |
| 1332 | Ga0500595_052155 | 3300053119 | Bacteria | 1264 |
| 1333 | Ga0500607_045996 | 3300053121 | Bacteria | 2340 |
| 1334 | Ga0500607_097384 | 3300053121 | Bacteria | 1467 |
| 1335 | Ga0500608_000393 | 3300053122 | Bacteria | 16801 |
| 1336 | Ga0500614_012695 | 3300053123 | Bacteria | 1843 |
| 1337 | Ga0500642_0000058 | 3300053130 | Bacteria | 66200 |
| 1338 | Ga0500642_0000703 | 3300053130 | Bacteria | 9894 |
| 1339 | Ga0500652_000711 | 3300053131 | Bacteria | 11297 |
| 1340 | Ga0500652_140659 | 3300053131 | Bacteria | 1005 |
| 1341 | Ga0500655_022180 | 3300053133 | Bacteria | 1193 |
| 1342 | Ga0500658_0080186 | 3300053134 | Bacteria | 1394 |
| 1343 | Ga0500559_0000366 | 3300053136 | Bacteria | 33251 |
| 1344 | Ga0500559_0001403 | 3300053136 | Bacteria | 13686 |
| 1345 | Ga0500559_0004662 | 3300053136 | Bacteria | 6458 |
| 1346 | Ga0500559_0007008 | 3300053136 | Bacteria | 5037 |
| 1347 | Ga0500559_0029053 | 3300053136 | Bacteria | 2365 |
| 1348 | Ga0500559_0157801 | 3300053136 | Bacteria | 1066 |
| 1349 | Ga0500568_0000603 | 3300053139 | Bacteria | 26129 |
| 1350 | Ga0500568_0007229 | 3300053139 | Bacteria | 5472 |
| 1351 | Ga0500568_0024624 | 3300053139 | Bacteria | 2547 |
| 1352 | Ga0500568_0030896 | 3300053139 | Bacteria | 2215 |
| 1353 | Ga0500568_0071299 | 3300053139 | Bacteria | 1330 |
| 1354 | Ga0500568_0109911 | 3300053139 | Bacteria | 1031 |
| 1355 | Ga0500573_0003825 | 3300053140 | Bacteria | 7851 |
| 1356 | Ga0500577_0000616 | 3300053142 | Bacteria | 9140 |
| 1357 | Ga0500586_036153 | 3300053145 | Bacteria | 1655 |
| 1358 | Ga0500588_0151055 | 3300053146 | Bacteria | 840 |
| 1359 | Ga0500588_0158355 | 3300053146 | Bacteria | 823 |
| 1360 | Ga0500589_194989 | 3300053147 | Bacteria | 783 |
| 1361 | Ga0500590_114939 | 3300053148 | Bacteria | 1270 |
| 1362 | Ga0500603_000664 | 3300053150 | Bacteria | 8371 |
| 1363 | Ga0500603_009507 | 3300053150 | Bacteria | 2178 |
| 1364 | Ga0500603_054625 | 3300053150 | Bacteria | 1102 |
| 1365 | Ga0500604_0013483 | 3300053151 | Bacteria | 2215 |
| 1366 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 1367 | Ga0500616_0002365 | 3300053153 | Bacteria | 15857 |
| 1368 | Ga0500616_0010971 | 3300053153 | Bacteria | 5394 |
| 1369 | Ga0500619_022328 | 3300053154 | Bacteria | 1835 |
| 1370 | Ga0500619_090401 | 3300053154 | Bacteria | 1034 |
| 1371 | Ga0500620_003266 | 3300053155 | Bacteria | 3437 |
| 1372 | Ga0500622_0003891 | 3300053156 | Bacteria | 9671 |
| 1373 | Ga0500622_0006990 | 3300053156 | Bacteria | 6461 |
| 1374 | Ga0500622_0115937 | 3300053156 | Bacteria | 1304 |
| 1375 | Ga0500627_0023382 | 3300053158 | Bacteria | 2519 |
| 1376 | Ga0500627_0075119 | 3300053158 | Bacteria | 1501 |
| 1377 | Ga0500630_003535 | 3300053159 | Bacteria | 7555 |
| 1378 | Ga0500633_0052223 | 3300053160 | Bacteria | 1414 |
| 1379 | Ga0500634_0118415 | 3300053161 | Bacteria | 1293 |
| 1380 | Ga0500638_006438 | 3300053162 | Bacteria | 4805 |
| 1381 | Ga0500638_206743 | 3300053162 | Bacteria | 825 |
| 1382 | Ga0500638_234419 | 3300053162 | Bacteria | 751 |
| 1383 | Ga0500639_000034 | 3300053163 | Bacteria | 66994 |
| 1384 | Ga0500639_001800 | 3300053163 | Bacteria | 10755 |
| 1385 | Ga0500639_148350 | 3300053163 | Bacteria | 1085 |
| 1386 | Ga0500636_0006585 | 3300053177 | Bacteria | 6672 |
| 1387 | Ga0500636_0015558 | 3300053177 | Bacteria | 4483 |
| 1388 | Ga0500636_0046600 | 3300053177 | Bacteria | 2555 |
| 1389 | Ga0500636_0072915 | 3300053177 | Bacteria | 1989 |
| 1390 | Ga0500636_0205952 | 3300053177 | Bacteria | 1036 |
| 1391 | Ga0500637_0000742 | 3300053178 | Bacteria | 13043 |
| 1392 | Ga0500637_0080859 | 3300053178 | Bacteria | 1877 |
| 1393 | Ga0500637_0097654 | 3300053178 | Bacteria | 1702 |
| 1394 | Ga0500637_0293199 | 3300053178 | Bacteria | 890 |
| 1395 | Ga0500567_177423 | 3300053723 | Bacteria | 750 |
| 1396 | Ga0500576_078959 | 3300053725 | Bacteria | 1395 |
| 1397 | Ga0500645_014699 | 3300053730 | Bacteria | 2490 |
| 1398 | Ga0500596_002867 | 3300053735 | Bacteria | 3358 |
| 1399 | Ga0500596_004222 | 3300053735 | Bacteria | 2658 |
| 1400 | Ga0500599_001531 | 3300053736 | Bacteria | 2674 |
| 1401 | Ga0500601_000312 | 3300053737 | Bacteria | 9081 |
| 1402 | Ga0500601_009495 | 3300053737 | Bacteria | 1085 |
| 1403 | Ga0501084_0043628 | 3300054114 | Bacteria | 3751 |
| 1404 | Ga0501084_0460317 | 3300054114 | Bacteria | 1075 |
| 1405 | Ga0500661_002298 | 3300055283 | Bacteria | 3611 |
| 1406 | Ga0500661_007866 | 3300055283 | Bacteria | 1966 |
| 1407 | Ga0500661_025072 | 3300055283 | Bacteria | 1054 |
| 1408 | Ga0501082_0006469 | 3300060353 | Bacteria | 10161 |
| 1409 | Ga0501082_0165372 | 3300060353 | Bacteria | 1922 |
| 1410 | Ga0501082_0399895 | 3300060353 | Bacteria | 1199 |
| 1411 | Ga0466962_0162410 | 3300061719 | Bacteria | 1086 |
| 1412 | Ga0530510_0338280 | 3300061734 | Bacteria | 1130 |
| 1413 | 2876810941 | 2876808645 | Bacteria | 8824342 |
| 1414 | 2507509406 | 2507262055 | Bacteria | 8048963 |
| 1415 | 2508543448 | 2508501009 | Bacteria | 7784016 |
| 1416 | 2508698775 | 2508501042 | Bacteria | 8719808 |
| 1417 | 2511397822 | 2511231028 | Bacteria | 8046582 |
| 1418 | 2513628257 | 2513237092 | Bacteria | 8341956 |
| 1419 | 2513637970 | 2513237094 | Bacteria | 8789602 |
| 1420 | 2513646591 | 2513237095 | Bacteria | 8976980 |
| 1421 | 2513656639 | 2513237096 | Bacteria | 8722461 |
| 1422 | 2513672317 | 2513237098 | Bacteria | 9902361 |
| 1423 | 2513691789 | 2513237101 | Bacteria | 7952346 |
| 1424 | 2513702035 | 2513237102 | Bacteria | 7703324 |
| 1425 | 2513717491 | 2513237104 | Bacteria | 10034502 |
| 1426 | 2513858571 | 2513237137 | Bacteria | 9558895 |
| 1427 | 2513876398 | 2513237139 | Bacteria | 8737671 |
| 1428 | 2513917824 | 2513237145 | Bacteria | 8979722 |
| 1429 | 2514010738 | 2513237161 | Bacteria | 8871253 |
| 1430 | 2515628984 | 2515154112 | Bacteria | 8294334 |
| 1431 | 2517102064 | 2517093001 | Bacteria | 9002274 |
| 1432 | 2517893128 | 2517572143 | Bacteria | 9484767 |
| 1433 | 2524436496 | 2524023205 | Bacteria | 8918781 |
| 1434 | 2524466880 | 2524023210 | Bacteria | 9029266 |
| 1435 | 2524539346 | 2524023228 | Bacteria | 10118060 |
| 1436 | 2528851504 | 2528768022 | Bacteria | 10457665 |
| 1437 | 2603858836 | 2602042107 | Bacteria | 6226103 |
| 1438 | 2617352250 | 2617270735 | Bacteria | 9163226 |
| 1439 | 2617376527 | 2617270741 | Bacteria | 8201522 |
| 1440 | 2671117762 | 2667528175 | Bacteria | 7532676 |
| 1441 | 2723845797 | 2721755755 | Bacteria | 8322773 |
| 1442 | 2728754636 | 2728368998 | Bacteria | 8720350 |
| 1443 | 2745077131 | 2744054633 | Bacteria | 8678936 |
| 1444 | 2793064848 | 2791355196 | Bacteria | 7323613 |
| 1445 | 2793070002 | 2791355197 | Bacteria | 8420563 |
| 1446 | 2793077210 | |||
| 1447 | 2805920124 | 2802429603 | Bacteria | 8777136 |
| 1448 | 2818240216 | 2816332527 | Bacteria | 8933356 |
| 1449 | 2824604223 | 2824600985 | Bacteria | 8488197 |
| 1450 | 2824617453 | 2824609381 | Bacteria | 8672835 |
| 1451 | 2824619773 | 2824617872 | Bacteria | 8814715 |
| 1452 | 2824629381 | 2824626560 | Bacteria | 8813858 |
| 1453 | 2824642140 | 2824635225 | Bacteria | 8785348 |
| 1454 | 2824651175 | 2824644064 | Bacteria | 8743947 |
| 1455 | 2824660045 | 2824653114 | Bacteria | 8493680 |
| 1456 | 2824666640 | 2824661429 | Bacteria | 9877870 |
| 1457 | 2824676999 | 2824671348 | Bacteria | 8369588 |
| 1458 | 2824683712 | 2824679649 | Bacteria | 8248951 |
| 1459 | 2824694975 | 2824687955 | Bacteria | 8360029 |
| 1460 | 2824703619 | 2824696289 | Bacteria | 8335049 |
| 1461 | 2824712616 | 2824704595 | Bacteria | 9667483 |
| 1462 | 2824721229 | 2824714736 | Bacteria | 8717648 |
| 1463 | 2824731268 | 2824723954 | Bacteria | 8758240 |
| 1464 | 2824739459 | 2824732956 | Bacteria | 7810675 |
| 1465 | 2824749638 | 2824746037 | Bacteria | 7911610 |
| 1466 | 2824760192 | 2824753945 | Bacteria | 9787441 |
| 1467 | 2824767181 | 2824763712 | Bacteria | 9792355 |
| 1468 | 2824780647 | 2824773399 | Bacteria | 8360218 |
| 1469 | 2838126605 | 2838122688 | Bacteria | 8803140 |
| 1470 | 2841947259 | 2841941048 | Bacteria | 8688029 |
| 1471 | 2841950704 | 2841949485 | Bacteria | 8680857 |
| 1472 | 2841964392 | 2841957949 | Bacteria | 8652217 |
| 1473 | 2841967021 | 2841966195 | Bacteria | 8673214 |
| 1474 | 2841975766 | 2841974524 | Bacteria | 8931498 |
| 1475 | 2841990133 | 2841983080 | Bacteria | 8395090 |
| 1476 | 2842039814 | 2842038055 | Bacteria | 8002051 |
| 1477 | 2842047240 | 2842045827 | Bacteria | 8006841 |
| 1478 | 2844318327 | 2844315083 | Bacteria | 8138177 |
| 1479 | 2847935203 | 2847930680 | Bacteria | 9342022 |
| 1480 | 2847945802 | 2847939898 | Bacteria | 8606328 |
| 1481 | 2849080057 | 2849076700 | Bacteria | 7039503 |
| 1482 | 2857510567 | 2857509624 | Bacteria | 7472071 |
| 1483 | 2857528058 | 2857524615 | Bacteria | 6615449 |
| 1484 | 2874597500 | 2874590934 | Bacteria | 8299676 |
| 1485 | 2874609553 | 2874604998 | Bacteria | 7834745 |
| 1486 | 2874612788 | 2874612657 | Bacteria | 8252029 |
| 1487 | 2874627835 | 2874620515 | Bacteria | 8290088 |
| 1488 | 2874636316 | 2874628541 | Bacteria | 8630250 |
| 1489 | 2874648576 | 2874645413 | Bacteria | 8214782 |
| 1490 | 2876770796 | 2876761206 | Bacteria | 10111113 |
| 1491 | 2876777703 | 2876771140 | Bacteria | 8287509 |
| 1492 | 2876822538 | 2876818435 | Bacteria | 8274608 |
| 1493 | 2879078111 | 2879074833 | Bacteria | 8279565 |
| 1494 | 2879089107 | 2879083081 | Bacteria | 8587928 |
| 1495 | 2879102931 | 2879099564 | Bacteria | 10442239 |
| 1496 | 2879115669 | 2879110137 | Bacteria | 8907982 |
| 1497 | 2879134548 | 2879127579 | Bacteria | 8294491 |
| 1498 | 2879149917 | 2879142872 | Bacteria | 8267021 |
| 1499 | 2881366649 | 2881364244 | Bacteria | 7710352 |
| 1500 | 2881669597 | 2881665667 | Bacteria | 8175609 |
| 1501 | 2885373287 | 2885366525 | Bacteria | 8326213 |
| 1502 | 2885378309 | 2885374607 | Bacteria | 8927485 |
| 1503 | 2885390637 | 2885383462 | Bacteria | 9473874 |
| 1504 | 2885417424 | 2885409591 | Bacteria | 9235467 |
| 1505 | 2888383263 | 2888378607 | Bacteria | 9652610 |
| 1506 | 2888394647 | 2888388044 | Bacteria | 7304136 |
| 1507 | 2888423646 | 2888419890 | Bacteria | 7857137 |
| 1508 | 2889040638 | 2889033259 | Bacteria | 9099371 |
| 1509 | 2893068479 | 2893066018 | Bacteria | 6158120 |
| 1510 | 2903729274 | 2903727486 | Bacteria | 8281579 |
| 1511 | 2903753062 | 2903748898 | Bacteria | 9972761 |
| 1512 | 2903775120 | 2903768456 | Bacteria | 9749579 |
| 1513 | 2904672845 | 2904666416 | Bacteria | 8226587 |
| 1514 | 2904696537 | 2904690495 | Bacteria | 9412302 |
| 1515 | 2904703982 | |||
| 1516 | 2904717102 | 2904711408 | Bacteria | 9771557 |
| 1517 | 2906609430 | 2906602504 | Bacteria | 8295279 |
| 1518 | 2906617661 | |||
| 1519 | 2906634677 | 2906626472 | Bacteria | 8826946 |
| 1520 | 2906636792 | 2906635258 | Bacteria | 8601019 |
| 1521 | 2906645906 | 2906643746 | Bacteria | 8722424 |
| 1522 | 2906661360 | 2906660503 | Bacteria | 8595048 |
| 1523 | 2908743521 | 2908739725 | Bacteria | 8628932 |
| 1524 | 2908760391 | 2908756301 | Bacteria | 8864324 |
| 1525 | 2908779367 | 2908775508 | Bacteria | 8092255 |
| 1526 | 2919075457 | 2919073203 | Bacteria | 6531949 |
| 1527 | 2922367743 | 2922361189 | Bacteria | 7436256 |
| 1528 | 2922373426 | |||
| 1529 | 2922392353 | 2922386360 | Bacteria | 7017218 |
| 1530 | 2922395577 | 2922393267 | Bacteria | 8285685 |
| 1531 | 2922429358 | |||
| 1532 | 2929617173 | 2929615660 | Bacteria | 9193770 |
| 1533 | 2929626877 | 2929624759 | Bacteria | 9339455 |
| 1534 | 2932793197 | 2932784394 | Bacteria | 9704911 |
| 1535 | 2932796445 | 2932794094 | Bacteria | 7915132 |
| 1536 | 2932808934 | 2932801729 | Bacteria | 7987968 |
| 1537 | 2932813036 | 2932809354 | Bacteria | 9135765 |
| 1538 | 2932821113 | 2932818245 | Bacteria | 9955613 |
| 1539 | 2932836779 | 2932828146 | Bacteria | 9745859 |
| 1540 | 2933579130 | 2933577622 | Bacteria | 9116884 |
| 1541 | 2935611709 | 2935608549 | Bacteria | 8203142 |
| 1542 | 2935621544 | 2935616580 | Bacteria | 9032984 |
| 1543 | 2935634067 | 2935630451 | Bacteria | 8169952 |
| 1544 | 2935645477 | 2935638405 | Bacteria | 10015038 |
| 1545 | 2935651786 | 2935648319 | Bacteria | 8801166 |
| 1546 | 2935660596 | 2935656913 | Bacteria | 8965014 |
| 1547 | 2935667595 | 2935665750 | Bacteria | 9571747 |
| 1548 | 2935681757 | 2935675223 | Bacteria | 9928132 |
| 1549 | 2935688343 | 2935684952 | Bacteria | 9590419 |
| 1550 | 2935699026 | 2935694250 | Bacteria | 9291695 |
| 1551 | 2935706407 | 2935703347 | Bacteria | 10242284 |
| 1552 | 2935715362 | 2935713505 | Bacteria | 9608509 |
| 1553 | 2935726074 | 2935722832 | Bacteria | 9608746 |
| 1554 | 2935734181 | 2935732158 | Bacteria | 9706831 |
| 1555 | 2935743560 | 2935741537 | Bacteria | 9707219 |
| 1556 | 2935754403 | 2935750917 | Bacteria | 9590372 |
| 1557 | 2935768481 | 2935760218 | Bacteria | 9817913 |
| 1558 | 2935774079 | 2935769743 | Bacteria | 7878163 |
| 1559 | 2935780601 | 2935777560 | Bacteria | 8077691 |
| 1560 | 2935789551 | 2935785616 | Bacteria | 7962367 |
| 1561 | 2935797328 | 2935793552 | Bacteria | 8012592 |
| 1562 | 2935806598 | 2935801545 | Bacteria | 9301974 |
| 1563 | 2935813190 | 2935810662 | Bacteria | 9401221 |
| 1564 | 2935821187 | 2935819856 | Bacteria | 8261050 |
| 1565 | 2935830843 | 2935827899 | Bacteria | 10038562 |
| 1566 | 2935840869 | 2935837841 | Bacteria | 9454360 |
| 1567 | 2935850553 | 2935847175 | Bacteria | 8228321 |
| 1568 | 2935859791 | 2935855204 | Bacteria | 9035059 |
| 1569 | 2935869136 | 2935864058 | Bacteria | 9784707 |
| 1570 | 2935880671 | 2935873716 | Bacteria | 9632195 |
| 1571 | 2935886646 | 2935883170 | Bacteria | 7964738 |
| 1572 | 2935914153 | 2935908558 | Bacteria | 8568796 |
| 1573 | 2935921323 | 2935916978 | Bacteria | 9113783 |
| 1574 | 2935931658 | 2935926038 | Bacteria | 8601059 |
| 1575 | 2935940407 | 2935934488 | Bacteria | 8602579 |
| 1576 | 2935947768 | 2935942939 | Bacteria | 8599779 |
| 1577 | 2935956691 | 2935951376 | Bacteria | 8602333 |
| 1578 | 2935965750 | 2935959822 | Bacteria | 7869783 |
| 1579 | 2935973484 | 2935967501 | Bacteria | 8603075 |
| 1580 | 2935980907 | 2935975950 | Bacteria | 8347125 |
| 1581 | 2935990395 | 2935984226 | Bacteria | 8302647 |
| 1582 | 2936000947 | 2935992306 | Bacteria | 9802711 |
| 1583 | 2936010189 | 2936002035 | Bacteria | 9362176 |
| 1584 | 2936014652 | 2936011229 | Bacteria | 8801034 |
| 1585 | 2936023551 | 2936019824 | Bacteria | 8804134 |
| 1586 | 2936032579 | 2936028420 | Bacteria | 8965941 |
| 1587 | 2936043742 | 2936037263 | Bacteria | 9446081 |
| 1588 | 2936050393 | 2936046547 | Bacteria | 8903709 |
| 1589 | 2936059115 | 2936055302 | Bacteria | 8785755 |
| 1590 | 2940560221 | 2940556831 | Bacteria | 9590747 |
| 1591 | 2941510958 | 2941507105 | Bacteria | 8166816 |
| 1592 | 2941518342 | 2941515067 | Bacteria | 8166720 |
| 1593 | 2941527395 | 2941523033 | Bacteria | 8169134 |
| 1594 | 2941534083 | 2941531003 | Bacteria | 7653939 |
| 1595 | 2941541000 | 2941538514 | Bacteria | 9402094 |
| 1596 | 3005479526 | 3005474847 | Bacteria | 9259049 |
| 1597 | 3005489410 | 3005483717 | Bacteria | 7877331 |
| 1598 | 3005511828 | 3005506211 | Bacteria | 6943378 |
| 1599 | 3005588545 | 3005587118 | Bacteria | 7794411 |
| 1600 | 3005598419 | 3005594810 | Bacteria | 8716512 |
| 1601 | 3005714110 | 3005710791 | Bacteria | 7622528 |
| 1602 | 3005721584 | 3005718088 | Bacteria | 8283608 |
| 1603 | 8006932117 | 8006926726 | Bacteria | 6749210 |
| 1604 | 8006941613 | 8006933436 | Bacteria | 10410654 |
| 1605 | 8006967447 | 8006964411 | Bacteria | 8966052 |
| 1606 | 8006981323 | 8006973647 | Bacteria | 10679141 |
| 1607 | 8006988073 | 8006984368 | Bacteria | 9651211 |
| 1608 | 8006996441 | 8006994254 | Bacteria | 8309700 |
| 1609 | 8016514252 | 8016511872 | Bacteria | 9921665 |
| 1610 | 8016530441 | 8016522445 | Bacteria | 8156687 |
| 1611 | 8016535712 | 8016530956 | Bacteria | 8155261 |
| 1612 | 8016553240 | 8016548790 | Bacteria | 8155074 |
| 1613 | 8016561618 | 8016557553 | Bacteria | 8154380 |
| 1614 | 8016578164 | 8016575299 | Bacteria | 8154085 |
| 1615 | 8016592831 | 8016583857 | Bacteria | 10421953 |
| 1616 | 8016599456 | 8016595262 | Bacteria | 8149947 |
| 1617 | 8016611533 | 8016603502 | Bacteria | 8731218 |
| 1618 | 8016622264 | 8016613128 | Bacteria | 8794220 |
| 1619 | 8016627631 | 8016622563 | Bacteria | 7999408 |
| 1620 | 8016631848 | 8016630954 | Bacteria | 9217207 |
| 1621 | 8017062171 | 8017057580 | Bacteria | 10023680 |
| 1622 | 8019535438 | 8019530166 | Bacteria | 8155624 |
| 1623 | 8019544067 | 8019538911 | Bacteria | 7872763 |
| 1624 | 8019554736 | 8019547302 | Bacteria | 7996444 |
| 1625 | 8019557533 | 8019555841 | Bacteria | 9642137 |
| 1626 | 8019567763 | 8019565922 | Bacteria | 9639779 |
| 1627 | 8019581621 | 8019576017 | Bacteria | 10049540 |
| 1628 | 8019589256 | 8019586578 | Bacteria | 10212056 |
| 1629 | 8019601976 | 8019597564 | Bacteria | 10041141 |
| 1630 | 8019616574 | 8019608314 | Bacteria | 10042931 |
| 1631 | 8019627290 | 8019619141 | Bacteria | 9218857 |
| 1632 | 8019635281 | 8019629233 | Bacteria | 8687553 |
| 1633 | 8019644419 | 8019638758 | Bacteria | 9062356 |
| 1634 | 8019657456 | 8019648815 | Bacteria | 10014479 |
| 1635 | 8019663120 | 8019659431 | Bacteria | 8577854 |
| 1636 | 8019672719 | 8019668869 | Bacteria | 8791617 |
| 1637 | 8019683442 | 8019678201 | Bacteria | 8863603 |
| 1638 | 8019689177 | 8019687851 | Bacteria | 8712826 |
| 1639 | 8055747212 | 8055742211 | Bacteria | 9226248 |
| 1640 | 8056674557 | 8056673599 | Bacteria | 7871253 |
| 1641 | 8056685298 | 8056681323 | Bacteria | 8472857 |
| 1642 | 8056690212 | 8056689827 | Bacteria | 6712655 |
| 1643 | 8056972687 | 8056967851 | Bacteria | 9038162 |
| 1644 | RicEn_C651 | |||
| 1645 | JGI25406J46586_10014911 | |||
| 1646 | JGI25406J46586_10094120 | |||
| 1647 | JGI25165J46597_1006252 | |||
| 1648 | JGI25153J46596_10003518 | |||
| 1649 | JGI25153J46596_10006847 | |||
| 1650 | JGI25153J46596_10012797 | |||
| 1651 | JGI25153J46596_10016522 | |||
| 1652 | JGI25160J50197_1003097 | |||
| 1653 | JGI25160J50197_1005052 | |||
| 1654 | JGI25160J50197_1044907 | |||
| 1655 | JGI25404J52841_10007374 | |||
| 1656 | JGI25404J52841_10040120 | |||
| 1657 | Ga0055542_1011767 | |||
| 1658 | Ga0055526_1064162 | |||
| 1659 | Ga0055531_10008796 | |||
| 1660 | Ga0055543_1003302 | |||
| 1661 | Ga0065165_1001864 | |||
| 1662 | Ga0065165_1019808 | |||
| 1663 | Ga0065165_1020382 | |||
| 1664 | Ga0070658_10230450 | |||
| 1665 | Ga0070676_10153610 | |||
| 1666 | Ga0070683_100029863 | |||
| 1667 | Ga0070683_100689422 | |||
| 1668 | Ga0070670_100508728 | |||
| 1669 | Ga0068869_100111795 | |||
| 1670 | Ga0068869_100335859 | |||
| 1671 | Ga0068869_100467874 | |||
| 1672 | Ga0070680_100018923 | |||
| 1673 | Ga0070680_100187668 | |||
| 1674 | Ga0070680_100463579 | |||
| 1675 | Ga0070680_100492177 | |||
| 1676 | Ga0070682_100026401 | |||
| 1677 | Ga0070682_100162523 | |||
| 1678 | Ga0070682_100362253 | |||
| 1679 | Ga0070682_100542480 | |||
| 1680 | Ga0068868_100589656 | |||
| 1681 | Ga0070660_100010416 | |||
| 1682 | Ga0070660_100253469 | |||
| 1683 | Ga0070660_100299299 | |||
| 1684 | Ga0070687_100206945 | |||
| 1685 | Ga0070661_100006251 | |||
| 1686 | Ga0070661_100377068 | |||
| 1687 | Ga0070668_100067207 | |||
| 1688 | Ga0070668_100089962 | |||
| 1689 | Ga0070668_100138774 | |||
| 1690 | Ga0070669_100378212 | |||
| 1691 | Ga0070669_100843392 | |||
| 1692 | Ga0070675_100065137 | |||
| 1693 | Ga0070675_101244157 | |||
| 1694 | Ga0070671_100276120 | |||
| 1695 | Ga0070671_100531100 | |||
| 1696 | Ga0070671_100706021 | |||
| 1697 | Ga0070674_100078595 | |||
| 1698 | Ga0070674_100111556 | |||
| 1699 | Ga0070659_100177733 | |||
| 1700 | Ga0070659_100375862 | |||
| 1701 | Ga0070659_100448417 | |||
| 1702 | Ga0070667_100134781 | |||
| 1703 | Ga0070709_10000951 | |||
| 1704 | Ga0070709_10076815 | |||
| 1705 | Ga0070709_10172145 | |||
| 1706 | Ga0070714_100010720 | |||
| 1707 | Ga0070714_100074142 | |||
| 1708 | Ga0070714_100226980 | |||
| 1709 | Ga0070714_100386619 | |||
| 1710 | Ga0070713_100000936 | |||
| 1711 | Ga0070713_100005223 | |||
| 1712 | Ga0070713_100066626 | |||
| 1713 | Ga0070713_100098866 | |||
| 1714 | Ga0070713_100294418 | |||
| 1715 | Ga0070710_10002437 | |||
| 1716 | Ga0070710_10372108 | |||
| 1717 | Ga0070711_100003765 | |||
| 1718 | Ga0070711_100010373 | |||
| 1719 | Ga0070711_100133712 | |||
| 1720 | Ga0070705_100788869 | |||
| 1721 | Ga0070663_100028775 | |||
| 1722 | Ga0070663_100033215 | |||
| 1723 | Ga0070663_100051889 | |||
| 1724 | Ga0070663_100153154 | |||
| 1725 | Ga0070678_100038290 | |||
| 1726 | Ga0070678_100046100 | |||
| 1727 | Ga0070678_100050632 | |||
| 1728 | Ga0070678_100622586 | |||
| 1729 | Ga0070662_100017777 | |||
| 1730 | Ga0070662_100462378 | |||
| 1731 | Ga0070662_100473847 | |||
| 1732 | Ga0070681_10013529 | |||
| 1733 | Ga0070681_10024245 | |||
| 1734 | Ga0070681_10034302 | |||
| 1735 | Ga0070681_10147981 | |||
| 1736 | Ga0070681_10189850 | |||
| 1737 | Ga0070681_10200951 | |||
| 1738 | Ga0070681_10531280 | |||
| 1739 | Ga0068867_100452316 | |||
| 1740 | Ga0070698_100415922 | |||
| 1741 | Ga0070699_100742334 | |||
| 1742 | Ga0070699_101106830 | |||
| 1743 | Ga0070679_100007218 | |||
| 1744 | Ga0070679_100095395 | |||
| 1745 | Ga0070679_100136758 | |||
| 1746 | Ga0070679_100418008 | |||
| 1747 | Ga0070679_100485784 | |||
| 1748 | Ga0070679_100526022 | |||
| 1749 | Ga0070684_100018029 | |||
| 1750 | Ga0070684_100036613 | |||
| 1751 | Ga0070684_100064431 | |||
| 1752 | Ga0070684_100084021 | |||
| 1753 | Ga0070684_100456942 | |||
| 1754 | Ga0070697_100056309 | |||
| 1755 | Ga0068853_100004481 | |||
| 1756 | Ga0068853_100263379 | |||
| 1757 | Ga0068853_100422717 | |||
| 1758 | Ga0068853_100435135 | |||
| 1759 | Ga0070672_100651502 | |||
| 1760 | Ga0070693_100060897 | |||
| 1761 | Ga0070693_100390176 | |||
| 1762 | Ga0070665_100062885 | |||
| 1763 | Ga0070665_100094386 | |||
| 1764 | Ga0070665_100100681 | |||
| 1765 | Ga0070665_100139357 | |||
| 1766 | Ga0070665_100290721 | |||
| 1767 | Ga0070665_100335848 | |||
| 1768 | Ga0070665_100475332 | |||
| 1769 | Ga0070665_100839981 | |||
| 1770 | Ga0070704_100205904 | |||
| 1771 | Ga0068855_100026568 | |||
| 1772 | Ga0068855_100067965 | |||
| 1773 | Ga0068855_100121768 | |||
| 1774 | Ga0068855_100202775 | |||
| 1775 | Ga0068855_100221112 | |||
| 1776 | Ga0068855_100325301 | |||
| 1777 | Ga0068855_100446345 | |||
| 1778 | Ga0068855_100505285 | |||
| 1779 | Ga0068855_100610859 | |||
| 1780 | Ga0070664_100074373 | |||
| 1781 | Ga0070664_100631390 | |||
| 1782 | Ga0068857_100017569 | |||
| 1783 | Ga0068857_100145722 | |||
| 1784 | Ga0068857_100921285 | |||
| 1785 | Ga0068857_101371698 | |||
| 1786 | Ga0068854_100177549 | |||
| 1787 | Ga0068856_100006094 | |||
| 1788 | Ga0068856_100185539 | |||
| 1789 | Ga0068856_100253901 | |||
| 1790 | Ga0068856_100519403 | |||
| 1791 | Ga0068856_100547175 | |||
| 1792 | Ga0068856_100984659 | |||
| 1793 | Ga0068852_100002018 | |||
| 1794 | Ga0068852_100082448 | |||
| 1795 | Ga0068852_100103345 | |||
| 1796 | Ga0068852_100141834 | |||
| 1797 | Ga0068852_100218320 | |||
| 1798 | Ga0068852_100312610 | |||
| 1799 | Ga0068852_100641887 | |||
| 1800 | Ga0068852_101445009 | |||
| 1801 | Ga0068859_100251619 | |||
| 1802 | Ga0068859_100414858 | |||
| 1803 | Ga0068859_100474485 | |||
| 1804 | Ga0068864_100546987 | |||
| 1805 | Ga0068861_100195399 | |||
| 1806 | Ga0068861_100354350 | |||
| 1807 | Ga0068851_10013775 | |||
| 1808 | Ga0068851_10201064 | |||
| 1809 | Ga0068863_100318014 | |||
| 1810 | Ga0068863_100905256 | |||
| 1811 | Ga0068858_100248395 | |||
| 1812 | Ga0068858_100313002 | |||
| 1813 | Ga0068858_100355497 | |||
| 1814 | Ga0068858_100444577 | |||
| 1815 | Ga0068860_100000058 | |||
| 1816 | Ga0068860_100204938 | |||
| 1817 | Ga0068860_100353409 | |||
| 1818 | Ga0068860_100692530 | |||
| 1819 | Ga0068862_100037323 | |||
| 1820 | Ga0068862_100105591 | |||
| 1821 | Ga0068862_100626257 | |||
| 1822 | Ga0068862_100943347 | |||
| 1823 | Ga0081455_10009084 | |||
| 1824 | Ga0081455_10018953 | |||
| 1825 | Ga0081455_10059666 | |||
| 1826 | Ga0081455_10074357 | |||
| 1827 | Ga0081455_10202229 | |||
| 1828 | Ga0081455_10251739 | |||
| 1829 | Ga0081538_10043006 | |||
| 1830 | Ga0081538_10176859 | |||
| 1831 | Ga0081540_1001631 | |||
| 1832 | Ga0081540_1004115 | |||
| 1833 | Ga0081540_1009209 | |||
| 1834 | Ga0081540_1009520 | |||
| 1835 | Ga0081540_1024605 | |||
| 1836 | Ga0081540_1031069 | |||
| 1837 | Ga0081540_1037550 | |||
| 1838 | Ga0081540_1040575 | |||
| 1839 | Ga0081540_1122431 | |||
| 1840 | Ga0081539_10000250 | |||
| 1841 | Ga0081539_10000269 | |||
| 1842 | Ga0081539_10017984 | |||
| 1843 | Ga0081539_10176671 | |||
| 1844 | Ga0070717_10001774 | |||
| 1845 | Ga0070717_10049640 | |||
| 1846 | Ga0070717_10304250 | |||
| 1847 | Ga0075365_10015428 | |||
| 1848 | Ga0075365_10040951 | |||
| 1849 | Ga0075365_10053219 | |||
| 1850 | Ga0075365_10059845 | |||
| 1851 | Ga0075365_10130996 | |||
| 1852 | Ga0075365_10148307 | |||
| 1853 | Ga0075365_10236657 | |||
| 1854 | Ga0075365_10406974 | |||
| 1855 | Ga0075368_10017232 | |||
| 1856 | Ga0075368_10096813 | |||
| 1857 | Ga0075368_10124387 | |||
| 1858 | Ga0075368_10168457 | |||
| 1859 | Ga0075363_100012935 | |||
| 1860 | Ga0075363_100086970 | |||
| 1861 | Ga0075363_100201765 | |||
| 1862 | Ga0075364_10090682 | |||
| 1863 | Ga0075364_10106011 | |||
| 1864 | Ga0075364_10378106 | |||
| 1865 | Ga0070715_10000514 | |||
| 1866 | Ga0070715_10044050 | |||
| 1867 | Ga0070716_100004285 | |||
| 1868 | Ga0070716_100179140 | |||
| 1869 | Ga0070712_100072591 | |||
| 1870 | Ga0070712_100089027 | |||
| 1871 | Ga0070712_100575789 | |||
| 1872 | Ga0075362_10229066 | |||
| 1873 | Ga0075367_10026323 | |||
| 1874 | Ga0075367_10056089 | |||
| 1875 | Ga0075367_10215730 | |||
| 1876 | Ga0075369_10073960 | |||
| 1877 | Ga0075366_10056404 | |||
| 1878 | Ga0075366_10105423 | |||
| 1879 | Ga0075366_10253032 | |||
| 1880 | Ga0075366_10405609 | |||
| 1881 | Ga0097621_100698839 | |||
| 1882 | Ga0097621_101048862 | |||
| 1883 | Ga0075370_10030042 | |||
| 1884 | Ga0075370_10065298 | |||
| 1885 | Ga0075370_10112231 | |||
| 1886 | Ga0075370_10225902 | |||
| 1887 | Ga0075370_10334931 | |||
| 1888 | Ga0075433_10628661 | |||
| 1889 | Ga0075434_100008873 | |||
| 1890 | Ga0075434_100915210 | |||
| 1891 | Ga0075434_101575156 | |||
| 1892 | Ga0068865_100075446 | |||
| 1893 | Ga0097620_100251646 | |||
| 1894 | Ga0097620_100414853 | |||
| 1895 | Ga0097620_100474452 | |||
| 1896 | Ga0099825_1017862 | |||
| 1897 | Ga0099824_1004496 | |||
| 1898 | Ga0099822_1001205 | |||
| 1899 | Ga0099823_1074998 | |||
| 1900 | Ga0099794_10111599 | |||
| 1901 | Ga0099794_10247543 | |||
| 1902 | Ga0099795_10028277 | |||
| 1903 | Ga0099795_10043937 | |||
| 1904 | Ga0099795_10117800 | |||
| 1905 | Ga0105250_10146291 | |||
| 1906 | Ga0105240_10037185 | |||
| 1907 | Ga0105240_10060299 | |||
| 1908 | Ga0105240_10147223 | |||
| 1909 | Ga0105240_10170959 | |||
| 1910 | Ga0105240_10216390 | |||
| 1911 | Ga0111539_10054668 | |||
| 1912 | Ga0105245_10018719 | |||
| 1913 | Ga0105245_10083841 | |||
| 1914 | Ga0105245_10132382 | |||
| 1915 | Ga0105247_10005197 | |||
| 1916 | Ga0105247_10043201 | |||
| 1917 | Ga0105247_10120425 | |||
| 1918 | Ga0105247_10122234 | |||
| 1919 | Ga0105247_10534453 | |||
| 1920 | Ga0105247_10766575 | |||
| 1921 | Ga0105247_10808356 | |||
| 1922 | Ga0105243_10023714 | |||
| 1923 | Ga0105243_10246899 | |||
| 1924 | Ga0105241_10022043 | |||
| 1925 | Ga0105241_10022614 | |||
| 1926 | Ga0105241_10244997 | |||
| 1927 | Ga0105241_10351808 | |||
| 1928 | Ga0105241_10447478 | |||
| 1929 | Ga0105242_10193943 | |||
| 1930 | Ga0105242_10279996 | |||
| 1931 | Ga0105248_10199489 | |||
| 1932 | Ga0105248_10489643 | |||
| 1933 | Ga0105248_10614982 | |||
| 1934 | Ga0105248_10836986 | |||
| 1935 | Ga0105248_10858407 | |||
| 1936 | Ga0105248_10989480 | |||
| 1937 | Ga0105248_11095786 | |||
| 1938 | Ga0105237_10003757 | |||
| 1939 | Ga0105237_10013957 | |||
| 1940 | Ga0105237_10108092 | |||
| 1941 | Ga0105237_10154651 | |||
| 1942 | Ga0105237_10207611 | |||
| 1943 | Ga0105237_10355262 | |||
| 1944 | Ga0105238_10012843 | |||
| 1945 | Ga0105238_10087356 | |||
| 1946 | Ga0105238_10108517 | |||
| 1947 | Ga0105238_10355678 | |||
| 1948 | Ga0105238_10378419 | |||
| 1949 | Ga0105238_10431818 | |||
| 1950 | Ga0105238_10991369 | |||
| 1951 | Ga0105249_10548931 | |||
| 1952 | Ga0099796_10007070 | |||
| 1953 | Ga0105239_10083730 | |||
| 1954 | Ga0105239_10095378 | |||
| 1955 | Ga0105239_10099271 | |||
| 1956 | Ga0105239_10132392 | |||
| 1957 | Ga0105239_10168407 | |||
| 1958 | Ga0105239_10300527 | |||
| 1959 | Ga0105239_10489871 | |||
| 1960 | Ga0105239_10608053 | |||
| 1961 | Ga0105239_10734397 | |||
| 1962 | Ga0105246_10121996 | |||
| 1963 | Ga0105246_10388004 | |||
| 1964 | Ga0105246_10416012 | |||
| 1965 | Ga0157325_1010924 | |||
| 1966 | Ga0157313_1006498 | |||
| 1967 | Ga0157373_10114711 | |||
| 1968 | Ga0157371_10127012 | |||
| 1969 | Ga0157370_10076545 | |||
| 1970 | Ga0157370_10358922 | |||
| 1971 | Ga0157370_10375147 | |||
| 1972 | Ga0157370_10562780 | |||
| 1973 | Ga0157370_10970339 | |||
| 1974 | Ga0157369_10008435 | |||
| 1975 | Ga0157369_10030907 | |||
| 1976 | Ga0157369_10163132 | |||
| 1977 | Ga0157369_10455646 | |||
| 1978 | Ga0157369_10830928 | |||
| 1979 | Ga0157374_10073477 | |||
| 1980 | Ga0157374_10161238 | |||
| 1981 | Ga0157374_10172122 | |||
| 1982 | Ga0157374_11494353 | |||
| 1983 | Ga0157378_10015347 | |||
| 1984 | Ga0157378_10375595 | |||
| 1985 | Ga0163162_10413533 | |||
| 1986 | Ga0163162_10605167 | |||
| 1987 | Ga0157372_10096728 | |||
| 1988 | Ga0157372_10447920 | |||
| 1989 | Ga0157372_10756641 | |||
| 1990 | Ga0157372_11580295 | |||
| 1991 | Ga0157375_10022349 | |||
| 1992 | Ga0157375_10191028 | |||
| 1993 | Ga0157375_10247572 | |||
| 1994 | Ga0157375_10312102 | |||
| 1995 | Ga0157375_10529595 | |||
| 1996 | Ga0157375_10586051 | |||
| 1997 | Ga0157375_11317625 | |||
| 1998 | Ga0163163_10017322 | |||
| 1999 | Ga0163163_10048111 | |||
| 2000 | Ga0163163_10420635 | |||
| 2001 | Ga0163163_10549931 | |||
| 2002 | Ga0163163_11066205 | |||
| 2003 | Ga0157380_10126713 | |||
| 2004 | Ga0157380_10338062 | |||
| 2005 | Ga0157380_10358136 | |||
| 2006 | Ga0157380_11479962 | |||
| 2007 | Ga0157377_10198201 | |||
| 2008 | Ga0157379_10250131 | |||
| 2009 | Ga0157379_10434627 | |||
| 2010 | Ga0157379_10631896 | |||
| 2011 | Ga0157376_10054586 | |||
| 2012 | Ga0157376_10247875 | |||
| 2013 | Ga0157376_10438937 | |||
| 2014 | Ga0157376_10550588 | |||
| 2015 | Ga0163161_10180473 | |||
| 2016 | Ga0163161_10414456 | |||
| 2017 | Ga0214544_1000009 | |||
| 2018 | Ga0214542_1000002 | |||
| 2019 | Ga0214545_1000002 | |||
| 2020 | Ga0214543_1000013 | |||
| 2021 | Ga0213873_10038419 | |||
| 2022 | Ga0213874_10051145 | |||
| 2023 | Ga0213876_10001848 | |||
| 2024 | Ga0213876_10011429 | |||
| 2025 | Ga0213875_10035810 | |||
| 2026 | Ga0213875_10269927 | |||
| 2027 | Ga0209563_101045 | |||
| 2028 | Ga0209677_102385 | |||
| 2029 | Ga0209677_102571 | |||
| 2030 | Ga0209148_1000446 | |||
| 2031 | Ga0209233_1001302 | |||
| 2032 | Ga0209233_1001367 | |||
| 2033 | Ga0209233_1031508 | |||
| 2034 | Ga0209455_1006256 | |||
| 2035 | Ga0209673_1049900 | |||
| 2036 | Ga0209564_1009891 | |||
| 2037 | Ga0209564_1024293 | |||
| 2038 | Ga0209758_1000100 | |||
| 2039 | Ga0209758_1000160 | |||
| 2040 | Ga0209758_1002793 | |||
| 2041 | Ga0209758_1003932 | |||
| 2042 | Ga0209758_1005852 | |||
| 2043 | Ga0209758_1016663 | |||
| 2044 | Ga0209758_1030410 | |||
| 2045 | Ga0209758_1031291 | |||
| 2046 | Ga0209050_1050100 | |||
| 2047 | Ga0209256_1010637 | |||
| 2048 | Ga0207426_1001094 | |||
| 2049 | Ga0207426_1002241 | |||
| 2050 | Ga0207426_1021409 | |||
| 2051 | Ga0209257_1005571 | |||
| 2052 | Ga0207697_10040240 | |||
| 2053 | Ga0207697_10137630 | |||
| 2054 | Ga0207697_10307825 | |||
| 2055 | Ga0207656_10212297 | |||
| 2056 | Ga0207696_1077977 | |||
| 2057 | Ga0207692_10000308 | |||
| 2058 | Ga0207692_10002064 | |||
| 2059 | Ga0207692_10095563 | |||
| 2060 | Ga0207642_10018415 | |||
| 2061 | Ga0207710_10005066 | |||
| 2062 | Ga0207710_10011801 | |||
| 2063 | Ga0207688_10224906 | |||
| 2064 | Ga0207680_10359672 | |||
| 2065 | Ga0207647_10015173 | |||
| 2066 | Ga0207647_10066702 | |||
| 2067 | Ga0207647_10150208 | |||
| 2068 | Ga0207647_10173629 | |||
| 2069 | Ga0207685_10000468 | |||
| 2070 | Ga0207685_10068762 | |||
| 2071 | Ga0207699_10001291 | |||
| 2072 | Ga0207699_10010647 | |||
| 2073 | Ga0207699_10128528 | |||
| 2074 | Ga0207645_10027775 | |||
| 2075 | Ga0207645_10030138 | |||
| 2076 | Ga0207643_10223284 | |||
| 2077 | Ga0207705_10274616 | |||
| 2078 | Ga0207684_10085353 | |||
| 2079 | Ga0207654_10070600 | |||
| 2080 | Ga0207654_10077759 | |||
| 2081 | Ga0207654_10185810 | |||
| 2082 | Ga0207707_10000494 | |||
| 2083 | Ga0207707_10000896 | |||
| 2084 | Ga0207707_10026257 | |||
| 2085 | Ga0207707_10109574 | |||
| 2086 | Ga0207707_10304168 | |||
| 2087 | Ga0207695_10000278 | |||
| 2088 | Ga0207695_10080608 | |||
| 2089 | Ga0207695_10184308 | |||
| 2090 | Ga0207695_10254696 | |||
| 2091 | Ga0207695_10340327 | |||
| 2092 | Ga0207695_10752725 | |||
| 2093 | Ga0207671_10006710 | |||
| 2094 | Ga0207671_10062495 | |||
| 2095 | Ga0207671_10128103 | |||
| 2096 | Ga0207671_10187699 | |||
| 2097 | Ga0207671_10222555 | |||
| 2098 | Ga0207671_10388735 | |||
| 2099 | Ga0207693_10001932 | |||
| 2100 | Ga0207693_10006236 | |||
| 2101 | Ga0207693_10012373 | |||
| 2102 | Ga0207693_10013898 | |||
| 2103 | Ga0207693_10105956 | |||
| 2104 | Ga0207663_10000365 | |||
| 2105 | Ga0207663_10007002 | |||
| 2106 | Ga0207663_10027757 | |||
| 2107 | Ga0207663_10129357 | |||
| 2108 | Ga0207660_10001052 | |||
| 2109 | Ga0207660_10017659 | |||
| 2110 | Ga0207660_10065377 | |||
| 2111 | Ga0207660_10082459 | |||
| 2112 | Ga0207657_10011901 | |||
| 2113 | Ga0207657_10199380 | |||
| 2114 | Ga0207657_10348207 | |||
| 2115 | Ga0207657_10349687 | |||
| 2116 | Ga0207657_10416926 | |||
| 2117 | Ga0207649_10891177 | |||
| 2118 | Ga0207652_10001721 | |||
| 2119 | Ga0207652_10002542 | |||
| 2120 | Ga0207652_10029879 | |||
| 2121 | Ga0207652_10033319 | |||
| 2122 | Ga0207652_10255219 | |||
| 2123 | Ga0207652_10264232 | |||
| 2124 | Ga0207652_10346860 | |||
| 2125 | Ga0207646_10052414 | |||
| 2126 | Ga0207681_10237112 | |||
| 2127 | Ga0207694_10046441 | |||
| 2128 | Ga0207694_10115281 | |||
| 2129 | Ga0207694_10195200 | |||
| 2130 | Ga0207694_10239753 | |||
| 2131 | Ga0207694_10272737 | |||
| 2132 | Ga0207694_10671562 | |||
| 2133 | Ga0207694_11045332 | |||
| 2134 | Ga0207650_10105342 | |||
| 2135 | Ga0207687_10012698 | |||
| 2136 | Ga0207687_10086909 | |||
| 2137 | Ga0207687_10355679 | |||
| 2138 | Ga0207700_10000752 | |||
| 2139 | Ga0207700_10076249 | |||
| 2140 | Ga0207700_10209162 | |||
| 2141 | Ga0207700_10639121 | |||
| 2142 | Ga0207664_10023582 | |||
| 2143 | Ga0207664_10143318 | |||
| 2144 | Ga0207664_10843445 | |||
| 2145 | Ga0207644_10058994 | |||
| 2146 | Ga0207644_10244542 | |||
| 2147 | Ga0207690_10197654 | |||
| 2148 | Ga0207690_10291979 | |||
| 2149 | Ga0207690_10358604 | |||
| 2150 | Ga0207706_10114484 | |||
| 2151 | Ga0207686_10173751 | |||
| 2152 | Ga0207686_10373665 | |||
| 2153 | Ga0207709_10052805 | |||
| 2154 | Ga0207709_10369126 | |||
| 2155 | Ga0207669_10052815 | |||
| 2156 | Ga0207669_10086954 | |||
| 2157 | Ga0207669_10258533 | |||
| 2158 | Ga0207669_10447611 | |||
| 2159 | Ga0207669_10572483 | |||
| 2160 | Ga0207704_10014890 | |||
| 2161 | Ga0207665_10000957 | |||
| 2162 | Ga0207665_10004741 | |||
| 2163 | Ga0207665_10539715 | |||
| 2164 | Ga0207691_10033524 | |||
| 2165 | Ga0207691_10034661 | |||
| 2166 | Ga0207691_10824720 | |||
| 2167 | Ga0207711_10396851 | |||
| 2168 | Ga0207711_10430120 | |||
| 2169 | Ga0207711_10931781 | |||
| 2170 | Ga0207689_10188972 | |||
| 2171 | Ga0207689_10240079 | |||
| 2172 | Ga0207689_10365900 | |||
| 2173 | Ga0207661_10015207 | |||
| 2174 | Ga0207661_10223074 | |||
| 2175 | Ga0207661_10390469 | |||
| 2176 | Ga0207679_10054680 | |||
| 2177 | Ga0207679_10541624 | |||
| 2178 | Ga0207679_10565554 | |||
| 2179 | Ga0207667_10003512 | |||
| 2180 | Ga0207667_10010956 | |||
| 2181 | Ga0207667_10184363 | |||
| 2182 | Ga0207667_10215470 | |||
| 2183 | Ga0207667_10330631 | |||
| 2184 | Ga0207667_10521761 | |||
| 2185 | Ga0207667_11267521 | |||
| 2186 | Ga0207651_10307059 | |||
| 2187 | Ga0207651_10650690 | |||
| 2188 | Ga0207712_10215242 | |||
| 2189 | Ga0207712_10687044 | |||
| 2190 | Ga0207668_10106980 | |||
| 2191 | Ga0207668_10191611 | |||
| 2192 | Ga0207668_10193574 | |||
| 2193 | Ga0207668_10221896 | |||
| 2194 | Ga0207668_11005197 | |||
| 2195 | Ga0207658_10255064 | |||
| 2196 | Ga0207658_10258570 | |||
| 2197 | Ga0207658_11234830 | |||
| 2198 | Ga0207677_10194612 | |||
| 2199 | Ga0207677_10602621 | |||
| 2200 | Ga0207703_10093548 | |||
| 2201 | Ga0207703_10131827 | |||
| 2202 | Ga0207703_10204380 | |||
| 2203 | Ga0207703_10263644 | |||
| 2204 | Ga0207703_11031884 | |||
| 2205 | Ga0207639_10007089 | |||
| 2206 | Ga0207639_10149273 | |||
| 2207 | Ga0207639_10358067 | |||
| 2208 | Ga0207639_10685993 | |||
| 2209 | Ga0207639_10903925 | |||
| 2210 | Ga0207678_10060617 | |||
| 2211 | Ga0207678_10066555 | |||
| 2212 | Ga0207678_10091282 | |||
| 2213 | Ga0207678_10126493 | |||
| 2214 | Ga0207678_10399880 | |||
| 2215 | Ga0207678_10798733 | |||
| 2216 | Ga0207702_10004908 | |||
| 2217 | Ga0207702_10291263 | |||
| 2218 | Ga0207702_10300882 | |||
| 2219 | Ga0207702_10577360 | |||
| 2220 | Ga0207702_10683171 | |||
| 2221 | Ga0207702_10768230 | |||
| 2222 | Ga0207641_10458860 | |||
| 2223 | Ga0207648_10027013 | |||
| 2224 | Ga0207676_10121979 | |||
| 2225 | Ga0207676_10183059 | |||
| 2226 | Ga0207676_10572198 | |||
| 2227 | Ga0207676_10635248 | |||
| 2228 | Ga0207674_10016819 | |||
| 2229 | Ga0207674_10076950 | |||
| 2230 | Ga0207674_10078158 | |||
| 2231 | Ga0207674_10812741 | |||
| 2232 | Ga0207675_100193953 | |||
| 2233 | Ga0207675_100196150 | |||
| 2234 | Ga0207683_10036246 | |||
| 2235 | Ga0207683_10075265 | |||
| 2236 | Ga0207683_10262697 | |||
| 2237 | Ga0207698_10033235 | |||
| 2238 | Ga0207698_10094835 | |||
| 2239 | Ga0207698_10384358 | |||
| 2240 | Ga0209389_1000113 | |||
| 2241 | Ga0209589_1000023 | |||
| 2242 | Ga0209589_1000041 | |||
| 2243 | Ga0209489_100032 | |||
| 2244 | Ga0209489_100070 | |||
| 2245 | Ga0209489_107143 | |||
| 2246 | Ga0209700_100021 | |||
| 2247 | Ga0209700_100040 | |||
| 2248 | Ga0209588_1027013 | |||
| 2249 | Ga0209813_10016723 | |||
| 2250 | Ga0209813_10059055 | |||
| 2251 | Ga0268266_10063942 | |||
| 2252 | Ga0268266_10097492 | |||
| 2253 | Ga0268266_10149445 | |||
| 2254 | Ga0268266_10272122 | |||
| 2255 | Ga0268265_10044540 | |||
| 2256 | Ga0268265_10069413 | |||
| 2257 | Ga0268265_10267710 | |||
| 2258 | Ga0268265_10268890 | |||
| 2259 | Ga0268264_10000022 | |||
| 2260 | Ga0268264_10094942 | |||
| 2261 | Ga0268264_10294537 | |||
| 2262 | Ga0268264_10872588 | |||
| 2263 | Ga0265337_1010612 | |||
| 2264 | Ga0265334_10033498 | |||
| 2265 | Ga0265334_10034598 | |||
| 2266 | Ga0265318_10123634 | |||
| 2267 | Ga0265323_10019751 | |||
| 2268 | Ga0307517_10001054 | |||
| 2269 | Ga0307515_10073527 | |||
| 2270 | Ga0265338_10000337 | |||
| 2271 | Ga0265338_10611853 | |||
| 2272 | Ga0265324_10010988 | |||
| 2273 | Ga0307511_10214421 | |||
| 2274 | Ga0265762_1021662 | |||
| 2275 | Ga0265760_10119633 | |||
| 2276 | Ga0265325_10017156 | |||
| 2277 | Ga0265340_10011816 | |||
| 2278 | Ga0265340_10128737 | |||
| 2279 | Ga0265339_10021644 | |||
| 2280 | Ga0265339_10071611 | |||
| 2281 | Ga0265331_10080665 | |||
| 2282 | Ga0265331_10151928 | |||
| 2283 | Ga0265331_10197745 | |||
| 2284 | Ga0265316_10120452 | |||
| 2285 | Ga0307513_10242240 | |||
| 2286 | Ga0307513_10539348 | |||
| 2287 | Ga0307509_10069489 | |||
| 2288 | Ga0307509_10248383 | |||
| 2289 | Ga0307509_10276692 | |||
| 2290 | Ga0307408_100624601 | |||
| 2291 | Ga0307408_100812913 | |||
| 2292 | Ga0265313_10241970 | |||
| 2293 | Ga0307508_10000038 | |||
| 2294 | Ga0307508_10011952 | |||
| 2295 | Ga0307508_10049566 | |||
| 2296 | Ga0307508_10179027 | |||
| 2297 | Ga0307508_10231295 | |||
| 2298 | Ga0307508_10484184 | |||
| 2299 | Ga0265314_10010719 | |||
| 2300 | Ga0265314_10416874 | |||
| 2301 | Ga0265342_10005896 | |||
| 2302 | Ga0265342_10027683 | |||
| 2303 | Ga0307516_10021961 | |||
| 2304 | Ga0307516_10218372 | |||
| 2305 | Ga0307516_10253433 | |||
| 2306 | Ga0307516_10452957 | |||
| 2307 | Ga0307405_10334448 | |||
| 2308 | Ga0307405_10486612 | |||
| 2309 | Ga0307413_10128964 | |||
| 2310 | Ga0307518_10237817 | |||
| 2311 | Ga0307407_10086172 | |||
| 2312 | Ga0307409_100135783 | |||
| 2313 | Ga0307416_100096572 | |||
| 2314 | Ga0307414_10211996 | |||
| 2315 | Ga0307415_100298446 | |||
| 2316 | Ga0307507_10006782 | |||
| 2317 | Ga0307510_10046892 | |||
| 2318 | Ga0307510_10059591 | |||
| 2319 | Ga0315911_1000001 | |||
| 2320 | Ga0316215_1008573 | |||
| 2321 | Ga0373958_0094615 | |||
| 2322 | Ga0373926_0001023 | |||
| 2323 | Ga0373926_0042922 | |||
| 2324 | Ga0373934_0059515 | |||
| 2325 | Ga0373944_0055536 | |||
| 2326 | Ga0373952_0032660 | |||
| 2327 | Ga0373923_0000923 | |||
| 2328 | Ga0373923_0033913 | |||
| 2329 | Ga0373932_0079158 | |||
| 2330 | Ga0373936_0026216 | |||
| 2331 | Ga0373936_0036592 | |||
| 2332 | Ga0373936_0214801 | |||
| 2333 | Ga0373939_0073328 | |||
| 2334 | Ga0373941_0010495 | |||
| 2335 | Ga0373945_0011559 | |||
| 2336 | Ga0373945_0056625 | |||
| 2337 | Ga0373953_0007891 | |||
| 2338 | Ga0373953_0015186 | |||
| 2339 | Ga0373953_0067556 | |||
| 2340 | Ga0373954_0041893 | |||
| 2341 | Ga0373954_0102801 | |||
| 2342 | Ga0373954_0158867 | |||
| 2343 | Ga0373957_0000375 | |||
| 2344 | Ga0373943_0039246 | |||
| 2345 | Ga0373946_0025361 | |||
| 2346 | Ga0373955_0001328 | |||
| 2347 | Ga0373924_0001614 | |||
| 2348 | Ga0373924_0110706 | |||
| 2349 | Ga0373931_0014501 | |||
| 2350 | Ga0373935_0284639 | |||
| 2351 | Ga0373935_0296239 | |||
| 2352 | Ga0373935_0450177 | |||
| 2353 | Ga0373935_0525089 | |||
| 2354 | Ga0373927_0000225 | |||
| 2355 | Ga0373927_0027925 | |||
| 2356 | Ga0373927_0032601 | |||
| 2357 | Ga0373927_0061827 | |||
| 2358 | Ga0373927_0092919 | |||
| 2359 | Ga0373927_0141451 | |||
| 2360 | Ga0373927_0166913 | |||
| 2361 | Ga0373933_0001518 | |||
| 2362 | Ga0373933_0043637 | |||
| 2363 | Ga0373933_0047712 | |||
| 2364 | Ga0373933_0142763 | |||
| 2365 | Ga0373947_0023122 | |||
| 2366 | Ga0373947_0137064 | |||
| 2367 | Ga0373947_0263604 | |||
| 2368 | Ga0373947_0406711 | |||
| 2369 | Ga0373937_0091905 | |||
| 2370 | Ga0373937_0196775 | |||
| 2371 | Ga0373925_0000711 | |||
| 2372 | Ga0373925_0057892 | |||
| 2373 | Ga0373925_0101408 | |||
| 2374 | Ga0373925_0197535 | |||
| 2375 | Ga0373925_0209187 | |||
| 2376 | Ga0395899_0140917 | |||
| 2377 | Ga0395900_0000860 | |||
| 2378 | Ga0395900_0323770 | |||
| 2379 | Ga0395900_0483145 | |||
| 2380 | Ga0395898_0046012 | |||
| 2381 | Ga0395905_0056855 | |||
| 2382 | Ga0395905_0123786 | |||
| 2383 | Ga0436364_0267346 | |||
| 2384 | Ga0436364_0500303 | |||
| 2385 | Ga0436364_1340351 | |||
| 2386 | Ga0395901_0057535 | |||
| 2387 | Ga0395901_0974883 | |||
| 2388 | Ga0436365_0151039 | |||
| 2389 | Ga0436365_0268210 | |||
| 2390 | Ga0436365_0710303 | |||
| 2391 | Ga0436365_1095310 | |||
| 2392 | Ga0436365_1396402 | |||
| 2393 | Ga0436365_1591893 | |||
| 2394 | Ga0436365_1655446 | |||
| 2395 | Ga0436365_1817893 | |||
| 2396 | Ga0436365_1870953 | |||
| 2397 | Ga0436360_0660865 | |||
| 2398 | Ga0436363_0772753 | |||
| 2399 | Ga0436363_0894926 | |||
| 2400 | Ga0436363_1201079 | |||
| 2401 | Ga0436363_1223665 | |||
| 2402 | Ga0436362_0332326 | |||
| 2403 | Ga0439465_0108277 | |||
| 2404 | Ga0451791_0964902 | |||
| 2405 | Ga0451797_0764166 | |||
| 2406 | Ga0451802_0611095 | |||
| 2407 | Ga0451839_1631068 | |||
| 2408 | Ga0451839_1657451 | |||
| 2409 | Ga0451841_0572120 | |||
| 2410 | Ga0451849_0054097 | |||
| 2411 | Ga0451853_2886446 | |||
| 2412 | Ga0451853_3008790 | |||
| 2413 | Ga0451853_3547507 | |||
| 2414 | Ga0439463_049467 | |||
| 2415 | Ga0439458_0079320 | |||
| 2416 | Ga0466972_0000660 | |||
| 2417 | Ga0466972_0004579 | |||
| 2418 | Ga0466972_0109388 | |||
| 2419 | Ga0466965_0099463 | |||
| 2420 | Ga0466966_0000932 | |||
| 2421 | Ga0466966_0102237 | |||
| 2422 | Ga0466961_0000488 | |||
| 2423 | Ga0466963_0074240 | |||
| 2424 | Ga0466963_0121993 | |||
| 2425 | Ga0466964_0352582 | |||
| 2426 | Ga0466964_0411657 | |||
| 2427 | Ga0466968_0002010 | |||
| 2428 | Ga0466957_0079290 | |||
| 2429 | Ga0466957_0159408 | |||
| 2430 | Ga0466957_0407282 | |||
| 2431 | Ga0466967_0031184 | |||
| 2432 | Ga0466967_0115452 | |||
| 2433 | Ga0495617_042503 | |||
| 2434 | Ga0495617_077806 | |||
| 2435 | Ga0495592_0002531 | |||
| 2436 | Ga0495592_0018338 | |||
| 2437 | Ga0495592_0395432 | |||
| 2438 | Ga0495592_0603616 | |||
| 2439 | Ga0495603_0001221 | |||
| 2440 | Ga0495603_0026173 | |||
| 2441 | Ga0495603_0191071 | |||
| 2442 | Ga0495629_0000179 | |||
| 2443 | Ga0495629_0001007 | |||
| 2444 | Ga0495629_0005795 | |||
| 2445 | Ga0495638_0012856 | |||
| 2446 | Ga0495638_0066840 | |||
| 2447 | Ga0495638_0258927 | |||
| 2448 | Ga0495651_0013292 | |||
| 2449 | Ga0495651_0157426 | |||
| 2450 | Ga0495651_0162720 | |||
| 2451 | Ga0495651_0272952 | |||
| 2452 | Ga0495651_0323804 | |||
| 2453 | Ga0495651_0360313 | |||
| 2454 | Ga0495651_0482053 | |||
| 2455 | Ga0495653_0211587 | |||
| 2456 | Ga0495650_0207173 | |||
| 2457 | Ga0495580_0000280 | |||
| 2458 | Ga0495580_0029169 | |||
| 2459 | Ga0495582_0000061 | |||
| 2460 | Ga0495582_0143590 | |||
| 2461 | Ga0495639_0000102 | |||
| 2462 | Ga0495639_0036398 | |||
| 2463 | Ga0495662_0000074 | |||
| 2464 | Ga0495662_0021975 | |||
| 2465 | Ga0495664_0077067 | |||
| 2466 | Ga0495664_0116766 | |||
| 2467 | Ga0495584_0367079 | |||
| 2468 | Ga0495585_0200184 | |||
| 2469 | Ga0495594_0000378 | |||
| 2470 | Ga0495594_0188928 | |||
| 2471 | Ga0495594_0310518 | |||
| 2472 | Ga0495594_0332067 | |||
| 2473 | Ga0495583_0038104 | |||
| 2474 | Ga0495606_0003007 | |||
| 2475 | Ga0495606_0094118 | |||
| 2476 | Ga0495606_0296470 | |||
| 2477 | Ga0495608_0017019 | |||
| 2478 | Ga0495608_0410528 | |||
| 2479 | Ga0495610_0086587 | |||
| 2480 | Ga0495610_0116191 | |||
| 2481 | Ga0495616_0254761 | |||
| 2482 | Ga0495618_0007907 | |||
| 2483 | Ga0495618_0039412 | |||
| 2484 | Ga0495618_0245563 | |||
| 2485 | Ga0495620_0035877 | |||
| 2486 | Ga0495628_0004580 | |||
| 2487 | Ga0495628_0058989 | |||
| 2488 | Ga0495628_0078743 | |||
| 2489 | Ga0495628_0393307 | |||
| 2490 | Ga0495630_0001032 | |||
| 2491 | Ga0495630_0037229 | |||
| 2492 | Ga0495631_0105640 | |||
| 2493 | Ga0495632_0049316 | |||
| 2494 | Ga0495632_0214786 | |||
| 2495 | Ga0495643_0019680 | |||
| 2496 | Ga0495648_0002612 | |||
| 2497 | Ga0495648_0002918 | |||
| 2498 | Ga0495648_0030845 | |||
| 2499 | Ga0495648_0030855 | |||
| 2500 | Ga0495648_0044101 | |||
| 2501 | Ga0495648_0118640 | |||
| 2502 | Ga0495648_0147774 | |||
| 2503 | Ga0495648_0207891 | |||
| 2504 | Ga0495666_0007696 | |||
| 2505 | Ga0495642_0245168 | |||
| 2506 | Ga0495652_0003857 | |||
| 2507 | Ga0495652_0032487 | |||
| 2508 | Ga0495652_0075661 | |||
| 2509 | Ga0495652_0249787 | |||
| 2510 | Ga0495654_0178950 | |||
| 2511 | Ga0495665_0000261 | |||
| 2512 | Ga0495665_0011427 | |||
| 2513 | Ga0495640_0040108 | |||
| 2514 | Ga0495640_0060166 | |||
| 2515 | Ga0495640_0116764 | |||
| 2516 | Ga0495640_0270334 | |||
| 2517 | Ga0495586_0239141 | |||
| 2518 | Ga0495587_0012126 | |||
| 2519 | Ga0495587_0079430 | |||
| 2520 | Ga0495587_0181922 | |||
| 2521 | Ga0495621_0022283 | |||
| 2522 | Ga0495597_0138775 | |||
| 2523 | Ga0495597_0159820 | |||
| 2524 | Ga0495645_0025567 | |||
| 2525 | Ga0495645_0147373 | |||
| 2526 | Ga0495645_0258674 | |||
| 2527 | Ga0495645_0277518 | |||
| 2528 | Ga0495645_0335358 | |||
| 2529 | Ga0495622_0016935 | |||
| 2530 | Ga0495622_0101574 | |||
| 2531 | Ga0495633_0127435 | |||
| 2532 | Ga0495667_0004202 | |||
| 2533 | Ga0495667_0036521 | |||
| 2534 | Ga0495667_0124599 | |||
| 2535 | Ga0495667_0136614 | |||
| 2536 | Ga0495656_0096587 | |||
| 2537 | Ga0495668_0050083 | |||
| 2538 | Ga0495668_0053210 | |||
| 2539 | Ga0495668_0231398 | |||
| 2540 | Ga0495634_0000161 | |||
| 2541 | Ga0495634_0022358 | |||
| 2542 | Ga0495634_0195081 | |||
| 2543 | Ga0495625_0048156 | |||
| 2544 | Ga0495625_0331278 | |||
| 2545 | Ga0495635_0008716 | |||
| 2546 | Ga0495635_0033710 | |||
| 2547 | Ga0495635_0037786 | |||
| 2548 | Ga0495635_0054592 | |||
| 2549 | Ga0495635_0071655 | |||
| 2550 | Ga0495659_0014177 | |||
| 2551 | Ga0495659_0203320 | |||
| 2552 | Ga0495661_0181418 | |||
| 2553 | Ga0495588_0020981 | |||
| 2554 | Ga0495588_0025233 | |||
| 2555 | Ga0495588_0321470 | |||
| 2556 | Ga0495588_0323936 | |||
| 2557 | Ga0495588_0427306 | |||
| 2558 | Ga0495657_0015740 | |||
| 2559 | Ga0495657_0019424 | |||
| 2560 | Ga0495657_0064717 | |||
| 2561 | Ga0495599_0009174 | |||
| 2562 | Ga0495599_0084427 | |||
| 2563 | Ga0495599_0183929 | |||
| 2564 | Ga0495599_0309661 | |||
| 2565 | Ga0495623_0023186 | |||
| 2566 | Ga0495623_0035017 | |||
| 2567 | Ga0495623_0082545 | |||
| 2568 | Ga0495623_0115991 | |||
| 2569 | Ga0495623_0145015 | |||
| 2570 | Ga0495623_0159907 | |||
| 2571 | Ga0495623_0248044 | |||
| 2572 | Ga0495646_0040870 | |||
| 2573 | Ga0495646_0086315 | |||
| 2574 | Ga0495646_0097016 | |||
| 2575 | Ga0495647_0028695 | |||
| 2576 | Ga0495658_0000315 | |||
| 2577 | Ga0495658_0109624 | |||
| 2578 | Ga0495669_0281291 | |||
| 2579 | Ga0495613_0002949 | |||
| 2580 | Ga0495613_0218703 | |||
| 2581 | Ga0495613_0373042 | |||
| 2582 | Ga0495624_0029489 | |||
| 2583 | Ga0495624_0058579 | |||
| 2584 | Ga0495624_0379776 | |||
| 2585 | Ga0495670_0020190 | |||
| 2586 | Ga0495671_0147083 | |||
| 2587 | Ga0495649_0040180 | |||
| 2588 | Ga0495649_0247943 | |||
| 2589 | Ga0495589_0314519 | |||
| 2590 | Ga0495600_0006120 | |||
| 2591 | Ga0495600_0010630 | |||
| 2592 | Ga0495600_0042515 | |||
| 2593 | Ga0495600_0048711 | |||
| 2594 | Ga0495660_0080346 | |||
| 2595 | Ga0495581_0000255 | |||
| 2596 | Ga0495581_0062966 | |||
| 2597 | Ga0495581_0226685 | |||
| 2598 | Ga0495604_0015795 | |||
| 2599 | Ga0495604_0066179 | |||
| 2600 | Ga0495604_0096882 | |||
| 2601 | Ga0495604_0200105 | |||
| 2602 | Ga0495674_0000117 | |||
| 2603 | Ga0495674_0027042 | |||
| 2604 | Ga0495674_0039883 | |||
| 2605 | Ga0495674_0067676 | |||
| 2606 | Ga0495674_0123813 | |||
| 2607 | Ga0495674_0298004 | |||
| 2608 | Ga0495672_0008790 | |||
| 2609 | Ga0495672_0011329 | |||
| 2610 | Ga0495672_0058411 | |||
| 2611 | Ga0495672_0128851 | |||
| 2612 | Ga0495672_0131965 | |||
| 2613 | Ga0495676_0051519 | |||
| 2614 | Ga0495676_0119809 | |||
| 2615 | Ga0495676_0312874 | |||
| 2616 | Ga0495676_0730243 | |||
| 2617 | Ga0495680_0000688 | |||
| 2618 | Ga0495680_0004171 | |||
| 2619 | Ga0495680_0072956 | |||
| 2620 | Ga0495680_0176306 | |||
| 2621 | Ga0495687_015006 | |||
| 2622 | Ga0495675_0006128 | |||
| 2623 | Ga0495675_0061318 | |||
| 2624 | Ga0495675_0361093 | |||
| 2625 | Ga0495677_0044745 | |||
| 2626 | Ga0495684_0000633 | |||
| 2627 | Ga0495684_0020139 | |||
| 2628 | Ga0495684_0060136 | |||
| 2629 | Ga0495684_0145984 | |||
| 2630 | Ga0495684_0212357 | |||
| 2631 | Ga0495593_0000086 | |||
| 2632 | Ga0495593_0002322 | |||
| 2633 | Ga0495593_0028926 | |||
| 2634 | Ga0495593_0149102 | |||
| 2635 | Ga0495602_0004737 | |||
| 2636 | Ga0495602_0029828 | |||
| 2637 | Ga0495602_0204155 | |||
| 2638 | Ga0495602_0234176 | |||
| 2639 | Ga0495602_0357159 | |||
| 2640 | Ga0495602_0369283 | |||
| 2641 | Ga0495626_0120996 | |||
| 2642 | Ga0496100_0098944 | |||
| 2643 | Ga0496100_0112296 | |||
| 2644 | Ga0496100_0570969 | |||
| 2645 | Ga0496100_0665719 | |||
| 2646 | Ga0496101_0023934 | |||
| 2647 | Ga0496101_0444885 | |||
| 2648 | Ga0496101_0780065 | |||
| 2649 | Ga0496102_0013632 | |||
| 2650 | Ga0496102_0051025 | |||
| 2651 | Ga0496102_0097921 | |||
| 2652 | Ga0496102_0106172 | |||
| 2653 | Ga0496102_0132304 | |||
| 2654 | Ga0496102_0506723 | |||
| 2655 | Ga0496102_0706217 | |||
| 2656 | Ga0496102_0807003 | |||
| 2657 | Ga0496103_0194972 | |||
| 2658 | Ga0496104_0011141 | |||
| 2659 | Ga0496104_0049613 | |||
| 2660 | Ga0496104_0064542 | |||
| 2661 | Ga0496104_0097842 | |||
| 2662 | Ga0496104_0126823 | |||
| 2663 | Ga0496104_0131997 | |||
| 2664 | Ga0496105_0003203 | |||
| 2665 | Ga0496105_0008366 | |||
| 2666 | Ga0496105_0016607 | |||
| 2667 | Ga0496105_0088755 | |||
| 2668 | Ga0496105_0305289 | |||
| 2669 | Ga0496105_0377082 | |||
| 2670 | Ga0496106_0000546 | |||
| 2671 | Ga0496106_0005548 | |||
| 2672 | Ga0496106_0010390 | |||
| 2673 | Ga0496106_0040671 | |||
| 2674 | Ga0496106_0165675 | |||
| 2675 | Ga0496106_0566529 | |||
| 2676 | Ga0496107_0002937 | |||
| 2677 | Ga0496107_0004305 | |||
| 2678 | Ga0496107_0017612 | |||
| 2679 | Ga0496107_0057818 | |||
| 2680 | Ga0496107_0094496 | |||
| 2681 | Ga0496107_0130263 | |||
| 2682 | Ga0496107_0258456 | |||
| 2683 | Ga0496108_0001440 | |||
| 2684 | Ga0496108_0501445 | |||
| 2685 | Ga0496109_0001610 | |||
| 2686 | Ga0496109_0015876 | |||
| 2687 | Ga0496109_0081792 | |||
| 2688 | Ga0496109_0103673 | |||
| 2689 | Ga0496109_0131305 | |||
| 2690 | Ga0496109_0292592 | |||
| 2691 | Ga0496110_0012816 | |||
| 2692 | Ga0496110_0017787 | |||
| 2693 | Ga0496110_0050143 | |||
| 2694 | Ga0496110_0088331 | |||
| 2695 | Ga0496110_0119358 | |||
| 2696 | Ga0496110_0856248 | |||
| 2697 | Ga0496110_1123985 | |||
| 2698 | Ga0496111_0021964 | |||
| 2699 | Ga0496111_0040806 | |||
| 2700 | Ga0496111_0141440 | |||
| 2701 | Ga0496111_0369969 | |||
| 2702 | Ga0496111_0420705 | |||
| 2703 | Ga0496112_0000079 | |||
| 2704 | Ga0496112_0007905 | |||
| 2705 | Ga0496112_0009200 | |||
| 2706 | Ga0496112_0028997 | |||
| 2707 | Ga0496112_0032003 | |||
| 2708 | Ga0496112_0033853 | |||
| 2709 | Ga0496112_0046075 | |||
| 2710 | Ga0496112_0069563 | |||
| 2711 | Ga0496112_0085641 | |||
| 2712 | Ga0496113_0018743 | |||
| 2713 | Ga0496113_0034316 | |||
| 2714 | Ga0496113_0070124 | |||
| 2715 | Ga0496113_0364465 | |||
| 2716 | Ga0496114_0019840 | |||
| 2717 | Ga0496114_0026302 | |||
| 2718 | Ga0496114_0239484 | |||
| 2719 | Ga0496114_0255707 | |||
| 2720 | Ga0496114_0383421 | |||
| 2721 | Ga0496114_0522738 | |||
| 2722 | Ga0496114_0787329 | |||
| 2723 | Ga0496115_0030579 | |||
| 2724 | Ga0496115_0034088 | |||
| 2725 | Ga0496115_0039040 | |||
| 2726 | Ga0496115_0050911 | |||
| 2727 | Ga0496115_0056445 | |||
| 2728 | Ga0496115_0121603 | |||
| 2729 | Ga0496115_0216268 | |||
| 2730 | Ga0496115_0300131 | |||
| 2731 | Ga0496115_0436859 | |||
| 2732 | Ga0496115_0544837 | |||
| 2733 | Ga0496116_0119249 | |||
| 2734 | Ga0496116_0132314 | |||
| 2735 | Ga0496117_0041834 | |||
| 2736 | Ga0496117_0086770 | |||
| 2737 | Ga0496117_0103769 | |||
| 2738 | Ga0496117_0198089 | |||
| 2739 | Ga0496117_0229638 | |||
| 2740 | Ga0496118_0003967 | |||
| 2741 | Ga0496118_0046546 | |||
| 2742 | Ga0496118_0070050 | |||
| 2743 | Ga0496118_0072285 | |||
| 2744 | Ga0496119_0020659 | |||
| 2745 | Ga0496119_0051144 | |||
| 2746 | Ga0496119_0096053 | |||
| 2747 | Ga0496119_0130553 | |||
| 2748 | Ga0496120_0008075 | |||
| 2749 | Ga0496120_0017144 | |||
| 2750 | Ga0496121_0000495 | |||
| 2751 | Ga0496121_0000576 | |||
| 2752 | Ga0496121_0001789 | |||
| 2753 | Ga0496121_0003477 | |||
| 2754 | Ga0496121_0005072 | |||
| 2755 | Ga0496121_0023876 | |||
| 2756 | Ga0496121_0024511 | |||
| 2757 | Ga0496121_0084412 | |||
| 2758 | Ga0496121_0085565 | |||
| 2759 | Ga0496121_0177005 | |||
| 2760 | Ga0496121_0185412 | |||
| 2761 | Ga0496121_0320823 | |||
| 2762 | Ga0496121_0383172 | |||
| 2763 | Ga0496122_0126372 | |||
| 2764 | Ga0496123_0023903 | |||
| 2765 | Ga0496123_0045334 | |||
| 2766 | Ga0496124_0055299 | |||
| 2767 | Ga0496124_0112519 | |||
| 2768 | Ga0496124_0125827 | |||
| 2769 | Ga0496124_0351760 | |||
| 2770 | Ga0496125_0003570 | |||
| 2771 | Ga0496125_0034194 | |||
| 2772 | Ga0496125_0037412 | |||
| 2773 | Ga0496125_0042128 | |||
| 2774 | Ga0496125_0045546 | |||
| 2775 | Ga0496125_0060992 | |||
| 2776 | Ga0496125_0076578 | |||
| 2777 | Ga0496125_0167892 | |||
| 2778 | Ga0496125_0318590 | |||
| 2779 | Ga0496126_0002315 | |||
| 2780 | Ga0496126_0006641 | |||
| 2781 | Ga0496126_0007687 | |||
| 2782 | Ga0496126_0008516 | |||
| 2783 | Ga0496126_0030050 | |||
| 2784 | Ga0496126_0041989 | |||
| 2785 | Ga0496126_0061749 | |||
| 2786 | Ga0496126_0078368 | |||
| 2787 | Ga0496126_0094451 | |||
| 2788 | Ga0496126_0104047 | |||
| 2789 | Ga0496126_0112266 | |||
| 2790 | Ga0496126_0138804 | |||
| 2791 | Ga0496126_0141356 | |||
| 2792 | Ga0496126_0142335 | |||
| 2793 | Ga0496126_0151861 | |||
| 2794 | Ga0496126_0175123 | |||
| 2795 | Ga0496126_0177784 | |||
| 2796 | Ga0496126_0229460 | |||
| 2797 | Ga0496126_0292981 | |||
| 2798 | Ga0496126_0303240 | |||
| 2799 | Ga0496126_0380180 | |||
| 2800 | Ga0496126_0452266 | |||
| 2801 | Ga0496126_0456066 | |||
| 2802 | Ga0496126_0526203 | |||
| 2803 | Ga0496126_0603044 | |||
| 2804 | Ga0495678_096604 | |||
| 2805 | Ga0501031_0004261 | |||
| 2806 | Ga0501031_0150707 | |||
| 2807 | Ga0501032_0005554 | |||
| 2808 | Ga0501032_0138626 | |||
| 2809 | Ga0501032_0244123 | |||
| 2810 | Ga0501032_0313647 | |||
| 2811 | Ga0501033_0000256 | |||
| 2812 | Ga0501033_0136088 | |||
| 2813 | Ga0501034_0000175 | |||
| 2814 | Ga0501034_0354427 | |||
| 2815 | Ga0501034_0368998 | |||
| 2816 | Ga0501034_0713679 | |||
| 2817 | Ga0501036_0000032 | |||
| 2818 | Ga0501036_0656210 | |||
| 2819 | Ga0501037_0001755 | |||
| 2820 | Ga0501037_0092867 | |||
| 2821 | Ga0501037_0147015 | |||
| 2822 | Ga0501038_0000114 | |||
| 2823 | Ga0501038_0025774 | |||
| 2824 | Ga0501038_0110509 | |||
| 2825 | Ga0501039_0001954 | |||
| 2826 | Ga0501039_0487062 | |||
| 2827 | Ga0501040_0025761 | |||
| 2828 | Ga0501041_0541366 | |||
| 2829 | Ga0501042_0251438 | |||
| 2830 | Ga0501043_0002389 | |||
| 2831 | Ga0501046_0004110 | |||
| 2832 | Ga0501046_0188243 | |||
| 2833 | Ga0501047_0000085 | |||
| 2834 | Ga0501047_0116791 | |||
| 2835 | Ga0501047_0178053 | |||
| 2836 | Ga0501047_0179361 | |||
| 2837 | Ga0501047_0196472 | |||
| 2838 | Ga0501048_0001859 | |||
| 2839 | Ga0501048_0039196 | |||
| 2840 | Ga0501048_0185910 | |||
| 2841 | Ga0501067_0000096 | |||
| 2842 | Ga0501067_0007715 | |||
| 2843 | Ga0501068_0000220 | |||
| 2844 | Ga0501068_0002790 | |||
| 2845 | Ga0501069_0003655 | |||
| 2846 | Ga0501069_0040056 | |||
| 2847 | Ga0501069_0161040 | |||
| 2848 | Ga0501070_0005720 | |||
| 2849 | Ga0501070_0262510 | |||
| 2850 | Ga0501070_0264154 | |||
| 2851 | Ga0501070_0474754 | |||
| 2852 | Ga0501071_0076396 | |||
| 2853 | Ga0501071_0092212 | |||
| 2854 | Ga0501072_0003496 | |||
| 2855 | Ga0501073_0000026 | |||
| 2856 | Ga0501073_0193431 | |||
| 2857 | Ga0501074_0000878 | |||
| 2858 | Ga0501074_0065877 | |||
| 2859 | Ga0501076_0188248 | |||
| 2860 | Ga0501077_0225687 | |||
| 2861 | Ga0501079_0007708 | |||
| 2862 | Ga0501080_0005240 | |||
| 2863 | Ga0501080_0333878 | |||
| 2864 | Ga0501081_0167660 | |||
| 2865 | Ga0501083_0012775 | |||
| 2866 | Ga0501083_0378157 | |||
| 2867 | Ga0501035_0003195 | |||
| 2868 | Ga0501035_0027489 | |||
| 2869 | Ga0501044_0000061 | |||
| 2870 | Ga0501044_0111623 | |||
| 2871 | Ga0501044_0143992 | |||
| 2872 | Ga0501044_0357216 | |||
| 2873 | Ga0501044_0381715 | |||
| 2874 | Ga0501044_0435807 | |||
| 2875 | Ga0501044_0601617 | |||
| 2876 | Ga0501045_0090535 | |||
| 2877 | Ga0501045_0387975 | |||
| 2878 | nmdc:mga03n38_23321_c1 | |||
| 2879 | nmdc:mga03n38_3983_c1 | |||
| 2880 | nmdc:mga00v17_107230_c1 | |||
| 2881 | nmdc:mga0yw44_109677_c1 | |||
| 2882 | nmdc:mga0yw44_156432_c1 | |||
| 2883 | nmdc:mga0yw44_163960_c1 | |||
| 2884 | nmdc:mga0yw44_35589_c1 | |||
| 2885 | nmdc:mga0yw44_384637_c1 | |||
| 2886 | nmdc:mga0yw44_385394_c1 | |||
| 2887 | nmdc:mga0yw44_55380_c1 | |||
| 2888 | nmdc:mga0yw44_58163_c1 | |||
| 2889 | nmdc:mga0k408_102575_c1 | |||
| 2890 | nmdc:mga0k408_103595_c1 | |||
| 2891 | nmdc:mga0k408_290809_c1 | |||
| 2892 | nmdc:mga06z11_109098_c1 | |||
| 2893 | nmdc:mga06z11_22801_c2 | |||
| 2894 | nmdc:mga06z11_30063_c1 | |||
| 2895 | nmdc:mga06z11_526816_c1 | |||
| 2896 | nmdc:mga04h51_23345_c1 | |||
| 2897 | nmdc:mga04h51_27163_c1 | |||
| 2898 | nmdc:mga04h51_70640_c1 | |||
| 2899 | nmdc:mga04h51_89026_c1 | |||
| 2900 | nmdc:mga07m45_145517_c1 | |||
| 2901 | nmdc:mga07m45_186513_c1 | |||
| 2902 | nmdc:mga07m45_224211_c1 | |||
| 2903 | nmdc:mga07m45_243653_c1 | |||
| 2904 | nmdc:mga07m45_41716_c1 | |||
| 2905 | nmdc:mga07m45_73605_c1 | |||
| 2906 | nmdc:mga07m45_7361_c2 | |||
| 2907 | nmdc:mga05p37_704993_c1 | |||
| 2908 | nmdc:mga08y16_904525_c1 | |||
| 2909 | nmdc:mga0n895_337869_c1 | |||
| 2910 | nmdc:mga0n895_581500_c1 | |||
| 2911 | nmdc:mga0n895_804835_c1 | |||
| 2912 | nmdc:mga0rr50_83404_c1 | |||
| 2913 | nmdc:mga08x19_40402_c2 | |||
| 2914 | nmdc:mga0sz30_6811_c1 | |||
| 2915 | nmdc:mga0sz30_71801_c2 | |||
| 2916 | Ga0495601_0069967 | |||
| 2917 | Ga0495601_0200514 | |||
| 2918 | Ga0495601_0371688 | |||
| 2919 | Ga0495601_0463683 | |||
| 2920 | Ga0495612_0002860 | |||
| 2921 | Ga0495612_0065484 | |||
| 2922 | Ga0500610_0043837 | |||
| 2923 | Ga0500635_0002252 | |||
| 2924 | Ga0495655_0004246 | |||
| 2925 | Ga0495595_0004246 | |||
| 2926 | Ga0495595_0028104 | |||
| 2927 | Ga0495595_0314909 | |||
| 2928 | Ga0495619_0000182 | |||
| 2929 | Ga0495619_0012568 | |||
| 2930 | Ga0495619_0046963 | |||
| 2931 | Ga0500578_0036475 | |||
| 2932 | Ga0500578_0069467 | |||
| 2933 | Ga0500643_000025 | |||
| 2934 | Ga0500643_047421 | |||
| 2935 | Ga0500647_0108689 | |||
| 2936 | Ga0500647_0186634 | |||
| 2937 | Ga0500583_0041181 | |||
| 2938 | Ga0500583_0098211 | |||
| 2939 | Ga0500651_0047257 | |||
| 2940 | Ga0500651_0076618 | |||
| 2941 | Ga0500651_0128774 | |||
| 2942 | Ga0500651_0256279 | |||
| 2943 | Ga0500566_0000038 | |||
| 2944 | Ga0500566_0000184 | |||
| 2945 | Ga0500566_0020577 | |||
| 2946 | Ga0500566_0215292 | |||
| 2947 | Ga0500640_000523 | |||
| 2948 | Ga0500641_0017528 | |||
| 2949 | Ga0500641_0076312 | |||
| 2950 | Ga0500641_0264403 | |||
| 2951 | Ga0500648_209530 | |||
| 2952 | Ga0500650_0154791 | |||
| 2953 | Ga0500554_060816 | |||
| 2954 | Ga0500554_061704 | |||
| 2955 | Ga0500556_0000002 | |||
| 2956 | Ga0500556_0017722 | |||
| 2957 | Ga0500557_000001 | |||
| 2958 | Ga0500562_027472 | |||
| 2959 | Ga0500569_000655 | |||
| 2960 | Ga0500569_022048 | |||
| 2961 | Ga0500569_089516 | |||
| 2962 | Ga0500572_000010 | |||
| 2963 | Ga0500572_000333 | |||
| 2964 | Ga0500572_004350 | |||
| 2965 | Ga0500582_155590 | |||
| 2966 | Ga0500591_075170 | |||
| 2967 | Ga0500592_002487 | |||
| 2968 | Ga0500592_015695 | |||
| 2969 | Ga0500595_000143 | |||
| 2970 | Ga0500595_004985 | |||
| 2971 | Ga0500595_005633 | |||
| 2972 | Ga0500595_007784 | |||
| 2973 | Ga0500595_008041 | |||
| 2974 | Ga0500595_012396 | |||
| 2975 | Ga0500595_052155 | |||
| 2976 | Ga0500607_045996 | |||
| 2977 | Ga0500607_097384 | |||
| 2978 | Ga0500608_000393 | |||
| 2979 | Ga0500614_012695 | |||
| 2980 | Ga0500642_0000058 | |||
| 2981 | Ga0500642_0000703 | |||
| 2982 | Ga0500652_000711 | |||
| 2983 | Ga0500652_140659 | |||
| 2984 | Ga0500655_022180 | |||
| 2985 | Ga0500658_0080186 | |||
| 2986 | Ga0500559_0000366 | |||
| 2987 | Ga0500559_0001403 | |||
| 2988 | Ga0500559_0004662 | |||
| 2989 | Ga0500559_0007008 | |||
| 2990 | Ga0500559_0029053 | |||
| 2991 | Ga0500559_0157801 | |||
| 2992 | Ga0500568_0000603 | |||
| 2993 | Ga0500568_0007229 | |||
| 2994 | Ga0500568_0024624 | |||
| 2995 | Ga0500568_0030896 | |||
| 2996 | Ga0500568_0071299 | |||
| 2997 | Ga0500568_0109911 | |||
| 2998 | Ga0500573_0003825 | |||
| 2999 | Ga0500577_0000616 | |||
| 3000 | Ga0500586_036153 | |||
| 3001 | Ga0500588_0151055 | |||
| 3002 | Ga0500588_0158355 | |||
| 3003 | Ga0500589_194989 | |||
| 3004 | Ga0500590_114939 | |||
| 3005 | Ga0500603_000664 | |||
| 3006 | Ga0500603_009507 | |||
| 3007 | Ga0500603_054625 | |||
| 3008 | Ga0500604_0013483 | |||
| 3009 | Ga0500616_0000069 | |||
| 3010 | Ga0500616_0002365 | |||
| 3011 | Ga0500616_0010971 | |||
| 3012 | Ga0500619_022328 | |||
| 3013 | Ga0500619_090401 | |||
| 3014 | Ga0500620_003266 | |||
| 3015 | Ga0500622_0003891 | |||
| 3016 | Ga0500622_0006990 | |||
| 3017 | Ga0500622_0115937 | |||
| 3018 | Ga0500627_0023382 | |||
| 3019 | Ga0500627_0075119 | |||
| 3020 | Ga0500630_003535 | |||
| 3021 | Ga0500633_0052223 | |||
| 3022 | Ga0500634_0118415 | |||
| 3023 | Ga0500638_006438 | |||
| 3024 | Ga0500638_206743 | |||
| 3025 | Ga0500638_234419 | |||
| 3026 | Ga0500639_000034 | |||
| 3027 | Ga0500639_001800 | |||
| 3028 | Ga0500639_148350 | |||
| 3029 | Ga0500636_0006585 | |||
| 3030 | Ga0500636_0015558 | |||
| 3031 | Ga0500636_0046600 | |||
| 3032 | Ga0500636_0072915 | |||
| 3033 | Ga0500636_0205952 | |||
| 3034 | Ga0500637_0000742 | |||
| 3035 | Ga0500637_0080859 | |||
| 3036 | Ga0500637_0097654 | |||
| 3037 | Ga0500637_0293199 | |||
| 3038 | Ga0500567_177423 | |||
| 3039 | Ga0500576_078959 | |||
| 3040 | Ga0500645_014699 | |||
| 3041 | Ga0500596_002867 | |||
| 3042 | Ga0500596_004222 | |||
| 3043 | Ga0500599_001531 | |||
| 3044 | Ga0500601_000312 | |||
| 3045 | Ga0500601_009495 | |||
| 3046 | Ga0501084_0043628 | |||
| 3047 | Ga0501084_0460317 | |||
| 3048 | Ga0500661_002298 | |||
| 3049 | Ga0500661_007866 | |||
| 3050 | Ga0500661_025072 | |||
| 3051 | Ga0501082_0006469 | |||
| 3052 | Ga0501082_0165372 | |||
| 3053 | Ga0501082_0399895 | |||
| 3054 | Ga0466962_0162410 | |||
| 3055 | Ga0530510_0338280 | |||
| 3056 | 2876810941 | |||
| 3057 | 2507509406 | |||
| 3058 | 2508543448 | |||
| 3059 | 2508698775 | |||
| 3060 | 2511397822 | |||
| 3061 | 2513628257 | |||
| 3062 | 2513637970 | |||
| 3063 | 2513646591 | |||
| 3064 | 2513656639 | |||
| 3065 | 2513672317 | |||
| 3066 | 2513691789 | |||
| 3067 | 2513702035 | |||
| 3068 | 2513717491 | |||
| 3069 | 2513858571 | |||
| 3070 | 2513876398 | |||
| 3071 | 2513917824 | |||
| 3072 | 2514010738 | |||
| 3073 | 2515628984 | |||
| 3074 | 2517102064 | |||
| 3075 | 2517893128 | |||
| 3076 | 2524436496 | |||
| 3077 | 2524466880 | |||
| 3078 | 2524539346 | |||
| 3079 | 2528851504 | |||
| 3080 | 2603858836 | |||
| 3081 | 2617352250 | |||
| 3082 | 2617376527 | |||
| 3083 | 2671117762 | |||
| 3084 | 2723845797 | |||
| 3085 | 2728754636 | |||
| 3086 | 2745077131 | |||
| 3087 | 2793064848 | |||
| 3088 | 2793070002 | |||
| 3089 | 2793077210 | |||
| 3090 | 2805920124 | |||
| 3091 | 2818240216 | |||
| 3092 | 2824604223 | |||
| 3093 | 2824617453 | |||
| 3094 | 2824619773 | |||
| 3095 | 2824629381 | |||
| 3096 | 2824642140 | |||
| 3097 | 2824651175 | |||
| 3098 | 2824660045 | |||
| 3099 | 2824666640 | |||
| 3100 | 2824676999 | |||
| 3101 | 2824683712 | |||
| 3102 | 2824694975 | |||
| 3103 | 2824703619 | |||
| 3104 | 2824712616 | |||
| 3105 | 2824721229 | |||
| 3106 | 2824731268 | |||
| 3107 | 2824739459 | |||
| 3108 | 2824749638 | |||
| 3109 | 2824760192 | |||
| 3110 | 2824767181 | |||
| 3111 | 2824780647 | |||
| 3112 | 2838126605 | |||
| 3113 | 2841947259 | |||
| 3114 | 2841950704 | |||
| 3115 | 2841964392 | |||
| 3116 | 2841967021 | |||
| 3117 | 2841975766 | |||
| 3118 | 2841990133 | |||
| 3119 | 2842039814 | |||
| 3120 | 2842047240 | |||
| 3121 | 2844318327 | |||
| 3122 | 2847935203 | |||
| 3123 | 2847945802 | |||
| 3124 | 2849080057 | |||
| 3125 | 2857510567 | |||
| 3126 | 2857528058 | |||
| 3127 | 2874597500 | |||
| 3128 | 2874609553 | |||
| 3129 | 2874612788 | |||
| 3130 | 2874627835 | |||
| 3131 | 2874636316 | |||
| 3132 | 2874648576 | |||
| 3133 | 2876770796 | |||
| 3134 | 2876777703 | |||
| 3135 | 2876822538 | |||
| 3136 | 2879078111 | |||
| 3137 | 2879089107 | |||
| 3138 | 2879102931 | |||
| 3139 | 2879115669 | |||
| 3140 | 2879134548 | |||
| 3141 | 2879149917 | |||
| 3142 | 2881366649 | |||
| 3143 | 2881669597 | |||
| 3144 | 2885373287 | |||
| 3145 | 2885378309 | |||
| 3146 | 2885390637 | |||
| 3147 | 2885417424 | |||
| 3148 | 2888383263 | |||
| 3149 | 2888394647 | |||
| 3150 | 2888423646 | |||
| 3151 | 2889040638 | |||
| 3152 | 2893068479 | |||
| 3153 | 2903729274 | |||
| 3154 | 2903753062 | |||
| 3155 | 2903775120 | |||
| 3156 | 2904672845 | |||
| 3157 | 2904696537 | |||
| 3158 | 2904703982 | |||
| 3159 | 2904717102 | |||
| 3160 | 2906609430 | |||
| 3161 | 2906617661 | |||
| 3162 | 2906634677 | |||
| 3163 | 2906636792 | |||
| 3164 | 2906645906 | |||
| 3165 | 2906661360 | |||
| 3166 | 2908743521 | |||
| 3167 | 2908760391 | |||
| 3168 | 2908779367 | |||
| 3169 | 2919075457 | |||
| 3170 | 2922367743 | |||
| 3171 | 2922373426 | |||
| 3172 | 2922392353 | |||
| 3173 | 2922395577 | |||
| 3174 | 2922429358 | |||
| 3175 | 2929617173 | |||
| 3176 | 2929626877 | |||
| 3177 | 2932793197 | |||
| 3178 | 2932796445 | |||
| 3179 | 2932808934 | |||
| 3180 | 2932813036 | |||
| 3181 | 2932821113 | |||
| 3182 | 2932836779 | |||
| 3183 | 2933579130 | |||
| 3184 | 2935611709 | |||
| 3185 | 2935621544 | |||
| 3186 | 2935634067 | |||
| 3187 | 2935645477 | |||
| 3188 | 2935651786 | |||
| 3189 | 2935660596 | |||
| 3190 | 2935667595 | |||
| 3191 | 2935681757 | |||
| 3192 | 2935688343 | |||
| 3193 | 2935699026 | |||
| 3194 | 2935706407 | |||
| 3195 | 2935715362 | |||
| 3196 | 2935726074 | |||
| 3197 | 2935734181 | |||
| 3198 | 2935743560 | |||
| 3199 | 2935754403 | |||
| 3200 | 2935768481 | |||
| 3201 | 2935774079 | |||
| 3202 | 2935780601 | |||
| 3203 | 2935789551 | |||
| 3204 | 2935797328 | |||
| 3205 | 2935806598 | |||
| 3206 | 2935813190 | |||
| 3207 | 2935821187 | |||
| 3208 | 2935830843 | |||
| 3209 | 2935840869 | |||
| 3210 | 2935850553 | |||
| 3211 | 2935859791 | |||
| 3212 | 2935869136 | |||
| 3213 | 2935880671 | |||
| 3214 | 2935886646 | |||
| 3215 | 2935914153 | |||
| 3216 | 2935921323 | |||
| 3217 | 2935931658 | |||
| 3218 | 2935940407 | |||
| 3219 | 2935947768 | |||
| 3220 | 2935956691 | |||
| 3221 | 2935965750 | |||
| 3222 | 2935973484 | |||
| 3223 | 2935980907 | |||
| 3224 | 2935990395 | |||
| 3225 | 2936000947 | |||
| 3226 | 2936010189 | |||
| 3227 | 2936014652 | |||
| 3228 | 2936023551 | |||
| 3229 | 2936032579 | |||
| 3230 | 2936043742 | |||
| 3231 | 2936050393 | |||
| 3232 | 2936059115 | |||
| 3233 | 2940560221 | |||
| 3234 | 2941510958 | |||
| 3235 | 2941518342 | |||
| 3236 | 2941527395 | |||
| 3237 | 2941534083 | |||
| 3238 | 2941541000 | |||
| 3239 | 3005479526 | |||
| 3240 | 3005489410 | |||
| 3241 | 3005511828 | |||
| 3242 | 3005588545 | |||
| 3243 | 3005598419 | |||
| 3244 | 3005714110 | |||
| 3245 | 3005721584 | |||
| 3246 | 8006932117 | |||
| 3247 | 8006941613 | |||
| 3248 | 8006967447 | |||
| 3249 | 8006981323 | |||
| 3250 | 8006988073 | |||
| 3251 | 8006996441 | |||
| 3252 | 8016514252 | |||
| 3253 | 8016530441 | |||
| 3254 | 8016535712 | |||
| 3255 | 8016553240 | |||
| 3256 | 8016561618 | |||
| 3257 | 8016578164 | |||
| 3258 | 8016592831 | |||
| 3259 | 8016599456 | |||
| 3260 | 8016611533 | |||
| 3261 | 8016622264 | |||
| 3262 | 8016627631 | |||
| 3263 | 8016631848 | |||
| 3264 | 8017062171 | |||
| 3265 | 8019535438 | |||
| 3266 | 8019544067 | |||
| 3267 | 8019554736 | |||
| 3268 | 8019557533 | |||
| 3269 | 8019567763 | |||
| 3270 | 8019581621 | |||
| 3271 | 8019589256 | |||
| 3272 | 8019601976 | |||
| 3273 | 8019616574 | |||
| 3274 | 8019627290 | |||
| 3275 | 8019635281 | |||
| 3276 | 8019644419 | |||
| 3277 | 8019657456 | |||
| 3278 | 8019663120 | |||
| 3279 | 8019672719 | |||
| 3280 | 8019683442 | |||
| 3281 | 8019689177 | |||
| 3282 | 8055747212 | |||
| 3283 | 8056674557 | |||
| 3284 | 8056685298 | |||
| 3285 | 8056690212 | |||
| 3286 | 8056972687 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qa9-assembly1.cif.gz_A | crystal structure of prb (ph1109 protein redesigned for binding) | 0.9629 | 4 | 140 |
| 2d5a-assembly1.cif.gz_A | hypothetical protein from pyrococcus horikoshii ot3 | 0.9559 | 4 | 140 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.9511 | 6 | 139 |
| 3q9n-assembly1.cif.gz_A | in silico and in vitro co-evolution of a high affinity complementary protein-protein interface | 0.9473 | 4 | 140 |
| 3q9u-assembly1.cif.gz_A | in silico and in vitro co-evolution of a high affinity complementary protein-protein interface | 0.9452 | 4 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9511 | 6 | 139 | 3.40.50.720 |
| 3q9nB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.945 | 4 | 140 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9307 | 6 | 139 | 3.40.50.720 |
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8969 | 19 | 132 | 3.40.50.720 |
| 3q9nB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8914 | 4 | 140 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8KJL4-F1-model_v4 | deleted | 0.9926 | 1 | 140 |
|
| AF-A0A526S3G7-F1-model_v4 | CoA-binding protein | 0.9919 | 1 | 128 |
|
| AF-A0A7W9ZRZ4-F1-model_v4 | CoA-binding domain-containing protein | 0.9914 | 1 | 140 |
|
| AF-A0A2N8B2T8-F1-model_v4 | deleted | 0.991 | 23 | 130 |
|
| AF-A0A292E4Q2-F1-model_v4 | CoA-binding protein | 0.9905 | 1 | 139 |
|