F495177

General Info

Members Datasets Scaffolds Average Seq Length
1644 495 1644 117

Family's Representative Sequence

Representative Sequence 3300025321|Ga0207656_10079040|Ga0207656_100790402
Length 129
Sequence MATVIDRTLRRMAKVRRNVRRAAGERARLSVFRSSKHIYAQVIDDAKGQTLASASSLEKDMRDSLKTGANVEAAKAVGKRLAERASAKGVKQVVFDRGGYLYHGRIKALTDAARAAGLNKNEVVAEPEE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
139 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
143 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
246 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
247 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
251 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
252 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
256 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
257 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
258 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
263 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
264 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
267 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
272 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
290 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
291 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
311 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
312 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
313 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
314 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
315 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
318 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
319 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
328 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
337 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
340 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
341 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
342 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
343 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
344 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
345 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
363 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
366 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
390 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
402 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
403 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
404 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
405 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
406 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
407 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
446 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
459 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
460 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
461 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
462 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
463 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
464 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
465 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
466 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
470 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
473 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
480 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
481 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
482 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
483 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
484 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
489 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
490 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
493 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
494 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
495 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0
Rhizoplane 8.39
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214759678 2209111006 Bacteria 845
2 JGI24739J22299_10144545 3300001989 Bacteria 704
3 JGI24737J22298_10012538 3300001990 Bacteria 2764
4 JGI24743J22301_10003311 3300001991 Bacteria 2536
5 JGI24743J22301_10016767 3300001991 Bacteria 1369
6 JGI24735J21928_10059282 3300002067 Bacteria 1100
7 JGI24750J21931_1003024 3300002070 Bacteria 2016
8 JGI24748J21848_1005402 3300002074 Bacteria 1483
9 JGI24748J21848_1010371 3300002074 Bacteria 1097
10 JGI24738J21930_10126757 3300002075 Bacteria 557
11 JGI24749J21850_1018028 3300002076 Bacteria 996
12 JGI24749J21850_1025735 3300002076 Bacteria 839
13 JGI24744J21845_10004856 3300002077 Bacteria 2780
14 JGI24034J26672_10000759 3300002239 Bacteria 4168
15 JGI24742J22300_10002388 3300002244 Bacteria 3008
16 JGI24751J29686_10018660 3300002459 Bacteria 1435
17 JGI24751J29686_10087860 3300002459 Bacteria 646
18 Ga0006759J45824_1087614 3300003163 Bacteria 802
19 JGI25405J52794_10052991 3300003911 Bacteria 871
20 Ga0058863_11642270 3300004799 Bacteria 615
21 Ga0070658_10012301 3300005327 Bacteria 6871
22 Ga0070658_10028805 3300005327 Bacteria 4459
23 Ga0070658_10372342 3300005327 Bacteria 1224
24 Ga0070658_10860766 3300005327 Bacteria 788
25 Ga0070676_10010331 3300005328 Bacteria 5064
26 Ga0070676_10014395 3300005328 Bacteria 4347
27 Ga0070676_11471820 3300005328 Bacteria 524
28 Ga0070683_100014681 3300005329 Bacteria 6861
29 Ga0070683_100191365 3300005329 Bacteria 1942
30 Ga0070683_100429364 3300005329 Bacteria 1261
31 Ga0070683_100512901 3300005329 Bacteria 1146
32 Ga0070690_100012397 3300005330 Bacteria 5017
33 Ga0070690_100348982 3300005330 Bacteria 1074
34 Ga0070690_100363357 3300005330 Bacteria 1054
35 Ga0070670_100000376 3300005331 Bacteria 37212
36 Ga0070670_100030580 3300005331 Bacteria 4636
37 Ga0070670_100241497 3300005331 Bacteria 1573
38 Ga0070677_10853475 3300005333 Bacteria 523
39 Ga0068869_100003825 3300005334 Bacteria 9286
40 Ga0068869_100548880 3300005334 Bacteria 970
41 Ga0068869_100683405 3300005334 Bacteria 874
42 Ga0068869_100692359 3300005334 Bacteria 868
43 Ga0070666_10004644 3300005335 Bacteria 8386
44 Ga0070666_10054197 3300005335 Bacteria 2705
45 Ga0070680_100005733 3300005336 Bacteria 9421
46 Ga0070680_100008294 3300005336 Bacteria 7948
47 Ga0070680_100082947 3300005336 Bacteria 2647
48 Ga0070680_100528794 3300005336 Bacteria 1010
49 Ga0070680_101981287 3300005336 Bacteria 505
50 Ga0070682_100019629 3300005337 Bacteria 3967
51 Ga0070682_100374571 3300005337 Bacteria 1069
52 Ga0070682_100418421 3300005337 Bacteria 1018
53 Ga0068868_100010801 3300005338 Bacteria 6623
54 Ga0068868_100112498 3300005338 Bacteria 2213
55 Ga0070660_100000686 3300005339 Bacteria 22383
56 Ga0070660_100049574 3300005339 Bacteria 3228
57 Ga0070660_100057227 3300005339 Bacteria 3019
58 Ga0070660_101559261 3300005339 Bacteria 562
59 Ga0070689_100000122 3300005340 Bacteria 44668
60 Ga0070689_100708332 3300005340 Bacteria 879
61 Ga0070691_10000273 3300005341 Bacteria 18063
62 Ga0070691_10182034 3300005341 Bacteria 1094
63 Ga0070691_10346138 3300005341 Bacteria 824
64 Ga0070691_10477143 3300005341 Bacteria 717
65 Ga0070691_10613013 3300005341 Bacteria 644
66 Ga0070687_100037227 3300005343 Bacteria 2430
67 Ga0070687_100075376 3300005343 Bacteria 1824
68 Ga0070687_100108333 3300005343 Bacteria 1568
69 Ga0070661_100000385 3300005344 Bacteria 34633
70 Ga0070661_100175972 3300005344 Bacteria 1627
71 Ga0070661_101821715 3300005344 Bacteria 517
72 Ga0070692_10003072 3300005345 Bacteria 6671
73 Ga0070692_10013137 3300005345 Bacteria 3854
74 Ga0070668_100000440 3300005347 Bacteria 27444
75 Ga0070668_100013602 3300005347 Bacteria 6077
76 Ga0070668_100047834 3300005347 Bacteria 3289
77 Ga0070668_101067461 3300005347 Bacteria 728
78 Ga0070668_101564347 3300005347 Bacteria 604
79 Ga0070668_102145361 3300005347 Bacteria 516
80 Ga0070669_100002082 3300005353 Bacteria 14453
81 Ga0070669_100142900 3300005353 Bacteria 1846
82 Ga0070669_100477873 3300005353 Bacteria 1031
83 Ga0070669_101195644 3300005353 Bacteria 657
84 Ga0070675_100004703 3300005354 Bacteria 10420
85 Ga0070675_100033615 3300005354 Bacteria 4159
86 Ga0070675_100405443 3300005354 Bacteria 1217
87 Ga0070675_101681748 3300005354 Bacteria 586
88 Ga0070671_100001283 3300005355 Bacteria 18858
89 Ga0070671_100026489 3300005355 Bacteria 4765
90 Ga0070674_100000649 3300005356 Bacteria 17518
91 Ga0070674_100005343 3300005356 Bacteria 7407
92 Ga0070674_100625618 3300005356 Bacteria 912
93 Ga0070674_100794434 3300005356 Bacteria 817
94 Ga0070673_100002163 3300005364 Bacteria 11899
95 Ga0070688_100000217 3300005365 Bacteria 30556
96 Ga0070688_100077268 3300005365 Bacteria 2144
97 Ga0070688_100325791 3300005365 Bacteria 1118
98 Ga0070659_100003485 3300005366 Bacteria 11201
99 Ga0070667_100003614 3300005367 Bacteria 13156
100 Ga0070667_100250921 3300005367 Bacteria 1582
101 Ga0070667_100306973 3300005367 Bacteria 1430
102 Ga0070667_100804944 3300005367 Bacteria 872
103 Ga0070703_10013074 3300005406 Bacteria 2353
104 Ga0070703_10246341 3300005406 Bacteria 723
105 Ga0070709_10001353 3300005434 Bacteria 13379
106 Ga0070709_10002316 3300005434 Bacteria 10332
107 Ga0070709_10048001 3300005434 Bacteria 2662
108 Ga0070709_10901984 3300005434 Bacteria 699
109 Ga0070709_10964496 3300005434 Bacteria 677
110 Ga0070709_11005154 3300005434 Bacteria 663
111 Ga0070714_100006925 3300005435 Bacteria 8788
112 Ga0070714_100028686 3300005435 Bacteria 4620
113 Ga0070714_100050142 3300005435 Bacteria 3555
114 Ga0070714_100145434 3300005435 Bacteria 2132
115 Ga0070714_100203275 3300005435 Bacteria 1813
116 Ga0070714_100248615 3300005435 Bacteria 1643
117 Ga0070714_100927664 3300005435 Bacteria 846
118 Ga0070713_100001694 3300005436 Bacteria 14164
119 Ga0070713_100003041 3300005436 Bacteria 11020
120 Ga0070713_100087057 3300005436 Bacteria 2679
121 Ga0070713_100125988 3300005436 Bacteria 2253
122 Ga0070713_100362513 3300005436 Bacteria 1347
123 Ga0070713_101384983 3300005436 Bacteria 682
124 Ga0070710_10003492 3300005437 Bacteria 7449
125 Ga0070710_10005298 3300005437 Bacteria 6115
126 Ga0070710_10042115 3300005437 Bacteria 2523
127 Ga0070710_10355796 3300005437 Bacteria 970
128 Ga0070710_11284353 3300005437 Bacteria 544
129 Ga0070701_10000897 3300005438 Bacteria 10740
130 Ga0070701_10046902 3300005438 Bacteria 2223
131 Ga0070701_10476439 3300005438 Bacteria 806
132 Ga0070701_11034118 3300005438 Bacteria 575
133 Ga0070711_100000834 3300005439 Bacteria 16154
134 Ga0070711_100026258 3300005439 Bacteria 3816
135 Ga0070711_100116502 3300005439 Bacteria 1969
136 Ga0070711_100121489 3300005439 Bacteria 1932
137 Ga0070711_100203885 3300005439 Bacteria 1528
138 Ga0070711_100257509 3300005439 Bacteria 1371
139 Ga0070711_100338886 3300005439 Bacteria 1206
140 Ga0070705_100001475 3300005440 Bacteria 12439
141 Ga0070705_100934968 3300005440 Bacteria 699
142 Ga0070700_100001041 3300005441 Bacteria 13717
143 Ga0070700_100035300 3300005441 Bacteria 3025
144 Ga0070694_100000195 3300005444 Bacteria 32086
145 Ga0070694_100119543 3300005444 Bacteria 1889
146 Ga0070694_101181484 3300005444 Bacteria 641
147 Ga0070694_101259501 3300005444 Bacteria 621
148 Ga0070708_100020902 3300005445 Bacteria 5527
149 Ga0070708_100309032 3300005445 Bacteria 1489
150 Ga0070708_100955872 3300005445 Bacteria 804
151 Ga0070663_100000352 3300005455 Bacteria 24139
152 Ga0070663_100414448 3300005455 Bacteria 1104
153 Ga0070663_100825021 3300005455 Bacteria 796
154 Ga0070663_101672311 3300005455 Bacteria 569
155 Ga0070678_100001146 3300005456 Bacteria 14002
156 Ga0070678_100280065 3300005456 Bacteria 1410
157 Ga0070678_100522757 3300005456 Bacteria 1050
158 Ga0070678_101010011 3300005456 Bacteria 765
159 Ga0070662_100002265 3300005457 Bacteria 11806
160 Ga0070662_101103326 3300005457 Bacteria 681
161 Ga0070681_10066653 3300005458 Bacteria 3569
162 Ga0070681_10485858 3300005458 Bacteria 1148
163 Ga0068867_100674127 3300005459 Bacteria 910
164 Ga0068867_102351000 3300005459 Bacteria 507
165 Ga0070685_10004968 3300005466 Bacteria 6735
166 Ga0070685_10576501 3300005466 Bacteria 806
167 Ga0070685_10875964 3300005466 Bacteria 667
168 Ga0070706_100299185 3300005467 Bacteria 1501
169 Ga0070706_100352764 3300005467 Bacteria 1371
170 Ga0070707_100065999 3300005468 Bacteria 3477
171 Ga0070707_101182211 3300005468 Bacteria 731
172 Ga0070698_100141794 3300005471 Bacteria 2354
173 Ga0070698_100520905 3300005471 Bacteria 1127
174 Ga0070699_100014494 3300005518 Bacteria 6779
175 Ga0070699_100050437 3300005518 Bacteria 3603
176 Ga0070699_100076224 3300005518 Bacteria 2919
177 Ga0070679_100074568 3300005530 Bacteria 3384
178 Ga0070679_100116188 3300005530 Bacteria 2660
179 Ga0070679_100200073 3300005530 Bacteria 1964
180 Ga0070679_100366118 3300005530 Bacteria 1389
181 Ga0070679_102061390 3300005530 Bacteria 520
182 Ga0070684_100102300 3300005535 Bacteria 2561
183 Ga0070684_100576104 3300005535 Bacteria 1045
184 Ga0070684_100744672 3300005535 Bacteria 915
185 Ga0070697_100000391 3300005536 Bacteria 34002
186 Ga0070697_101795161 3300005536 Bacteria 549
187 Ga0068853_100001082 3300005539 Bacteria 19264
188 Ga0068853_100030559 3300005539 Bacteria 4551
189 Ga0070672_100002807 3300005543 Bacteria 11158
190 Ga0070672_100329507 3300005543 Bacteria 1299
191 Ga0070686_100001391 3300005544 Bacteria 13661
192 Ga0070686_100031187 3300005544 Bacteria 3257
193 Ga0070686_100628828 3300005544 Bacteria 849
194 Ga0070695_100000238 3300005545 Bacteria 27265
195 Ga0070695_100521562 3300005545 Bacteria 922
196 Ga0070695_100789888 3300005545 Bacteria 760
197 Ga0070696_100000815 3300005546 Bacteria 20059
198 Ga0070696_100213690 3300005546 Bacteria 1445
199 Ga0070693_100000455 3300005547 Bacteria 18375
200 Ga0070693_100066674 3300005547 Bacteria 2107
201 Ga0070693_100395544 3300005547 Bacteria 957
202 Ga0070665_100008997 3300005548 Bacteria 10112
203 Ga0070665_100414654 3300005548 Bacteria 1355
204 Ga0070665_101749622 3300005548 Bacteria 628
205 Ga0070704_100000124 3300005549 Bacteria 27978
206 Ga0070704_100057511 3300005549 Bacteria 2765
207 Ga0070704_100143127 3300005549 Bacteria 1870
208 Ga0070704_101148947 3300005549 Bacteria 707
209 Ga0068855_100002691 3300005563 Bacteria 21916
210 Ga0068855_100027910 3300005563 Bacteria 6751
211 Ga0068855_100030257 3300005563 Bacteria 6476
212 Ga0068855_100193954 3300005563 Bacteria 2289
213 Ga0068855_102039326 3300005563 Bacteria 579
214 Ga0070664_100002450 3300005564 Bacteria 14942
215 Ga0070664_100710964 3300005564 Bacteria 936
216 Ga0068857_100003648 3300005577 Bacteria 12905
217 Ga0068857_100704236 3300005577 Bacteria 960
218 Ga0068857_101434846 3300005577 Bacteria 672
219 Ga0068854_100004862 3300005578 Bacteria 8473
220 Ga0068854_100056166 3300005578 Bacteria 2837
221 Ga0068854_100177557 3300005578 Bacteria 1661
222 Ga0068856_100005122 3300005614 Bacteria 12946
223 Ga0068856_100484785 3300005614 Bacteria 1257
224 Ga0068856_100561745 3300005614 Bacteria 1162
225 Ga0068856_100664381 3300005614 Bacteria 1063
226 Ga0070702_100000018 3300005615 Bacteria 47204
227 Ga0070702_100100454 3300005615 Bacteria 1773
228 Ga0070702_100100819 3300005615 Bacteria 1770
229 Ga0070702_100108879 3300005615 Bacteria 1714
230 Ga0070702_100132523 3300005615 Bacteria 1576
231 Ga0070702_101185794 3300005615 Bacteria 615
232 Ga0068852_100055001 3300005616 Bacteria 3433
233 Ga0068852_100383315 3300005616 Bacteria 1379
234 Ga0068852_100544806 3300005616 Bacteria 1160
235 Ga0068852_101860426 3300005616 Bacteria 624
236 Ga0068852_101992423 3300005616 Bacteria 603
237 Ga0068859_100052965 3300005617 Bacteria 4081
238 Ga0068859_100139311 3300005617 Bacteria 2500
239 Ga0068859_100646451 3300005617 Bacteria 1150
240 Ga0068864_100002243 3300005618 Bacteria 15978
241 Ga0068864_100252941 3300005618 Bacteria 1636
242 Ga0068864_100403825 3300005618 Bacteria 1299
243 Ga0068864_100458100 3300005618 Bacteria 1221
244 Ga0068864_100683251 3300005618 Bacteria 1001
245 Ga0068866_10149516 3300005718 Bacteria 1351
246 Ga0068866_10236436 3300005718 Bacteria 1110
247 Ga0068861_100000942 3300005719 Bacteria 17675
248 Ga0068861_100078234 3300005719 Bacteria 2582
249 Ga0068861_101526931 3300005719 Bacteria 656
250 Ga0068851_10041001 3300005834 Bacteria 2328
251 Ga0068851_10044010 3300005834 Bacteria 2252
252 Ga0068870_10015701 3300005840 Bacteria 3600
253 Ga0068870_10069787 3300005840 Bacteria 1913
254 Ga0068863_100007947 3300005841 Bacteria 10367
255 Ga0068863_100064525 3300005841 Bacteria 3463
256 Ga0068863_100235960 3300005841 Bacteria 1765
257 Ga0068863_100475637 3300005841 Bacteria 1228
258 Ga0068863_101026517 3300005841 Bacteria 828
259 Ga0068863_102402119 3300005841 Bacteria 537
260 Ga0068858_100016672 3300005842 Bacteria 6898
261 Ga0068858_100034173 3300005842 Bacteria 4716
262 Ga0068858_100129047 3300005842 Bacteria 2369
263 Ga0068858_100907586 3300005842 Bacteria 861
264 Ga0068860_100000598 3300005843 Bacteria 43069
265 Ga0068860_100051012 3300005843 Bacteria 3938
266 Ga0068860_100067934 3300005843 Bacteria 3386
267 Ga0068860_101222857 3300005843 Bacteria 772
268 Ga0068860_101297423 3300005843 Bacteria 749
269 Ga0068860_101982194 3300005843 Bacteria 604
270 Ga0068862_100002944 3300005844 Bacteria 14884
271 Ga0068862_100066335 3300005844 Bacteria 3110
272 Ga0068862_101108388 3300005844 Bacteria 787
273 Ga0081455_10002425 3300005937 Bacteria 22245
274 Ga0081455_10014358 3300005937 Bacteria 7770
275 Ga0081455_10042010 3300005937 Bacteria 4016
276 Ga0081455_10075517 3300005937 Bacteria 2780
277 Ga0081455_10744669 3300005937 Bacteria 620
278 Ga0081538_10010008 3300005981 Bacteria 7819
279 Ga0081538_10036355 3300005981 Bacteria 3215
280 Ga0081540_1004248 3300005983 Bacteria 10995
281 Ga0081540_1008438 3300005983 Bacteria 7199
282 Ga0081540_1029521 3300005983 Bacteria 3053
283 Ga0081540_1089269 3300005983 Bacteria 1360
284 Ga0070717_10003669 3300006028 Bacteria 11020
285 Ga0070717_10026162 3300006028 Bacteria 4652
286 Ga0070717_10208855 3300006028 Bacteria 1713
287 Ga0070717_10448226 3300006028 Bacteria 1163
288 Ga0070717_11080427 3300006028 Bacteria 731
289 Ga0070717_11779412 3300006028 Bacteria 557
290 Ga0075365_10017964 3300006038 Bacteria 4339
291 Ga0075365_10150283 3300006038 Bacteria 1620
292 Ga0075365_10176373 3300006038 Bacteria 1493
293 Ga0075365_10347537 3300006038 Bacteria 1045
294 Ga0075365_10557272 3300006038 Bacteria 811
295 Ga0075368_10015066 3300006042 Bacteria 2862
296 Ga0075363_100002116 3300006048 Bacteria 7965
297 Ga0075363_100007498 3300006048 Bacteria 5023
298 Ga0075364_10006710 3300006051 Bacteria 6786
299 Ga0075364_10053651 3300006051 Bacteria 2635
300 Ga0075364_10126537 3300006051 Bacteria 1713
301 Ga0075364_10137627 3300006051 Bacteria 1641
302 Ga0075364_10786752 3300006051 Bacteria 649
303 Ga0075432_10000910 3300006058 Bacteria 9311
304 Ga0075432_10021478 3300006058 Bacteria 2207
305 Ga0075432_10329864 3300006058 Bacteria 641
306 Ga0070715_10003461 3300006163 Bacteria 5024
307 Ga0070715_10004143 3300006163 Bacteria 4717
308 Ga0070715_10018779 3300006163 Bacteria 2641
309 Ga0070716_100001603 3300006173 Bacteria 10188
310 Ga0070716_100018351 3300006173 Bacteria 3643
311 Ga0070716_100255800 3300006173 Bacteria 1196
312 Ga0070716_100769228 3300006173 Bacteria 743
313 Ga0070712_100006185 3300006175 Bacteria 7408
314 Ga0070712_100006515 3300006175 Bacteria 7246
315 Ga0070712_100020063 3300006175 Bacteria 4369
316 Ga0070712_100082405 3300006175 Bacteria 2333
317 Ga0070712_100083256 3300006175 Bacteria 2323
318 Ga0070712_100143172 3300006175 Bacteria 1827
319 Ga0070712_100155352 3300006175 Bacteria 1761
320 Ga0070712_100358838 3300006175 Bacteria 1195
321 Ga0070712_100708397 3300006175 Bacteria 859
322 Ga0070712_100759772 3300006175 Bacteria 830
323 Ga0070712_100882228 3300006175 Bacteria 770
324 Ga0075362_10009142 3300006177 Bacteria 3818
325 Ga0075362_10011880 3300006177 Bacteria 3442
326 Ga0075362_10028490 3300006177 Bacteria 2399
327 Ga0075362_10265470 3300006177 Bacteria 847
328 Ga0075367_10030148 3300006178 Bacteria 3108
329 Ga0075367_10095154 3300006178 Bacteria 1816
330 Ga0075367_10613541 3300006178 Bacteria 691
331 Ga0075369_10003443 3300006186 Bacteria 5763
332 Ga0075369_10030362 3300006186 Bacteria 2276
333 Ga0075369_10142902 3300006186 Bacteria 1092
334 Ga0075427_10000879 3300006194 Bacteria 3701
335 Ga0075366_10010619 3300006195 Bacteria 5172
336 Ga0075366_10104526 3300006195 Bacteria 1701
337 Ga0097621_100091426 3300006237 Bacteria 2547
338 Ga0097621_100135968 3300006237 Bacteria 2097
339 Ga0097621_100463131 3300006237 Bacteria 1144
340 Ga0097621_100847747 3300006237 Bacteria 849
341 Ga0097621_101103082 3300006237 Bacteria 745
342 Ga0075370_10233079 3300006353 Bacteria 1089
343 Ga0075370_10447832 3300006353 Bacteria 777
344 Ga0068871_100316253 3300006358 Bacteria 1373
345 Ga0068871_100571276 3300006358 Bacteria 1026
346 Ga0068871_100587366 3300006358 Bacteria 1012
347 Ga0068871_100662154 3300006358 Bacteria 954
348 Ga0068871_101353061 3300006358 Bacteria 670
349 Ga0075428_100006364 3300006844 Bacteria 13140
350 Ga0075428_100055506 3300006844 Bacteria 4340
351 Ga0075428_100069496 3300006844 Bacteria 3850
352 Ga0075428_100084565 3300006844 Bacteria 3462
353 Ga0075428_100091938 3300006844 Bacteria 3308
354 Ga0075428_100131245 3300006844 Bacteria 2725
355 Ga0075428_100553409 3300006844 Bacteria 1230
356 Ga0075428_100917605 3300006844 Bacteria 929
357 Ga0075428_101391609 3300006844 Bacteria 736
358 Ga0075428_101524373 3300006844 Bacteria 700
359 Ga0075428_102192616 3300006844 Bacteria 570
360 Ga0075430_100000196 3300006846 Bacteria 40930
361 Ga0075430_100133466 3300006846 Bacteria 2069
362 Ga0075430_100301325 3300006846 Bacteria 1326
363 Ga0075430_100365144 3300006846 Bacteria 1192
364 Ga0075430_100392591 3300006846 Bacteria 1145
365 Ga0075430_101574710 3300006846 Bacteria 540
366 Ga0075431_100001183 3300006847 Bacteria 23547
367 Ga0075431_100003503 3300006847 Bacteria 15211
368 Ga0075431_100040605 3300006847 Bacteria 4796
369 Ga0075431_100117861 3300006847 Bacteria 2740
370 Ga0075433_10000991 3300006852 Bacteria 20176
371 Ga0075433_10040008 3300006852 Bacteria 4056
372 Ga0075433_10102267 3300006852 Bacteria 2537
373 Ga0075433_10268366 3300006852 Bacteria 1512
374 Ga0075433_10955918 3300006852 Bacteria 747
375 Ga0075434_100006955 3300006871 Bacteria 10427
376 Ga0075434_100063778 3300006871 Bacteria 3667
377 Ga0075434_100069351 3300006871 Bacteria 3515
378 Ga0075434_100153740 3300006871 Bacteria 2321
379 Ga0075434_100155737 3300006871 Bacteria 2304
380 Ga0075434_100185510 3300006871 Bacteria 2101
381 Ga0075434_100234300 3300006871 Bacteria 1856
382 Ga0075434_101405985 3300006871 Bacteria 708
383 Ga0075434_101708911 3300006871 Bacteria 637
384 Ga0075429_100000573 3300006880 Bacteria 28269
385 Ga0075429_100041550 3300006880 Bacteria 4005
386 Ga0075429_100119198 3300006880 Bacteria 2306
387 Ga0075429_100243267 3300006880 Bacteria 1576
388 Ga0068865_100005623 3300006881 Bacteria 7609
389 Ga0068865_100179744 3300006881 Bacteria 1628
390 Ga0068865_100403629 3300006881 Bacteria 1120
391 Ga0068865_100673291 3300006881 Bacteria 881
392 Ga0075436_100002180 3300006914 Bacteria 13503
393 Ga0075436_100547121 3300006914 Bacteria 849
394 Ga0097620_100052965 3300006931 Bacteria 4081
395 Ga0097620_100139316 3300006931 Bacteria 2500
396 Ga0097620_100646462 3300006931 Bacteria 1150
397 Ga0075435_100032313 3300007076 Bacteria 4132
398 Ga0075435_100038516 3300007076 Bacteria 3811
399 Ga0075435_100069144 3300007076 Bacteria 2878
400 Ga0075435_100100047 3300007076 Bacteria 2402
401 Ga0075435_100540609 3300007076 Bacteria 1009
402 Ga0075435_101428083 3300007076 Bacteria 606
403 Ga0099794_10176997 3300007265 Bacteria 1088
404 Ga0099795_10003497 3300007788 Bacteria 3897
405 Ga0099795_10085234 3300007788 Bacteria 1215
406 Ga0099795_10118325 3300007788 Bacteria 1057
407 Ga0099795_10122138 3300007788 Bacteria 1042
408 Ga0105251_10187889 3300009011 Bacteria 930
409 Ga0105251_10330457 3300009011 Bacteria 694
410 Ga0105250_10050115 3300009092 Bacteria 1675
411 Ga0105240_10015848 3300009093 Bacteria 10226
412 Ga0105240_10039464 3300009093 Bacteria 6047
413 Ga0105240_10960624 3300009093 Bacteria 916
414 Ga0111539_10000683 3300009094 Bacteria 43914
415 Ga0111539_10041411 3300009094 Bacteria 5538
416 Ga0111539_10140413 3300009094 Bacteria 2828
417 Ga0111539_10234018 3300009094 Bacteria 2139
418 Ga0111539_10274886 3300009094 Bacteria 1960
419 Ga0111539_10483254 3300009094 Bacteria 1442
420 Ga0111539_11156146 3300009094 Bacteria 899
421 Ga0111539_11222761 3300009094 Bacteria 872
422 Ga0111539_11629432 3300009094 Bacteria 748
423 Ga0111539_11912337 3300009094 Bacteria 688
424 Ga0105245_10000718 3300009098 Bacteria 29853
425 Ga0105245_10150129 3300009098 Bacteria 2203
426 Ga0105245_11157887 3300009098 Bacteria 820
427 Ga0105247_10001104 3300009101 Bacteria 20096
428 Ga0105247_10005639 3300009101 Bacteria 7852
429 Ga0105247_10009289 3300009101 Bacteria 5972
430 Ga0114129_10005890 3300009147 Bacteria 17359
431 Ga0114129_10008352 3300009147 Bacteria 14760
432 Ga0114129_10051465 3300009147 Bacteria 5782
433 Ga0114129_10055672 3300009147 Bacteria 5542
434 Ga0114129_10056000 3300009147 Bacteria 5525
435 Ga0114129_10093675 3300009147 Bacteria 4161
436 Ga0114129_10269051 3300009147 Bacteria 2281
437 Ga0114129_10324925 3300009147 Bacteria 2044
438 Ga0114129_10358846 3300009147 Bacteria 1929
439 Ga0114129_10593186 3300009147 Bacteria 1436
440 Ga0114129_10751109 3300009147 Bacteria 1249
441 Ga0114129_12501117 3300009147 Bacteria 617
442 Ga0105243_10001752 3300009148 Bacteria 18680
443 Ga0105243_10013879 3300009148 Bacteria 6099
444 Ga0105243_10239071 3300009148 Bacteria 1615
445 Ga0105243_10643693 3300009148 Bacteria 1026
446 Ga0105243_12578077 3300009148 Bacteria 548
447 Ga0105241_10003357 3300009174 Bacteria 11919
448 Ga0105241_10041206 3300009174 Bacteria 3488
449 Ga0105241_10107361 3300009174 Bacteria 2230
450 Ga0105241_11165184 3300009174 Bacteria 728
451 Ga0105242_10004159 3300009176 Bacteria 11268
452 Ga0105242_10171628 3300009176 Bacteria 1906
453 Ga0105248_10002832 3300009177 Bacteria 19248
454 Ga0105248_10049856 3300009177 Bacteria 4694
455 Ga0105248_10152794 3300009177 Bacteria 2604
456 Ga0105237_10001618 3300009545 Bacteria 29243
457 Ga0105237_10205484 3300009545 Bacteria 1970
458 Ga0105237_11178663 3300009545 Bacteria 773
459 Ga0105237_11265400 3300009545 Bacteria 744
460 Ga0105238_10068253 3300009551 Bacteria 3557
461 Ga0105238_10315729 3300009551 Bacteria 1548
462 Ga0105238_10808005 3300009551 Bacteria 954
463 Ga0105238_11380623 3300009551 Bacteria 731
464 Ga0105238_11495410 3300009551 Bacteria 704
465 Ga0105238_11711467 3300009551 Bacteria 660
466 Ga0105249_10002122 3300009553 Bacteria 17209
467 Ga0105249_10019915 3300009553 Bacteria 5991
468 Ga0105249_10207100 3300009553 Bacteria 1922
469 Ga0105030_105473 3300009987 Bacteria 1074
470 Ga0099796_10007209 3300010159 Bacteria 2896
471 Ga0105239_10002536 3300010375 Bacteria 23214
472 Ga0105239_10686464 3300010375 Bacteria 1170
473 Ga0105239_10952171 3300010375 Bacteria 986
474 Ga0105239_11182797 3300010375 Bacteria 881
475 Ga0105246_10002439 3300011119 Bacteria 11222
476 Ga0105246_10539117 3300011119 Bacteria 998
477 Ga0105246_10672572 3300011119 Bacteria 904
478 Ga0105246_10996248 3300011119 Bacteria 758
479 Ga0157337_1036464 3300012483 Bacteria 526
480 Ga0157338_1018783 3300012515 Bacteria 786
481 Ga0157373_11025399 3300013100 Bacteria 617
482 Ga0157371_10008731 3300013102 Bacteria 8043
483 Ga0157371_10182572 3300013102 Bacteria 1501
484 Ga0157371_10324711 3300013102 Bacteria 1117
485 Ga0157370_10011636 3300013104 Bacteria 9184
486 Ga0157370_10234537 3300013104 Bacteria 1698
487 Ga0157370_10494637 3300013104 Bacteria 1123
488 Ga0157370_10643449 3300013104 Bacteria 969
489 Ga0157369_10001227 3300013105 Bacteria 31941
490 Ga0157369_10077891 3300013105 Bacteria 3553
491 Ga0157369_10129027 3300013105 Bacteria 2680
492 Ga0157369_10444632 3300013105 Bacteria 1342
493 Ga0157374_10019573 3300013296 Bacteria 5992
494 Ga0157374_10237035 3300013296 Bacteria 1793
495 Ga0157374_11774222 3300013296 Bacteria 642
496 Ga0157374_12545409 3300013296 Bacteria 539
497 Ga0157378_10000470 3300013297 Bacteria 38483
498 Ga0157378_10160004 3300013297 Bacteria 2105
499 Ga0157378_10222004 3300013297 Bacteria 1797
500 Ga0157378_10264832 3300013297 Bacteria 1651
501 Ga0157378_13255051 3300013297 Bacteria 505
502 Ga0163162_10010877 3300013306 Bacteria 8856
503 Ga0163162_10526980 3300013306 Bacteria 1311
504 Ga0163162_11148476 3300013306 Bacteria 881
505 Ga0157372_10001215 3300013307 Bacteria 27865
506 Ga0157372_11744327 3300013307 Bacteria 716
507 Ga0157372_11844582 3300013307 Bacteria 695
508 Ga0157375_10001640 3300013308 Bacteria 19249
509 Ga0157375_10007439 3300013308 Bacteria 9585
510 Ga0157375_10150710 3300013308 Bacteria 2461
511 Ga0157375_10326790 3300013308 Bacteria 1698
512 Ga0163163_10005311 3300014325 Bacteria 11124
513 Ga0163163_10020116 3300014325 Bacteria 6282
514 Ga0163163_10024251 3300014325 Bacteria 5772
515 Ga0163163_10072150 3300014325 Bacteria 3442
516 Ga0163163_11312134 3300014325 Bacteria 786
517 Ga0163163_12749307 3300014325 Bacteria 549
518 Ga0157380_10037923 3300014326 Bacteria 3739
519 Ga0157380_12349138 3300014326 Bacteria 598
520 Ga0157377_10001529 3300014745 Bacteria 10047
521 Ga0157377_10001603 3300014745 Bacteria 9842
522 Ga0157377_11143448 3300014745 Bacteria 599
523 Ga0157379_10001927 3300014968 Bacteria 17169
524 Ga0157379_10054921 3300014968 Bacteria 3559
525 Ga0157379_10089976 3300014968 Bacteria 2753
526 Ga0157379_10221483 3300014968 Bacteria 1714
527 Ga0157379_10901122 3300014968 Bacteria 839
528 Ga0157376_10013610 3300014969 Bacteria 6077
529 Ga0157376_10066977 3300014969 Bacteria 3036
530 Ga0157376_10138607 3300014969 Bacteria 2180
531 Ga0157376_10243836 3300014969 Bacteria 1675
532 Ga0157376_10271221 3300014969 Bacteria 1594
533 Ga0163161_10005439 3300017792 Bacteria 8844
534 Ga0163161_10008942 3300017792 Bacteria 6925
535 Ga0163161_10517706 3300017792 Bacteria 974
536 Ga0163161_10689052 3300017792 Bacteria 850
537 Ga0163161_10989844 3300017792 Bacteria 717
538 Ga0206356_10060013 3300020070 Bacteria 2571
539 Ga0206353_10187901 3300020082 Bacteria 576
540 Ga0206353_10221297 3300020082 Bacteria 873
541 Ga0206353_11955118 3300020082 Bacteria 1129
542 Ga0213872_10047148 3300021361 Bacteria 1960
543 Ga0213872_10282788 3300021361 Bacteria 692
544 Ga0213876_10164987 3300021384 Bacteria 1178
545 Ga0213876_10280961 3300021384 Bacteria 885
546 Ga0207697_10150474 3300025315 Bacteria 1012
547 Ga0207656_10031281 3300025321 Bacteria 2204
548 Ga0207656_10079040 3300025321 Bacteria 1475
549 Ga0207653_10015755 3300025885 Bacteria 2373
550 Ga0207653_10097229 3300025885 Bacteria 1037
551 Ga0207692_10008689 3300025898 Bacteria 4215
552 Ga0207692_10019276 3300025898 Bacteria 3080
553 Ga0207692_10228836 3300025898 Bacteria 1105
554 Ga0207692_10391819 3300025898 Bacteria 864
555 Ga0207692_10455847 3300025898 Bacteria 806
556 Ga0207692_10643785 3300025898 Bacteria 684
557 Ga0207642_10043170 3300025899 Bacteria 1987
558 Ga0207710_10002653 3300025900 Bacteria 8248
559 Ga0207710_10028106 3300025900 Bacteria 2440
560 Ga0207710_10056175 3300025900 Bacteria 1776
561 Ga0207688_10002321 3300025901 Bacteria 10228
562 Ga0207688_10002614 3300025901 Bacteria 9749
563 Ga0207680_10023670 3300025903 Bacteria 3358
564 Ga0207680_10782634 3300025903 Bacteria 684
565 Ga0207647_10001458 3300025904 Bacteria 18183
566 Ga0207647_10014266 3300025904 Bacteria 5483
567 Ga0207685_10000290 3300025905 Bacteria 7986
568 Ga0207685_10240862 3300025905 Bacteria 870
569 Ga0207685_10249876 3300025905 Bacteria 857
570 Ga0207699_10002558 3300025906 Bacteria 8581
571 Ga0207699_10625272 3300025906 Bacteria 785
572 Ga0207699_10805405 3300025906 Bacteria 691
573 Ga0207699_11326644 3300025906 Bacteria 532
574 Ga0207645_10011689 3300025907 Bacteria 5985
575 Ga0207645_10016093 3300025907 Bacteria 4952
576 Ga0207643_10002622 3300025908 Bacteria 9735
577 Ga0207643_10142261 3300025908 Bacteria 1433
578 Ga0207643_10238621 3300025908 Bacteria 1117
579 Ga0207705_10005544 3300025909 Bacteria 9436
580 Ga0207705_10024761 3300025909 Bacteria 4283
581 Ga0207705_10040855 3300025909 Bacteria 3327
582 Ga0207705_10291800 3300025909 Bacteria 1250
583 Ga0207705_10994375 3300025909 Bacteria 648
584 Ga0207684_10040904 3300025910 Bacteria 3930
585 Ga0207684_10050801 3300025910 Bacteria 3518
586 Ga0207654_10050857 3300025911 Bacteria 2383
587 Ga0207707_10009792 3300025912 Bacteria 8311
588 Ga0207707_10194309 3300025912 Bacteria 1770
589 Ga0207707_10452187 3300025912 Bacteria 1099
590 Ga0207707_11178404 3300025912 Bacteria 621
591 Ga0207695_10012684 3300025913 Bacteria 10093
592 Ga0207695_10136830 3300025913 Bacteria 2402
593 Ga0207693_10000493 3300025915 Bacteria 35669
594 Ga0207693_10004694 3300025915 Bacteria 11503
595 Ga0207693_10004752 3300025915 Bacteria 11421
596 Ga0207693_10065973 3300025915 Bacteria 2834
597 Ga0207693_10074134 3300025915 Bacteria 2665
598 Ga0207693_10106487 3300025915 Bacteria 2199
599 Ga0207693_10299198 3300025915 Bacteria 1260
600 Ga0207693_10315032 3300025915 Bacteria 1225
601 Ga0207693_10494694 3300025915 Bacteria 955
602 Ga0207693_10497169 3300025915 Bacteria 952
603 Ga0207693_10615830 3300025915 Bacteria 845
604 Ga0207663_10005514 3300025916 Bacteria 6381
605 Ga0207663_10048237 3300025916 Bacteria 2634
606 Ga0207663_10049634 3300025916 Bacteria 2604
607 Ga0207663_10120602 3300025916 Bacteria 1795
608 Ga0207663_10169979 3300025916 Bacteria 1547
609 Ga0207663_10203262 3300025916 Bacteria 1430
610 Ga0207663_10403581 3300025916 Bacteria 1046
611 Ga0207660_10071001 3300025917 Bacteria 2532
612 Ga0207660_10073946 3300025917 Bacteria 2486
613 Ga0207660_10109315 3300025917 Bacteria 2078
614 Ga0207660_10266788 3300025917 Bacteria 1355
615 Ga0207660_10799462 3300025917 Bacteria 770
616 Ga0207660_10930916 3300025917 Bacteria 709
617 Ga0207660_11193394 3300025917 Bacteria 619
618 Ga0207662_10002711 3300025918 Bacteria 8937
619 Ga0207662_10034508 3300025918 Bacteria 2952
620 Ga0207662_10225742 3300025918 Bacteria 1221
621 Ga0207657_10000282 3300025919 Bacteria 54101
622 Ga0207657_10023849 3300025919 Bacteria 5685
623 Ga0207649_10001010 3300025920 Bacteria 17375
624 Ga0207649_10472851 3300025920 Bacteria 949
625 Ga0207649_11622124 3300025920 Bacteria 512
626 Ga0207652_10013408 3300025921 Bacteria 6634
627 Ga0207652_10237592 3300025921 Bacteria 1642
628 Ga0207652_10259630 3300025921 Bacteria 1567
629 Ga0207652_10342562 3300025921 Bacteria 1349
630 Ga0207652_11037422 3300025921 Bacteria 719
631 Ga0207652_11153368 3300025921 Bacteria 676
632 Ga0207646_10283451 3300025922 Bacteria 1497
633 Ga0207646_10746081 3300025922 Bacteria 874
634 Ga0207681_10020922 3300025923 Bacteria 4152
635 Ga0207681_10029567 3300025923 Bacteria 3561
636 Ga0207681_10404259 3300025923 Bacteria 1104
637 Ga0207694_10030650 3300025924 Bacteria 4107
638 Ga0207694_10198859 3300025924 Bacteria 1630
639 Ga0207694_10231602 3300025924 Bacteria 1509
640 Ga0207694_11094085 3300025924 Bacteria 674
641 Ga0207694_11231220 3300025924 Bacteria 633
642 Ga0207650_10012017 3300025925 Bacteria 5967
643 Ga0207650_10014747 3300025925 Bacteria 5433
644 Ga0207650_10803324 3300025925 Bacteria 797
645 Ga0207659_10090636 3300025926 Bacteria 2282
646 Ga0207659_10184311 3300025926 Bacteria 1656
647 Ga0207659_11260496 3300025926 Bacteria 635
648 Ga0207687_10022775 3300025927 Bacteria 4172
649 Ga0207687_10084329 3300025927 Bacteria 2303
650 Ga0207700_10009359 3300025928 Bacteria 6115
651 Ga0207700_10085165 3300025928 Bacteria 2480
652 Ga0207700_10110505 3300025928 Bacteria 2211
653 Ga0207700_10209760 3300025928 Bacteria 1646
654 Ga0207700_10538468 3300025928 Bacteria 1035
655 Ga0207700_11111194 3300025928 Bacteria 707
656 Ga0207664_10032209 3300025929 Bacteria 4017
657 Ga0207664_10032967 3300025929 Bacteria 3975
658 Ga0207664_10391707 3300025929 Bacteria 1234
659 Ga0207664_10900364 3300025929 Bacteria 794
660 Ga0207644_10017754 3300025931 Bacteria 4810
661 Ga0207644_10240700 3300025931 Bacteria 1441
662 Ga0207690_10013638 3300025932 Bacteria 4888
663 Ga0207690_10033103 3300025932 Bacteria 3321
664 Ga0207690_11013553 3300025932 Bacteria 691
665 Ga0207690_11526077 3300025932 Bacteria 558
666 Ga0207706_10000270 3300025933 Bacteria 56584
667 Ga0207706_10002966 3300025933 Bacteria 16372
668 Ga0207706_10610389 3300025933 Bacteria 936
669 Ga0207686_10029250 3300025934 Bacteria 3248
670 Ga0207686_10061736 3300025934 Bacteria 2377
671 Ga0207686_10120517 3300025934 Bacteria 1785
672 Ga0207709_10003044 3300025935 Bacteria 10157
673 Ga0207709_10044613 3300025935 Bacteria 2680
674 Ga0207709_10772963 3300025935 Bacteria 774
675 Ga0207709_11163088 3300025935 Bacteria 635
676 Ga0207670_10014460 3300025936 Bacteria 4685
677 Ga0207670_10073263 3300025936 Bacteria 2374
678 Ga0207670_10794669 3300025936 Bacteria 788
679 Ga0207669_10005870 3300025937 Bacteria 5552
680 Ga0207669_10014807 3300025937 Bacteria 3918
681 Ga0207669_10186680 3300025937 Bacteria 1491
682 Ga0207669_10476584 3300025937 Bacteria 994
683 Ga0207669_10867338 3300025937 Bacteria 752
684 Ga0207669_11633935 3300025937 Bacteria 550
685 Ga0207704_10016350 3300025938 Bacteria 3811
686 Ga0207704_10069539 3300025938 Bacteria 2225
687 Ga0207704_10183570 3300025938 Bacteria 1514
688 Ga0207704_11842970 3300025938 Bacteria 520
689 Ga0207665_10001538 3300025939 Bacteria 15513
690 Ga0207665_10006468 3300025939 Bacteria 7773
691 Ga0207665_10106545 3300025939 Bacteria 1964
692 Ga0207665_10303651 3300025939 Bacteria 1194
693 Ga0207665_10522790 3300025939 Bacteria 919
694 Ga0207691_10010501 3300025940 Bacteria 8885
695 Ga0207691_10023983 3300025940 Bacteria 5739
696 Ga0207691_10488293 3300025940 Bacteria 1046
697 Ga0207711_10013882 3300025941 Bacteria 6690
698 Ga0207711_10062779 3300025941 Bacteria 3205
699 Ga0207711_10202865 3300025941 Bacteria 1810
700 Ga0207689_10006518 3300025942 Bacteria 10303
701 Ga0207689_10436683 3300025942 Bacteria 1093
702 Ga0207661_10038656 3300025944 Bacteria 3742
703 Ga0207661_10063827 3300025944 Bacteria 2984
704 Ga0207661_10298682 3300025944 Bacteria 1443
705 Ga0207679_10020167 3300025945 Bacteria 4495
706 Ga0207679_10100954 3300025945 Bacteria 2256
707 Ga0207667_10004001 3300025949 Bacteria 18104
708 Ga0207667_10010619 3300025949 Bacteria 10752
709 Ga0207667_10248836 3300025949 Bacteria 1818
710 Ga0207667_10379323 3300025949 Bacteria 1441
711 Ga0207667_11662079 3300025949 Bacteria 606
712 Ga0207651_10006413 3300025960 Bacteria 6156
713 Ga0207651_10359711 3300025960 Bacteria 1228
714 Ga0207712_10010018 3300025961 Bacteria 6008
715 Ga0207712_10023440 3300025961 Bacteria 4073
716 Ga0207712_10047602 3300025961 Bacteria 2978
717 Ga0207668_10001057 3300025972 Bacteria 16415
718 Ga0207668_10173698 3300025972 Bacteria 1692
719 Ga0207668_10189790 3300025972 Bacteria 1627
720 Ga0207668_12043200 3300025972 Bacteria 516
721 Ga0207640_10007947 3300025981 Bacteria 5856
722 Ga0207640_10030939 3300025981 Bacteria 3302
723 Ga0207640_10944235 3300025981 Bacteria 756
724 Ga0207658_10007478 3300025986 Bacteria 7442
725 Ga0207658_10086922 3300025986 Bacteria 2413
726 Ga0207658_10930718 3300025986 Bacteria 792
727 Ga0207677_10045718 3300026023 Bacteria 2925
728 Ga0207677_10489404 3300026023 Bacteria 1061
729 Ga0207677_10945075 3300026023 Bacteria 779
730 Ga0207703_10010584 3300026035 Bacteria 7208
731 Ga0207703_10024714 3300026035 Bacteria 4727
732 Ga0207703_10305115 3300026035 Bacteria 1453
733 Ga0207703_10437839 3300026035 Bacteria 1219
734 Ga0207639_10004087 3300026041 Bacteria 9843
735 Ga0207639_10143507 3300026041 Bacteria 1992
736 Ga0207639_10240122 3300026041 Bacteria 1575
737 Ga0207639_10926900 3300026041 Bacteria 815
738 Ga0207678_10000477 3300026067 Bacteria 36336
739 Ga0207678_10007497 3300026067 Bacteria 9645
740 Ga0207678_11003446 3300026067 Bacteria 739
741 Ga0207678_11065359 3300026067 Bacteria 716
742 Ga0207708_10000337 3300026075 Bacteria 36962
743 Ga0207708_10003609 3300026075 Bacteria 11405
744 Ga0207702_10194962 3300026078 Bacteria 1874
745 Ga0207702_11723392 3300026078 Bacteria 619
746 Ga0207702_11726983 3300026078 Bacteria 618
747 Ga0207641_10024140 3300026088 Bacteria 5011
748 Ga0207641_10180092 3300026088 Bacteria 1935
749 Ga0207641_10206999 3300026088 Bacteria 1812
750 Ga0207641_10623926 3300026088 Bacteria 1057
751 Ga0207648_10005612 3300026089 Bacteria 12612
752 Ga0207648_10258789 3300026089 Bacteria 1552
753 Ga0207676_10014591 3300026095 Bacteria 5657
754 Ga0207676_10022810 3300026095 Bacteria 4608
755 Ga0207676_10402391 3300026095 Bacteria 1280
756 Ga0207676_10579687 3300026095 Bacteria 1075
757 Ga0207676_12209346 3300026095 Bacteria 548
758 Ga0207674_10002865 3300026116 Bacteria 21427
759 Ga0207674_10071868 3300026116 Bacteria 3476
760 Ga0207674_10182232 3300026116 Bacteria 2051
761 Ga0207674_10404168 3300026116 Bacteria 1320
762 Ga0207674_11063222 3300026116 Bacteria 779
763 Ga0207675_100002251 3300026118 Bacteria 19192
764 Ga0207675_100003007 3300026118 Bacteria 16534
765 Ga0207675_100030423 3300026118 Bacteria 5028
766 Ga0207675_101588383 3300026118 Bacteria 674
767 Ga0207683_10000681 3300026121 Bacteria 31192
768 Ga0207683_10018094 3300026121 Bacteria 6008
769 Ga0207683_10335602 3300026121 Bacteria 1386
770 Ga0207683_10583984 3300026121 Bacteria 1034
771 Ga0207683_10738797 3300026121 Bacteria 913
772 Ga0207698_10080301 3300026142 Bacteria 2627
773 Ga0207698_10230088 3300026142 Bacteria 1682
774 Ga0207698_10594596 3300026142 Bacteria 1090
775 Ga0209969_1085288 3300027360 Bacteria 506
776 Ga0209179_1015152 3300027512 Bacteria 1427
777 Ga0209971_1099285 3300027682 Bacteria 712
778 Ga0207428_10002442 3300027907 Bacteria 18563
779 Ga0207428_10069161 3300027907 Bacteria 2776
780 Ga0207428_10114091 3300027907 Bacteria 2077
781 Ga0207428_10703191 3300027907 Bacteria 723
782 Ga0268266_10034032 3300028379 Bacteria 4331
783 Ga0268266_10172079 3300028379 Bacteria 1966
784 Ga0268266_11250728 3300028379 Bacteria 717
785 Ga0268265_10019608 3300028380 Bacteria 4704
786 Ga0268265_10322285 3300028380 Bacteria 1400
787 Ga0268265_11879117 3300028380 Bacteria 605
788 Ga0268264_10076694 3300028381 Bacteria 2845
789 Ga0268264_10095860 3300028381 Bacteria 2568
790 Ga0268264_10289811 3300028381 Bacteria 1537
791 Ga0268264_10431172 3300028381 Bacteria 1273
792 Ga0268264_12041028 3300028381 Bacteria 582
793 Ga0268264_12358376 3300028381 Bacteria 538
794 Ga0265337_1007309 3300028556 Bacteria 4141
795 Ga0265762_1004970 3300030760 Bacteria 2381
796 Ga0265332_10002691 3300031238 Bacteria 8896
797 Ga0265325_10123119 3300031241 Bacteria 1248
798 Ga0265329_10009828 3300031242 Bacteria 3545
799 Ga0265340_10002851 3300031247 Bacteria 9840
800 Ga0265339_10006770 3300031249 Bacteria 7478
801 Ga0265339_10061553 3300031249 Bacteria 2020
802 Ga0265331_10026076 3300031250 Bacteria 2944
803 Ga0265316_10350364 3300031344 Bacteria 1069
804 Ga0265313_10003687 3300031595 Bacteria 12218
805 Ga0265313_10004533 3300031595 Bacteria 10604
806 Ga0316575_10000986 3300031665 Bacteria 8786
807 Ga0316575_10207013 3300031665 Bacteria 817
808 Ga0316579_10033081 3300031691 Bacteria 2372
809 Ga0265314_10072853 3300031711 Bacteria 2293
810 Ga0265342_10000448 3300031712 Bacteria 44982
811 Ga0265342_10115179 3300031712 Bacteria 1518
812 Ga0316576_10005834 3300031727 Bacteria 7592
813 Ga0316576_10972141 3300031727 Bacteria 606
814 Ga0316578_10039175 3300031728 Bacteria 2736
815 Ga0316578_10296659 3300031728 Bacteria 967
816 Ga0316578_10826644 3300031728 Bacteria 536
817 Ga0316577_10032670 3300031733 Bacteria 2907
818 Ga0307409_101406426 3300031995 Bacteria 724
819 Ga0307415_101066537 3300032126 Bacteria 755
820 Ga0307415_101262848 3300032126 Bacteria 698
821 Ga0316583_10000484 3300032133 Bacteria 11841
822 Ga0316583_10115997 3300032133 Bacteria 934
823 Ga0316585_10002061 3300032137 Bacteria 5391
824 Ga0316580_10020547 3300032139 Bacteria 2034
825 Ga0316593_10000349 3300032168 Bacteria 8071
826 Ga0316593_10054391 3300032168 Bacteria 1358
827 Ga0316593_10196779 3300032168 Bacteria 744
828 Ga0316592_1041458 3300033524 Bacteria 1019
829 Ga0316588_1047158 3300033528 Bacteria 1040
830 Ga0316596_1000615 3300033541 Bacteria 6324
831 Ga0373948_0168302 3300034817 Bacteria 556
832 Ga0373950_0047162 3300034818 Bacteria 839
833 Ga0373958_0019124 3300034819 Bacteria 1249
834 Ga0373926_0045022 3300035083 Bacteria 1581
835 Ga0373926_0045218 3300035083 Bacteria 1578
836 Ga0373928_0004396 3300035084 Bacteria 2689
837 Ga0373928_0014834 3300035084 Bacteria 1580
838 Ga0373928_0255048 3300035084 Bacteria 524
839 Ga0373929_0020926 3300035085 Bacteria 1323
840 Ga0373929_0153856 3300035085 Bacteria 618
841 Ga0373934_0014666 3300035086 Bacteria 2970
842 Ga0373934_0015790 3300035086 Bacteria 2867
843 Ga0373940_0035043 3300035088 Bacteria 1357
844 Ga0373940_0225469 3300035088 Bacteria 624
845 Ga0373940_0357942 3300035088 Bacteria 513
846 Ga0373944_0008272 3300035089 Bacteria 2810
847 Ga0373944_0143495 3300035089 Bacteria 837
848 Ga0373944_0172914 3300035089 Bacteria 771
849 Ga0373944_0375932 3300035089 Bacteria 544
850 Ga0373949_0009948 3300035090 Bacteria 2080
851 Ga0373951_0041137 3300035091 Bacteria 1115
852 Ga0373951_0059440 3300035091 Bacteria 955
853 Ga0373951_0065450 3300035091 Bacteria 917
854 Ga0373952_0103999 3300035092 Bacteria 752
855 Ga0373923_0017765 3300035111 Bacteria 2726
856 Ga0373923_0019794 3300035111 Bacteria 2610
857 Ga0373923_0097074 3300035111 Bacteria 1296
858 Ga0373923_0113960 3300035111 Bacteria 1203
859 Ga0373923_0144119 3300035111 Bacteria 1078
860 Ga0373923_0461157 3300035111 Bacteria 617
861 Ga0373932_0036377 3300035112 Bacteria 1398
862 Ga0373932_0103894 3300035112 Bacteria 928
863 Ga0373932_0213658 3300035112 Bacteria 690
864 Ga0373936_0045644 3300035113 Bacteria 1765
865 Ga0373936_0123083 3300035113 Bacteria 1110
866 Ga0373939_0006547 3300035114 Bacteria 2809
867 Ga0373939_0007725 3300035114 Bacteria 2618
868 Ga0373939_0033667 3300035114 Bacteria 1498
869 Ga0373939_0200449 3300035114 Bacteria 754
870 Ga0373941_0018441 3300035115 Bacteria 1928
871 Ga0373941_0037958 3300035115 Bacteria 1472
872 Ga0373945_0004201 3300035116 Bacteria 4567
873 Ga0373945_0013612 3300035116 Bacteria 2718
874 Ga0373945_0464462 3300035116 Bacteria 561
875 Ga0373953_0009334 3300035117 Bacteria 3370
876 Ga0373953_0087582 3300035117 Bacteria 1300
877 Ga0373953_0124369 3300035117 Bacteria 1097
878 Ga0373954_0002392 3300035118 Bacteria 7857
879 Ga0373954_0023678 3300035118 Bacteria 2795
880 Ga0373954_0517109 3300035118 Bacteria 591
881 Ga0373956_0004726 3300035119 Bacteria 5447
882 Ga0373956_0013425 3300035119 Bacteria 3407
883 Ga0373956_0132598 3300035119 Bacteria 1167
884 Ga0373956_0257559 3300035119 Bacteria 830
885 Ga0373956_0512380 3300035119 Bacteria 572
886 Ga0373957_0011973 3300035120 Bacteria 2909
887 Ga0373957_0150763 3300035120 Bacteria 954
888 Ga0373957_0258057 3300035120 Bacteria 734
889 Ga0373960_0009519 3300035121 Bacteria 2356
890 Ga0373960_0015717 3300035121 Bacteria 1936
891 Ga0373960_0274883 3300035121 Bacteria 619
892 Ga0373943_0006870 3300035170 Bacteria 5105
893 Ga0373943_0017824 3300035170 Bacteria 3254
894 Ga0373943_0112261 3300035170 Bacteria 1439
895 Ga0373943_0148474 3300035170 Bacteria 1268
896 Ga0373943_0178879 3300035170 Bacteria 1165
897 Ga0373943_0188905 3300035170 Bacteria 1135
898 Ga0373943_0413261 3300035170 Bacteria 780
899 Ga0373946_0028041 3300035171 Bacteria 2231
900 Ga0373946_0055085 3300035171 Bacteria 1675
901 Ga0373946_0144232 3300035171 Bacteria 1106
902 Ga0373946_0207209 3300035171 Bacteria 941
903 Ga0373946_0318895 3300035171 Bacteria 772
904 Ga0373946_0756430 3300035171 Bacteria 510
905 Ga0373955_0012493 3300035172 Bacteria 4080
906 Ga0373942_0006754 3300035207 Bacteria 2651
907 Ga0373942_0171205 3300035207 Bacteria 707
908 Ga0373942_0308843 3300035207 Bacteria 551
909 Ga0373961_0003340 3300035241 Bacteria 3989
910 Ga0373961_0213615 3300035241 Bacteria 685
911 Ga0373962_0006059 3300035242 Bacteria 2923
912 Ga0373962_0304308 3300035242 Bacteria 566
913 Ga0316574_0001643 3300035398 Bacteria 10749
914 Ga0373924_0002711 3300035410 Bacteria 5976
915 Ga0373924_0029520 3300035410 Bacteria 2192
916 Ga0373924_0202565 3300035410 Bacteria 876
917 Ga0373931_0004918 3300035691 Bacteria 6144
918 Ga0373931_0005070 3300035691 Bacteria 6058
919 Ga0373931_0021991 3300035691 Bacteria 3205
920 Ga0373931_0041263 3300035691 Bacteria 2424
921 Ga0373931_0183942 3300035691 Bacteria 1239
922 Ga0373935_0015950 3300035692 Bacteria 4547
923 Ga0373935_0023121 3300035692 Bacteria 3817
924 Ga0373935_0047522 3300035692 Bacteria 2714
925 Ga0373935_0054814 3300035692 Bacteria 2540
926 Ga0373935_0080377 3300035692 Bacteria 2118
927 Ga0373935_0223997 3300035692 Bacteria 1307
928 Ga0373935_0502917 3300035692 Bacteria 880
929 Ga0373935_0747845 3300035692 Bacteria 720
930 Ga0373927_0003573 3300035695 Bacteria 11101
931 Ga0373927_0034549 3300035695 Bacteria 3289
932 Ga0373927_0044694 3300035695 Bacteria 2865
933 Ga0373927_0090178 3300035695 Bacteria 1991
934 Ga0373927_0106806 3300035695 Bacteria 1823
935 Ga0373927_0183618 3300035695 Bacteria 1372
936 Ga0373927_0188859 3300035695 Bacteria 1352
937 Ga0373927_0868296 3300035695 Bacteria 595
938 Ga0373933_0000858 3300035724 Bacteria 18640
939 Ga0373933_0004782 3300035724 Bacteria 7402
940 Ga0373933_0155749 3300035724 Bacteria 1449
941 Ga0373933_0962484 3300035724 Bacteria 562
942 Ga0373947_0090707 3300035725 Bacteria 1905
943 Ga0373947_0094908 3300035725 Bacteria 1866
944 Ga0373947_0188861 3300035725 Bacteria 1344
945 Ga0373947_0269760 3300035725 Bacteria 1129
946 Ga0373947_0482221 3300035725 Bacteria 841
947 Ga0373937_0001081 3300036401 Bacteria 22992
948 Ga0373937_0014628 3300036401 Bacteria 6929
949 Ga0373937_0069217 3300036401 Bacteria 3253
950 Ga0373937_0069312 3300036401 Bacteria 3252
951 Ga0373937_0138840 3300036401 Bacteria 2273
952 Ga0373937_0230888 3300036401 Bacteria 1743
953 Ga0373937_0244129 3300036401 Bacteria 1692
954 Ga0373937_1100805 3300036401 Bacteria 743
955 Ga0373937_1290907 3300036401 Bacteria 678
956 Ga0373937_1692054 3300036401 Bacteria 579
957 Ga0316582_0056650 3300036647 Bacteria 2501
958 Ga0316582_0108417 3300036647 Bacteria 1846
959 Ga0316582_0251242 3300036647 Bacteria 1212
960 Ga0316584_0001849 3300036712 Bacteria 13108
961 Ga0316584_0168385 3300036712 Bacteria 1626
962 Ga0373925_0048113 3300037068 Bacteria 3176
963 Ga0373925_0071988 3300037068 Bacteria 2615
964 Ga0373925_0085655 3300037068 Bacteria 2402
965 Ga0373925_0089443 3300037068 Bacteria 2352
966 Ga0373925_0120050 3300037068 Bacteria 2040
967 Ga0373925_0571461 3300037068 Bacteria 930
968 Ga0373925_0610612 3300037068 Bacteria 898
969 Ga0373925_0962810 3300037068 Bacteria 703
970 Ga0395899_0203983 3300037312 Bacteria 1377
971 Ga0395899_0499096 3300037312 Bacteria 790
972 Ga0395900_0032155 3300037418 Bacteria 5394
973 Ga0395898_0020934 3300037466 Bacteria 6638
974 Ga0395898_1076214 3300037466 Bacteria 738
975 Ga0395905_0002506 3300037471 Bacteria 20297
976 Ga0395905_0471539 3300037471 Bacteria 1154
977 Ga0316581_0013780 3300037588 Bacteria 2296
978 Ga0395901_0020211 3300038443 Bacteria 6817
979 Ga0395901_0039094 3300038443 Bacteria 4909
980 Ga0400483_046311 3300039062 Bacteria 7891
981 Ga0400483_057660 3300039062 Bacteria 5388
982 Ga0400483_217885 3300039062 Bacteria 12374
983 Ga0400483_283959 3300039062 Bacteria 2839
984 Ga0436365_0220024 3300039437 Bacteria 1701
985 Ga0436365_1158777 3300039437 Bacteria 1493
986 Ga0436360_0347915 3300039438 Bacteria 1224
987 Ga0436360_1007310 3300039438 Bacteria 517
988 Ga0436360_1281029 3300039438 Bacteria 894
989 Ga0436361_0316570 3300039447 Bacteria 12614
990 Ga0436361_0411891 3300039447 Bacteria 2843
991 Ga0436361_0776613 3300039447 Bacteria 1566
992 Ga0436363_0866799 3300039450 Bacteria 1071
993 Ga0439453_0007095 3300041408 Bacteria 1766
994 Ga0451839_0771846 3300041496 Bacteria 502
995 Ga0451845_0219459 3300041501 Bacteria 878
996 Ga0451853_3244529 3300041512 Bacteria 1315
997 Ga0439444_0066116 3300042437 Bacteria 765
998 Ga0466965_0704194 3300044683 Bacteria 580
999 Ga0466961_0078638 3300044693 Bacteria 2089
1000 Ga0466964_0104897 3300044706 Bacteria 1252
1001 Ga0466957_0059645 3300044842 Bacteria 2339
1002 Ga0466957_0090325 3300044842 Bacteria 1918
1003 Ga0466959_0131651 3300045049 Bacteria 1772
1004 Ga0466958_0051538 3300045836 Bacteria 2492
1005 Ga0466958_0470069 3300045836 Bacteria 815
1006 Ga0495617_079214 3300046452 Bacteria 1077
1007 Ga0495592_0002995 3300046454 Bacteria 12028
1008 Ga0495592_0016992 3300046454 Bacteria 5524
1009 Ga0495592_0088405 3300046454 Bacteria 2227
1010 Ga0495592_0209527 3300046454 Bacteria 1310
1011 Ga0495592_0297634 3300046454 Bacteria 1050
1012 Ga0495603_0000280 3300046455 Bacteria 27139
1013 Ga0495603_0024811 3300046455 Bacteria 3627
1014 Ga0495603_0189093 3300046455 Bacteria 1191
1015 Ga0495590_0164086 3300046457 Bacteria 808
1016 Ga0495590_0188583 3300046457 Bacteria 755
1017 Ga0495591_069799 3300046458 Bacteria 915
1018 Ga0495591_166499 3300046458 Bacteria 527
1019 Ga0495629_0000177 3300046459 Bacteria 56906
1020 Ga0495629_0003398 3300046459 Bacteria 12038
1021 Ga0495629_0378020 3300046459 Bacteria 964
1022 Ga0495638_0022881 3300046460 Bacteria 4097
1023 Ga0495638_0438671 3300046460 Bacteria 669
1024 Ga0495641_0056838 3300046461 Bacteria 1773
1025 Ga0495641_0119142 3300046461 Bacteria 1177
1026 Ga0495651_0013698 3300046462 Bacteria 6268
1027 Ga0495651_0021413 3300046462 Bacteria 5025
1028 Ga0495651_0266258 3300046462 Bacteria 1164
1029 Ga0495653_0000370 3300046463 Bacteria 36284
1030 Ga0495653_0105197 3300046463 Bacteria 2038
1031 Ga0495653_0118115 3300046463 Bacteria 1894
1032 Ga0495653_0166038 3300046463 Bacteria 1528
1033 Ga0495653_0363541 3300046463 Bacteria 928
1034 Ga0495580_0002426 3300046472 Bacteria 16287
1035 Ga0495580_0075797 3300046472 Bacteria 2346
1036 Ga0495580_0184678 3300046472 Bacteria 1439
1037 Ga0495580_0203918 3300046472 Bacteria 1362
1038 Ga0495580_0244542 3300046472 Bacteria 1229
1039 Ga0495580_0669709 3300046472 Bacteria 681
1040 Ga0495582_0000185 3300046473 Bacteria 34065
1041 Ga0495582_0010538 3300046473 Bacteria 5085
1042 Ga0495582_0027947 3300046473 Bacteria 3094
1043 Ga0495582_0076849 3300046473 Bacteria 1851
1044 Ga0495582_0077710 3300046473 Bacteria 1841
1045 Ga0495605_0063655 3300046474 Bacteria 1759
1046 Ga0495605_0097023 3300046474 Bacteria 1359
1047 Ga0495605_0309776 3300046474 Bacteria 667
1048 Ga0495639_0342409 3300046475 Bacteria 750
1049 Ga0495639_0459828 3300046475 Bacteria 647
1050 Ga0495639_0472269 3300046475 Bacteria 638
1051 Ga0495662_0058857 3300046476 Bacteria 1856
1052 Ga0495662_0209308 3300046476 Bacteria 961
1053 Ga0495662_0441762 3300046476 Bacteria 638
1054 Ga0495664_0008161 3300046477 Bacteria 5832
1055 Ga0495584_0049503 3300046491 Bacteria 2117
1056 Ga0495584_0086302 3300046491 Bacteria 1581
1057 Ga0495584_0586223 3300046491 Bacteria 568
1058 Ga0495584_0723369 3300046491 Bacteria 507
1059 Ga0495585_0101955 3300046492 Bacteria 1534
1060 Ga0495585_0123498 3300046492 Bacteria 1368
1061 Ga0495585_0571831 3300046492 Bacteria 533
1062 Ga0495594_0000224 3300046499 Bacteria 27588
1063 Ga0495594_0317156 3300046499 Bacteria 888
1064 Ga0495594_0449212 3300046499 Bacteria 733
1065 Ga0495596_0016620 3300046500 Bacteria 3054
1066 Ga0495596_0062670 3300046500 Bacteria 1447
1067 Ga0495596_0232718 3300046500 Bacteria 715
1068 Ga0495607_0242185 3300046501 Bacteria 872
1069 Ga0495607_0272434 3300046501 Bacteria 806
1070 Ga0495583_0119602 3300046506 Bacteria 1110
1071 Ga0495608_0011138 3300046511 Bacteria 6260
1072 Ga0495608_0420177 3300046511 Bacteria 816
1073 Ga0495608_0475447 3300046511 Bacteria 758
1074 Ga0495616_0088942 3300046513 Bacteria 1466
1075 Ga0495618_0014905 3300046514 Bacteria 4741
1076 Ga0495618_0227273 3300046514 Bacteria 1176
1077 Ga0495618_0266774 3300046514 Bacteria 1071
1078 Ga0495618_0564568 3300046514 Bacteria 680
1079 Ga0495620_0052076 3300046515 Bacteria 1740
1080 Ga0495628_0003568 3300046516 Bacteria 13931
1081 Ga0495628_0005831 3300046516 Bacteria 10790
1082 Ga0495628_0233524 3300046516 Bacteria 1378
1083 Ga0495630_0066370 3300046517 Bacteria 2712
1084 Ga0495630_0124827 3300046517 Bacteria 1953
1085 Ga0495630_0158716 3300046517 Bacteria 1722
1086 Ga0495630_0373582 3300046517 Bacteria 1092
1087 Ga0495631_0111828 3300046518 Bacteria 1174
1088 Ga0495631_0298459 3300046518 Bacteria 686
1089 Ga0495637_0091127 3300046520 Bacteria 1202
1090 Ga0495637_0093075 3300046520 Bacteria 1186
1091 Ga0495644_0055785 3300046523 Bacteria 1484
1092 Ga0495644_0183255 3300046523 Bacteria 805
1093 Ga0495648_0411333 3300046524 Bacteria 602
1094 Ga0495663_0031451 3300046525 Bacteria 1577
1095 Ga0495666_0020979 3300046526 Bacteria 3235
1096 Ga0495666_0032415 3300046526 Bacteria 2557
1097 Ga0495666_0248538 3300046526 Bacteria 810
1098 Ga0495666_0473514 3300046526 Bacteria 560
1099 Ga0495652_0004294 3300046529 Bacteria 13663
1100 Ga0495652_0008048 3300046529 Bacteria 9659
1101 Ga0495652_0250052 3300046529 Bacteria 1314
1102 Ga0495654_0067633 3300046530 Bacteria 1701
1103 Ga0495665_0020677 3300046531 Bacteria 3534
1104 Ga0495665_0150508 3300046531 Bacteria 1215
1105 Ga0495640_0000769 3300046533 Bacteria 24154
1106 Ga0495640_0118587 3300046533 Bacteria 1722
1107 Ga0495640_0166827 3300046533 Bacteria 1408
1108 Ga0495640_0270358 3300046533 Bacteria 1060
1109 Ga0495640_0341530 3300046533 Bacteria 925
1110 Ga0495587_0001283 3300046536 Bacteria 16691
1111 Ga0495587_0148497 3300046536 Bacteria 1336
1112 Ga0495587_0381608 3300046536 Bacteria 784
1113 Ga0495587_0574789 3300046536 Bacteria 621
1114 Ga0495598_0009024 3300046537 Bacteria 2342
1115 Ga0495598_0207185 3300046537 Bacteria 710
1116 Ga0495609_0054382 3300046538 Bacteria 1778
1117 Ga0495609_0249650 3300046538 Bacteria 731
1118 Ga0495621_0465532 3300046539 Bacteria 542
1119 Ga0495597_0084571 3300046542 Bacteria 1353
1120 Ga0495597_0219787 3300046542 Bacteria 755
1121 Ga0495645_0002505 3300046543 Bacteria 12464
1122 Ga0495645_0124944 3300046543 Bacteria 1808
1123 Ga0495645_0334430 3300046543 Bacteria 980
1124 Ga0495622_0000916 3300046557 Bacteria 15986
1125 Ga0495622_0098477 3300046557 Bacteria 1341
1126 Ga0495633_0099647 3300046558 Bacteria 1349
1127 Ga0495633_0229979 3300046558 Bacteria 848
1128 Ga0495667_0001942 3300046559 Bacteria 13669
1129 Ga0495667_0006336 3300046559 Bacteria 8029
1130 Ga0495667_0062276 3300046559 Bacteria 2445
1131 Ga0495667_0085085 3300046559 Bacteria 2052
1132 Ga0495667_0106536 3300046559 Bacteria 1812
1133 Ga0495656_0004659 3300046615 Bacteria 4711
1134 Ga0495656_0059778 3300046615 Bacteria 1659
1135 Ga0495668_0336045 3300046616 Bacteria 829
1136 Ga0495668_0348050 3300046616 Bacteria 813
1137 Ga0495634_0002200 3300046642 Bacteria 16376
1138 Ga0495634_0003557 3300046642 Bacteria 12469
1139 Ga0495634_0061741 3300046642 Bacteria 2490
1140 Ga0495634_0076021 3300046642 Bacteria 2205
1141 Ga0495634_0305523 3300046642 Bacteria 961
1142 Ga0495634_0815607 3300046642 Bacteria 531
1143 Ga0495611_0049922 3300046648 Bacteria 1884
1144 Ga0495611_0053809 3300046648 Bacteria 1818
1145 Ga0495611_0150870 3300046648 Bacteria 1085
1146 Ga0495611_0191034 3300046648 Bacteria 956
1147 Ga0495625_0055800 3300046660 Bacteria 2816
1148 Ga0495635_0004328 3300046663 Bacteria 9835
1149 Ga0495635_0098468 3300046663 Bacteria 1999
1150 Ga0495635_0196130 3300046663 Bacteria 1370
1151 Ga0495635_0303975 3300046663 Bacteria 1069
1152 Ga0495659_0007507 3300046664 Bacteria 3460
1153 Ga0495659_0060864 3300046664 Bacteria 1394
1154 Ga0495659_0078175 3300046664 Bacteria 1251
1155 Ga0495659_0126753 3300046664 Bacteria 1010
1156 Ga0495659_0395746 3300046664 Bacteria 596
1157 Ga0495661_0027325 3300046665 Bacteria 3665
1158 Ga0495661_0537802 3300046665 Bacteria 554
1159 Ga0495588_0000617 3300046674 Bacteria 16755
1160 Ga0495588_0480421 3300046674 Bacteria 651
1161 Ga0495657_0007254 3300046675 Bacteria 8587
1162 Ga0495657_0234127 3300046675 Bacteria 1110
1163 Ga0495657_0626438 3300046675 Bacteria 621
1164 Ga0495599_0002367 3300046678 Bacteria 10955
1165 Ga0495599_0051527 3300046678 Bacteria 2579
1166 Ga0495599_0067780 3300046678 Bacteria 2228
1167 Ga0495623_0003723 3300046679 Bacteria 10054
1168 Ga0495623_0109058 3300046679 Bacteria 1679
1169 Ga0495623_0212673 3300046679 Bacteria 1106
1170 Ga0495646_0008521 3300046680 Bacteria 6513
1171 Ga0495647_0001129 3300046681 Bacteria 8180
1172 Ga0495647_0053068 3300046681 Bacteria 1580
1173 Ga0495647_0347006 3300046681 Bacteria 675
1174 Ga0495658_0007723 3300046683 Bacteria 5329
1175 Ga0495658_0044340 3300046683 Bacteria 2492
1176 Ga0495658_0055052 3300046683 Bacteria 2265
1177 Ga0495658_0057445 3300046683 Bacteria 2223
1178 Ga0495658_0112907 3300046683 Bacteria 1635
1179 Ga0495658_0212426 3300046683 Bacteria 1209
1180 Ga0495669_0393295 3300046684 Bacteria 671
1181 Ga0495613_0015015 3300046689 Bacteria 5749
1182 Ga0495613_0037438 3300046689 Bacteria 3596
1183 Ga0495613_0286270 3300046689 Bacteria 1143
1184 Ga0495613_0387084 3300046689 Bacteria 955
1185 Ga0495613_0413857 3300046689 Bacteria 918
1186 Ga0495613_0533055 3300046689 Bacteria 787
1187 Ga0495624_0193375 3300046690 Bacteria 1237
1188 Ga0495624_0210796 3300046690 Bacteria 1178
1189 Ga0495624_0255715 3300046690 Bacteria 1059
1190 Ga0495624_0344344 3300046690 Bacteria 897
1191 Ga0495670_0009268 3300046691 Bacteria 4842
1192 Ga0495670_0115065 3300046691 Bacteria 1394
1193 Ga0495671_0106997 3300046692 Bacteria 1366
1194 Ga0495671_0306253 3300046692 Bacteria 764
1195 Ga0495649_0052691 3300046694 Bacteria 2204
1196 Ga0495589_0045587 3300046794 Bacteria 2178
1197 Ga0495589_0078961 3300046794 Bacteria 1602
1198 Ga0495589_0105377 3300046794 Bacteria 1363
1199 Ga0495600_0000422 3300046809 Bacteria 21824
1200 Ga0495600_0018323 3300046809 Bacteria 4460
1201 Ga0495581_0001367 3300047315 Bacteria 13506
1202 Ga0495581_0027518 3300047315 Bacteria 3297
1203 Ga0495581_0446366 3300047315 Bacteria 753
1204 Ga0495604_0000406 3300047317 Bacteria 38847
1205 Ga0495604_0003635 3300047317 Bacteria 12295
1206 Ga0495604_0045726 3300047317 Bacteria 3416
1207 Ga0495604_0125551 3300047317 Bacteria 1851
1208 Ga0495604_0472478 3300047317 Bacteria 816
1209 Ga0495674_0000757 3300047319 Bacteria 30677
1210 Ga0495674_0022160 3300047319 Bacteria 5862
1211 Ga0495674_0048954 3300047319 Bacteria 3737
1212 Ga0495674_0116376 3300047319 Bacteria 2261
1213 Ga0495674_0321579 3300047319 Bacteria 1260
1214 Ga0495672_0086797 3300047320 Bacteria 1729
1215 Ga0495672_0216951 3300047320 Bacteria 947
1216 Ga0495676_0165669 3300047321 Bacteria 1559
1217 Ga0495676_0214106 3300047321 Bacteria 1331
1218 Ga0495676_0425201 3300047321 Bacteria 879
1219 Ga0495676_0483740 3300047321 Bacteria 814
1220 Ga0495676_0565281 3300047321 Bacteria 742
1221 Ga0495680_0001477 3300047322 Bacteria 25369
1222 Ga0495680_0022302 3300047322 Bacteria 5280
1223 Ga0495680_0034950 3300047322 Bacteria 4053
1224 Ga0495680_0260952 3300047322 Bacteria 1225
1225 Ga0495675_0020789 3300047444 Bacteria 4177
1226 Ga0495677_0036120 3300047445 Bacteria 1804
1227 Ga0495679_041324 3300047446 Bacteria 1429
1228 Ga0495684_0002545 3300047471 Bacteria 14510
1229 Ga0495684_0074470 3300047471 Bacteria 2580
1230 Ga0495684_0118622 3300047471 Bacteria 1994
1231 Ga0495684_0139724 3300047471 Bacteria 1816
1232 Ga0495684_0144044 3300047471 Bacteria 1786
1233 Ga0495593_0001943 3300047673 Bacteria 12328
1234 Ga0495593_0035371 3300047673 Bacteria 2713
1235 Ga0495602_0010292 3300048088 Bacteria 9709
1236 Ga0495602_0064701 3300048088 Bacteria 3160
1237 Ga0495602_0335593 3300048088 Bacteria 1095
1238 Ga0495602_0443803 3300048088 Bacteria 917
1239 Ga0495602_0513173 3300048088 Bacteria 836
1240 Ga0495614_0000618 3300048089 Bacteria 14895
1241 Ga0495626_0344699 3300048091 Bacteria 582
1242 Ga0496100_0046778 3300048903 Bacteria 2784
1243 Ga0496100_0088544 3300048903 Bacteria 2107
1244 Ga0496100_0107165 3300048903 Bacteria 1935
1245 Ga0496100_0253450 3300048903 Bacteria 1302
1246 Ga0496100_0541140 3300048903 Bacteria 900
1247 Ga0496100_0945759 3300048903 Bacteria 677
1248 Ga0496101_0017801 3300048904 Bacteria 4822
1249 Ga0496101_0023344 3300048904 Bacteria 4272
1250 Ga0496101_0026858 3300048904 Bacteria 4003
1251 Ga0496101_0056548 3300048904 Bacteria 2836
1252 Ga0496101_0122824 3300048904 Bacteria 1964
1253 Ga0496101_0617387 3300048904 Bacteria 857
1254 Ga0496101_1260571 3300048904 Bacteria 579
1255 Ga0496101_1373106 3300048904 Bacteria 551
1256 Ga0496102_0037292 3300048905 Bacteria 4384
1257 Ga0496102_0057326 3300048905 Bacteria 3556
1258 Ga0496102_0099939 3300048905 Bacteria 2693
1259 Ga0496102_0129848 3300048905 Bacteria 2357
1260 Ga0496102_0320454 3300048905 Bacteria 1460
1261 Ga0496102_0386817 3300048905 Bacteria 1316
1262 Ga0496102_0755371 3300048905 Bacteria 895
1263 Ga0496102_0874639 3300048905 Bacteria 820
1264 Ga0496102_0954496 3300048905 Bacteria 778
1265 Ga0496103_0004036 3300048906 Bacteria 8920
1266 Ga0496103_0018919 3300048906 Bacteria 4135
1267 Ga0496103_0034290 3300048906 Bacteria 3103
1268 Ga0496103_0246224 3300048906 Bacteria 1150
1269 Ga0496103_0286399 3300048906 Bacteria 1060
1270 Ga0496103_0291013 3300048906 Bacteria 1051
1271 Ga0496103_0405659 3300048906 Bacteria 875
1272 Ga0496104_0000399 3300048907 Bacteria 38066
1273 Ga0496104_0000877 3300048907 Bacteria 25894
1274 Ga0496104_0002521 3300048907 Bacteria 15773
1275 Ga0496104_0014456 3300048907 Bacteria 7130
1276 Ga0496104_0162849 3300048907 Bacteria 2139
1277 Ga0496104_0174598 3300048907 Bacteria 2059
1278 Ga0496104_0250569 3300048907 Bacteria 1683
1279 Ga0496104_0350944 3300048907 Bacteria 1388
1280 Ga0496104_0441309 3300048907 Bacteria 1213
1281 Ga0496104_0674945 3300048907 Bacteria 942
1282 Ga0496104_1441290 3300048907 Bacteria 592
1283 Ga0496104_1660121 3300048907 Bacteria 541
1284 Ga0496105_0002417 3300048908 Bacteria 13529
1285 Ga0496105_0021595 3300048908 Bacteria 5210
1286 Ga0496105_0030949 3300048908 Bacteria 4387
1287 Ga0496105_0091268 3300048908 Bacteria 2515
1288 Ga0496105_0197359 3300048908 Bacteria 1643
1289 Ga0496105_0304908 3300048908 Bacteria 1279
1290 Ga0496105_0309265 3300048908 Bacteria 1269
1291 Ga0496106_0017883 3300048909 Bacteria 5242
1292 Ga0496106_0058432 3300048909 Bacteria 2920
1293 Ga0496106_0062001 3300048909 Bacteria 2839
1294 Ga0496106_0120117 3300048909 Bacteria 2054
1295 Ga0496106_0120270 3300048909 Bacteria 2052
1296 Ga0496106_0411286 3300048909 Bacteria 1087
1297 Ga0496106_0484605 3300048909 Bacteria 993
1298 Ga0496107_0003748 3300048910 Bacteria 10211
1299 Ga0496107_0010615 3300048910 Bacteria 6403
1300 Ga0496107_0035744 3300048910 Bacteria 3562
1301 Ga0496107_0078161 3300048910 Bacteria 2410
1302 Ga0496107_0098304 3300048910 Bacteria 2143
1303 Ga0496107_0135875 3300048910 Bacteria 1816
1304 Ga0496107_0296984 3300048910 Bacteria 1202
1305 Ga0496107_0491203 3300048910 Bacteria 911
1306 Ga0496107_0504327 3300048910 Bacteria 897
1307 Ga0496108_0015644 3300048911 Bacteria 6187
1308 Ga0496108_0021902 3300048911 Bacteria 5253
1309 Ga0496108_0046788 3300048911 Bacteria 3615
1310 Ga0496108_0075075 3300048911 Bacteria 2855
1311 Ga0496108_0280155 3300048911 Bacteria 1451
1312 Ga0496108_0299816 3300048911 Bacteria 1400
1313 Ga0496108_0338699 3300048911 Bacteria 1312
1314 Ga0496108_0484657 3300048911 Bacteria 1080
1315 Ga0496108_0862139 3300048911 Bacteria 779
1316 Ga0496108_0882631 3300048911 Bacteria 768
1317 Ga0496108_1175836 3300048911 Bacteria 649
1318 Ga0496109_0005037 3300048912 Bacteria 11039
1319 Ga0496109_0030562 3300048912 Bacteria 4828
1320 Ga0496109_0098970 3300048912 Bacteria 2704
1321 Ga0496109_0142383 3300048912 Bacteria 2242
1322 Ga0496109_0194364 3300048912 Bacteria 1907
1323 Ga0496109_0212329 3300048912 Bacteria 1820
1324 Ga0496109_0268932 3300048912 Bacteria 1606
1325 Ga0496109_0363896 3300048912 Bacteria 1366
1326 Ga0496109_1014459 3300048912 Bacteria 767
1327 Ga0496110_0008327 3300048913 Bacteria 8342
1328 Ga0496110_0013967 3300048913 Bacteria 6653
1329 Ga0496110_0014672 3300048913 Bacteria 6512
1330 Ga0496110_0133237 3300048913 Bacteria 2245
1331 Ga0496110_0213197 3300048913 Bacteria 1756
1332 Ga0496110_0264455 3300048913 Bacteria 1566
1333 Ga0496110_0297171 3300048913 Bacteria 1471
1334 Ga0496110_0357403 3300048913 Bacteria 1331
1335 Ga0496110_0425225 3300048913 Bacteria 1211
1336 Ga0496110_0785626 3300048913 Bacteria 856
1337 Ga0496110_0838202 3300048913 Bacteria 824
1338 Ga0496110_1052460 3300048913 Bacteria 721
1339 Ga0496110_1395135 3300048913 Bacteria 610
1340 Ga0496111_0006735 3300048914 Bacteria 7481
1341 Ga0496111_0010039 3300048914 Bacteria 6336
1342 Ga0496111_0026431 3300048914 Bacteria 4099
1343 Ga0496111_0145742 3300048914 Bacteria 1755
1344 Ga0496111_0566087 3300048914 Bacteria 833
1345 Ga0496111_1080691 3300048914 Bacteria 572
1346 Ga0496112_0002152 3300048915 Bacteria 15650
1347 Ga0496112_0005326 3300048915 Bacteria 11105
1348 Ga0496112_0009931 3300048915 Bacteria 8610
1349 Ga0496112_0185490 3300048915 Bacteria 2044
1350 Ga0496112_0245866 3300048915 Bacteria 1741
1351 Ga0496112_0290615 3300048915 Bacteria 1580
1352 Ga0496112_0448589 3300048915 Bacteria 1228
1353 Ga0496112_0448776 3300048915 Bacteria 1227
1354 Ga0496112_1257005 3300048915 Bacteria 656
1355 Ga0496113_0005226 3300048916 Bacteria 8080
1356 Ga0496113_0016963 3300048916 Bacteria 5042
1357 Ga0496113_0030967 3300048916 Bacteria 3877
1358 Ga0496113_0178410 3300048916 Bacteria 1683
1359 Ga0496113_0220513 3300048916 Bacteria 1511
1360 Ga0496113_0346148 3300048916 Bacteria 1192
1361 Ga0496113_0371704 3300048916 Bacteria 1147
1362 Ga0496114_0003614 3300048917 Bacteria 11884
1363 Ga0496114_0026260 3300048917 Bacteria 4767
1364 Ga0496114_0031170 3300048917 Bacteria 4386
1365 Ga0496114_0034421 3300048917 Bacteria 4179
1366 Ga0496114_0341901 3300048917 Bacteria 1323
1367 Ga0496114_0684025 3300048917 Bacteria 900
1368 Ga0496114_0786681 3300048917 Bacteria 830
1369 Ga0496114_1046956 3300048917 Bacteria 700
1370 Ga0496115_0024323 3300048918 Bacteria 4706
1371 Ga0496115_0032266 3300048918 Bacteria 4131
1372 Ga0496115_0037442 3300048918 Bacteria 3844
1373 Ga0496115_0082386 3300048918 Bacteria 2621
1374 Ga0496115_0094340 3300048918 Bacteria 2448
1375 Ga0496115_0099794 3300048918 Bacteria 2380
1376 Ga0496115_0129762 3300048918 Bacteria 2077
1377 Ga0496115_0194930 3300048918 Bacteria 1674
1378 Ga0496115_0470902 3300048918 Bacteria 1012
1379 Ga0496115_1172899 3300048918 Bacteria 578
1380 Ga0496119_0239329 3300048922 Bacteria 920
1381 Ga0496121_0217025 3300048924 Bacteria 1350
1382 Ga0496122_0552339 3300048925 Bacteria 548
1383 Ga0496126_0094779 3300048929 Bacteria 2619
1384 Ga0501031_0026171 3300049568 Bacteria 3805
1385 Ga0501031_0252196 3300049568 Bacteria 1147
1386 Ga0501032_0274050 3300049569 Bacteria 1093
1387 Ga0501034_0056814 3300049571 Bacteria 3936
1388 Ga0501034_0191226 3300049571 Bacteria 2009
1389 Ga0501034_1315469 3300049571 Bacteria 599
1390 Ga0501036_0114546 3300049572 Bacteria 2278
1391 Ga0501036_0493075 3300049572 Bacteria 1020
1392 Ga0501036_1055248 3300049572 Bacteria 664
1393 Ga0501036_1448311 3300049572 Bacteria 556
1394 Ga0501037_0156358 3300049573 Bacteria 1627
1395 Ga0501037_0392335 3300049573 Bacteria 953
1396 Ga0501038_0102284 3300049574 Bacteria 2384
1397 Ga0501038_0161708 3300049574 Bacteria 1819
1398 Ga0501038_0949052 3300049574 Bacteria 633
1399 Ga0501039_0069929 3300049575 Bacteria 2727
1400 Ga0501039_0179770 3300049575 Bacteria 1664
1401 Ga0501039_0245664 3300049575 Bacteria 1407
1402 Ga0501039_0465619 3300049575 Bacteria 992
1403 Ga0501039_0654365 3300049575 Bacteria 823
1404 Ga0501039_1390594 3300049575 Bacteria 540
1405 Ga0501040_0249533 3300049576 Bacteria 1266
1406 Ga0501040_0672035 3300049576 Bacteria 749
1407 Ga0501040_0704238 3300049576 Bacteria 730
1408 Ga0501041_0013799 3300049577 Bacteria 4789
1409 Ga0501041_0056868 3300049577 Bacteria 2391
1410 Ga0501041_0320352 3300049577 Bacteria 978
1411 Ga0501042_0030096 3300049578 Bacteria 3833
1412 Ga0501042_0679890 3300049578 Bacteria 748
1413 Ga0501043_0032912 3300049579 Bacteria 4078
1414 Ga0501043_0650126 3300049579 Bacteria 774
1415 Ga0501043_0774059 3300049579 Bacteria 696
1416 Ga0501046_0128506 3300049580 Bacteria 1923
1417 Ga0501046_0278251 3300049580 Bacteria 1226
1418 Ga0501046_0280873 3300049580 Bacteria 1220
1419 Ga0501046_0645495 3300049580 Bacteria 748
1420 Ga0501046_0678309 3300049580 Bacteria 727
1421 Ga0501046_0813432 3300049580 Bacteria 654
1422 Ga0501048_0017587 3300049582 Bacteria 5264
1423 Ga0501048_0140506 3300049582 Bacteria 1708
1424 Ga0501048_0271425 3300049582 Bacteria 1205
1425 Ga0501048_0739222 3300049582 Bacteria 707
1426 Ga0501067_0228464 3300049583 Bacteria 1036
1427 Ga0501067_0595156 3300049583 Bacteria 620
1428 Ga0501067_0839229 3300049583 Bacteria 518
1429 Ga0501068_0024472 3300049584 Bacteria 3546
1430 Ga0501068_0101141 3300049584 Bacteria 1787
1431 Ga0501068_0353435 3300049584 Bacteria 945
1432 Ga0501069_0079477 3300049585 Bacteria 1846
1433 Ga0501069_0187904 3300049585 Bacteria 1195
1434 Ga0501069_0681814 3300049585 Bacteria 619
1435 Ga0501069_0687787 3300049585 Bacteria 617
1436 Ga0501069_0997841 3300049585 Bacteria 511
1437 Ga0501070_0035593 3300049586 Bacteria 4160
1438 Ga0501070_0426311 3300049586 Bacteria 1071
1439 Ga0501071_0138073 3300049587 Bacteria 1814
1440 Ga0501071_0275241 3300049587 Bacteria 1273
1441 Ga0501071_0447967 3300049587 Bacteria 988
1442 Ga0501071_0890781 3300049587 Bacteria 687
1443 Ga0501071_0945384 3300049587 Bacteria 665
1444 Ga0501071_0974315 3300049587 Bacteria 655
1445 Ga0501071_1090623 3300049587 Bacteria 617
1446 Ga0501071_1365092 3300049587 Bacteria 547
1447 Ga0501072_0019597 3300049588 Bacteria 5231
1448 Ga0501072_0352756 3300049588 Bacteria 1168
1449 Ga0501072_0385856 3300049588 Bacteria 1111
1450 Ga0501072_0386825 3300049588 Bacteria 1110
1451 Ga0501072_0883334 3300049588 Bacteria 698
1452 Ga0501073_0113312 3300049589 Bacteria 1881
1453 Ga0501073_0194049 3300049589 Bacteria 1405
1454 Ga0501073_0263553 3300049589 Bacteria 1189
1455 Ga0501074_0047115 3300049590 Bacteria 3116
1456 Ga0501074_0200359 3300049590 Bacteria 1423
1457 Ga0501074_0538773 3300049590 Bacteria 827
1458 Ga0501074_1001655 3300049590 Bacteria 587
1459 Ga0501075_0013808 3300049591 Bacteria 5774
1460 Ga0501075_0159090 3300049591 Bacteria 1723
1461 Ga0501075_0332420 3300049591 Bacteria 1158
1462 Ga0501075_0349015 3300049591 Bacteria 1127
1463 Ga0501075_0504332 3300049591 Bacteria 923
1464 Ga0501076_0000421 3300049592 Bacteria 26662
1465 Ga0501076_0101603 3300049592 Bacteria 2318
1466 Ga0501076_0151129 3300049592 Bacteria 1889
1467 Ga0501076_0282047 3300049592 Bacteria 1361
1468 Ga0501076_0835865 3300049592 Bacteria 759
1469 Ga0501076_1170327 3300049592 Bacteria 633
1470 Ga0501077_0102988 3300049593 Bacteria 1809
1471 Ga0501077_0175879 3300049593 Bacteria 1360
1472 Ga0501077_0238424 3300049593 Bacteria 1156
1473 Ga0501077_0392189 3300049593 Bacteria 887
1474 Ga0501077_0392948 3300049593 Bacteria 886
1475 Ga0501079_0064512 3300049741 Bacteria 2825
1476 Ga0501079_0252153 3300049741 Bacteria 1379
1477 Ga0501079_1012291 3300049741 Bacteria 654
1478 Ga0501079_1379742 3300049741 Bacteria 555
1479 Ga0501080_0339968 3300049742 Bacteria 1356
1480 Ga0501080_0550479 3300049742 Bacteria 1028
1481 Ga0501080_0963527 3300049742 Bacteria 741
1482 Ga0501080_1657888 3300049742 Bacteria 540
1483 Ga0501080_1730864 3300049742 Bacteria 527
1484 Ga0501081_0009235 3300049743 Bacteria 6422
1485 Ga0501081_0155526 3300049743 Bacteria 1645
1486 Ga0501081_0632560 3300049743 Bacteria 802
1487 Ga0501081_0843053 3300049743 Bacteria 690
1488 Ga0501081_1060508 3300049743 Bacteria 613
1489 Ga0501083_0045332 3300049744 Bacteria 2975
1490 Ga0501083_0726681 3300049744 Bacteria 646
1491 Ga0501083_1062635 3300049744 Bacteria 527
1492 Ga0501035_0050399 3300049822 Bacteria 3731
1493 Ga0501035_0186136 3300049822 Bacteria 1787
1494 Ga0501035_0240284 3300049822 Bacteria 1541
1495 Ga0501035_0418728 3300049822 Bacteria 1112
1496 Ga0501035_0541718 3300049822 Bacteria 954
1497 Ga0501035_1154331 3300049822 Bacteria 603
1498 Ga0501035_1304239 3300049822 Bacteria 560
1499 Ga0501044_0123906 3300049823 Bacteria 2583
1500 Ga0501044_0456100 3300049823 Bacteria 1184
1501 Ga0501044_0690224 3300049823 Bacteria 907
1502 Ga0501045_0047269 3300049824 Bacteria 3134
1503 Ga0501045_0077461 3300049824 Bacteria 2450
1504 Ga0501045_0363122 3300049824 Bacteria 1078
1505 Ga0501045_0714675 3300049824 Bacteria 739
1506 Ga0501045_1020092 3300049824 Bacteria 606
1507 nmdc:mga03683_14894_c1 3300050489 Bacteria 2889
1508 nmdc:mga03683_44485_c1 3300050489 Bacteria 1835
1509 nmdc:mga03n38_3636_c1 3300050490 Bacteria 4981
1510 nmdc:mga03n38_8276_c1 3300050490 Bacteria 3725
1511 nmdc:mga00v17_17914_c1 3300050491 Bacteria 4017
1512 nmdc:mga00v17_181674_c1 3300050491 Bacteria 1357
1513 nmdc:mga00v17_22519_c1 3300050491 Bacteria 3636
1514 nmdc:mga00v17_267635_c1 3300050491 Bacteria 559
1515 nmdc:mga0yw44_1064880_c1 3300050492 Bacteria 547
1516 nmdc:mga0yw44_20022_c2 3300050492 Bacteria 2360
1517 nmdc:mga0yw44_2894_c1 3300050492 Bacteria 7461
1518 nmdc:mga0yw44_78099_c1 3300050492 Bacteria 2070
1519 nmdc:mga0k408_253612_c1 3300050493 Bacteria 1050
1520 nmdc:mga0k408_39549_c1 3300050493 Bacteria 2711
1521 nmdc:mga0k408_517737_c1 3300050493 Bacteria 706
1522 nmdc:mga06z11_213004_c1 3300050494 Bacteria 1126
1523 nmdc:mga06z11_216863_c1 3300050494 Bacteria 1117
1524 nmdc:mga06z11_348578_c1 3300050494 Bacteria 886
1525 nmdc:mga06z11_35540_c1 3300050494 Bacteria 2454
1526 nmdc:mga06z11_944727_c1 3300050494 Bacteria 525
1527 nmdc:mga04h51_38480_c1 3300050495 Bacteria 1549
1528 nmdc:mga07m45_157211_c1 3300050496 Bacteria 1319
1529 nmdc:mga07m45_181168_c1 3300050496 Bacteria 1225
1530 nmdc:mga07m45_588459_c1 3300050496 Bacteria 643
1531 nmdc:mga05p37_14706_c1 3300050507 Bacteria 9402
1532 nmdc:mga05p37_193059_c1 3300050507 Bacteria 2471
1533 nmdc:mga05p37_204463_c1 3300050507 Bacteria 2390
1534 nmdc:mga05p37_206532_c1 3300050507 Bacteria 2376
1535 nmdc:mga05p37_2437_c1 3300050507 Bacteria 21635
1536 nmdc:mga05p37_307020_c1 3300050507 Bacteria 1882
1537 nmdc:mga05p37_484383_c1 3300050507 Bacteria 1424
1538 nmdc:mga05p37_862206_c1 3300050507 Bacteria 982
1539 nmdc:mga05p37_907001_c1 3300050507 Bacteria 949
1540 nmdc:mga09592_134808_c1 3300050508 Bacteria 2126
1541 nmdc:mga09592_1370_c1 3300050508 Bacteria 19524
1542 nmdc:mga09592_162093_c1 3300050508 Bacteria 1932
1543 nmdc:mga09592_38412_c1 3300050508 Bacteria 4019
1544 nmdc:mga0qj67_1096646_c1 3300050509 Bacteria 622
1545 nmdc:mga0qj67_117019_c1 3300050509 Bacteria 2154
1546 nmdc:mga0qj67_2465_c1 3300050509 Bacteria 13183
1547 nmdc:mga0qj67_585613_c1 3300050509 Bacteria 893
1548 nmdc:mga06r32_114842_c1 3300050510 Bacteria 2651
1549 nmdc:mga06r32_159579_c1 3300050510 Bacteria 2237
1550 nmdc:mga06r32_312060_c1 3300050510 Bacteria 1558
1551 nmdc:mga06r32_46596_c1 3300050510 Bacteria 4137
1552 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
1553 nmdc:mga06r32_82733_c1 3300050510 Bacteria 3128
1554 nmdc:mga06r32_848681_c1 3300050510 Bacteria 872
1555 nmdc:mga08y16_133990_c1 3300050511 Bacteria 2575
1556 nmdc:mga08y16_325380_c1 3300050511 Bacteria 1582
1557 nmdc:mga08y16_36949_c1 3300050511 Bacteria 5129
1558 nmdc:mga08y16_37233_c1 3300050511 Bacteria 5110
1559 nmdc:mga08y16_496833_c1 3300050511 Bacteria 1240
1560 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
1561 nmdc:mga08y16_96065_c1 3300050511 Bacteria 3086
1562 nmdc:mga0n895_115180_c1 3300050512 Bacteria 2706
1563 nmdc:mga0n895_1187628_c1 3300050512 Bacteria 737
1564 nmdc:mga0n895_278101_c1 3300050512 Bacteria 1698
1565 nmdc:mga0n895_283_c1 3300050512 Bacteria 33340
1566 nmdc:mga0n895_78493_c1 3300050512 Bacteria 3286
1567 nmdc:mga0n895_847059_c1 3300050512 Bacteria 902
1568 nmdc:mga0n895_878774_c1 3300050512 Bacteria 883
1569 nmdc:mga0n895_94230_c1 3300050512 Bacteria 2998
1570 nmdc:mga0n895_98619_c1 3300050512 Bacteria 2929
1571 nmdc:mga0rr50_275087_c1 3300050513 Bacteria 1404
1572 nmdc:mga0rr50_333024_c1 3300050513 Bacteria 1274
1573 nmdc:mga0rr50_529062_c1 3300050513 Bacteria 1003
1574 nmdc:mga0rr50_6776_c1 3300050513 Bacteria 7016
1575 nmdc:mga0rr50_865616_c1 3300050513 Bacteria 771
1576 nmdc:mga0rr50_87561_c1 3300050513 Bacteria 2418
1577 nmdc:mga08x19_400636_c1 3300050514 Bacteria 962
1578 nmdc:mga08x19_41905_c1 3300050514 Bacteria 2917
1579 nmdc:mga0a205_1337165_c1 3300050515 Bacteria 564
1580 nmdc:mga0a205_147065_c1 3300050515 Bacteria 2257
1581 nmdc:mga0a205_272015_c1 3300050515 Bacteria 1571
1582 nmdc:mga0a205_278805_c1 3300050515 Bacteria 1547
1583 nmdc:mga0a205_387_c1 3300050515 Bacteria 33459
1584 nmdc:mga0sz30_177334_c1 3300050516 Bacteria 945
1585 nmdc:mga0sz30_626_c1 3300050516 Bacteria 13119
1586 Ga0495601_0002429 3300053077 Bacteria 10574
1587 Ga0495601_0003476 3300053077 Bacteria 9041
1588 Ga0495601_0004237 3300053077 Bacteria 8280
1589 Ga0495601_0049763 3300053077 Bacteria 2643
1590 Ga0495601_0104580 3300053077 Bacteria 1830
1591 Ga0495601_0186371 3300053077 Bacteria 1356
1592 Ga0495601_0210318 3300053077 Bacteria 1271
1593 Ga0495601_0387606 3300053077 Bacteria 906
1594 Ga0495612_0006736 3300053078 Bacteria 4705
1595 Ga0495612_0007484 3300053078 Bacteria 4462
1596 Ga0495655_0110854 3300053083 Bacteria 824
1597 Ga0495655_0218125 3300053083 Bacteria 630
1598 Ga0495595_0000821 3300053084 Bacteria 11875
1599 Ga0495595_0001865 3300053084 Bacteria 8184
1600 Ga0495595_0012728 3300053084 Bacteria 3544
1601 Ga0495595_0031909 3300053084 Bacteria 2370
1602 Ga0495595_0047137 3300053084 Bacteria 1987
1603 Ga0495595_0105857 3300053084 Bacteria 1360
1604 Ga0495595_0204772 3300053084 Bacteria 983
1605 Ga0495619_0000352 3300053085 Bacteria 32130
1606 Ga0495619_0001164 3300053085 Bacteria 17272
1607 Ga0495619_0001481 3300053085 Bacteria 15481
1608 Ga0495619_0007707 3300053085 Bacteria 6815
1609 Ga0495619_0008093 3300053085 Bacteria 6653
1610 Ga0495619_0027905 3300053085 Bacteria 3640
1611 Ga0495619_0097132 3300053085 Bacteria 2001
1612 Ga0495619_0115427 3300053085 Bacteria 1837
1613 Ga0500651_0036207 3300053093 Bacteria 3110
1614 Ga0500651_0179633 3300053093 Bacteria 1258
1615 Ga0500641_0106857 3300053096 Bacteria 1203
1616 Ga0500593_003205 3300053117 Bacteria 6141
1617 Ga0500594_0212399 3300053118 Bacteria 638
1618 Ga0500595_055179 3300053119 Bacteria 1217
1619 Ga0500642_0224743 3300053130 Bacteria 869
1620 Ga0500652_000024 3300053131 Bacteria 116239
1621 Ga0500616_0088791 3300053153 Bacteria 1536
1622 Ga0500638_368840 3300053162 Bacteria 526
1623 Ga0500636_0079812 3300053177 Bacteria 1886
1624 Ga0500645_001772 3300053730 Bacteria 10420
1625 Ga0500645_141569 3300053730 Bacteria 665
1626 Ga0501084_0077198 3300054114 Bacteria 2792
1627 Ga0501084_0275420 3300054114 Bacteria 1421
1628 Ga0501084_0339547 3300054114 Bacteria 1269
1629 Ga0501084_0558072 3300054114 Bacteria 968
1630 Ga0501084_1473501 3300054114 Bacteria 570
1631 Ga0501082_0015085 3300060353 Bacteria 6656
1632 Ga0501082_0075942 3300060353 Bacteria 2895
1633 Ga0501082_0196280 3300060353 Bacteria 1756
1634 Ga0501082_0282344 3300060353 Bacteria 1445
1635 Ga0501082_0480273 3300060353 Bacteria 1086
1636 Ga0501082_0620932 3300060353 Bacteria 946
1637 Ga0501082_0657339 3300060353 Bacteria 917
1638 Ga0530510_0076398 3300061734 Bacteria 2433
1639 Ga0530510_0078777 3300061734 Bacteria 2396
1640 Ga0530510_0139537 3300061734 Bacteria 1785
1641 Ga0530510_0431366 3300061734 Bacteria 995
1642 Ga0530510_0498055 3300061734 Bacteria 923
1643 Ga0530510_0667077 3300061734 Bacteria 792
1644 Ga0530510_0676321 3300061734 Bacteria 786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10005890 Ga0114129_1000589021 87
2 3300050515 nmdc:mga0a205_1337165_c1 nmdc:mga0a205_1337165_c1_211_537 88
3 3300006844 Ga0075428_101391609 Ga0075428_1013916093 89
4 3300009094 Ga0111539_10000683 Ga0111539_1000068324 89
5 3300009147 Ga0114129_10751109 Ga0114129_107511093 89
6 3300050507 nmdc:mga05p37_307020_c1 nmdc:mga05p37_307020_c1_1311_1673 89
7 3300009093 Ga0105240_10960624 Ga0105240_109606242 90
8 3300009147 Ga0114129_10593186 Ga0114129_105931863 90
9 3300009545 Ga0105237_11265400 Ga0105237_112654002 90
10 3300013100 Ga0157373_11025399 Ga0157373_110253991 90
11 3300013104 Ga0157370_10494637 Ga0157370_104946373 90
12 3300031727 Ga0316576_10972141 Ga0316576_109721411 90
13 3300031728 Ga0316578_10296659 Ga0316578_102966592 90
14 3300035089 Ga0373944_0375932 Ga0373944_0375932_174_500 90
15 3300035116 Ga0373945_0464462 Ga0373945_0464462_135_455 90
16 3300035117 Ga0373953_0124369 Ga0373953_0124369_192_518 90
17 3300035119 Ga0373956_0132598 Ga0373956_0132598_264_590 90
18 3300035242 Ga0373962_0304308 Ga0373962_0304308_236_556 90
19 3300035410 Ga0373924_0029520 Ga0373924_0029520_1650_1976 90
20 3300036401 Ga0373937_0069312 Ga0373937_0069312_769_1095 90
21 3300036712 Ga0316584_0168385 Ga0316584_0168385_756_1118 90
22 3300037068 Ga0373925_0571461 Ga0373925_0571461_339_665 90
23 3300039438 Ga0436360_1281029 Ga0436360_1281029_32_352 90
24 3300045836 Ga0466958_0051538 Ga0466958_0051538_2133_2459 90
25 3300046454 Ga0495592_0297634 Ga0495592_0297634_420_746 90
26 3300046462 Ga0495651_0266258 Ga0495651_0266258_193_519 90
27 3300046463 Ga0495653_0105197 Ga0495653_0105197_1061_1387 90
28 3300046514 Ga0495618_0564568 Ga0495618_0564568_300_626 90
29 3300046531 Ga0495665_0150508 Ga0495665_0150508_555_881 90
30 3300046536 Ga0495587_0148497 Ga0495587_0148497_483_809 90
31 3300046543 Ga0495645_0334430 Ga0495645_0334430_518_844 90
32 3300046558 Ga0495633_0229979 Ga0495633_0229979_508_828 90
33 3300046663 Ga0495635_0303975 Ga0495635_0303975_245_571 90
34 3300046681 Ga0495647_0347006 Ga0495647_0347006_228_554 90
35 3300046683 Ga0495658_0055052 Ga0495658_0055052_1584_1910 90
36 3300047317 Ga0495604_0045726 Ga0495604_0045726_355_681 90
37 3300047319 Ga0495674_0116376 Ga0495674_0116376_147_473 90
38 3300047320 Ga0495672_0086797 Ga0495672_0086797_654_974 90
39 3300047322 Ga0495680_0260952 Ga0495680_0260952_394_720 90
40 3300048088 Ga0495602_0335593 Ga0495602_0335593_93_419 90
41 3300049569 Ga0501032_0274050 Ga0501032_0274050_750_1070 90
42 3300049572 Ga0501036_1448311 Ga0501036_1448311_222_542 90
43 3300049574 Ga0501038_0949052 Ga0501038_0949052_12_332 90
44 3300049576 Ga0501040_0704238 Ga0501040_0704238_29_349 90
45 3300049579 Ga0501043_0774059 Ga0501043_0774059_346_672 90
46 3300049587 Ga0501071_0890781 Ga0501071_0890781_343_663 90
47 3300049587 Ga0501071_0974315 Ga0501071_0974315_306_626 90
48 3300049591 Ga0501075_0332420 Ga0501075_0332420_825_1145 90
49 3300049591 Ga0501075_0349015 Ga0501075_0349015_29_349 90
50 3300049592 Ga0501076_0835865 Ga0501076_0835865_23_343 90
51 3300049743 Ga0501081_0632560 Ga0501081_0632560_24_344 90
52 3300049744 Ga0501083_1062635 Ga0501083_1062635_172_492 90
53 3300049822 Ga0501035_1154331 Ga0501035_1154331_20_340 90
54 3300049824 Ga0501045_1020092 Ga0501045_1020092_269_589 90
55 3300050494 nmdc:mga06z11_944727_c1 nmdc:mga06z11_944727_c1_192_512 90
56 3300050509 nmdc:mga0qj67_1096646_c1 nmdc:mga0qj67_1096646_c1_96_416 90
57 3300053077 Ga0495601_0186371 Ga0495601_0186371_100_426 90
58 3300053083 Ga0495655_0218125 Ga0495655_0218125_23_343 90
59 3300053084 Ga0495595_0001865 Ga0495595_0001865_2032_2358 90
60 3300053085 Ga0495619_0001481 Ga0495619_0001481_4857_5183 90
61 3300005616 Ga0068852_101860426 Ga0068852_1018604262 92
62 3300009551 Ga0105238_11495410 Ga0105238_114954102 92
63 3300014969 Ga0157376_10271221 Ga0157376_102712212 92
64 3300025924 Ga0207694_11094085 Ga0207694_110940852 92
65 3300026078 Ga0207702_11726983 Ga0207702_117269832 92
66 3300036401 Ga0373937_1290907 Ga0373937_1290907_251_613 92
67 3300036401 Ga0373937_1692054 Ga0373937_1692054_192_554 92
68 3300046675 Ga0495657_0626438 Ga0495657_0626438_109_471 92
69 3300048088 Ga0495602_0513173 Ga0495602_0513173_196_558 92
70 3300048903 Ga0496100_0088544 Ga0496100_0088544_1128_1490 92
71 3300048904 Ga0496101_0023344 Ga0496101_0023344_1585_1947 92
72 3300048906 Ga0496103_0286399 Ga0496103_0286399_138_500 92
73 3300048908 Ga0496105_0197359 Ga0496105_0197359_935_1297 92
74 3300048909 Ga0496106_0411286 Ga0496106_0411286_432_794 92
75 3300048911 Ga0496108_0484657 Ga0496108_0484657_572_934 92
76 3300048912 Ga0496109_0194364 Ga0496109_0194364_16_378 92
77 3300048917 Ga0496114_0026260 Ga0496114_0026260_2540_2902 92
78 3300048918 Ga0496115_0094340 Ga0496115_0094340_506_868 92
79 3300053077 Ga0495601_0210318 Ga0495601_0210318_794_1156 92
80 3300053084 Ga0495595_0031909 Ga0495595_0031909_1526_1888 92
81 3300053085 Ga0495619_0007707 Ga0495619_0007707_2291_2653 92
82 3300005328 Ga0070676_11471820 Ga0070676_114718201 93
83 3300005341 Ga0070691_10346138 Ga0070691_103461382 93
84 3300005347 Ga0070668_101067461 Ga0070668_1010674612 93
85 3300005353 Ga0070669_100477873 Ga0070669_1004778733 93
86 3300005444 Ga0070694_100119543 Ga0070694_1001195434 93
87 3300005544 Ga0070686_100628828 Ga0070686_1006288282 93
88 3300005545 Ga0070695_100789888 Ga0070695_1007898882 93
89 3300005549 Ga0070704_100143127 Ga0070704_1001431274 93
90 3300009094 Ga0111539_11222761 Ga0111539_112227613 93
91 3300009545 Ga0105237_10205484 Ga0105237_102054842 93
92 3300009551 Ga0105238_11711467 Ga0105238_117114672 93
93 3300013307 Ga0157372_11844582 Ga0157372_118445822 93
94 3300014969 Ga0157376_10243836 Ga0157376_102438361 93
95 3300035083 Ga0373926_0045022 Ga0373926_0045022_295_624 93
96 3300035088 Ga0373940_0225469 Ga0373940_0225469_123_485 93
97 3300035089 Ga0373944_0008272 Ga0373944_0008272_440_769 93
98 3300035091 Ga0373951_0059440 Ga0373951_0059440_485_814 93
99 3300035111 Ga0373923_0097074 Ga0373923_0097074_213_542 93
100 3300035113 Ga0373936_0045644 Ga0373936_0045644_760_1089 93
101 3300035116 Ga0373945_0004201 Ga0373945_0004201_3707_4036 93
102 3300035170 Ga0373943_0188905 Ga0373943_0188905_760_1089 93
103 3300035170 Ga0373943_0413261 Ga0373943_0413261_331_693 93
104 3300035171 Ga0373946_0055085 Ga0373946_0055085_294_623 93
105 3300035171 Ga0373946_0144232 Ga0373946_0144232_405_767 93
106 3300035410 Ga0373924_0202565 Ga0373924_0202565_31_360 93
107 3300035692 Ga0373935_0047522 Ga0373935_0047522_1675_2004 93
108 3300035692 Ga0373935_0502917 Ga0373935_0502917_132_494 93
109 3300035692 Ga0373935_0747845 Ga0373935_0747845_271_600 93
110 3300035695 Ga0373927_0034549 Ga0373927_0034549_1062_1424 93
111 3300035695 Ga0373927_0868296 Ga0373927_0868296_181_510 93
112 3300035725 Ga0373947_0094908 Ga0373947_0094908_836_1198 93
113 3300037068 Ga0373925_0048113 Ga0373925_0048113_48_377 93
114 3300037068 Ga0373925_0085655 Ga0373925_0085655_148_510 93
115 3300037068 Ga0373925_0962810 Ga0373925_0962810_267_596 93
116 3300041512 Ga0451853_3244529 Ga0451853_3244529_588_917 93
117 3300046455 Ga0495603_0024811 Ga0495603_0024811_442_771 93
118 3300046457 Ga0495590_0164086 Ga0495590_0164086_187_516 93
119 3300046458 Ga0495591_069799 Ga0495591_069799_327_656 93
120 3300046461 Ga0495641_0119142 Ga0495641_0119142_441_770 93
121 3300046472 Ga0495580_0184678 Ga0495580_0184678_19_348 93
122 3300046473 Ga0495582_0010538 Ga0495582_0010538_432_761 93
123 3300046473 Ga0495582_0076849 Ga0495582_0076849_769_1131 93
124 3300046474 Ga0495605_0309776 Ga0495605_0309776_244_573 93
125 3300046475 Ga0495639_0459828 Ga0495639_0459828_168_497 93
126 3300046475 Ga0495639_0472269 Ga0495639_0472269_288_617 93
127 3300046476 Ga0495662_0209308 Ga0495662_0209308_136_465 93
128 3300046476 Ga0495662_0441762 Ga0495662_0441762_13_342 93
129 3300046491 Ga0495584_0723369 Ga0495584_0723369_19_348 93
130 3300046492 Ga0495585_0123498 Ga0495585_0123498_794_1123 93
131 3300046500 Ga0495596_0016620 Ga0495596_0016620_1052_1381 93
132 3300046500 Ga0495596_0232718 Ga0495596_0232718_120_449 93
133 3300046501 Ga0495607_0242185 Ga0495607_0242185_369_698 93
134 3300046501 Ga0495607_0272434 Ga0495607_0272434_223_552 93
135 3300046506 Ga0495583_0119602 Ga0495583_0119602_660_989 93
136 3300046511 Ga0495608_0475447 Ga0495608_0475447_224_553 93
137 3300046513 Ga0495616_0088942 Ga0495616_0088942_857_1186 93
138 3300046514 Ga0495618_0227273 Ga0495618_0227273_401_730 93
139 3300046515 Ga0495620_0052076 Ga0495620_0052076_404_733 93
140 3300046516 Ga0495628_0233524 Ga0495628_0233524_900_1229 93
141 3300046517 Ga0495630_0373582 Ga0495630_0373582_345_707 93
142 3300046518 Ga0495631_0111828 Ga0495631_0111828_148_477 93
143 3300046520 Ga0495637_0091127 Ga0495637_0091127_315_644 93
144 3300046520 Ga0495637_0093075 Ga0495637_0093075_20_349 93
145 3300046523 Ga0495644_0055785 Ga0495644_0055785_256_585 93
146 3300046523 Ga0495644_0183255 Ga0495644_0183255_296_625 93
147 3300046525 Ga0495663_0031451 Ga0495663_0031451_228_557 93
148 3300046526 Ga0495666_0032415 Ga0495666_0032415_1869_2198 93
149 3300046526 Ga0495666_0248538 Ga0495666_0248538_222_584 93
150 3300046530 Ga0495654_0067633 Ga0495654_0067633_228_557 93
151 3300046533 Ga0495640_0341530 Ga0495640_0341530_236_565 93
152 3300046536 Ga0495587_0381608 Ga0495587_0381608_67_396 93
153 3300046537 Ga0495598_0009024 Ga0495598_0009024_1031_1360 93
154 3300046537 Ga0495598_0207185 Ga0495598_0207185_132_461 93
155 3300046538 Ga0495609_0249650 Ga0495609_0249650_41_370 93
156 3300046539 Ga0495621_0465532 Ga0495621_0465532_140_469 93
157 3300046542 Ga0495597_0219787 Ga0495597_0219787_172_501 93
158 3300046557 Ga0495622_0098477 Ga0495622_0098477_417_746 93
159 3300046558 Ga0495633_0099647 Ga0495633_0099647_326_655 93
160 3300046615 Ga0495656_0059778 Ga0495656_0059778_1304_1633 93
161 3300046616 Ga0495668_0336045 Ga0495668_0336045_79_408 93
162 3300046616 Ga0495668_0348050 Ga0495668_0348050_20_349 93
163 3300046642 Ga0495634_0305523 Ga0495634_0305523_377_706 93
164 3300046642 Ga0495634_0815607 Ga0495634_0815607_17_346 93
165 3300046648 Ga0495611_0053809 Ga0495611_0053809_1044_1373 93
166 3300046648 Ga0495611_0150870 Ga0495611_0150870_492_821 93
167 3300046660 Ga0495625_0055800 Ga0495625_0055800_1013_1342 93
168 3300046665 Ga0495661_0027325 Ga0495661_0027325_446_775 93
169 3300046665 Ga0495661_0537802 Ga0495661_0537802_51_380 93
170 3300046674 Ga0495588_0480421 Ga0495588_0480421_19_348 93
171 3300046678 Ga0495599_0051527 Ga0495599_0051527_151_480 93
172 3300046681 Ga0495647_0053068 Ga0495647_0053068_339_668 93
173 3300046683 Ga0495658_0112907 Ga0495658_0112907_634_996 93
174 3300046683 Ga0495658_0212426 Ga0495658_0212426_46_375 93
175 3300046684 Ga0495669_0393295 Ga0495669_0393295_86_415 93
176 3300046689 Ga0495613_0286270 Ga0495613_0286270_603_932 93
177 3300046689 Ga0495613_0413857 Ga0495613_0413857_395_757 93
178 3300046690 Ga0495624_0193375 Ga0495624_0193375_673_1035 93
179 3300046690 Ga0495624_0210796 Ga0495624_0210796_792_1121 93
180 3300046691 Ga0495670_0009268 Ga0495670_0009268_828_1157 93
181 3300046691 Ga0495670_0115065 Ga0495670_0115065_161_490 93
182 3300046692 Ga0495671_0106997 Ga0495671_0106997_428_757 93
183 3300046692 Ga0495671_0306253 Ga0495671_0306253_358_687 93
184 3300046694 Ga0495649_0052691 Ga0495649_0052691_939_1268 93
185 3300046794 Ga0495589_0045587 Ga0495589_0045587_795_1124 93
186 3300046794 Ga0495589_0078961 Ga0495589_0078961_1003_1332 93
187 3300047315 Ga0495581_0027518 Ga0495581_0027518_1921_2250 93
188 3300047319 Ga0495674_0321579 Ga0495674_0321579_561_890 93
189 3300047321 Ga0495676_0165669 Ga0495676_0165669_480_809 93
190 3300047321 Ga0495676_0483740 Ga0495676_0483740_65_427 93
191 3300047321 Ga0495676_0565281 Ga0495676_0565281_251_580 93
192 3300047446 Ga0495679_041324 Ga0495679_041324_444_773 93
193 3300048088 Ga0495602_0443803 Ga0495602_0443803_245_574 93
194 3300048903 Ga0496100_0253450 Ga0496100_0253450_362_691 93
195 3300048904 Ga0496101_0056548 Ga0496101_0056548_1248_1577 93
196 3300048905 Ga0496102_0874639 Ga0496102_0874639_335_664 93
197 3300048906 Ga0496103_0034290 Ga0496103_0034290_1981_2310 93
198 3300048909 Ga0496106_0484605 Ga0496106_0484605_110_439 93
199 3300048910 Ga0496107_0098304 Ga0496107_0098304_1383_1712 93
200 3300048911 Ga0496108_0280155 Ga0496108_0280155_966_1295 93
201 3300048912 Ga0496109_0142383 Ga0496109_0142383_1467_1796 93
202 3300048913 Ga0496110_0838202 Ga0496110_0838202_157_486 93
203 3300048914 Ga0496111_0145742 Ga0496111_0145742_532_861 93
204 3300048915 Ga0496112_0290615 Ga0496112_0290615_262_591 93
205 3300048916 Ga0496113_0178410 Ga0496113_0178410_1151_1480 93
206 3300048917 Ga0496114_0684025 Ga0496114_0684025_157_486 93
207 3300048918 Ga0496115_0470902 Ga0496115_0470902_438_767 93
208 3300049575 Ga0501039_0179770 Ga0501039_0179770_642_971 93
209 3300049576 Ga0501040_0249533 Ga0501040_0249533_205_534 93
210 3300049580 Ga0501046_0128506 Ga0501046_0128506_408_737 93
211 3300049582 Ga0501048_0140506 Ga0501048_0140506_182_511 93
212 3300049588 Ga0501072_0386825 Ga0501072_0386825_321_650 93
213 3300049589 Ga0501073_0263553 Ga0501073_0263553_443_772 93
214 3300049590 Ga0501074_0200359 Ga0501074_0200359_574_903 93
215 3300049591 Ga0501075_0504332 Ga0501075_0504332_494_823 93
216 3300049592 Ga0501076_0151129 Ga0501076_0151129_96_425 93
217 3300049743 Ga0501081_0155526 Ga0501081_0155526_661_990 93
218 3300049744 Ga0501083_0726681 Ga0501083_0726681_216_545 93
219 3300049824 Ga0501045_0363122 Ga0501045_0363122_205_534 93
220 3300049824 Ga0501045_0714675 Ga0501045_0714675_201_530 93
221 3300050493 nmdc:mga0k408_253612_c1 nmdc:mga0k408_253612_c1_109_438 93
222 3300050511 nmdc:mga08y16_133990_c1 nmdc:mga08y16_133990_c1_2141_2470 93
223 3300053077 Ga0495601_0104580 Ga0495601_0104580_828_1157 93
224 3300053083 Ga0495655_0110854 Ga0495655_0110854_410_739 93
225 3300053096 Ga0500641_0106857 Ga0500641_0106857_66_395 93
226 3300054114 Ga0501084_0339547 Ga0501084_0339547_574_903 93
227 3300060353 Ga0501082_0480273 Ga0501082_0480273_631_960 93
228 3300060353 Ga0501082_0657339 Ga0501082_0657339_531_860 93
229 3300061734 Ga0530510_0076398 Ga0530510_0076398_727_1056 93
230 3300061734 Ga0530510_0431366 Ga0530510_0431366_395_724 93
231 3300007788 Ga0099795_10122138 Ga0099795_101221382 94
232 3300049592 Ga0501076_0101603 Ga0501076_0101603_844_1179 95
233 3300006844 Ga0075428_100917605 Ga0075428_1009176053 96
234 3300049571 Ga0501034_1315469 Ga0501034_1315469_244_582 96
235 3300049572 Ga0501036_1055248 Ga0501036_1055248_20_358 96
236 3300050512 nmdc:mga0n895_1187628_c1 nmdc:mga0n895_1187628_c1_34_396 96
237 3300004799 Ga0058863_11642270 Ga0058863_116422701 97
238 3300005329 Ga0070683_100512901 Ga0070683_1005129012 97
239 3300005530 Ga0070679_100200073 Ga0070679_1002000734 97
240 3300005535 Ga0070684_100744672 Ga0070684_1007446722 97
241 3300005563 Ga0068855_100193954 Ga0068855_1001939545 97
242 3300005614 Ga0068856_100484785 Ga0068856_1004847852 97
243 3300005616 Ga0068852_100383315 Ga0068852_1003833152 97
244 3300025909 Ga0207705_10040855 Ga0207705_100408555 97
245 3300025921 Ga0207652_11153368 Ga0207652_111533681 97
246 3300025924 Ga0207694_10198859 Ga0207694_101988594 97
247 3300025944 Ga0207661_10298682 Ga0207661_102986822 97
248 3300025949 Ga0207667_10379323 Ga0207667_103793232 97
249 3300025981 Ga0207640_10944235 Ga0207640_109442351 97
250 3300026041 Ga0207639_10240122 Ga0207639_102401222 97
251 3300026116 Ga0207674_10071868 Ga0207674_100718686 97
252 3300026142 Ga0207698_10230088 Ga0207698_102300882 97
253 3300031711 Ga0265314_10072853 Ga0265314_100728532 97
254 3300049575 Ga0501039_0069929 Ga0501039_0069929_1375_1737 98
255 3300049577 Ga0501041_0320352 Ga0501041_0320352_12_374 98
256 3300007788 Ga0099795_10003497 Ga0099795_100034977 99
257 3300010159 Ga0099796_10007209 Ga0099796_100072092 99
258 3300025932 Ga0207690_11526077 Ga0207690_115260772 99
259 3300027512 Ga0209179_1015152 Ga0209179_10151523 99
260 3300047320 Ga0495672_0216951 Ga0495672_0216951_306_668 99
261 3300050495 nmdc:mga04h51_38480_c1 nmdc:mga04h51_38480_c1_1190_1537 99
262 3300009093 Ga0105240_10015848 Ga0105240_100158488 100
263 3300013104 Ga0157370_10011636 Ga0157370_100116365 100
264 3300013105 Ga0157369_10129027 Ga0157369_101290275 100
265 3300006175 Ga0070712_100708397 Ga0070712_1007083972 101
266 3300025915 Ga0207693_10497169 Ga0207693_104971692 101
267 3300028556 Ga0265337_1007309 Ga0265337_10073094 101
268 3300037068 Ga0373925_0610612 Ga0373925_0610612_32_394 101
269 3300006844 Ga0075428_102192616 Ga0075428_1021926162 102
270 3300031249 Ga0265339_10061553 Ga0265339_100615534 102
271 3300032133 Ga0316583_10115997 Ga0316583_101159971 102
272 3300035089 Ga0373944_0172914 Ga0373944_0172914_384_746 102
273 3300035111 Ga0373923_0019794 Ga0373923_0019794_1152_1514 102
274 3300035117 Ga0373953_0009334 Ga0373953_0009334_2603_2965 102
275 3300035119 Ga0373956_0013425 Ga0373956_0013425_2413_2775 102
276 3300035120 Ga0373957_0150763 Ga0373957_0150763_441_803 102
277 3300035170 Ga0373943_0178879 Ga0373943_0178879_596_958 102
278 3300035410 Ga0373924_0002711 Ga0373924_0002711_1875_2237 102
279 3300035692 Ga0373935_0080377 Ga0373935_0080377_1636_1998 102
280 3300036401 Ga0373937_0014628 Ga0373937_0014628_1336_1698 102
281 3300036647 Ga0316582_0108417 Ga0316582_0108417_583_939 102
282 3300046454 Ga0495592_0016992 Ga0495592_0016992_2339_2701 102
283 3300046461 Ga0495641_0056838 Ga0495641_0056838_575_937 102
284 3300046462 Ga0495651_0021413 Ga0495651_0021413_817_1179 102
285 3300046463 Ga0495653_0166038 Ga0495653_0166038_60_422 102
286 3300046516 Ga0495628_0005831 Ga0495628_0005831_8332_8694 102
287 3300046524 Ga0495648_0411333 Ga0495648_0411333_157_519 102
288 3300046529 Ga0495652_0008048 Ga0495652_0008048_6733_7095 102
289 3300046533 Ga0495640_0270358 Ga0495640_0270358_310_672 102
290 3300046543 Ga0495645_0002505 Ga0495645_0002505_1342_1704 102
291 3300046559 Ga0495667_0006336 Ga0495667_0006336_1578_1940 102
292 3300046678 Ga0495599_0002367 Ga0495599_0002367_6725_7087 102
293 3300046679 Ga0495623_0109058 Ga0495623_0109058_422_784 102
294 3300046809 Ga0495600_0018323 Ga0495600_0018323_382_744 102
295 3300047317 Ga0495604_0003635 Ga0495604_0003635_5153_5515 102
296 3300047322 Ga0495680_0022302 Ga0495680_0022302_3502_3864 102
297 3300047471 Ga0495684_0074470 Ga0495684_0074470_2145_2507 102
298 3300049822 Ga0501035_0541718 Ga0501035_0541718_214_570 102
299 3300050510 nmdc:mga06r32_848681_c1 nmdc:mga06r32_848681_c1_232_603 102
300 3300053077 Ga0495601_0002429 Ga0495601_0002429_9921_10283 102
301 3300053078 Ga0495612_0006736 Ga0495612_0006736_2424_2786 102
302 3300053084 Ga0495595_0105857 Ga0495595_0105857_16_378 102
303 3300053085 Ga0495619_0008093 Ga0495619_0008093_3677_4039 102
304 3300053093 Ga0500651_0036207 Ga0500651_0036207_1274_1636 102
305 3300053730 Ga0500645_001772 Ga0500645_001772_2307_2669 102
306 3300005341 Ga0070691_10613013 Ga0070691_106130131 103
307 3300005347 Ga0070668_102145361 Ga0070668_1021453611 103
308 3300005434 Ga0070709_10964496 Ga0070709_109644962 103
309 3300005436 Ga0070713_101384983 Ga0070713_1013849831 103
310 3300005439 Ga0070711_100338886 Ga0070711_1003388862 103
311 3300006048 Ga0075363_100002116 Ga0075363_10000211612 103
312 3300006051 Ga0075364_10006710 Ga0075364_100067106 103
313 3300006058 Ga0075432_10021478 Ga0075432_100214782 103
314 3300006175 Ga0070712_100759772 Ga0070712_1007597722 103
315 3300006177 Ga0075362_10011880 Ga0075362_100118804 103
316 3300006178 Ga0075367_10030148 Ga0075367_100301484 103
317 3300006186 Ga0075369_10030362 Ga0075369_100303624 103
318 3300006194 Ga0075427_10000879 Ga0075427_100008795 103
319 3300006195 Ga0075366_10010619 Ga0075366_100106198 103
320 3300006353 Ga0075370_10447832 Ga0075370_104478322 103
321 3300006844 Ga0075428_100006364 Ga0075428_10000636410 103
322 3300006844 Ga0075428_100084565 Ga0075428_1000845655 103
323 3300006846 Ga0075430_100000196 Ga0075430_10000019630 103
324 3300006846 Ga0075430_100365144 Ga0075430_1003651443 103
325 3300006847 Ga0075431_100001183 Ga0075431_10000118310 103
326 3300006847 Ga0075431_100117861 Ga0075431_1001178616 103
327 3300006852 Ga0075433_10000991 Ga0075433_100009919 103
328 3300006871 Ga0075434_100006955 Ga0075434_10000695513 103
329 3300006880 Ga0075429_100000573 Ga0075429_1000005738 103
330 3300006880 Ga0075429_100119198 Ga0075429_1001191983 103
331 3300007076 Ga0075435_100100047 Ga0075435_1001000472 103
332 3300009094 Ga0111539_10140413 Ga0111539_101404136 103
333 3300009147 Ga0114129_10008352 Ga0114129_100083528 103
334 3300009147 Ga0114129_10269051 Ga0114129_102690515 103
335 3300025915 Ga0207693_10615830 Ga0207693_106158302 103
336 3300025916 Ga0207663_10169979 Ga0207663_101699792 103
337 3300025972 Ga0207668_12043200 Ga0207668_120432002 103
338 3300027907 Ga0207428_10002442 Ga0207428_1000244225 103
339 3300031595 Ga0265313_10003687 Ga0265313_1000368713 103
340 3300035084 Ga0373928_0255048 Ga0373928_0255048_34_393 103
341 3300035692 Ga0373935_0223997 Ga0373935_0223997_201_560 103
342 3300036647 Ga0316582_0251242 Ga0316582_0251242_547_906 103
343 3300037068 Ga0373925_0120050 Ga0373925_0120050_1390_1749 103
344 3300041501 Ga0451845_0219459 Ga0451845_0219459_425_784 103
345 3300046454 Ga0495592_0088405 Ga0495592_0088405_1610_1969 103
346 3300046460 Ga0495638_0438671 Ga0495638_0438671_82_441 103
347 3300046472 Ga0495580_0075797 Ga0495580_0075797_51_410 103
348 3300046517 Ga0495630_0124827 Ga0495630_0124827_1148_1507 103
349 3300046526 Ga0495666_0473514 Ga0495666_0473514_26_385 103
350 3300046533 Ga0495640_0118587 Ga0495640_0118587_1069_1428 103
351 3300046689 Ga0495613_0015015 Ga0495613_0015015_3903_4262 103
352 3300047319 Ga0495674_0022160 Ga0495674_0022160_4079_4438 103
353 3300048091 Ga0495626_0344699 Ga0495626_0344699_33_392 103
354 3300050489 nmdc:mga03683_14894_c1 nmdc:mga03683_14894_c1_1102_1461 103
355 3300050490 nmdc:mga03n38_8276_c1 nmdc:mga03n38_8276_c1_2017_2376 103
356 3300050491 nmdc:mga00v17_17914_c1 nmdc:mga00v17_17914_c1_2309_2668 103
357 3300050493 nmdc:mga0k408_39549_c1 nmdc:mga0k408_39549_c1_1253_1612 103
358 3300050493 nmdc:mga0k408_517737_c1 nmdc:mga0k408_517737_c1_289_648 103
359 3300050494 nmdc:mga06z11_216863_c1 nmdc:mga06z11_216863_c1_579_938 103
360 3300050496 nmdc:mga07m45_157211_c1 nmdc:mga07m45_157211_c1_749_1108 103
361 3300050507 nmdc:mga05p37_206532_c1 nmdc:mga05p37_206532_c1_592_954 103
362 3300050507 nmdc:mga05p37_2437_c1 nmdc:mga05p37_2437_c1_4886_5248 103
363 3300050508 nmdc:mga09592_1370_c1 nmdc:mga09592_1370_c1_7135_7497 103
364 3300050508 nmdc:mga09592_162093_c1 nmdc:mga09592_162093_c1_1055_1417 103
365 3300050509 nmdc:mga0qj67_2465_c1 nmdc:mga0qj67_2465_c1_922_1284 103
366 3300050510 nmdc:mga06r32_159579_c1 nmdc:mga06r32_159579_c1_1359_1721 103
367 3300050510 nmdc:mga06r32_638_c1 nmdc:mga06r32_638_c1_13451_13813 103
368 3300050511 nmdc:mga08y16_37233_c1 nmdc:mga08y16_37233_c1_329_691 103
369 3300050511 nmdc:mga08y16_549_c1 nmdc:mga08y16_549_c1_13847_14209 103
370 3300050512 nmdc:mga0n895_283_c1 nmdc:mga0n895_283_c1_28761_29123 103
371 3300050513 nmdc:mga0rr50_6776_c1 nmdc:mga0rr50_6776_c1_5250_5612 103
372 3300050515 nmdc:mga0a205_387_c1 nmdc:mga0a205_387_c1_1050_1412 103
373 3300053077 Ga0495601_0004237 Ga0495601_0004237_2895_3254 103
374 3300053153 Ga0500616_0088791 Ga0500616_0088791_1055_1414 103
375 2209111006 2214759678 2213774790 104
376 3300001989 JGI24739J22299_10144545 JGI24739J22299_101445452 104
377 3300001990 JGI24737J22298_10012538 JGI24737J22298_100125384 104
378 3300001991 JGI24743J22301_10003311 JGI24743J22301_100033113 104
379 3300001991 JGI24743J22301_10016767 JGI24743J22301_100167672 104
380 3300002067 JGI24735J21928_10059282 JGI24735J21928_100592822 104
381 3300002070 JGI24750J21931_1003024 JGI24750J21931_10030245 104
382 3300002074 JGI24748J21848_1005402 JGI24748J21848_10054023 104
383 3300002074 JGI24748J21848_1010371 JGI24748J21848_10103712 104
384 3300002075 JGI24738J21930_10126757 JGI24738J21930_101267571 104
385 3300002076 JGI24749J21850_1018028 JGI24749J21850_10180281 104
386 3300002076 JGI24749J21850_1025735 JGI24749J21850_10257351 104
387 3300002077 JGI24744J21845_10004856 JGI24744J21845_100048563 104
388 3300002239 JGI24034J26672_10000759 JGI24034J26672_100007598 104
389 3300002244 JGI24742J22300_10002388 JGI24742J22300_100023886 104
390 3300002459 JGI24751J29686_10018660 JGI24751J29686_100186603 104
391 3300002459 JGI24751J29686_10087860 JGI24751J29686_100878601 104
392 3300003163 Ga0006759J45824_1087614 Ga0006759J45824_10876142 104
393 3300003911 JGI25405J52794_10052991 JGI25405J52794_100529912 104
394 3300005327 Ga0070658_10012301 Ga0070658_100123016 104
395 3300005327 Ga0070658_10028805 Ga0070658_100288058 104
396 3300005327 Ga0070658_10372342 Ga0070658_103723421 104
397 3300005327 Ga0070658_10860766 Ga0070658_108607662 104
398 3300005328 Ga0070676_10010331 Ga0070676_100103316 104
399 3300005328 Ga0070676_10014395 Ga0070676_100143954 104
400 3300005329 Ga0070683_100014681 Ga0070683_10001468116 104
401 3300005329 Ga0070683_100191365 Ga0070683_1001913654 104
402 3300005329 Ga0070683_100429364 Ga0070683_1004293641 104
403 3300005330 Ga0070690_100012397 Ga0070690_1000123975 104
404 3300005330 Ga0070690_100348982 Ga0070690_1003489822 104
405 3300005330 Ga0070690_100363357 Ga0070690_1003633572 104
406 3300005331 Ga0070670_100000376 Ga0070670_10000037638 104
407 3300005331 Ga0070670_100030580 Ga0070670_1000305807 104
408 3300005331 Ga0070670_100241497 Ga0070670_1002414973 104
409 3300005333 Ga0070677_10853475 Ga0070677_108534751 104
410 3300005334 Ga0068869_100003825 Ga0068869_10000382510 104
411 3300005334 Ga0068869_100548880 Ga0068869_1005488801 104
412 3300005334 Ga0068869_100683405 Ga0068869_1006834052 104
413 3300005334 Ga0068869_100692359 Ga0068869_1006923592 104
414 3300005335 Ga0070666_10004644 Ga0070666_1000464417 104
415 3300005335 Ga0070666_10054197 Ga0070666_100541972 104
416 3300005336 Ga0070680_100005733 Ga0070680_1000057339 104
417 3300005336 Ga0070680_100008294 Ga0070680_10000829414 104
418 3300005336 Ga0070680_100082947 Ga0070680_1000829471 104
419 3300005336 Ga0070680_100528794 Ga0070680_1005287942 104
420 3300005336 Ga0070680_101981287 Ga0070680_1019812871 104
421 3300005337 Ga0070682_100019629 Ga0070682_1000196293 104
422 3300005337 Ga0070682_100374571 Ga0070682_1003745712 104
423 3300005337 Ga0070682_100418421 Ga0070682_1004184212 104
424 3300005338 Ga0068868_100010801 Ga0068868_1000108015 104
425 3300005338 Ga0068868_100112498 Ga0068868_1001124982 104
426 3300005339 Ga0070660_100000686 Ga0070660_10000068623 104
427 3300005339 Ga0070660_100049574 Ga0070660_1000495745 104
428 3300005339 Ga0070660_100057227 Ga0070660_1000572272 104
429 3300005339 Ga0070660_101559261 Ga0070660_1015592612 104
430 3300005340 Ga0070689_100000122 Ga0070689_10000012220 104
431 3300005340 Ga0070689_100708332 Ga0070689_1007083321 104
432 3300005341 Ga0070691_10000273 Ga0070691_1000027316 104
433 3300005341 Ga0070691_10182034 Ga0070691_101820342 104
434 3300005341 Ga0070691_10477143 Ga0070691_104771431 104
435 3300005343 Ga0070687_100037227 Ga0070687_1000372273 104
436 3300005343 Ga0070687_100075376 Ga0070687_1000753763 104
437 3300005343 Ga0070687_100108333 Ga0070687_1001083334 104
438 3300005344 Ga0070661_100000385 Ga0070661_1000003855 104
439 3300005344 Ga0070661_100175972 Ga0070661_1001759724 104
440 3300005344 Ga0070661_101821715 Ga0070661_1018217151 104
441 3300005345 Ga0070692_10003072 Ga0070692_1000307211 104
442 3300005345 Ga0070692_10013137 Ga0070692_100131375 104
443 3300005347 Ga0070668_100000440 Ga0070668_1000004406 104
444 3300005347 Ga0070668_100013602 Ga0070668_1000136026 104
445 3300005347 Ga0070668_100047834 Ga0070668_1000478342 104
446 3300005347 Ga0070668_101564347 Ga0070668_1015643471 104
447 3300005353 Ga0070669_100002082 Ga0070669_1000020824 104
448 3300005353 Ga0070669_100142900 Ga0070669_1001429001 104
449 3300005353 Ga0070669_101195644 Ga0070669_1011956441 104
450 3300005354 Ga0070675_100004703 Ga0070675_10000470312 104
451 3300005354 Ga0070675_100033615 Ga0070675_1000336154 104
452 3300005354 Ga0070675_100405443 Ga0070675_1004054433 104
453 3300005354 Ga0070675_101681748 Ga0070675_1016817481 104
454 3300005355 Ga0070671_100001283 Ga0070671_10000128322 104
455 3300005355 Ga0070671_100026489 Ga0070671_1000264893 104
456 3300005356 Ga0070674_100000649 Ga0070674_10000064923 104
457 3300005356 Ga0070674_100005343 Ga0070674_1000053437 104
458 3300005356 Ga0070674_100625618 Ga0070674_1006256182 104
459 3300005356 Ga0070674_100794434 Ga0070674_1007944341 104
460 3300005364 Ga0070673_100002163 Ga0070673_1000021636 104
461 3300005365 Ga0070688_100000217 Ga0070688_10000021735 104
462 3300005365 Ga0070688_100077268 Ga0070688_1000772683 104
463 3300005365 Ga0070688_100325791 Ga0070688_1003257912 104
464 3300005366 Ga0070659_100003485 Ga0070659_10000348520 104
465 3300005367 Ga0070667_100003614 Ga0070667_1000036148 104
466 3300005367 Ga0070667_100250921 Ga0070667_1002509214 104
467 3300005367 Ga0070667_100306973 Ga0070667_1003069732 104
468 3300005367 Ga0070667_100804944 Ga0070667_1008049442 104
469 3300005406 Ga0070703_10013074 Ga0070703_100130744 104
470 3300005406 Ga0070703_10246341 Ga0070703_102463412 104
471 3300005434 Ga0070709_10001353 Ga0070709_1000135314 104
472 3300005434 Ga0070709_10002316 Ga0070709_100023162 104
473 3300005434 Ga0070709_10048001 Ga0070709_100480013 104
474 3300005434 Ga0070709_10901984 Ga0070709_109019842 104
475 3300005434 Ga0070709_11005154 Ga0070709_110051542 104
476 3300005435 Ga0070714_100006925 Ga0070714_10000692514 104
477 3300005435 Ga0070714_100028686 Ga0070714_1000286865 104
478 3300005435 Ga0070714_100050142 Ga0070714_1000501422 104
479 3300005435 Ga0070714_100145434 Ga0070714_1001454345 104
480 3300005435 Ga0070714_100203275 Ga0070714_1002032754 104
481 3300005435 Ga0070714_100248615 Ga0070714_1002486154 104
482 3300005435 Ga0070714_100927664 Ga0070714_1009276642 104
483 3300005436 Ga0070713_100001694 Ga0070713_10000169413 104
484 3300005436 Ga0070713_100003041 Ga0070713_1000030415 104
485 3300005436 Ga0070713_100087057 Ga0070713_1000870575 104
486 3300005436 Ga0070713_100125988 Ga0070713_1001259885 104
487 3300005436 Ga0070713_100362513 Ga0070713_1003625131 104
488 3300005437 Ga0070710_10003492 Ga0070710_100034922 104
489 3300005437 Ga0070710_10005298 Ga0070710_1000529814 104
490 3300005437 Ga0070710_10042115 Ga0070710_100421152 104
491 3300005437 Ga0070710_10355796 Ga0070710_103557962 104
492 3300005437 Ga0070710_11284353 Ga0070710_112843531 104
493 3300005438 Ga0070701_10000897 Ga0070701_1000089717 104
494 3300005438 Ga0070701_10046902 Ga0070701_100469024 104
495 3300005438 Ga0070701_10476439 Ga0070701_104764392 104
496 3300005438 Ga0070701_11034118 Ga0070701_110341181 104
497 3300005439 Ga0070711_100000834 Ga0070711_10000083423 104
498 3300005439 Ga0070711_100026258 Ga0070711_1000262585 104
499 3300005439 Ga0070711_100116502 Ga0070711_1001165022 104
500 3300005439 Ga0070711_100121489 Ga0070711_1001214892 104
501 3300005439 Ga0070711_100203885 Ga0070711_1002038853 104
502 3300005439 Ga0070711_100257509 Ga0070711_1002575094 104
503 3300005440 Ga0070705_100001475 Ga0070705_10000147513 104
504 3300005440 Ga0070705_100934968 Ga0070705_1009349682 104
505 3300005441 Ga0070700_100001041 Ga0070700_10000104113 104
506 3300005441 Ga0070700_100035300 Ga0070700_1000353004 104
507 3300005444 Ga0070694_100000195 Ga0070694_1000001958 104
508 3300005444 Ga0070694_101181484 Ga0070694_1011814841 104
509 3300005444 Ga0070694_101259501 Ga0070694_1012595011 104
510 3300005445 Ga0070708_100020902 Ga0070708_10002090212 104
511 3300005445 Ga0070708_100309032 Ga0070708_1003090322 104
512 3300005445 Ga0070708_100955872 Ga0070708_1009558722 104
513 3300005455 Ga0070663_100000352 Ga0070663_10000035211 104
514 3300005455 Ga0070663_100414448 Ga0070663_1004144482 104
515 3300005455 Ga0070663_100825021 Ga0070663_1008250211 104
516 3300005455 Ga0070663_101672311 Ga0070663_1016723111 104
517 3300005456 Ga0070678_100001146 Ga0070678_10000114617 104
518 3300005456 Ga0070678_100280065 Ga0070678_1002800652 104
519 3300005456 Ga0070678_100522757 Ga0070678_1005227572 104
520 3300005456 Ga0070678_101010011 Ga0070678_1010100112 104
521 3300005457 Ga0070662_100002265 Ga0070662_1000022652 104
522 3300005457 Ga0070662_101103326 Ga0070662_1011033261 104
523 3300005458 Ga0070681_10066653 Ga0070681_100666535 104
524 3300005458 Ga0070681_10485858 Ga0070681_104858581 104
525 3300005459 Ga0068867_100674127 Ga0068867_1006741272 104
526 3300005459 Ga0068867_102351000 Ga0068867_1023510001 104
527 3300005466 Ga0070685_10004968 Ga0070685_100049688 104
528 3300005466 Ga0070685_10576501 Ga0070685_105765012 104
529 3300005466 Ga0070685_10875964 Ga0070685_108759642 104
530 3300005467 Ga0070706_100299185 Ga0070706_1002991851 104
531 3300005467 Ga0070706_100352764 Ga0070706_1003527642 104
532 3300005468 Ga0070707_100065999 Ga0070707_1000659995 104
533 3300005468 Ga0070707_101182211 Ga0070707_1011822112 104
534 3300005471 Ga0070698_100141794 Ga0070698_1001417944 104
535 3300005471 Ga0070698_100520905 Ga0070698_1005209052 104
536 3300005518 Ga0070699_100014494 Ga0070699_1000144945 104
537 3300005518 Ga0070699_100050437 Ga0070699_1000504373 104
538 3300005518 Ga0070699_100076224 Ga0070699_1000762242 104
539 3300005530 Ga0070679_100074568 Ga0070679_1000745681 104
540 3300005530 Ga0070679_100116188 Ga0070679_1001161882 104
541 3300005530 Ga0070679_100366118 Ga0070679_1003661183 104
542 3300005530 Ga0070679_102061390 Ga0070679_1020613902 104
543 3300005535 Ga0070684_100102300 Ga0070684_1001023004 104
544 3300005535 Ga0070684_100576104 Ga0070684_1005761042 104
545 3300005536 Ga0070697_100000391 Ga0070697_10000039138 104
546 3300005536 Ga0070697_101795161 Ga0070697_1017951612 104
547 3300005539 Ga0068853_100001082 Ga0068853_10000108220 104
548 3300005539 Ga0068853_100030559 Ga0068853_1000305597 104
549 3300005543 Ga0070672_100002807 Ga0070672_10000280711 104
550 3300005543 Ga0070672_100329507 Ga0070672_1003295072 104
551 3300005544 Ga0070686_100001391 Ga0070686_10000139117 104
552 3300005544 Ga0070686_100031187 Ga0070686_1000311875 104
553 3300005545 Ga0070695_100000238 Ga0070695_10000023815 104
554 3300005545 Ga0070695_100521562 Ga0070695_1005215622 104
555 3300005546 Ga0070696_100000815 Ga0070696_1000008154 104
556 3300005546 Ga0070696_100213690 Ga0070696_1002136902 104
557 3300005547 Ga0070693_100000455 Ga0070693_10000045510 104
558 3300005547 Ga0070693_100066674 Ga0070693_1000666743 104
559 3300005547 Ga0070693_100395544 Ga0070693_1003955442 104
560 3300005548 Ga0070665_100008997 Ga0070665_1000089979 104
561 3300005548 Ga0070665_100414654 Ga0070665_1004146542 104
562 3300005548 Ga0070665_101749622 Ga0070665_1017496222 104
563 3300005549 Ga0070704_100000124 Ga0070704_10000012410 104
564 3300005549 Ga0070704_100057511 Ga0070704_1000575113 104
565 3300005549 Ga0070704_101148947 Ga0070704_1011489471 104
566 3300005563 Ga0068855_100002691 Ga0068855_10000269123 104
567 3300005563 Ga0068855_100027910 Ga0068855_10002791011 104
568 3300005563 Ga0068855_100030257 Ga0068855_1000302572 104
569 3300005563 Ga0068855_102039326 Ga0068855_1020393261 104
570 3300005564 Ga0070664_100002450 Ga0070664_1000024506 104
571 3300005564 Ga0070664_100710964 Ga0070664_1007109642 104
572 3300005577 Ga0068857_100003648 Ga0068857_1000036485 104
573 3300005577 Ga0068857_100704236 Ga0068857_1007042361 104
574 3300005577 Ga0068857_101434846 Ga0068857_1014348462 104
575 3300005578 Ga0068854_100004862 Ga0068854_1000048629 104
576 3300005578 Ga0068854_100056166 Ga0068854_1000561665 104
577 3300005578 Ga0068854_100177557 Ga0068854_1001775571 104
578 3300005614 Ga0068856_100005122 Ga0068856_1000051226 104
579 3300005614 Ga0068856_100561745 Ga0068856_1005617452 104
580 3300005614 Ga0068856_100664381 Ga0068856_1006643812 104
581 3300005615 Ga0070702_100000018 Ga0070702_10000001826 104
582 3300005615 Ga0070702_100100454 Ga0070702_1001004542 104
583 3300005615 Ga0070702_100100819 Ga0070702_1001008193 104
584 3300005615 Ga0070702_100108879 Ga0070702_1001088794 104
585 3300005615 Ga0070702_100132523 Ga0070702_1001325233 104
586 3300005615 Ga0070702_101185794 Ga0070702_1011857942 104
587 3300005616 Ga0068852_100055001 Ga0068852_1000550015 104
588 3300005616 Ga0068852_100544806 Ga0068852_1005448062 104
589 3300005616 Ga0068852_101992423 Ga0068852_1019924232 104
590 3300005617 Ga0068859_100052965 Ga0068859_1000529655 104
591 3300005617 Ga0068859_100139311 Ga0068859_1001393115 104
592 3300005617 Ga0068859_100646451 Ga0068859_1006464512 104
593 3300005618 Ga0068864_100002243 Ga0068864_1000022434 104
594 3300005618 Ga0068864_100252941 Ga0068864_1002529412 104
595 3300005618 Ga0068864_100403825 Ga0068864_1004038252 104
596 3300005618 Ga0068864_100458100 Ga0068864_1004581002 104
597 3300005618 Ga0068864_100683251 Ga0068864_1006832512 104
598 3300005718 Ga0068866_10149516 Ga0068866_101495161 104
599 3300005718 Ga0068866_10236436 Ga0068866_102364362 104
600 3300005719 Ga0068861_100000942 Ga0068861_10000094211 104
601 3300005719 Ga0068861_100078234 Ga0068861_1000782344 104
602 3300005719 Ga0068861_101526931 Ga0068861_1015269312 104
603 3300005834 Ga0068851_10041001 Ga0068851_100410013 104
604 3300005834 Ga0068851_10044010 Ga0068851_100440102 104
605 3300005840 Ga0068870_10015701 Ga0068870_100157016 104
606 3300005840 Ga0068870_10069787 Ga0068870_100697872 104
607 3300005841 Ga0068863_100007947 Ga0068863_1000079472 104
608 3300005841 Ga0068863_100064525 Ga0068863_1000645254 104
609 3300005841 Ga0068863_100235960 Ga0068863_1002359601 104
610 3300005841 Ga0068863_100475637 Ga0068863_1004756372 104
611 3300005841 Ga0068863_101026517 Ga0068863_1010265172 104
612 3300005841 Ga0068863_102402119 Ga0068863_1024021191 104
613 3300005842 Ga0068858_100016672 Ga0068858_10001667210 104
614 3300005842 Ga0068858_100034173 Ga0068858_1000341735 104
615 3300005842 Ga0068858_100129047 Ga0068858_1001290475 104
616 3300005842 Ga0068858_100907586 Ga0068858_1009075861 104
617 3300005843 Ga0068860_100000598 Ga0068860_10000059817 104
618 3300005843 Ga0068860_100051012 Ga0068860_1000510125 104
619 3300005843 Ga0068860_100067934 Ga0068860_1000679345 104
620 3300005843 Ga0068860_101222857 Ga0068860_1012228572 104
621 3300005843 Ga0068860_101297423 Ga0068860_1012974231 104
622 3300005843 Ga0068860_101982194 Ga0068860_1019821941 104
623 3300005844 Ga0068862_100002944 Ga0068862_10000294411 104
624 3300005844 Ga0068862_100066335 Ga0068862_1000663357 104
625 3300005844 Ga0068862_101108388 Ga0068862_1011083882 104
626 3300005937 Ga0081455_10002425 Ga0081455_1000242511 104
627 3300005937 Ga0081455_10014358 Ga0081455_1001435814 104
628 3300005937 Ga0081455_10042010 Ga0081455_100420105 104
629 3300005937 Ga0081455_10075517 Ga0081455_100755174 104
630 3300005937 Ga0081455_10744669 Ga0081455_107446691 104
631 3300005981 Ga0081538_10010008 Ga0081538_1001000811 104
632 3300005981 Ga0081538_10036355 Ga0081538_100363555 104
633 3300005983 Ga0081540_1004248 Ga0081540_100424820 104
634 3300005983 Ga0081540_1008438 Ga0081540_10084382 104
635 3300005983 Ga0081540_1029521 Ga0081540_10295212 104
636 3300005983 Ga0081540_1089269 Ga0081540_10892692 104
637 3300006028 Ga0070717_10003669 Ga0070717_1000366919 104
638 3300006028 Ga0070717_10026162 Ga0070717_100261626 104
639 3300006028 Ga0070717_10208855 Ga0070717_102088554 104
640 3300006028 Ga0070717_10448226 Ga0070717_104482262 104
641 3300006028 Ga0070717_11080427 Ga0070717_110804272 104
642 3300006028 Ga0070717_11779412 Ga0070717_117794121 104
643 3300006038 Ga0075365_10017964 Ga0075365_100179646 104
644 3300006038 Ga0075365_10150283 Ga0075365_101502831 104
645 3300006038 Ga0075365_10176373 Ga0075365_101763733 104
646 3300006038 Ga0075365_10347537 Ga0075365_103475372 104
647 3300006038 Ga0075365_10557272 Ga0075365_105572722 104
648 3300006042 Ga0075368_10015066 Ga0075368_100150665 104
649 3300006048 Ga0075363_100007498 Ga0075363_1000074981 104
650 3300006051 Ga0075364_10053651 Ga0075364_100536512 104
651 3300006051 Ga0075364_10126537 Ga0075364_101265373 104
652 3300006051 Ga0075364_10137627 Ga0075364_101376274 104
653 3300006051 Ga0075364_10786752 Ga0075364_107867522 104
654 3300006058 Ga0075432_10000910 Ga0075432_1000091017 104
655 3300006058 Ga0075432_10329864 Ga0075432_103298642 104
656 3300006163 Ga0070715_10003461 Ga0070715_100034611 104
657 3300006163 Ga0070715_10004143 Ga0070715_100041434 104
658 3300006163 Ga0070715_10018779 Ga0070715_100187792 104
659 3300006173 Ga0070716_100001603 Ga0070716_10000160319 104
660 3300006173 Ga0070716_100018351 Ga0070716_1000183515 104
661 3300006173 Ga0070716_100255800 Ga0070716_1002558001 104
662 3300006173 Ga0070716_100769228 Ga0070716_1007692281 104
663 3300006175 Ga0070712_100006185 Ga0070712_10000618511 104
664 3300006175 Ga0070712_100006515 Ga0070712_1000065156 104
665 3300006175 Ga0070712_100020063 Ga0070712_1000200636 104
666 3300006175 Ga0070712_100082405 Ga0070712_1000824054 104
667 3300006175 Ga0070712_100083256 Ga0070712_1000832565 104
668 3300006175 Ga0070712_100143172 Ga0070712_1001431722 104
669 3300006175 Ga0070712_100155352 Ga0070712_1001553524 104
670 3300006175 Ga0070712_100358838 Ga0070712_1003588382 104
671 3300006175 Ga0070712_100882228 Ga0070712_1008822282 104
672 3300006177 Ga0075362_10009142 Ga0075362_100091422 104
673 3300006177 Ga0075362_10028490 Ga0075362_100284904 104
674 3300006177 Ga0075362_10265470 Ga0075362_102654702 104
675 3300006178 Ga0075367_10095154 Ga0075367_100951542 104
676 3300006178 Ga0075367_10613541 Ga0075367_106135412 104
677 3300006186 Ga0075369_10003443 Ga0075369_100034436 104
678 3300006186 Ga0075369_10142902 Ga0075369_101429022 104
679 3300006195 Ga0075366_10104526 Ga0075366_101045263 104
680 3300006237 Ga0097621_100091426 Ga0097621_1000914264 104
681 3300006237 Ga0097621_100135968 Ga0097621_1001359682 104
682 3300006237 Ga0097621_100463131 Ga0097621_1004631312 104
683 3300006237 Ga0097621_100847747 Ga0097621_1008477472 104
684 3300006237 Ga0097621_101103082 Ga0097621_1011030821 104
685 3300006353 Ga0075370_10233079 Ga0075370_102330792 104
686 3300006358 Ga0068871_100316253 Ga0068871_1003162532 104
687 3300006358 Ga0068871_100571276 Ga0068871_1005712762 104
688 3300006358 Ga0068871_100587366 Ga0068871_1005873662 104
689 3300006358 Ga0068871_100662154 Ga0068871_1006621542 104
690 3300006358 Ga0068871_101353061 Ga0068871_1013530612 104
691 3300006844 Ga0075428_100055506 Ga0075428_1000555065 104
692 3300006844 Ga0075428_100069496 Ga0075428_1000694964 104
693 3300006844 Ga0075428_100091938 Ga0075428_1000919384 104
694 3300006844 Ga0075428_100131245 Ga0075428_1001312452 104
695 3300006844 Ga0075428_100553409 Ga0075428_1005534092 104
696 3300006844 Ga0075428_101524373 Ga0075428_1015243732 104
697 3300006846 Ga0075430_100133466 Ga0075430_1001334665 104
698 3300006846 Ga0075430_100301325 Ga0075430_1003013252 104
699 3300006846 Ga0075430_100392591 Ga0075430_1003925912 104
700 3300006846 Ga0075430_101574710 Ga0075430_1015747101 104
701 3300006847 Ga0075431_100003503 Ga0075431_10000350318 104
702 3300006847 Ga0075431_100040605 Ga0075431_1000406055 104
703 3300006852 Ga0075433_10040008 Ga0075433_100400084 104
704 3300006852 Ga0075433_10102267 Ga0075433_101022674 104
705 3300006852 Ga0075433_10268366 Ga0075433_102683662 104
706 3300006852 Ga0075433_10955918 Ga0075433_109559182 104
707 3300006871 Ga0075434_100063778 Ga0075434_1000637784 104
708 3300006871 Ga0075434_100069351 Ga0075434_1000693512 104
709 3300006871 Ga0075434_100153740 Ga0075434_1001537405 104
710 3300006871 Ga0075434_100155737 Ga0075434_1001557375 104
711 3300006871 Ga0075434_100185510 Ga0075434_1001855102 104
712 3300006871 Ga0075434_100234300 Ga0075434_1002343004 104
713 3300006871 Ga0075434_101405985 Ga0075434_1014059852 104
714 3300006871 Ga0075434_101708911 Ga0075434_1017089111 104
715 3300006880 Ga0075429_100041550 Ga0075429_1000415504 104
716 3300006880 Ga0075429_100243267 Ga0075429_1002432672 104
717 3300006881 Ga0068865_100005623 Ga0068865_1000056236 104
718 3300006881 Ga0068865_100179744 Ga0068865_1001797443 104
719 3300006881 Ga0068865_100403629 Ga0068865_1004036292 104
720 3300006881 Ga0068865_100673291 Ga0068865_1006732911 104
721 3300006914 Ga0075436_100002180 Ga0075436_10000218014 104
722 3300006914 Ga0075436_100547121 Ga0075436_1005471211 104
723 3300006931 Ga0097620_100052965 Ga0097620_1000529655 104
724 3300006931 Ga0097620_100139316 Ga0097620_1001393162 104
725 3300006931 Ga0097620_100646462 Ga0097620_1006464622 104
726 3300007076 Ga0075435_100032313 Ga0075435_1000323136 104
727 3300007076 Ga0075435_100038516 Ga0075435_1000385164 104
728 3300007076 Ga0075435_100069144 Ga0075435_1000691444 104
729 3300007076 Ga0075435_100540609 Ga0075435_1005406092 104
730 3300007076 Ga0075435_101428083 Ga0075435_1014280832 104
731 3300007265 Ga0099794_10176997 Ga0099794_101769971 104
732 3300007788 Ga0099795_10085234 Ga0099795_100852342 104
733 3300007788 Ga0099795_10118325 Ga0099795_101183252 104
734 3300009011 Ga0105251_10187889 Ga0105251_101878892 104
735 3300009011 Ga0105251_10330457 Ga0105251_103304571 104
736 3300009092 Ga0105250_10050115 Ga0105250_100501152 104
737 3300009093 Ga0105240_10039464 Ga0105240_100394646 104
738 3300009094 Ga0111539_10041411 Ga0111539_1004141111 104
739 3300009094 Ga0111539_10234018 Ga0111539_102340185 104
740 3300009094 Ga0111539_10274886 Ga0111539_102748862 104
741 3300009094 Ga0111539_10483254 Ga0111539_104832542 104
742 3300009094 Ga0111539_11156146 Ga0111539_111561462 104
743 3300009094 Ga0111539_11629432 Ga0111539_116294322 104
744 3300009094 Ga0111539_11912337 Ga0111539_119123372 104
745 3300009098 Ga0105245_10000718 Ga0105245_100007183 104
746 3300009098 Ga0105245_10150129 Ga0105245_101501295 104
747 3300009098 Ga0105245_11157887 Ga0105245_111578871 104
748 3300009101 Ga0105247_10001104 Ga0105247_1000110415 104
749 3300009101 Ga0105247_10005639 Ga0105247_100056392 104
750 3300009101 Ga0105247_10009289 Ga0105247_100092898 104
751 3300009147 Ga0114129_10051465 Ga0114129_1005146513 104
752 3300009147 Ga0114129_10055672 Ga0114129_100556726 104
753 3300009147 Ga0114129_10056000 Ga0114129_100560009 104
754 3300009147 Ga0114129_10093675 Ga0114129_100936752 104
755 3300009147 Ga0114129_10324925 Ga0114129_103249253 104
756 3300009147 Ga0114129_10358846 Ga0114129_103588462 104
757 3300009147 Ga0114129_12501117 Ga0114129_125011171 104
758 3300009148 Ga0105243_10001752 Ga0105243_1000175217 104
759 3300009148 Ga0105243_10013879 Ga0105243_100138797 104
760 3300009148 Ga0105243_10239071 Ga0105243_102390713 104
761 3300009148 Ga0105243_10643693 Ga0105243_106436932 104
762 3300009148 Ga0105243_12578077 Ga0105243_125780772 104
763 3300009174 Ga0105241_10003357 Ga0105241_1000335712 104
764 3300009174 Ga0105241_10041206 Ga0105241_100412062 104
765 3300009174 Ga0105241_10107361 Ga0105241_101073615 104
766 3300009174 Ga0105241_11165184 Ga0105241_111651841 104
767 3300009176 Ga0105242_10004159 Ga0105242_100041595 104
768 3300009176 Ga0105242_10171628 Ga0105242_101716285 104
769 3300009177 Ga0105248_10002832 Ga0105248_1000283218 104
770 3300009177 Ga0105248_10049856 Ga0105248_100498567 104
771 3300009177 Ga0105248_10152794 Ga0105248_101527944 104
772 3300009545 Ga0105237_10001618 Ga0105237_100016185 104
773 3300009545 Ga0105237_11178663 Ga0105237_111786632 104
774 3300009551 Ga0105238_10068253 Ga0105238_100682533 104
775 3300009551 Ga0105238_10315729 Ga0105238_103157293 104
776 3300009551 Ga0105238_10808005 Ga0105238_108080052 104
777 3300009551 Ga0105238_11380623 Ga0105238_113806232 104
778 3300009553 Ga0105249_10002122 Ga0105249_1000212213 104
779 3300009553 Ga0105249_10019915 Ga0105249_100199155 104
780 3300009553 Ga0105249_10207100 Ga0105249_102071005 104
781 3300009987 Ga0105030_105473 Ga0105030_1054732 104
782 3300010375 Ga0105239_10002536 Ga0105239_1000253610 104
783 3300010375 Ga0105239_10686464 Ga0105239_106864642 104
784 3300010375 Ga0105239_10952171 Ga0105239_109521712 104
785 3300010375 Ga0105239_11182797 Ga0105239_111827972 104
786 3300011119 Ga0105246_10002439 Ga0105246_100024392 104
787 3300011119 Ga0105246_10539117 Ga0105246_105391172 104
788 3300011119 Ga0105246_10672572 Ga0105246_106725722 104
789 3300011119 Ga0105246_10996248 Ga0105246_109962481 104
790 3300012483 Ga0157337_1036464 Ga0157337_10364642 104
791 3300012515 Ga0157338_1018783 Ga0157338_10187831 104
792 3300013102 Ga0157371_10008731 Ga0157371_100087313 104
793 3300013102 Ga0157371_10182572 Ga0157371_101825723 104
794 3300013102 Ga0157371_10324711 Ga0157371_103247113 104
795 3300013104 Ga0157370_10234537 Ga0157370_102345374 104
796 3300013104 Ga0157370_10643449 Ga0157370_106434492 104
797 3300013105 Ga0157369_10001227 Ga0157369_1000122714 104
798 3300013105 Ga0157369_10077891 Ga0157369_100778917 104
799 3300013105 Ga0157369_10444632 Ga0157369_104446323 104
800 3300013296 Ga0157374_10019573 Ga0157374_100195732 104
801 3300013296 Ga0157374_10237035 Ga0157374_102370354 104
802 3300013296 Ga0157374_11774222 Ga0157374_117742222 104
803 3300013296 Ga0157374_12545409 Ga0157374_125454092 104
804 3300013297 Ga0157378_10000470 Ga0157378_1000047020 104
805 3300013297 Ga0157378_10160004 Ga0157378_101600045 104
806 3300013297 Ga0157378_10222004 Ga0157378_102220043 104
807 3300013297 Ga0157378_10264832 Ga0157378_102648323 104
808 3300013297 Ga0157378_13255051 Ga0157378_132550511 104
809 3300013306 Ga0163162_10010877 Ga0163162_100108776 104
810 3300013306 Ga0163162_10526980 Ga0163162_105269802 104
811 3300013306 Ga0163162_11148476 Ga0163162_111484762 104
812 3300013307 Ga0157372_10001215 Ga0157372_1000121519 104
813 3300013307 Ga0157372_11744327 Ga0157372_117443272 104
814 3300013308 Ga0157375_10001640 Ga0157375_1000164011 104
815 3300013308 Ga0157375_10007439 Ga0157375_1000743916 104
816 3300013308 Ga0157375_10150710 Ga0157375_101507103 104
817 3300013308 Ga0157375_10326790 Ga0157375_103267902 104
818 3300014325 Ga0163163_10005311 Ga0163163_1000531118 104
819 3300014325 Ga0163163_10020116 Ga0163163_100201162 104
820 3300014325 Ga0163163_10024251 Ga0163163_100242515 104
821 3300014325 Ga0163163_10072150 Ga0163163_100721502 104
822 3300014325 Ga0163163_11312134 Ga0163163_113121342 104
823 3300014325 Ga0163163_12749307 Ga0163163_127493072 104
824 3300014326 Ga0157380_10037923 Ga0157380_100379239 104
825 3300014326 Ga0157380_12349138 Ga0157380_123491382 104
826 3300014745 Ga0157377_10001529 Ga0157377_1000152913 104
827 3300014745 Ga0157377_10001603 Ga0157377_100016033 104
828 3300014745 Ga0157377_11143448 Ga0157377_111434481 104
829 3300014968 Ga0157379_10001927 Ga0157379_1000192720 104
830 3300014968 Ga0157379_10054921 Ga0157379_100549215 104
831 3300014968 Ga0157379_10089976 Ga0157379_100899765 104
832 3300014968 Ga0157379_10221483 Ga0157379_102214833 104
833 3300014968 Ga0157379_10901122 Ga0157379_109011222 104
834 3300014969 Ga0157376_10013610 Ga0157376_100136103 104
835 3300014969 Ga0157376_10066977 Ga0157376_100669775 104
836 3300014969 Ga0157376_10138607 Ga0157376_101386072 104
837 3300017792 Ga0163161_10005439 Ga0163161_1000543911 104
838 3300017792 Ga0163161_10008942 Ga0163161_100089428 104
839 3300017792 Ga0163161_10517706 Ga0163161_105177061 104
840 3300017792 Ga0163161_10689052 Ga0163161_106890522 104
841 3300017792 Ga0163161_10989844 Ga0163161_109898442 104
842 3300020070 Ga0206356_10060013 Ga0206356_100600132 104
843 3300020082 Ga0206353_10187901 Ga0206353_101879012 104
844 3300020082 Ga0206353_10221297 Ga0206353_102212972 104
845 3300020082 Ga0206353_11955118 Ga0206353_119551182 104
846 3300021361 Ga0213872_10047148 Ga0213872_100471481 104
847 3300021361 Ga0213872_10282788 Ga0213872_102827882 104
848 3300021384 Ga0213876_10164987 Ga0213876_101649872 104
849 3300021384 Ga0213876_10280961 Ga0213876_102809612 104
850 3300025315 Ga0207697_10150474 Ga0207697_101504742 104
851 3300025321 Ga0207656_10031281 Ga0207656_100312815 104
852 3300025321 Ga0207656_10079040 Ga0207656_100790402 104
853 3300025885 Ga0207653_10015755 Ga0207653_100157552 104
854 3300025885 Ga0207653_10097229 Ga0207653_100972292 104
855 3300025898 Ga0207692_10008689 Ga0207692_100086896 104
856 3300025898 Ga0207692_10019276 Ga0207692_100192765 104
857 3300025898 Ga0207692_10228836 Ga0207692_102288362 104
858 3300025898 Ga0207692_10391819 Ga0207692_103918192 104
859 3300025898 Ga0207692_10455847 Ga0207692_104558472 104
860 3300025898 Ga0207692_10643785 Ga0207692_106437852 104
861 3300025899 Ga0207642_10043170 Ga0207642_100431702 104
862 3300025900 Ga0207710_10002653 Ga0207710_100026533 104
863 3300025900 Ga0207710_10028106 Ga0207710_100281064 104
864 3300025900 Ga0207710_10056175 Ga0207710_100561754 104
865 3300025901 Ga0207688_10002321 Ga0207688_1000232118 104
866 3300025901 Ga0207688_10002614 Ga0207688_100026145 104
867 3300025903 Ga0207680_10023670 Ga0207680_100236705 104
868 3300025903 Ga0207680_10782634 Ga0207680_107826342 104
869 3300025904 Ga0207647_10001458 Ga0207647_1000145814 104
870 3300025904 Ga0207647_10014266 Ga0207647_100142666 104
871 3300025905 Ga0207685_10000290 Ga0207685_100002905 104
872 3300025905 Ga0207685_10240862 Ga0207685_102408621 104
873 3300025905 Ga0207685_10249876 Ga0207685_102498762 104
874 3300025906 Ga0207699_10002558 Ga0207699_100025588 104
875 3300025906 Ga0207699_10625272 Ga0207699_106252721 104
876 3300025906 Ga0207699_10805405 Ga0207699_108054052 104
877 3300025906 Ga0207699_11326644 Ga0207699_113266442 104
878 3300025907 Ga0207645_10011689 Ga0207645_100116899 104
879 3300025907 Ga0207645_10016093 Ga0207645_100160935 104
880 3300025908 Ga0207643_10002622 Ga0207643_100026229 104
881 3300025908 Ga0207643_10142261 Ga0207643_101422613 104
882 3300025908 Ga0207643_10238621 Ga0207643_102386212 104
883 3300025909 Ga0207705_10005544 Ga0207705_100055448 104
884 3300025909 Ga0207705_10024761 Ga0207705_100247615 104
885 3300025909 Ga0207705_10291800 Ga0207705_102918002 104
886 3300025909 Ga0207705_10994375 Ga0207705_109943751 104
887 3300025910 Ga0207684_10040904 Ga0207684_100409041 104
888 3300025910 Ga0207684_10050801 Ga0207684_100508016 104
889 3300025911 Ga0207654_10050857 Ga0207654_100508572 104
890 3300025912 Ga0207707_10009792 Ga0207707_100097928 104
891 3300025912 Ga0207707_10194309 Ga0207707_101943094 104
892 3300025912 Ga0207707_10452187 Ga0207707_104521873 104
893 3300025912 Ga0207707_11178404 Ga0207707_111784042 104
894 3300025913 Ga0207695_10012684 Ga0207695_1001268411 104
895 3300025913 Ga0207695_10136830 Ga0207695_101368305 104
896 3300025915 Ga0207693_10000493 Ga0207693_1000049327 104
897 3300025915 Ga0207693_10004694 Ga0207693_1000469414 104
898 3300025915 Ga0207693_10004752 Ga0207693_100047525 104
899 3300025915 Ga0207693_10065973 Ga0207693_100659736 104
900 3300025915 Ga0207693_10074134 Ga0207693_100741345 104
901 3300025915 Ga0207693_10106487 Ga0207693_101064875 104
902 3300025915 Ga0207693_10299198 Ga0207693_102991982 104
903 3300025915 Ga0207693_10315032 Ga0207693_103150322 104
904 3300025915 Ga0207693_10494694 Ga0207693_104946942 104
905 3300025916 Ga0207663_10005514 Ga0207663_100055145 104
906 3300025916 Ga0207663_10048237 Ga0207663_100482372 104
907 3300025916 Ga0207663_10049634 Ga0207663_100496343 104
908 3300025916 Ga0207663_10120602 Ga0207663_101206024 104
909 3300025916 Ga0207663_10203262 Ga0207663_102032622 104
910 3300025916 Ga0207663_10403581 Ga0207663_104035811 104
911 3300025917 Ga0207660_10071001 Ga0207660_100710014 104
912 3300025917 Ga0207660_10073946 Ga0207660_100739464 104
913 3300025917 Ga0207660_10109315 Ga0207660_101093152 104
914 3300025917 Ga0207660_10266788 Ga0207660_102667882 104
915 3300025917 Ga0207660_10799462 Ga0207660_107994622 104
916 3300025917 Ga0207660_10930916 Ga0207660_109309161 104
917 3300025917 Ga0207660_11193394 Ga0207660_111933941 104
918 3300025918 Ga0207662_10002711 Ga0207662_1000271113 104
919 3300025918 Ga0207662_10034508 Ga0207662_100345082 104
920 3300025918 Ga0207662_10225742 Ga0207662_102257423 104
921 3300025919 Ga0207657_10000282 Ga0207657_1000028239 104
922 3300025919 Ga0207657_10023849 Ga0207657_100238495 104
923 3300025920 Ga0207649_10001010 Ga0207649_1000101019 104
924 3300025920 Ga0207649_10472851 Ga0207649_104728512 104
925 3300025920 Ga0207649_11622124 Ga0207649_116221241 104
926 3300025921 Ga0207652_10013408 Ga0207652_100134089 104
927 3300025921 Ga0207652_10237592 Ga0207652_102375923 104
928 3300025921 Ga0207652_10259630 Ga0207652_102596304 104
929 3300025921 Ga0207652_10342562 Ga0207652_103425622 104
930 3300025921 Ga0207652_11037422 Ga0207652_110374222 104
931 3300025922 Ga0207646_10283451 Ga0207646_102834514 104
932 3300025922 Ga0207646_10746081 Ga0207646_107460812 104
933 3300025923 Ga0207681_10020922 Ga0207681_100209222 104
934 3300025923 Ga0207681_10029567 Ga0207681_100295672 104
935 3300025923 Ga0207681_10404259 Ga0207681_104042592 104
936 3300025924 Ga0207694_10030650 Ga0207694_100306506 104
937 3300025924 Ga0207694_10231602 Ga0207694_102316022 104
938 3300025924 Ga0207694_11231220 Ga0207694_112312202 104
939 3300025925 Ga0207650_10012017 Ga0207650_100120176 104
940 3300025925 Ga0207650_10014747 Ga0207650_100147474 104
941 3300025925 Ga0207650_10803324 Ga0207650_108033242 104
942 3300025926 Ga0207659_10090636 Ga0207659_100906364 104
943 3300025926 Ga0207659_10184311 Ga0207659_101843114 104
944 3300025926 Ga0207659_11260496 Ga0207659_112604962 104
945 3300025927 Ga0207687_10022775 Ga0207687_100227756 104
946 3300025927 Ga0207687_10084329 Ga0207687_100843295 104
947 3300025928 Ga0207700_10009359 Ga0207700_100093595 104
948 3300025928 Ga0207700_10085165 Ga0207700_100851655 104
949 3300025928 Ga0207700_10110505 Ga0207700_101105051 104
950 3300025928 Ga0207700_10209760 Ga0207700_102097602 104
951 3300025928 Ga0207700_10538468 Ga0207700_105384681 104
952 3300025928 Ga0207700_11111194 Ga0207700_111111942 104
953 3300025929 Ga0207664_10032209 Ga0207664_100322095 104
954 3300025929 Ga0207664_10032967 Ga0207664_100329676 104
955 3300025929 Ga0207664_10391707 Ga0207664_103917073 104
956 3300025929 Ga0207664_10900364 Ga0207664_109003642 104
957 3300025931 Ga0207644_10017754 Ga0207644_100177541 104
958 3300025931 Ga0207644_10240700 Ga0207644_102407001 104
959 3300025932 Ga0207690_10013638 Ga0207690_100136383 104
960 3300025932 Ga0207690_10033103 Ga0207690_100331035 104
961 3300025932 Ga0207690_11013553 Ga0207690_110135531 104
962 3300025933 Ga0207706_10000270 Ga0207706_1000027040 104
963 3300025933 Ga0207706_10002966 Ga0207706_1000296615 104
964 3300025933 Ga0207706_10610389 Ga0207706_106103891 104
965 3300025934 Ga0207686_10029250 Ga0207686_100292505 104
966 3300025934 Ga0207686_10061736 Ga0207686_100617363 104
967 3300025934 Ga0207686_10120517 Ga0207686_101205172 104
968 3300025935 Ga0207709_10003044 Ga0207709_100030445 104
969 3300025935 Ga0207709_10044613 Ga0207709_100446131 104
970 3300025935 Ga0207709_10772963 Ga0207709_107729632 104
971 3300025935 Ga0207709_11163088 Ga0207709_111630882 104
972 3300025936 Ga0207670_10014460 Ga0207670_100144606 104
973 3300025936 Ga0207670_10073263 Ga0207670_100732635 104
974 3300025936 Ga0207670_10794669 Ga0207670_107946691 104
975 3300025937 Ga0207669_10005870 Ga0207669_100058706 104
976 3300025937 Ga0207669_10014807 Ga0207669_100148075 104
977 3300025937 Ga0207669_10186680 Ga0207669_101866802 104
978 3300025937 Ga0207669_10476584 Ga0207669_104765842 104
979 3300025937 Ga0207669_10867338 Ga0207669_108673381 104
980 3300025937 Ga0207669_11633935 Ga0207669_116339351 104
981 3300025938 Ga0207704_10016350 Ga0207704_100163506 104
982 3300025938 Ga0207704_10069539 Ga0207704_100695392 104
983 3300025938 Ga0207704_10183570 Ga0207704_101835702 104
984 3300025938 Ga0207704_11842970 Ga0207704_118429701 104
985 3300025939 Ga0207665_10001538 Ga0207665_1000153818 104
986 3300025939 Ga0207665_10006468 Ga0207665_1000646810 104
987 3300025939 Ga0207665_10106545 Ga0207665_101065452 104
988 3300025939 Ga0207665_10303651 Ga0207665_103036511 104
989 3300025939 Ga0207665_10522790 Ga0207665_105227902 104
990 3300025940 Ga0207691_10010501 Ga0207691_100105018 104
991 3300025940 Ga0207691_10023983 Ga0207691_1002398310 104
992 3300025940 Ga0207691_10488293 Ga0207691_104882932 104
993 3300025941 Ga0207711_10013882 Ga0207711_100138825 104
994 3300025941 Ga0207711_10062779 Ga0207711_100627794 104
995 3300025941 Ga0207711_10202865 Ga0207711_102028652 104
996 3300025942 Ga0207689_10006518 Ga0207689_100065189 104
997 3300025942 Ga0207689_10436683 Ga0207689_104366832 104
998 3300025944 Ga0207661_10038656 Ga0207661_100386565 104
999 3300025944 Ga0207661_10063827 Ga0207661_100638275 104
1000 3300025945 Ga0207679_10020167 Ga0207679_100201675 104
1001 3300025945 Ga0207679_10100954 Ga0207679_101009542 104
1002 3300025949 Ga0207667_10004001 Ga0207667_1000400111 104
1003 3300025949 Ga0207667_10010619 Ga0207667_100106192 104
1004 3300025949 Ga0207667_10248836 Ga0207667_102488362 104
1005 3300025949 Ga0207667_11662079 Ga0207667_116620791 104
1006 3300025960 Ga0207651_10006413 Ga0207651_100064135 104
1007 3300025960 Ga0207651_10359711 Ga0207651_103597112 104
1008 3300025961 Ga0207712_10010018 Ga0207712_100100185 104
1009 3300025961 Ga0207712_10023440 Ga0207712_100234405 104
1010 3300025961 Ga0207712_10047602 Ga0207712_100476022 104
1011 3300025972 Ga0207668_10001057 Ga0207668_1000105714 104
1012 3300025972 Ga0207668_10173698 Ga0207668_101736983 104
1013 3300025972 Ga0207668_10189790 Ga0207668_101897902 104
1014 3300025981 Ga0207640_10007947 Ga0207640_100079476 104
1015 3300025981 Ga0207640_10030939 Ga0207640_100309395 104
1016 3300025986 Ga0207658_10007478 Ga0207658_100074785 104
1017 3300025986 Ga0207658_10086922 Ga0207658_100869225 104
1018 3300025986 Ga0207658_10930718 Ga0207658_109307181 104
1019 3300026023 Ga0207677_10045718 Ga0207677_100457182 104
1020 3300026023 Ga0207677_10489404 Ga0207677_104894042 104
1021 3300026023 Ga0207677_10945075 Ga0207677_109450752 104
1022 3300026035 Ga0207703_10010584 Ga0207703_100105845 104
1023 3300026035 Ga0207703_10024714 Ga0207703_100247144 104
1024 3300026035 Ga0207703_10305115 Ga0207703_103051152 104
1025 3300026035 Ga0207703_10437839 Ga0207703_104378392 104
1026 3300026041 Ga0207639_10004087 Ga0207639_100040875 104
1027 3300026041 Ga0207639_10143507 Ga0207639_101435075 104
1028 3300026041 Ga0207639_10926900 Ga0207639_109269002 104
1029 3300026067 Ga0207678_10000477 Ga0207678_1000047730 104
1030 3300026067 Ga0207678_10007497 Ga0207678_1000749716 104
1031 3300026067 Ga0207678_11003446 Ga0207678_110034462 104
1032 3300026067 Ga0207678_11065359 Ga0207678_110653592 104
1033 3300026075 Ga0207708_10000337 Ga0207708_1000033720 104
1034 3300026075 Ga0207708_10003609 Ga0207708_1000360919 104
1035 3300026078 Ga0207702_10194962 Ga0207702_101949621 104
1036 3300026078 Ga0207702_11723392 Ga0207702_117233922 104
1037 3300026088 Ga0207641_10024140 Ga0207641_100241405 104
1038 3300026088 Ga0207641_10180092 Ga0207641_101800922 104
1039 3300026088 Ga0207641_10206999 Ga0207641_102069994 104
1040 3300026088 Ga0207641_10623926 Ga0207641_106239262 104
1041 3300026089 Ga0207648_10005612 Ga0207648_1000561210 104
1042 3300026089 Ga0207648_10258789 Ga0207648_102587892 104
1043 3300026095 Ga0207676_10014591 Ga0207676_100145916 104
1044 3300026095 Ga0207676_10022810 Ga0207676_100228106 104
1045 3300026095 Ga0207676_10402391 Ga0207676_104023912 104
1046 3300026095 Ga0207676_10579687 Ga0207676_105796872 104
1047 3300026095 Ga0207676_12209346 Ga0207676_122093461 104
1048 3300026116 Ga0207674_10002865 Ga0207674_1000286511 104
1049 3300026116 Ga0207674_10182232 Ga0207674_101822321 104
1050 3300026116 Ga0207674_10404168 Ga0207674_104041682 104
1051 3300026116 Ga0207674_11063222 Ga0207674_110632222 104
1052 3300026118 Ga0207675_100002251 Ga0207675_10000225120 104
1053 3300026118 Ga0207675_100003007 Ga0207675_10000300720 104
1054 3300026118 Ga0207675_100030423 Ga0207675_1000304238 104
1055 3300026118 Ga0207675_101588383 Ga0207675_1015883831 104
1056 3300026121 Ga0207683_10000681 Ga0207683_1000068114 104
1057 3300026121 Ga0207683_10018094 Ga0207683_100180944 104
1058 3300026121 Ga0207683_10335602 Ga0207683_103356023 104
1059 3300026121 Ga0207683_10583984 Ga0207683_105839842 104
1060 3300026121 Ga0207683_10738797 Ga0207683_107387972 104
1061 3300026142 Ga0207698_10080301 Ga0207698_100803012 104
1062 3300026142 Ga0207698_10594596 Ga0207698_105945962 104
1063 3300027360 Ga0209969_1085288 Ga0209969_10852881 104
1064 3300027682 Ga0209971_1099285 Ga0209971_10992852 104
1065 3300027907 Ga0207428_10069161 Ga0207428_100691614 104
1066 3300027907 Ga0207428_10114091 Ga0207428_101140912 104
1067 3300027907 Ga0207428_10703191 Ga0207428_107031912 104
1068 3300028379 Ga0268266_10034032 Ga0268266_100340326 104
1069 3300028379 Ga0268266_10172079 Ga0268266_101720794 104
1070 3300028379 Ga0268266_11250728 Ga0268266_112507282 104
1071 3300028380 Ga0268265_10019608 Ga0268265_100196082 104
1072 3300028380 Ga0268265_10322285 Ga0268265_103222852 104
1073 3300028380 Ga0268265_11879117 Ga0268265_118791171 104
1074 3300028381 Ga0268264_10076694 Ga0268264_100766944 104
1075 3300028381 Ga0268264_10095860 Ga0268264_100958602 104
1076 3300028381 Ga0268264_10289811 Ga0268264_102898113 104
1077 3300028381 Ga0268264_10431172 Ga0268264_104311722 104
1078 3300028381 Ga0268264_12041028 Ga0268264_120410282 104
1079 3300028381 Ga0268264_12358376 Ga0268264_123583761 104
1080 3300030760 Ga0265762_1004970 Ga0265762_10049705 104
1081 3300031238 Ga0265332_10002691 Ga0265332_100026914 104
1082 3300031241 Ga0265325_10123119 Ga0265325_101231192 104
1083 3300031242 Ga0265329_10009828 Ga0265329_100098285 104
1084 3300031247 Ga0265340_10002851 Ga0265340_1000285117 104
1085 3300031249 Ga0265339_10006770 Ga0265339_100067705 104
1086 3300031250 Ga0265331_10026076 Ga0265331_100260764 104
1087 3300031344 Ga0265316_10350364 Ga0265316_103503642 104
1088 3300031595 Ga0265313_10004533 Ga0265313_1000453312 104
1089 3300031665 Ga0316575_10000986 Ga0316575_100009865 104
1090 3300031665 Ga0316575_10207013 Ga0316575_102070132 104
1091 3300031691 Ga0316579_10033081 Ga0316579_100330812 104
1092 3300031712 Ga0265342_10000448 Ga0265342_1000044842 104
1093 3300031712 Ga0265342_10115179 Ga0265342_101151792 104
1094 3300031727 Ga0316576_10005834 Ga0316576_1000583414 104
1095 3300031728 Ga0316578_10039175 Ga0316578_100391753 104
1096 3300031728 Ga0316578_10826644 Ga0316578_108266442 104
1097 3300031733 Ga0316577_10032670 Ga0316577_100326703 104
1098 3300031995 Ga0307409_101406426 Ga0307409_1014064261 104
1099 3300032126 Ga0307415_101066537 Ga0307415_1010665372 104
1100 3300032126 Ga0307415_101262848 Ga0307415_1012628481 104
1101 3300032133 Ga0316583_10000484 Ga0316583_1000048413 104
1102 3300032137 Ga0316585_10002061 Ga0316585_100020615 104
1103 3300032139 Ga0316580_10020547 Ga0316580_100205475 104
1104 3300032168 Ga0316593_10000349 Ga0316593_100003492 104
1105 3300032168 Ga0316593_10054391 Ga0316593_100543913 104
1106 3300032168 Ga0316593_10196779 Ga0316593_101967791 104
1107 3300033524 Ga0316592_1041458 Ga0316592_10414582 104
1108 3300033528 Ga0316588_1047158 Ga0316588_10471582 104
1109 3300033541 Ga0316596_1000615 Ga0316596_100061513 104
1110 3300034817 Ga0373948_0168302 Ga0373948_0168302_149_511 104
1111 3300034818 Ga0373950_0047162 Ga0373950_0047162_242_604 104
1112 3300034819 Ga0373958_0019124 Ga0373958_0019124_323_685 104
1113 3300035083 Ga0373926_0045218 Ga0373926_0045218_1020_1382 104
1114 3300035084 Ga0373928_0004396 Ga0373928_0004396_321_683 104
1115 3300035084 Ga0373928_0014834 Ga0373928_0014834_236_598 104
1116 3300035085 Ga0373929_0020926 Ga0373929_0020926_242_604 104
1117 3300035085 Ga0373929_0153856 Ga0373929_0153856_151_513 104
1118 3300035086 Ga0373934_0014666 Ga0373934_0014666_55_417 104
1119 3300035086 Ga0373934_0015790 Ga0373934_0015790_1507_1869 104
1120 3300035088 Ga0373940_0035043 Ga0373940_0035043_939_1301 104
1121 3300035088 Ga0373940_0357942 Ga0373940_0357942_127_489 104
1122 3300035089 Ga0373944_0143495 Ga0373944_0143495_179_541 104
1123 3300035090 Ga0373949_0009948 Ga0373949_0009948_1240_1602 104
1124 3300035091 Ga0373951_0041137 Ga0373951_0041137_471_833 104
1125 3300035091 Ga0373951_0065450 Ga0373951_0065450_259_621 104
1126 3300035092 Ga0373952_0103999 Ga0373952_0103999_63_425 104
1127 3300035111 Ga0373923_0017765 Ga0373923_0017765_900_1262 104
1128 3300035111 Ga0373923_0113960 Ga0373923_0113960_704_1066 104
1129 3300035111 Ga0373923_0144119 Ga0373923_0144119_80_442 104
1130 3300035111 Ga0373923_0461157 Ga0373923_0461157_79_447 104
1131 3300035112 Ga0373932_0036377 Ga0373932_0036377_417_779 104
1132 3300035112 Ga0373932_0103894 Ga0373932_0103894_486_848 104
1133 3300035112 Ga0373932_0213658 Ga0373932_0213658_286_648 104
1134 3300035113 Ga0373936_0123083 Ga0373936_0123083_609_971 104
1135 3300035114 Ga0373939_0006547 Ga0373939_0006547_1708_2070 104
1136 3300035114 Ga0373939_0007725 Ga0373939_0007725_467_829 104
1137 3300035114 Ga0373939_0033667 Ga0373939_0033667_940_1302 104
1138 3300035114 Ga0373939_0200449 Ga0373939_0200449_240_602 104
1139 3300035115 Ga0373941_0018441 Ga0373941_0018441_466_828 104
1140 3300035115 Ga0373941_0037958 Ga0373941_0037958_850_1212 104
1141 3300035116 Ga0373945_0013612 Ga0373945_0013612_864_1226 104
1142 3300035117 Ga0373953_0087582 Ga0373953_0087582_191_553 104
1143 3300035118 Ga0373954_0002392 Ga0373954_0002392_5266_5628 104
1144 3300035118 Ga0373954_0023678 Ga0373954_0023678_965_1327 104
1145 3300035118 Ga0373954_0517109 Ga0373954_0517109_46_408 104
1146 3300035119 Ga0373956_0004726 Ga0373956_0004726_177_539 104
1147 3300035119 Ga0373956_0257559 Ga0373956_0257559_337_699 104
1148 3300035119 Ga0373956_0512380 Ga0373956_0512380_146_514 104
1149 3300035120 Ga0373957_0011973 Ga0373957_0011973_1737_2099 104
1150 3300035120 Ga0373957_0258057 Ga0373957_0258057_298_660 104
1151 3300035121 Ga0373960_0009519 Ga0373960_0009519_1699_2061 104
1152 3300035121 Ga0373960_0015717 Ga0373960_0015717_283_645 104
1153 3300035121 Ga0373960_0274883 Ga0373960_0274883_99_461 104
1154 3300035170 Ga0373943_0006870 Ga0373943_0006870_2295_2657 104
1155 3300035170 Ga0373943_0017824 Ga0373943_0017824_1572_1934 104
1156 3300035170 Ga0373943_0112261 Ga0373943_0112261_81_443 104
1157 3300035170 Ga0373943_0148474 Ga0373943_0148474_353_715 104
1158 3300035171 Ga0373946_0028041 Ga0373946_0028041_925_1287 104
1159 3300035171 Ga0373946_0207209 Ga0373946_0207209_312_674 104
1160 3300035171 Ga0373946_0318895 Ga0373946_0318895_107_469 104
1161 3300035171 Ga0373946_0756430 Ga0373946_0756430_103_465 104
1162 3300035172 Ga0373955_0012493 Ga0373955_0012493_2447_2809 104
1163 3300035207 Ga0373942_0006754 Ga0373942_0006754_537_899 104
1164 3300035207 Ga0373942_0171205 Ga0373942_0171205_266_628 104
1165 3300035207 Ga0373942_0308843 Ga0373942_0308843_113_475 104
1166 3300035241 Ga0373961_0003340 Ga0373961_0003340_2169_2531 104
1167 3300035241 Ga0373961_0213615 Ga0373961_0213615_105_473 104
1168 3300035242 Ga0373962_0006059 Ga0373962_0006059_199_561 104
1169 3300035398 Ga0316574_0001643 Ga0316574_0001643_1718_2080 104
1170 3300035691 Ga0373931_0004918 Ga0373931_0004918_5693_6055 104
1171 3300035691 Ga0373931_0005070 Ga0373931_0005070_2619_2981 104
1172 3300035691 Ga0373931_0021991 Ga0373931_0021991_1127_1489 104
1173 3300035691 Ga0373931_0041263 Ga0373931_0041263_952_1314 104
1174 3300035691 Ga0373931_0183942 Ga0373931_0183942_254_616 104
1175 3300035692 Ga0373935_0015950 Ga0373935_0015950_4163_4525 104
1176 3300035692 Ga0373935_0023121 Ga0373935_0023121_1866_2228 104
1177 3300035692 Ga0373935_0054814 Ga0373935_0054814_269_631 104
1178 3300035695 Ga0373927_0003573 Ga0373927_0003573_9461_9823 104
1179 3300035695 Ga0373927_0044694 Ga0373927_0044694_337_699 104
1180 3300035695 Ga0373927_0090178 Ga0373927_0090178_467_829 104
1181 3300035695 Ga0373927_0106806 Ga0373927_0106806_1037_1399 104
1182 3300035695 Ga0373927_0183618 Ga0373927_0183618_243_605 104
1183 3300035695 Ga0373927_0188859 Ga0373927_0188859_243_605 104
1184 3300035724 Ga0373933_0000858 Ga0373933_0000858_15387_15749 104
1185 3300035724 Ga0373933_0004782 Ga0373933_0004782_2959_3321 104
1186 3300035724 Ga0373933_0155749 Ga0373933_0155749_876_1244 104
1187 3300035724 Ga0373933_0962484 Ga0373933_0962484_59_421 104
1188 3300035725 Ga0373947_0090707 Ga0373947_0090707_1091_1453 104
1189 3300035725 Ga0373947_0188861 Ga0373947_0188861_708_1070 104
1190 3300035725 Ga0373947_0269760 Ga0373947_0269760_729_1091 104
1191 3300035725 Ga0373947_0482221 Ga0373947_0482221_343_705 104
1192 3300036401 Ga0373937_0001081 Ga0373937_0001081_6193_6555 104
1193 3300036401 Ga0373937_0069217 Ga0373937_0069217_2865_3227 104
1194 3300036401 Ga0373937_0138840 Ga0373937_0138840_115_477 104
1195 3300036401 Ga0373937_0230888 Ga0373937_0230888_328_690 104
1196 3300036401 Ga0373937_0244129 Ga0373937_0244129_102_464 104
1197 3300036401 Ga0373937_1100805 Ga0373937_1100805_123_485 104
1198 3300036647 Ga0316582_0056650 Ga0316582_0056650_1446_1808 104
1199 3300036712 Ga0316584_0001849 Ga0316584_0001849_10218_10580 104
1200 3300037068 Ga0373925_0071988 Ga0373925_0071988_1252_1614 104
1201 3300037068 Ga0373925_0089443 Ga0373925_0089443_226_588 104
1202 3300037312 Ga0395899_0203983 Ga0395899_0203983_203_565 104
1203 3300037312 Ga0395899_0499096 Ga0395899_0499096_180_542 104
1204 3300037418 Ga0395900_0032155 Ga0395900_0032155_4224_4586 104
1205 3300037466 Ga0395898_0020934 Ga0395898_0020934_3909_4271 104
1206 3300037466 Ga0395898_1076214 Ga0395898_1076214_172_534 104
1207 3300037471 Ga0395905_0002506 Ga0395905_0002506_16882_17244 104
1208 3300037471 Ga0395905_0471539 Ga0395905_0471539_341_703 104
1209 3300037588 Ga0316581_0013780 Ga0316581_0013780_135_497 104
1210 3300038443 Ga0395901_0020211 Ga0395901_0020211_6315_6677 104
1211 3300038443 Ga0395901_0039094 Ga0395901_0039094_3426_3788 104
1212 3300039062 Ga0400483_046311 Ga0400483_046311_2895_3257 104
1213 3300039062 Ga0400483_057660 Ga0400483_057660_4895_5257 104
1214 3300039062 Ga0400483_217885 Ga0400483_217885_8332_8694 104
1215 3300039062 Ga0400483_283959 Ga0400483_283959_2363_2725 104
1216 3300039437 Ga0436365_0220024 Ga0436365_0220024_641_1003 104
1217 3300039437 Ga0436365_1158777 Ga0436365_1158777_632_994 104
1218 3300039438 Ga0436360_0347915 Ga0436360_0347915_717_1079 104
1219 3300039438 Ga0436360_1007310 Ga0436360_1007310_41_403 104
1220 3300039447 Ga0436361_0316570 Ga0436361_0316570_8632_8994 104
1221 3300039447 Ga0436361_0411891 Ga0436361_0411891_567_929 104
1222 3300039447 Ga0436361_0776613 Ga0436361_0776613_778_1140 104
1223 3300039450 Ga0436363_0866799 Ga0436363_0866799_110_472 104
1224 3300041408 Ga0439453_0007095 Ga0439453_0007095_1036_1398 104
1225 3300041496 Ga0451839_0771846 Ga0451839_0771846_25_387 104
1226 3300042437 Ga0439444_0066116 Ga0439444_0066116_327_689 104
1227 3300044683 Ga0466965_0704194 Ga0466965_0704194_122_484 104
1228 3300044693 Ga0466961_0078638 Ga0466961_0078638_1441_1809 104
1229 3300044706 Ga0466964_0104897 Ga0466964_0104897_629_991 104
1230 3300044842 Ga0466957_0059645 Ga0466957_0059645_63_431 104
1231 3300044842 Ga0466957_0090325 Ga0466957_0090325_715_1083 104
1232 3300045049 Ga0466959_0131651 Ga0466959_0131651_440_808 104
1233 3300045836 Ga0466958_0470069 Ga0466958_0470069_371_739 104
1234 3300046452 Ga0495617_079214 Ga0495617_079214_519_881 104
1235 3300046454 Ga0495592_0002995 Ga0495592_0002995_10769_11131 104
1236 3300046454 Ga0495592_0209527 Ga0495592_0209527_122_484 104
1237 3300046455 Ga0495603_0000280 Ga0495603_0000280_20186_20548 104
1238 3300046455 Ga0495603_0189093 Ga0495603_0189093_592_954 104
1239 3300046457 Ga0495590_0188583 Ga0495590_0188583_94_456 104
1240 3300046458 Ga0495591_166499 Ga0495591_166499_149_511 104
1241 3300046459 Ga0495629_0000177 Ga0495629_0000177_29333_29695 104
1242 3300046459 Ga0495629_0003398 Ga0495629_0003398_2279_2641 104
1243 3300046459 Ga0495629_0378020 Ga0495629_0378020_106_468 104
1244 3300046460 Ga0495638_0022881 Ga0495638_0022881_146_508 104
1245 3300046462 Ga0495651_0013698 Ga0495651_0013698_546_908 104
1246 3300046463 Ga0495653_0000370 Ga0495653_0000370_30763_31125 104
1247 3300046463 Ga0495653_0118115 Ga0495653_0118115_1512_1874 104
1248 3300046463 Ga0495653_0363541 Ga0495653_0363541_139_501 104
1249 3300046472 Ga0495580_0002426 Ga0495580_0002426_1621_1983 104
1250 3300046472 Ga0495580_0203918 Ga0495580_0203918_20_382 104
1251 3300046472 Ga0495580_0244542 Ga0495580_0244542_36_398 104
1252 3300046472 Ga0495580_0669709 Ga0495580_0669709_142_504 104
1253 3300046473 Ga0495582_0000185 Ga0495582_0000185_17175_17537 104
1254 3300046473 Ga0495582_0027947 Ga0495582_0027947_1746_2108 104
1255 3300046473 Ga0495582_0077710 Ga0495582_0077710_1026_1388 104
1256 3300046474 Ga0495605_0063655 Ga0495605_0063655_378_740 104
1257 3300046474 Ga0495605_0097023 Ga0495605_0097023_695_1057 104
1258 3300046475 Ga0495639_0342409 Ga0495639_0342409_291_653 104
1259 3300046476 Ga0495662_0058857 Ga0495662_0058857_107_469 104
1260 3300046477 Ga0495664_0008161 Ga0495664_0008161_1476_1838 104
1261 3300046491 Ga0495584_0049503 Ga0495584_0049503_190_552 104
1262 3300046491 Ga0495584_0086302 Ga0495584_0086302_523_885 104
1263 3300046491 Ga0495584_0586223 Ga0495584_0586223_37_399 104
1264 3300046492 Ga0495585_0101955 Ga0495585_0101955_590_952 104
1265 3300046492 Ga0495585_0571831 Ga0495585_0571831_53_415 104
1266 3300046499 Ga0495594_0000224 Ga0495594_0000224_5645_6007 104
1267 3300046499 Ga0495594_0317156 Ga0495594_0317156_317_679 104
1268 3300046499 Ga0495594_0449212 Ga0495594_0449212_287_649 104
1269 3300046500 Ga0495596_0062670 Ga0495596_0062670_659_1021 104
1270 3300046511 Ga0495608_0011138 Ga0495608_0011138_1628_1990 104
1271 3300046511 Ga0495608_0420177 Ga0495608_0420177_398_766 104
1272 3300046514 Ga0495618_0014905 Ga0495618_0014905_2768_3130 104
1273 3300046514 Ga0495618_0266774 Ga0495618_0266774_69_431 104
1274 3300046516 Ga0495628_0003568 Ga0495628_0003568_1105_1467 104
1275 3300046517 Ga0495630_0066370 Ga0495630_0066370_2178_2540 104
1276 3300046517 Ga0495630_0158716 Ga0495630_0158716_385_747 104
1277 3300046518 Ga0495631_0298459 Ga0495631_0298459_132_494 104
1278 3300046526 Ga0495666_0020979 Ga0495666_0020979_2594_2956 104
1279 3300046529 Ga0495652_0004294 Ga0495652_0004294_4915_5277 104
1280 3300046529 Ga0495652_0250052 Ga0495652_0250052_493_855 104
1281 3300046531 Ga0495665_0020677 Ga0495665_0020677_241_603 104
1282 3300046533 Ga0495640_0000769 Ga0495640_0000769_9733_10095 104
1283 3300046533 Ga0495640_0166827 Ga0495640_0166827_871_1233 104
1284 3300046536 Ga0495587_0001283 Ga0495587_0001283_11587_11949 104
1285 3300046536 Ga0495587_0574789 Ga0495587_0574789_124_486 104
1286 3300046538 Ga0495609_0054382 Ga0495609_0054382_865_1227 104
1287 3300046542 Ga0495597_0084571 Ga0495597_0084571_806_1168 104
1288 3300046543 Ga0495645_0124944 Ga0495645_0124944_1318_1680 104
1289 3300046557 Ga0495622_0000916 Ga0495622_0000916_7912_8274 104
1290 3300046559 Ga0495667_0001942 Ga0495667_0001942_2547_2909 104
1291 3300046559 Ga0495667_0062276 Ga0495667_0062276_1776_2144 104
1292 3300046559 Ga0495667_0085085 Ga0495667_0085085_1476_1838 104
1293 3300046559 Ga0495667_0106536 Ga0495667_0106536_1337_1699 104
1294 3300046615 Ga0495656_0004659 Ga0495656_0004659_2048_2410 104
1295 3300046642 Ga0495634_0002200 Ga0495634_0002200_2572_2934 104
1296 3300046642 Ga0495634_0003557 Ga0495634_0003557_7020_7382 104
1297 3300046642 Ga0495634_0061741 Ga0495634_0061741_1757_2119 104
1298 3300046642 Ga0495634_0076021 Ga0495634_0076021_892_1254 104
1299 3300046648 Ga0495611_0049922 Ga0495611_0049922_52_414 104
1300 3300046648 Ga0495611_0191034 Ga0495611_0191034_345_707 104
1301 3300046663 Ga0495635_0004328 Ga0495635_0004328_399_761 104
1302 3300046663 Ga0495635_0098468 Ga0495635_0098468_709_1071 104
1303 3300046663 Ga0495635_0196130 Ga0495635_0196130_517_879 104
1304 3300046664 Ga0495659_0007507 Ga0495659_0007507_1833_2195 104
1305 3300046664 Ga0495659_0060864 Ga0495659_0060864_514_876 104
1306 3300046664 Ga0495659_0078175 Ga0495659_0078175_185_547 104
1307 3300046664 Ga0495659_0126753 Ga0495659_0126753_124_486 104
1308 3300046664 Ga0495659_0395746 Ga0495659_0395746_184_546 104
1309 3300046674 Ga0495588_0000617 Ga0495588_0000617_5667_6029 104
1310 3300046675 Ga0495657_0007254 Ga0495657_0007254_5428_5790 104
1311 3300046675 Ga0495657_0234127 Ga0495657_0234127_525_887 104
1312 3300046678 Ga0495599_0067780 Ga0495599_0067780_367_729 104
1313 3300046679 Ga0495623_0003723 Ga0495623_0003723_2522_2884 104
1314 3300046679 Ga0495623_0212673 Ga0495623_0212673_246_608 104
1315 3300046680 Ga0495646_0008521 Ga0495646_0008521_2207_2569 104
1316 3300046681 Ga0495647_0001129 Ga0495647_0001129_5169_5531 104
1317 3300046683 Ga0495658_0007723 Ga0495658_0007723_3240_3602 104
1318 3300046683 Ga0495658_0044340 Ga0495658_0044340_1020_1382 104
1319 3300046683 Ga0495658_0057445 Ga0495658_0057445_947_1309 104
1320 3300046689 Ga0495613_0037438 Ga0495613_0037438_2632_2994 104
1321 3300046689 Ga0495613_0387084 Ga0495613_0387084_287_649 104
1322 3300046689 Ga0495613_0533055 Ga0495613_0533055_46_408 104
1323 3300046690 Ga0495624_0255715 Ga0495624_0255715_290_652 104
1324 3300046690 Ga0495624_0344344 Ga0495624_0344344_189_551 104
1325 3300046794 Ga0495589_0105377 Ga0495589_0105377_19_381 104
1326 3300046809 Ga0495600_0000422 Ga0495600_0000422_5489_5851 104
1327 3300047315 Ga0495581_0001367 Ga0495581_0001367_7027_7389 104
1328 3300047315 Ga0495581_0446366 Ga0495581_0446366_25_387 104
1329 3300047317 Ga0495604_0000406 Ga0495604_0000406_11628_11990 104
1330 3300047317 Ga0495604_0125551 Ga0495604_0125551_411_773 104
1331 3300047317 Ga0495604_0472478 Ga0495604_0472478_386_748 104
1332 3300047319 Ga0495674_0000757 Ga0495674_0000757_28702_29064 104
1333 3300047319 Ga0495674_0048954 Ga0495674_0048954_76_438 104
1334 3300047321 Ga0495676_0214106 Ga0495676_0214106_634_996 104
1335 3300047321 Ga0495676_0425201 Ga0495676_0425201_192_554 104
1336 3300047322 Ga0495680_0001477 Ga0495680_0001477_5906_6268 104
1337 3300047322 Ga0495680_0034950 Ga0495680_0034950_2247_2609 104
1338 3300047444 Ga0495675_0020789 Ga0495675_0020789_43_405 104
1339 3300047445 Ga0495677_0036120 Ga0495677_0036120_248_610 104
1340 3300047471 Ga0495684_0002545 Ga0495684_0002545_9520_9882 104
1341 3300047471 Ga0495684_0118622 Ga0495684_0118622_399_761 104
1342 3300047471 Ga0495684_0139724 Ga0495684_0139724_1287_1649 104
1343 3300047471 Ga0495684_0144044 Ga0495684_0144044_421_783 104
1344 3300047673 Ga0495593_0001943 Ga0495593_0001943_8367_8729 104
1345 3300047673 Ga0495593_0035371 Ga0495593_0035371_889_1251 104
1346 3300048088 Ga0495602_0010292 Ga0495602_0010292_3541_3903 104
1347 3300048088 Ga0495602_0064701 Ga0495602_0064701_428_790 104
1348 3300048089 Ga0495614_0000618 Ga0495614_0000618_12313_12675 104
1349 3300048903 Ga0496100_0046778 Ga0496100_0046778_530_892 104
1350 3300048903 Ga0496100_0107165 Ga0496100_0107165_1387_1749 104
1351 3300048903 Ga0496100_0541140 Ga0496100_0541140_139_501 104
1352 3300048903 Ga0496100_0945759 Ga0496100_0945759_44_406 104
1353 3300048904 Ga0496101_0017801 Ga0496101_0017801_1211_1573 104
1354 3300048904 Ga0496101_0026858 Ga0496101_0026858_1651_2013 104
1355 3300048904 Ga0496101_0122824 Ga0496101_0122824_1539_1901 104
1356 3300048904 Ga0496101_0617387 Ga0496101_0617387_186_548 104
1357 3300048904 Ga0496101_1260571 Ga0496101_1260571_167_529 104
1358 3300048904 Ga0496101_1373106 Ga0496101_1373106_35_397 104
1359 3300048905 Ga0496102_0037292 Ga0496102_0037292_3964_4326 104
1360 3300048905 Ga0496102_0057326 Ga0496102_0057326_1445_1807 104
1361 3300048905 Ga0496102_0099939 Ga0496102_0099939_2310_2672 104
1362 3300048905 Ga0496102_0129848 Ga0496102_0129848_192_554 104
1363 3300048905 Ga0496102_0320454 Ga0496102_0320454_705_1067 104
1364 3300048905 Ga0496102_0386817 Ga0496102_0386817_28_390 104
1365 3300048905 Ga0496102_0755371 Ga0496102_0755371_300_662 104
1366 3300048905 Ga0496102_0954496 Ga0496102_0954496_78_440 104
1367 3300048906 Ga0496103_0004036 Ga0496103_0004036_8501_8863 104
1368 3300048906 Ga0496103_0018919 Ga0496103_0018919_1893_2255 104
1369 3300048906 Ga0496103_0246224 Ga0496103_0246224_325_687 104
1370 3300048906 Ga0496103_0291013 Ga0496103_0291013_600_962 104
1371 3300048906 Ga0496103_0405659 Ga0496103_0405659_414_776 104
1372 3300048907 Ga0496104_0000399 Ga0496104_0000399_29438_29800 104
1373 3300048907 Ga0496104_0000877 Ga0496104_0000877_13255_13617 104
1374 3300048907 Ga0496104_0002521 Ga0496104_0002521_7143_7505 104
1375 3300048907 Ga0496104_0014456 Ga0496104_0014456_1652_2014 104
1376 3300048907 Ga0496104_0162849 Ga0496104_0162849_28_390 104
1377 3300048907 Ga0496104_0174598 Ga0496104_0174598_665_1027 104
1378 3300048907 Ga0496104_0250569 Ga0496104_0250569_950_1312 104
1379 3300048907 Ga0496104_0350944 Ga0496104_0350944_809_1171 104
1380 3300048907 Ga0496104_0441309 Ga0496104_0441309_502_864 104
1381 3300048907 Ga0496104_0674945 Ga0496104_0674945_223_585 104
1382 3300048907 Ga0496104_1441290 Ga0496104_1441290_37_399 104
1383 3300048907 Ga0496104_1660121 Ga0496104_1660121_56_418 104
1384 3300048908 Ga0496105_0002417 Ga0496105_0002417_5360_5722 104
1385 3300048908 Ga0496105_0021595 Ga0496105_0021595_3971_4333 104
1386 3300048908 Ga0496105_0030949 Ga0496105_0030949_1531_1893 104
1387 3300048908 Ga0496105_0091268 Ga0496105_0091268_205_567 104
1388 3300048908 Ga0496105_0304908 Ga0496105_0304908_742_1104 104
1389 3300048908 Ga0496105_0309265 Ga0496105_0309265_662_1024 104
1390 3300048909 Ga0496106_0017883 Ga0496106_0017883_1881_2243 104
1391 3300048909 Ga0496106_0058432 Ga0496106_0058432_1722_2084 104
1392 3300048909 Ga0496106_0062001 Ga0496106_0062001_156_518 104
1393 3300048909 Ga0496106_0120117 Ga0496106_0120117_169_531 104
1394 3300048909 Ga0496106_0120270 Ga0496106_0120270_1453_1815 104
1395 3300048910 Ga0496107_0003748 Ga0496107_0003748_3053_3415 104
1396 3300048910 Ga0496107_0010615 Ga0496107_0010615_709_1071 104
1397 3300048910 Ga0496107_0035744 Ga0496107_0035744_2490_2852 104
1398 3300048910 Ga0496107_0078161 Ga0496107_0078161_156_518 104
1399 3300048910 Ga0496107_0135875 Ga0496107_0135875_440_802 104
1400 3300048910 Ga0496107_0296984 Ga0496107_0296984_47_409 104
1401 3300048910 Ga0496107_0491203 Ga0496107_0491203_121_483 104
1402 3300048910 Ga0496107_0504327 Ga0496107_0504327_93_455 104
1403 3300048911 Ga0496108_0015644 Ga0496108_0015644_1523_1885 104
1404 3300048911 Ga0496108_0021902 Ga0496108_0021902_3319_3681 104
1405 3300048911 Ga0496108_0046788 Ga0496108_0046788_924_1286 104
1406 3300048911 Ga0496108_0075075 Ga0496108_0075075_880_1242 104
1407 3300048911 Ga0496108_0299816 Ga0496108_0299816_204_566 104
1408 3300048911 Ga0496108_0338699 Ga0496108_0338699_68_430 104
1409 3300048911 Ga0496108_0862139 Ga0496108_0862139_184_546 104
1410 3300048911 Ga0496108_0882631 Ga0496108_0882631_163_525 104
1411 3300048911 Ga0496108_1175836 Ga0496108_1175836_59_421 104
1412 3300048912 Ga0496109_0005037 Ga0496109_0005037_415_777 104
1413 3300048912 Ga0496109_0030562 Ga0496109_0030562_3927_4289 104
1414 3300048912 Ga0496109_0098970 Ga0496109_0098970_87_449 104
1415 3300048912 Ga0496109_0212329 Ga0496109_0212329_599_961 104
1416 3300048912 Ga0496109_0268932 Ga0496109_0268932_814_1176 104
1417 3300048912 Ga0496109_0363896 Ga0496109_0363896_792_1154 104
1418 3300048912 Ga0496109_1014459 Ga0496109_1014459_127_489 104
1419 3300048913 Ga0496110_0008327 Ga0496110_0008327_5923_6285 104
1420 3300048913 Ga0496110_0013967 Ga0496110_0013967_6162_6524 104
1421 3300048913 Ga0496110_0014672 Ga0496110_0014672_1844_2206 104
1422 3300048913 Ga0496110_0133237 Ga0496110_0133237_214_576 104
1423 3300048913 Ga0496110_0213197 Ga0496110_0213197_1021_1383 104
1424 3300048913 Ga0496110_0264455 Ga0496110_0264455_1135_1497 104
1425 3300048913 Ga0496110_0297171 Ga0496110_0297171_156_518 104
1426 3300048913 Ga0496110_0357403 Ga0496110_0357403_299_661 104
1427 3300048913 Ga0496110_0425225 Ga0496110_0425225_519_881 104
1428 3300048913 Ga0496110_0785626 Ga0496110_0785626_457_819 104
1429 3300048913 Ga0496110_1052460 Ga0496110_1052460_130_492 104
1430 3300048913 Ga0496110_1395135 Ga0496110_1395135_156_518 104
1431 3300048914 Ga0496111_0006735 Ga0496111_0006735_138_500 104
1432 3300048914 Ga0496111_0010039 Ga0496111_0010039_2119_2481 104
1433 3300048914 Ga0496111_0026431 Ga0496111_0026431_1454_1816 104
1434 3300048914 Ga0496111_0566087 Ga0496111_0566087_397_759 104
1435 3300048914 Ga0496111_1080691 Ga0496111_1080691_185_547 104
1436 3300048915 Ga0496112_0002152 Ga0496112_0002152_4547_4909 104
1437 3300048915 Ga0496112_0005326 Ga0496112_0005326_4307_4669 104
1438 3300048915 Ga0496112_0009931 Ga0496112_0009931_2347_2709 104
1439 3300048915 Ga0496112_0185490 Ga0496112_0185490_1417_1779 104
1440 3300048915 Ga0496112_0245866 Ga0496112_0245866_1336_1698 104
1441 3300048915 Ga0496112_0448589 Ga0496112_0448589_341_703 104
1442 3300048915 Ga0496112_0448776 Ga0496112_0448776_333_695 104
1443 3300048915 Ga0496112_1257005 Ga0496112_1257005_118_480 104
1444 3300048916 Ga0496113_0005226 Ga0496113_0005226_1966_2328 104
1445 3300048916 Ga0496113_0016963 Ga0496113_0016963_286_648 104
1446 3300048916 Ga0496113_0030967 Ga0496113_0030967_28_390 104
1447 3300048916 Ga0496113_0220513 Ga0496113_0220513_735_1097 104
1448 3300048916 Ga0496113_0346148 Ga0496113_0346148_34_396 104
1449 3300048916 Ga0496113_0371704 Ga0496113_0371704_370_732 104
1450 3300048917 Ga0496114_0003614 Ga0496114_0003614_4307_4669 104
1451 3300048917 Ga0496114_0031170 Ga0496114_0031170_2002_2364 104
1452 3300048917 Ga0496114_0034421 Ga0496114_0034421_2329_2691 104
1453 3300048917 Ga0496114_0341901 Ga0496114_0341901_338_700 104
1454 3300048917 Ga0496114_0786681 Ga0496114_0786681_438_800 104
1455 3300048917 Ga0496114_1046956 Ga0496114_1046956_36_398 104
1456 3300048918 Ga0496115_0024323 Ga0496115_0024323_2236_2598 104
1457 3300048918 Ga0496115_0032266 Ga0496115_0032266_1651_2013 104
1458 3300048918 Ga0496115_0037442 Ga0496115_0037442_1646_2008 104
1459 3300048918 Ga0496115_0082386 Ga0496115_0082386_49_411 104
1460 3300048918 Ga0496115_0099794 Ga0496115_0099794_1617_1979 104
1461 3300048918 Ga0496115_0129762 Ga0496115_0129762_1569_1931 104
1462 3300048918 Ga0496115_0194930 Ga0496115_0194930_1087_1449 104
1463 3300048918 Ga0496115_1172899 Ga0496115_1172899_58_420 104
1464 3300048922 Ga0496119_0239329 Ga0496119_0239329_510_872 104
1465 3300048924 Ga0496121_0217025 Ga0496121_0217025_171_533 104
1466 3300048925 Ga0496122_0552339 Ga0496122_0552339_164_526 104
1467 3300048929 Ga0496126_0094779 Ga0496126_0094779_1556_1918 104
1468 3300049568 Ga0501031_0026171 Ga0501031_0026171_2553_2915 104
1469 3300049568 Ga0501031_0252196 Ga0501031_0252196_287_649 104
1470 3300049571 Ga0501034_0056814 Ga0501034_0056814_1701_2063 104
1471 3300049571 Ga0501034_0191226 Ga0501034_0191226_517_879 104
1472 3300049572 Ga0501036_0114546 Ga0501036_0114546_1839_2201 104
1473 3300049572 Ga0501036_0493075 Ga0501036_0493075_136_501 104
1474 3300049573 Ga0501037_0156358 Ga0501037_0156358_37_405 104
1475 3300049573 Ga0501037_0392335 Ga0501037_0392335_396_758 104
1476 3300049574 Ga0501038_0102284 Ga0501038_0102284_484_846 104
1477 3300049574 Ga0501038_0161708 Ga0501038_0161708_544_912 104
1478 3300049575 Ga0501039_0245664 Ga0501039_0245664_475_837 104
1479 3300049575 Ga0501039_0465619 Ga0501039_0465619_399_767 104
1480 3300049575 Ga0501039_0654365 Ga0501039_0654365_450_812 104
1481 3300049575 Ga0501039_1390594 Ga0501039_1390594_96_458 104
1482 3300049576 Ga0501040_0672035 Ga0501040_0672035_169_531 104
1483 3300049577 Ga0501041_0013799 Ga0501041_0013799_1864_2226 104
1484 3300049577 Ga0501041_0056868 Ga0501041_0056868_1724_2092 104
1485 3300049578 Ga0501042_0030096 Ga0501042_0030096_2195_2557 104
1486 3300049578 Ga0501042_0679890 Ga0501042_0679890_242_604 104
1487 3300049579 Ga0501043_0032912 Ga0501043_0032912_1704_2066 104
1488 3300049579 Ga0501043_0650126 Ga0501043_0650126_136_498 104
1489 3300049580 Ga0501046_0278251 Ga0501046_0278251_594_962 104
1490 3300049580 Ga0501046_0280873 Ga0501046_0280873_829_1191 104
1491 3300049580 Ga0501046_0645495 Ga0501046_0645495_94_456 104
1492 3300049580 Ga0501046_0678309 Ga0501046_0678309_167_529 104
1493 3300049580 Ga0501046_0813432 Ga0501046_0813432_160_522 104
1494 3300049582 Ga0501048_0017587 Ga0501048_0017587_1721_2089 104
1495 3300049582 Ga0501048_0271425 Ga0501048_0271425_823_1185 104
1496 3300049582 Ga0501048_0739222 Ga0501048_0739222_231_593 104
1497 3300049583 Ga0501067_0228464 Ga0501067_0228464_465_827 104
1498 3300049583 Ga0501067_0595156 Ga0501067_0595156_182_544 104
1499 3300049583 Ga0501067_0839229 Ga0501067_0839229_92_454 104
1500 3300049584 Ga0501068_0024472 Ga0501068_0024472_1344_1706 104
1501 3300049584 Ga0501068_0101141 Ga0501068_0101141_1118_1486 104
1502 3300049584 Ga0501068_0353435 Ga0501068_0353435_569_931 104
1503 3300049585 Ga0501069_0079477 Ga0501069_0079477_844_1206 104
1504 3300049585 Ga0501069_0187904 Ga0501069_0187904_196_564 104
1505 3300049585 Ga0501069_0681814 Ga0501069_0681814_66_428 104
1506 3300049585 Ga0501069_0687787 Ga0501069_0687787_121_483 104
1507 3300049585 Ga0501069_0997841 Ga0501069_0997841_105_467 104
1508 3300049586 Ga0501070_0035593 Ga0501070_0035593_1721_2083 104
1509 3300049586 Ga0501070_0426311 Ga0501070_0426311_143_511 104
1510 3300049587 Ga0501071_0138073 Ga0501071_0138073_336_698 104
1511 3300049587 Ga0501071_0275241 Ga0501071_0275241_668_1030 104
1512 3300049587 Ga0501071_0447967 Ga0501071_0447967_132_494 104
1513 3300049587 Ga0501071_0945384 Ga0501071_0945384_239_601 104
1514 3300049587 Ga0501071_1090623 Ga0501071_1090623_235_597 104
1515 3300049587 Ga0501071_1365092 Ga0501071_1365092_46_411 104
1516 3300049588 Ga0501072_0019597 Ga0501072_0019597_1470_1832 104
1517 3300049588 Ga0501072_0352756 Ga0501072_0352756_629_991 104
1518 3300049588 Ga0501072_0385856 Ga0501072_0385856_608_976 104
1519 3300049588 Ga0501072_0883334 Ga0501072_0883334_275_640 104
1520 3300049589 Ga0501073_0113312 Ga0501073_0113312_392_754 104
1521 3300049589 Ga0501073_0194049 Ga0501073_0194049_664_1032 104
1522 3300049590 Ga0501074_0047115 Ga0501074_0047115_2265_2627 104
1523 3300049590 Ga0501074_0538773 Ga0501074_0538773_256_618 104
1524 3300049590 Ga0501074_1001655 Ga0501074_1001655_12_374 104
1525 3300049591 Ga0501075_0013808 Ga0501075_0013808_666_1028 104
1526 3300049591 Ga0501075_0159090 Ga0501075_0159090_46_411 104
1527 3300049592 Ga0501076_0000421 Ga0501076_0000421_23157_23519 104
1528 3300049592 Ga0501076_0282047 Ga0501076_0282047_667_1029 104
1529 3300049592 Ga0501076_1170327 Ga0501076_1170327_207_569 104
1530 3300049593 Ga0501077_0102988 Ga0501077_0102988_134_496 104
1531 3300049593 Ga0501077_0175879 Ga0501077_0175879_197_559 104
1532 3300049593 Ga0501077_0238424 Ga0501077_0238424_412_774 104
1533 3300049593 Ga0501077_0392189 Ga0501077_0392189_442_804 104
1534 3300049593 Ga0501077_0392948 Ga0501077_0392948_265_633 104
1535 3300049741 Ga0501079_0064512 Ga0501079_0064512_1102_1470 104
1536 3300049741 Ga0501079_0252153 Ga0501079_0252153_705_1067 104
1537 3300049741 Ga0501079_1012291 Ga0501079_1012291_134_496 104
1538 3300049741 Ga0501079_1379742 Ga0501079_1379742_103_465 104
1539 3300049742 Ga0501080_0339968 Ga0501080_0339968_869_1231 104
1540 3300049742 Ga0501080_0550479 Ga0501080_0550479_265_627 104
1541 3300049742 Ga0501080_0963527 Ga0501080_0963527_349_711 104
1542 3300049742 Ga0501080_1657888 Ga0501080_1657888_91_453 104
1543 3300049742 Ga0501080_1730864 Ga0501080_1730864_145_507 104
1544 3300049743 Ga0501081_0009235 Ga0501081_0009235_3866_4228 104
1545 3300049743 Ga0501081_0843053 Ga0501081_0843053_169_531 104
1546 3300049743 Ga0501081_1060508 Ga0501081_1060508_236_601 104
1547 3300049744 Ga0501083_0045332 Ga0501083_0045332_2161_2523 104
1548 3300049822 Ga0501035_0050399 Ga0501035_0050399_1635_1997 104
1549 3300049822 Ga0501035_0186136 Ga0501035_0186136_526_888 104
1550 3300049822 Ga0501035_0240284 Ga0501035_0240284_902_1264 104
1551 3300049822 Ga0501035_0418728 Ga0501035_0418728_38_400 104
1552 3300049822 Ga0501035_1304239 Ga0501035_1304239_180_542 104
1553 3300049823 Ga0501044_0123906 Ga0501044_0123906_1607_1969 104
1554 3300049823 Ga0501044_0456100 Ga0501044_0456100_354_716 104
1555 3300049823 Ga0501044_0690224 Ga0501044_0690224_400_762 104
1556 3300049824 Ga0501045_0047269 Ga0501045_0047269_1233_1595 104
1557 3300049824 Ga0501045_0077461 Ga0501045_0077461_134_499 104
1558 3300050489 nmdc:mga03683_44485_c1 nmdc:mga03683_44485_c1_1040_1402 104
1559 3300050490 nmdc:mga03n38_3636_c1 nmdc:mga03n38_3636_c1_4280_4642 104
1560 3300050491 nmdc:mga00v17_181674_c1 nmdc:mga00v17_181674_c1_471_833 104
1561 3300050491 nmdc:mga00v17_22519_c1 nmdc:mga00v17_22519_c1_2726_3088 104
1562 3300050491 nmdc:mga00v17_267635_c1 nmdc:mga00v17_267635_c1_129_491 104
1563 3300050492 nmdc:mga0yw44_1064880_c1 nmdc:mga0yw44_1064880_c1_79_441 104
1564 3300050492 nmdc:mga0yw44_20022_c2 nmdc:mga0yw44_20022_c2_111_476 104
1565 3300050492 nmdc:mga0yw44_2894_c1 nmdc:mga0yw44_2894_c1_5744_6106 104
1566 3300050492 nmdc:mga0yw44_78099_c1 nmdc:mga0yw44_78099_c1_137_499 104
1567 3300050494 nmdc:mga06z11_213004_c1 nmdc:mga06z11_213004_c1_15_377 104
1568 3300050494 nmdc:mga06z11_348578_c1 nmdc:mga06z11_348578_c1_488_850 104
1569 3300050494 nmdc:mga06z11_35540_c1 nmdc:mga06z11_35540_c1_1860_2222 104
1570 3300050496 nmdc:mga07m45_181168_c1 nmdc:mga07m45_181168_c1_462_824 104
1571 3300050496 nmdc:mga07m45_588459_c1 nmdc:mga07m45_588459_c1_108_470 104
1572 3300050507 nmdc:mga05p37_14706_c1 nmdc:mga05p37_14706_c1_6335_6697 104
1573 3300050507 nmdc:mga05p37_193059_c1 nmdc:mga05p37_193059_c1_593_955 104
1574 3300050507 nmdc:mga05p37_204463_c1 nmdc:mga05p37_204463_c1_1095_1457 104
1575 3300050507 nmdc:mga05p37_484383_c1 nmdc:mga05p37_484383_c1_1013_1375 104
1576 3300050507 nmdc:mga05p37_862206_c1 nmdc:mga05p37_862206_c1_590_952 104
1577 3300050507 nmdc:mga05p37_907001_c1 nmdc:mga05p37_907001_c1_410_772 104
1578 3300050508 nmdc:mga09592_134808_c1 nmdc:mga09592_134808_c1_157_519 104
1579 3300050508 nmdc:mga09592_38412_c1 nmdc:mga09592_38412_c1_526_888 104
1580 3300050509 nmdc:mga0qj67_117019_c1 nmdc:mga0qj67_117019_c1_196_558 104
1581 3300050509 nmdc:mga0qj67_585613_c1 nmdc:mga0qj67_585613_c1_341_703 104
1582 3300050510 nmdc:mga06r32_114842_c1 nmdc:mga06r32_114842_c1_797_1159 104
1583 3300050510 nmdc:mga06r32_312060_c1 nmdc:mga06r32_312060_c1_1161_1523 104
1584 3300050510 nmdc:mga06r32_46596_c1 nmdc:mga06r32_46596_c1_3393_3755 104
1585 3300050510 nmdc:mga06r32_82733_c1 nmdc:mga06r32_82733_c1_2397_2759 104
1586 3300050511 nmdc:mga08y16_325380_c1 nmdc:mga08y16_325380_c1_786_1148 104
1587 3300050511 nmdc:mga08y16_36949_c1 nmdc:mga08y16_36949_c1_1157_1519 104
1588 3300050511 nmdc:mga08y16_496833_c1 nmdc:mga08y16_496833_c1_433_795 104
1589 3300050511 nmdc:mga08y16_96065_c1 nmdc:mga08y16_96065_c1_1009_1371 104
1590 3300050512 nmdc:mga0n895_115180_c1 nmdc:mga0n895_115180_c1_917_1279 104
1591 3300050512 nmdc:mga0n895_278101_c1 nmdc:mga0n895_278101_c1_1175_1537 104
1592 3300050512 nmdc:mga0n895_78493_c1 nmdc:mga0n895_78493_c1_575_937 104
1593 3300050512 nmdc:mga0n895_847059_c1 nmdc:mga0n895_847059_c1_115_477 104
1594 3300050512 nmdc:mga0n895_878774_c1 nmdc:mga0n895_878774_c1_363_725 104
1595 3300050512 nmdc:mga0n895_94230_c1 nmdc:mga0n895_94230_c1_1396_1758 104
1596 3300050512 nmdc:mga0n895_98619_c1 nmdc:mga0n895_98619_c1_1995_2357 104
1597 3300050513 nmdc:mga0rr50_275087_c1 nmdc:mga0rr50_275087_c1_654_1016 104
1598 3300050513 nmdc:mga0rr50_333024_c1 nmdc:mga0rr50_333024_c1_295_657 104
1599 3300050513 nmdc:mga0rr50_529062_c1 nmdc:mga0rr50_529062_c1_629_991 104
1600 3300050513 nmdc:mga0rr50_865616_c1 nmdc:mga0rr50_865616_c1_362_724 104
1601 3300050513 nmdc:mga0rr50_87561_c1 nmdc:mga0rr50_87561_c1_370_732 104
1602 3300050514 nmdc:mga08x19_400636_c1 nmdc:mga08x19_400636_c1_22_384 104
1603 3300050514 nmdc:mga08x19_41905_c1 nmdc:mga08x19_41905_c1_370_732 104
1604 3300050515 nmdc:mga0a205_147065_c1 nmdc:mga0a205_147065_c1_593_955 104
1605 3300050515 nmdc:mga0a205_272015_c1 nmdc:mga0a205_272015_c1_614_976 104
1606 3300050515 nmdc:mga0a205_278805_c1 nmdc:mga0a205_278805_c1_99_461 104
1607 3300050516 nmdc:mga0sz30_177334_c1 nmdc:mga0sz30_177334_c1_89_451 104
1608 3300050516 nmdc:mga0sz30_626_c1 nmdc:mga0sz30_626_c1_8537_8899 104
1609 3300053077 Ga0495601_0003476 Ga0495601_0003476_2087_2449 104
1610 3300053077 Ga0495601_0049763 Ga0495601_0049763_154_522 104
1611 3300053077 Ga0495601_0387606 Ga0495601_0387606_475_837 104
1612 3300053078 Ga0495612_0007484 Ga0495612_0007484_1615_1977 104
1613 3300053084 Ga0495595_0000821 Ga0495595_0000821_6153_6515 104
1614 3300053084 Ga0495595_0012728 Ga0495595_0012728_1937_2305 104
1615 3300053084 Ga0495595_0047137 Ga0495595_0047137_583_945 104
1616 3300053084 Ga0495595_0204772 Ga0495595_0204772_527_889 104
1617 3300053085 Ga0495619_0000352 Ga0495619_0000352_24973_25335 104
1618 3300053085 Ga0495619_0001164 Ga0495619_0001164_9030_9392 104
1619 3300053085 Ga0495619_0027905 Ga0495619_0027905_1349_1711 104
1620 3300053085 Ga0495619_0097132 Ga0495619_0097132_1258_1626 104
1621 3300053085 Ga0495619_0115427 Ga0495619_0115427_202_564 104
1622 3300053093 Ga0500651_0179633 Ga0500651_0179633_689_1051 104
1623 3300053117 Ga0500593_003205 Ga0500593_003205_1612_1974 104
1624 3300053118 Ga0500594_0212399 Ga0500594_0212399_74_436 104
1625 3300053119 Ga0500595_055179 Ga0500595_055179_834_1196 104
1626 3300053130 Ga0500642_0224743 Ga0500642_0224743_31_393 104
1627 3300053131 Ga0500652_000024 Ga0500652_000024_108018_108380 104
1628 3300053162 Ga0500638_368840 Ga0500638_368840_67_429 104
1629 3300053177 Ga0500636_0079812 Ga0500636_0079812_1291_1653 104
1630 3300053730 Ga0500645_141569 Ga0500645_141569_220_582 104
1631 3300054114 Ga0501084_0077198 Ga0501084_0077198_1949_2311 104
1632 3300054114 Ga0501084_0275420 Ga0501084_0275420_142_504 104
1633 3300054114 Ga0501084_0558072 Ga0501084_0558072_40_402 104
1634 3300054114 Ga0501084_1473501 Ga0501084_1473501_140_502 104
1635 3300060353 Ga0501082_0015085 Ga0501082_0015085_5154_5516 104
1636 3300060353 Ga0501082_0075942 Ga0501082_0075942_19_387 104
1637 3300060353 Ga0501082_0196280 Ga0501082_0196280_80_445 104
1638 3300060353 Ga0501082_0282344 Ga0501082_0282344_583_945 104
1639 3300060353 Ga0501082_0620932 Ga0501082_0620932_475_837 104
1640 3300061734 Ga0530510_0078777 Ga0530510_0078777_426_788 104
1641 3300061734 Ga0530510_0139537 Ga0530510_0139537_1192_1554 104
1642 3300061734 Ga0530510_0498055 Ga0530510_0498055_319_687 104
1643 3300061734 Ga0530510_0667077 Ga0530510_0667077_364_726 104
1644 3300061734 Ga0530510_0676321 Ga0530510_0676321_222_587 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

3

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p42-assembly1.cif.gz_A extended-synaptotagmin 2, smp - c2a - c2b domains 0.8751 37 55
6b4v-assembly1.cif.gz_P antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome 0.8526 9 104
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.852 26 104
4exr-assembly1.cif.gz_A-2 crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution 0.8475 31 56
6n1d-assembly1.cif.gz_AL18 x-ray crystal complex showing spontaneous ribosomal translocation of mrna and trnas into a chimeric hybrid state 0.8435 14 99
ID Description Score Start End Superfamily
af_O13981_436_790_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9071 31 55 2.130.10.10
af_P25574_24_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9057 31 55 3.40.50.150
af_A0A0P0V099_24_416_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9054 31 55 2.130.10.10
af_Q5ADV1_175_438_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8961 29 55 2.130.10.10
af_P55138_1_114_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8831 26 55 3.30.420.40
ID Description Score Start End GO Terms
AF-A3TU57-F1-model_v4 Large ribosomal subunit protein uL18 0.9106 15 104 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A8TZJ6-F1-model_v4 Large ribosomal subunit protein uL18 0.9016 16 104 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A357MHE9-F1-model_v4 Large ribosomal subunit protein uL18 0.8974 14 104 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A658S4U2-F1-model_v4 deleted 0.897 26 104
AF-A0A1Z9L2B1-F1-model_v4 Large ribosomal subunit protein uL18 0.8967 16 104 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
73.75 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map