F495182

General Info

Members Datasets Scaffolds Average Seq Length
1645 581 3290 297

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_000040|Ga0495591_000040_62838_63881
Length 347
Sequence VRHFVTRLRGDDRLAFKCEDPGRAASLAQAQALGDNPALVASVIPIDSELPMSESVFTPAHLQASTLYLPPGPWLTVLDCLCERFSAIPREQWLDRIARGRVLDGEGNPIAVDLAYREGLRIHYFREVPNETLIPVQETILYADEHLVVADKPHFLPVTPAGEYVEQTLLRRLIRTLDNPDLVPLHRIDRHTAGLVLFSANKQTRSAYQALFPTRQIDKRYEAIAGALPELEFPRVHKSRLVDGEPFFRMQEGEGQSNTETRIEVCEKNGELWRYGLYPVTGKKHQLRVHMAALGAGICNDPFYPEVLKDAVDDYDKPLKLLAKGLRFVDPVSGQERFFESRIILDW

Samples

Sample ID Description Type Environment
1 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
144 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
182 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
183 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
184 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
185 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
186 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
187 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
190 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
193 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
198 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
199 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
309 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
310 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
311 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
323 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
324 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
325 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
326 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
327 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
328 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
329 2511231004 Pseudomonas sp. GM102 Isolate Nodule
330 2511231006 Pseudomonas sp. GM17 Isolate Nodule
331 2511231007 Pseudomonas sp. GM18 Isolate Nodule
332 2511231008 Pseudomonas sp. GM21 Isolate Nodule
333 2511231010 Pseudomonas sp. GM25 Isolate Nodule
334 2511231011 Pseudomonas sp. GM30 Isolate Nodule
335 2511231012 Pseudomonas sp. GM33 Isolate Nodule
336 2511231014 Pseudomonas sp. GM48 Isolate Nodule
337 2511231015 Pseudomonas sp. GM49 Isolate Nodule
338 2511231016 Pseudomonas sp. GM50 Isolate Nodule
339 2511231017 Pseudomonas sp. GM55 Isolate Nodule
340 2511231018 Pseudomonas sp. GM60 Isolate Nodule
341 2511231019 Pseudomonas sp. GM67 Isolate Nodule
342 2511231020 Pseudomonas sp. GM74 Isolate Nodule
343 2511231021 Pseudomonas sp. GM78 Isolate Nodule
344 2511231022 Pseudomonas sp. GM79 Isolate Nodule
345 2511231024 Pseudomonas sp. GM84 Isolate Nodule
346 2511231031 Pseudomonas sp. GM16 Isolate Nodule
347 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
348 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
349 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
350 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
351 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
352 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
353 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
354 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
355 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
356 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
357 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
358 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
359 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
360 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
361 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
362 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
363 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
364 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
365 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
366 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
367 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
368 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
369 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
370 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
371 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
372 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
373 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
374 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
375 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
376 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
377 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
378 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
379 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
380 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
381 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
382 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
383 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
384 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
385 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
386 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
387 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
388 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
389 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
390 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
391 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
392 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
393 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
394 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
395 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
396 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
397 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
398 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
399 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
400 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
401 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
402 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
403 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
404 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
405 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
406 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
407 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
408 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
409 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
410 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
411 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
412 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
413 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
414 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
415 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
416 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
417 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
418 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
419 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
420 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
421 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
422 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
423 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
424 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
425 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
426 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
427 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
428 2643221593 Lysobacter sp. Root690 Isolate Unclassified
429 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
430 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
431 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
432 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
433 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
434 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
435 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
436 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
437 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
438 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
439 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
440 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
441 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
442 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
443 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
444 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
445 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
446 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
447 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
448 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
449 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
450 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
451 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
452 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
453 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
454 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
455 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
456 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
457 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
458 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
459 2773857670 Pseudomonas sp. 478 Isolate Unclassified
460 2773857673 Pseudomonas sp. 443 Isolate Unclassified
461 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
462 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
463 2784132063 Pseudomonas sp. 424 Isolate Unclassified
464 2784132072 Pseudomonas sp. 460 Isolate Unclassified
465 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
466 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
467 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
468 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
469 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
470 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
471 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
472 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
473 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
474 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
475 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
476 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
477 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
478 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
479 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
480 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
481 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
482 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
483 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
484 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
485 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
486 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
487 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
488 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
489 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
490 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
491 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
492 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
493 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
494 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
495 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
496 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
497 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
498 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
499 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
500 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
501 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
502 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
503 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
504 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
505 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
506 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
507 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
508 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
509 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
510 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
511 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
512 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
513 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
514 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
515 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
516 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
517 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
518 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
519 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
520 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
521 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
522 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
523 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
524 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
525 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
526 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
527 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
528 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
529 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
530 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
531 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
532 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
533 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
534 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
535 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
536 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
537 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
538 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
539 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
540 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
541 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
542 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
543 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
544 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
545 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
546 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
547 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
548 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
549 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
550 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
551 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
552 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
553 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
554 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
555 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
556 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
557 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
558 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
559 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
560 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
561 8052494512 Pseudomonas putida LD6 Isolate Unclassified
562 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
563 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
564 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
565 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
566 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
567 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
568 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
569 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
570 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
571 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
572 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
573 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
574 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
575 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
576 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
577 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
578 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
579 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
580 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
581 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 0
Isolates 15.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 1.82
Rhizoplane 4.74
Rhizosphere 76.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495591_000040 3300046458 Bacteria 155841
2 MRS2a_Contig_45 2124908027 Bacteria 78063
3 MRS2a_Contig_6898 2124908027 Bacteria 1810
4 SwRhRL2b_contig_1400918 2162886007 Bacteria 5175
5 MRS1b_contig_6133759 2162886011 Bacteria 2918
6 JGI25162J39368_1000077 3300002737 Bacteria 120042
7 JGI25154J39366_1002990 3300002738 Bacteria 3858
8 JGI25163J39215_1000050 3300002771 Bacteria 53099
9 JGI25163J39215_1000126 3300002771 Bacteria 31582
10 JGI25164J39214_1000054 3300002772 Bacteria 120042
11 JGI25164J39214_1000129 3300002772 Bacteria 72515
12 JGI25164J39214_1001811 3300002772 Bacteria 4121
13 JGI25165J46597_1000141 3300003214 Bacteria 120042
14 JGI25165J46597_1000251 3300003214 Bacteria 72515
15 JGI25165J46597_1000405 3300003214 Bacteria 45672
16 Ga0055538_1000090 3300003751 Bacteria 78300
17 Ga0055539_1000134 3300003752 Bacteria 78300
18 Ga0055533_1000138 3300003756 Bacteria 78275
19 Ga0055532_1000142 3300003758 Bacteria 69999
20 Ga0055525_1000183 3300003759 Bacteria 78300
21 Ga0055526_1000024 3300003771 Bacteria 158479
22 Ga0055537_1000180 3300003773 Bacteria 47002
23 Ga0055524_1000174 3300003775 Bacteria 73269
24 Ga0055536_1000239 3300003781 Bacteria 44007
25 Ga0055536_1000345 3300003781 Bacteria 34403
26 Ga0055536_1013222 3300003781 Bacteria 2998
27 Ga0055534_1000084 3300003784 Bacteria 73269
28 Ga0055528_1000016 3300003790 Bacteria 158479
29 Ga0055530_10000053 3300003791 Bacteria 102949
30 Ga0055530_10000289 3300003791 Bacteria 45948
31 Ga0055530_10001084 3300003791 Bacteria 21394
32 Ga0055540_1000105 3300003792 Bacteria 93593
33 Ga0055540_1000252 3300003792 Bacteria 48842
34 Ga0055540_1000790 3300003792 Bacteria 21432
35 Ga0055531_10000081 3300003794 Bacteria 103600
36 Ga0055531_10003476 3300003794 Bacteria 10020
37 Ga0055541_1000089 3300003841 Bacteria 78275
38 Ga0058692_1000001 3300003856 Bacteria 834230
39 Ga0065703_1000531 3300005272 Bacteria 9963
40 Ga0065714_10000016 3300005288 Bacteria 18961
41 Ga0065714_10002400 3300005288 Bacteria 22050
42 Ga0065714_10002585 3300005288 Bacteria 18890
43 Ga0065714_10002591 3300005288 Bacteria 24389
44 Ga0065714_10002616 3300005288 Bacteria 13699
45 Ga0065714_10003051 3300005288 Bacteria 8821
46 Ga0065714_10012583 3300005288 Bacteria 2794
47 Ga0065714_10028718 3300005288 Bacteria 2159
48 Ga0065714_10064635 3300005288 Bacteria 26793
49 Ga0065714_10066389 3300005288 Bacteria 6960
50 Ga0065714_10068183 3300005288 Bacteria 4909
51 Ga0065714_10071681 3300005288 Bacteria 3517
52 Ga0065704_10072159 3300005289 Bacteria 9040
53 Ga0065704_10078350 3300005289 Bacteria 4457
54 Ga0065704_10078370 3300005289 Bacteria 4449
55 Ga0065704_10083106 3300005289 Bacteria 3507
56 Ga0065704_10156508 3300005289 Bacteria 1387
57 Ga0065712_10002698 3300005290 Bacteria 6039
58 Ga0065712_10069156 3300005290 Bacteria 7865
59 Ga0065712_10096430 3300005290 Bacteria 2183
60 Ga0070670_100001221 3300005331 Bacteria 20451
61 Ga0070670_100037913 3300005331 Bacteria 4146
62 Ga0070666_10118520 3300005335 Bacteria 1834
63 Ga0070661_100006952 3300005344 Bacteria 7808
64 Ga0070669_100000316 3300005353 Bacteria 37853
65 Ga0070667_100000095 3300005367 Bacteria 109595
66 Ga0070714_100000079 3300005435 Bacteria 82899
67 Ga0070714_100190557 3300005435 Bacteria 1871
68 Ga0070662_100002228 3300005457 Bacteria 11892
69 Ga0070662_100043321 3300005457 Bacteria 3220
70 Ga0068853_100008519 3300005539 Bacteria 8242
71 Ga0068853_100107967 3300005539 Bacteria 2468
72 Ga0070665_100002661 3300005548 Bacteria 19422
73 Ga0070664_100000046 3300005564 Bacteria 74475
74 Ga0068859_100029592 3300005617 Bacteria 5496
75 Ga0068864_100000073 3300005618 Bacteria 109681
76 Ga0068851_10000050 3300005834 Bacteria 72913
77 Ga0068863_100043616 3300005841 Bacteria 4257
78 Ga0068863_100178337 3300005841 Bacteria 2039
79 Ga0075364_10081778 3300006051 Bacteria 2136
80 Ga0075364_10103678 3300006051 Bacteria 1895
81 Ga0075364_10170037 3300006051 Bacteria 1473
82 Ga0075432_10005424 3300006058 Bacteria 4347
83 Ga0075432_10008465 3300006058 Bacteria 3509
84 Ga0075432_10016442 3300006058 Bacteria 2524
85 Ga0075432_10025635 3300006058 Bacteria 2023
86 Ga0075362_10029925 3300006177 Bacteria 2349
87 Ga0075362_10052703 3300006177 Bacteria 1824
88 Ga0075369_10021203 3300006186 Bacteria 2667
89 Ga0075436_100040597 3300006914 Bacteria 3211
90 Ga0075436_100329914 3300006914 Bacteria 1097
91 Ga0097620_100029589 3300006931 Bacteria 5496
92 Ga0099823_1007660 3300006944 Bacteria 10978
93 Ga0099823_1044831 3300006944 Bacteria 2979
94 Ga0079104_1000124 3300006946 Bacteria 110752
95 Ga0079104_1000366 3300006946 Bacteria 53811
96 Ga0079104_1028267 3300006946 Bacteria 1426
97 Ga0099826_10025975 3300006948 Bacteria 4330
98 Ga0105251_10002695 3300009011 Bacteria 13648
99 Ga0105251_10002821 3300009011 Bacteria 13145
100 Ga0105251_10002860 3300009011 Bacteria 13031
101 Ga0105251_10004546 3300009011 Bacteria 9399
102 Ga0105251_10012498 3300009011 Bacteria 4802
103 Ga0105251_10015340 3300009011 Bacteria 4195
104 Ga0105251_10023765 3300009011 Bacteria 3157
105 Ga0105251_10035496 3300009011 Bacteria 2460
106 Ga0105251_10043360 3300009011 Bacteria 2179
107 Ga0105251_10077863 3300009011 Bacteria 1537
108 Ga0105251_10093381 3300009011 Bacteria 1380
109 Ga0105244_10000322 3300009036 Bacteria 45812
110 Ga0105244_10000983 3300009036 Bacteria 23917
111 Ga0105244_10001384 3300009036 Bacteria 19694
112 Ga0105244_10002008 3300009036 Bacteria 15684
113 Ga0105244_10002410 3300009036 Bacteria 14124
114 Ga0105244_10011071 3300009036 Bacteria 5433
115 Ga0105244_10011158 3300009036 Bacteria 5409
116 Ga0105244_10013783 3300009036 Bacteria 4706
117 Ga0105244_10024905 3300009036 Bacteria 3260
118 Ga0105244_10035659 3300009036 Bacteria 2612
119 Ga0105244_10045365 3300009036 Bacteria 2261
120 Ga0105244_10046440 3300009036 Bacteria 2231
121 Ga0105244_10046962 3300009036 Bacteria 2216
122 Ga0105244_10082614 3300009036 Bacteria 1589
123 Ga0105244_10093793 3300009036 Bacteria 1474
124 Ga0105250_10000319 3300009092 Bacteria 37054
125 Ga0105250_10001041 3300009092 Bacteria 15890
126 Ga0105250_10019670 3300009092 Bacteria 2730
127 Ga0105250_10039633 3300009092 Bacteria 1889
128 Ga0105250_10059168 3300009092 Bacteria 1538
129 Ga0105250_10062480 3300009092 Bacteria 1498
130 Ga0105250_10079968 3300009092 Bacteria 1324
131 Ga0105240_10060050 3300009093 Bacteria 4742
132 Ga0105247_10001068 3300009101 Bacteria 20467
133 Ga0105247_10015109 3300009101 Bacteria 4631
134 Ga0105243_10000010 3300009148 Bacteria 316672
135 Ga0105243_10000103 3300009148 Bacteria 97091
136 Ga0105243_10000405 3300009148 Bacteria 45268
137 Ga0105243_10067022 3300009148 Bacteria 2889
138 Ga0105243_10547595 3300009148 Bacteria 1105
139 Ga0105242_10000360 3300009176 Bacteria 36330
140 Ga0105248_10087748 3300009177 Bacteria 3501
141 Ga0105237_10007888 3300009545 Bacteria 11602
142 Ga0105237_10046669 3300009545 Bacteria 4357
143 Ga0105249_10074808 3300009553 Bacteria 3136
144 Ga0105249_10107172 3300009553 Bacteria 2637
145 Ga0105246_10000222 3300011119 Bacteria 28940
146 Ga0105246_10000465 3300011119 Bacteria 21797
147 Ga0105246_10011023 3300011119 Bacteria 5602
148 Ga0157345_1000026 3300012498 Bacteria 37334
149 Ga0157373_10000195 3300013100 Bacteria 50096
150 Ga0157373_10003312 3300013100 Bacteria 12172
151 Ga0157373_10008594 3300013100 Bacteria 7583
152 Ga0157373_10014944 3300013100 Bacteria 5683
153 Ga0157373_10016275 3300013100 Bacteria 5427
154 Ga0157373_10084348 3300013100 Bacteria 2240
155 Ga0157373_10107284 3300013100 Bacteria 1963
156 Ga0157373_10115674 3300013100 Bacteria 1885
157 Ga0157373_10186006 3300013100 Bacteria 1463
158 Ga0157373_10195614 3300013100 Bacteria 1425
159 Ga0157373_10329660 3300013100 Bacteria 1087
160 Ga0157371_10000186 3300013102 Bacteria 91270
161 Ga0157371_10000306 3300013102 Bacteria 64149
162 Ga0157371_10000390 3300013102 Bacteria 55089
163 Ga0157371_10003300 3300013102 Bacteria 14766
164 Ga0157371_10143257 3300013102 Bacteria 1702
165 Ga0157371_10211376 3300013102 Bacteria 1392
166 Ga0157371_10278483 3300013102 Bacteria 1208
167 Ga0157370_10002694 3300013104 Bacteria 21295
168 Ga0157370_10006604 3300013104 Bacteria 12750
169 Ga0157370_10031366 3300013104 Bacteria 5200
170 Ga0157370_10081529 3300013104 Bacteria 3044
171 Ga0157370_10123431 3300013104 Bacteria 2418
172 Ga0157370_10177604 3300013104 Bacteria 1979
173 Ga0157370_10179169 3300013104 Bacteria 1969
174 Ga0157370_10371820 3300013104 Bacteria 1317
175 Ga0157369_10001322 3300013105 Bacteria 30719
176 Ga0157369_10003927 3300013105 Bacteria 17636
177 Ga0157369_10036004 3300013105 Bacteria 5425
178 Ga0157369_10142783 3300013105 Bacteria 2532
179 Ga0157369_10163971 3300013105 Bacteria 2344
180 Ga0157369_10163972 3300013105 Bacteria 2344
181 Ga0157369_10632499 3300013105 Bacteria 1104
182 Ga0163162_10000072 3300013306 Bacteria 92818
183 Ga0163162_10223361 3300013306 Bacteria 2013
184 Ga0163162_10614266 3300013306 Bacteria 1213
185 Ga0157372_10003177 3300013307 Bacteria 17720
186 Ga0157372_10551341 3300013307 Bacteria 1344
187 Ga0157372_10771673 3300013307 Bacteria 1117
188 Ga0157375_10002479 3300013308 Bacteria 15981
189 Ga0157375_10002644 3300013308 Bacteria 15517
190 Ga0157375_10231135 3300013308 Bacteria 2008
191 Ga0157375_10237035 3300013308 Bacteria 1984
192 Ga0163163_10000230 3300014325 Bacteria 57639
193 Ga0182008_10000074 3300014497 Bacteria 78116
194 Ga0182008_10001296 3300014497 Bacteria 17080
195 Ga0182008_10001314 3300014497 Bacteria 16980
196 Ga0182008_10002229 3300014497 Bacteria 12278
197 Ga0182008_10002908 3300014497 Bacteria 10599
198 Ga0182008_10014512 3300014497 Bacteria 4125
199 Ga0182008_10104963 3300014497 Bacteria 1398
200 Ga0182008_10127260 3300014497 Bacteria 1269
201 Ga0182006_1000183 3300015261 Bacteria 65112
202 Ga0182006_1000326 3300015261 Bacteria 41249
203 Ga0182006_1000780 3300015261 Bacteria 21588
204 Ga0182006_1001649 3300015261 Bacteria 13155
205 Ga0182006_1011937 3300015261 Bacteria 3804
206 Ga0182006_1045388 3300015261 Bacteria 1710
207 Ga0182006_1049914 3300015261 Bacteria 1614
208 Ga0182006_1059794 3300015261 Bacteria 1441
209 Ga0182006_1061523 3300015261 Bacteria 1415
210 Ga0182007_10000903 3300015262 Bacteria 16420
211 Ga0182007_10005553 3300015262 Bacteria 5521
212 Ga0182007_10023350 3300015262 Bacteria 2174
213 Ga0182005_1000308 3300015265 Bacteria 29493
214 Ga0182005_1002027 3300015265 Bacteria 7603
215 Ga0182005_1033783 3300015265 Bacteria 1391
216 Ga0183360_10001 3300015689 Bacteria 3943671
217 Ga0163161_10000904 3300017792 Bacteria 22947
218 Ga0163161_10001710 3300017792 Bacteria 16106
219 Ga0163161_10003054 3300017792 Bacteria 11806
220 Ga0163161_10004486 3300017792 Bacteria 9711
221 Ga0163161_10006348 3300017792 Bacteria 8179
222 Ga0163161_10016314 3300017792 Bacteria 5185
223 Ga0163161_10031180 3300017792 Bacteria 3797
224 Ga0163161_10045349 3300017792 Bacteria 3170
225 Ga0163161_10171959 3300017792 Bacteria 1657
226 Ga0163161_10180818 3300017792 Bacteria 1617
227 Ga0163161_10256455 3300017792 Bacteria 1364
228 Ga0209760_100043 3300025207 Bacteria 113964
229 Ga0209760_100054 3300025207 Bacteria 102021
230 Ga0209784_100040 3300025224 Bacteria 231812
231 Ga0209566_100051 3300025225 Bacteria 231920
232 Ga0209674_100072 3300025226 Bacteria 231812
233 Ga0209147_100067 3300025229 Bacteria 231812
234 Ga0209563_100073 3300025230 Bacteria 231920
235 Ga0209563_101021 3300025230 Bacteria 8148
236 Ga0207427_100047 3300025231 Bacteria 240409
237 Ga0207427_100074 3300025231 Bacteria 153455
238 Ga0207427_100123 3300025231 Bacteria 98859
239 Ga0209437_100006 3300025233 Bacteria 1042724
240 Ga0209437_100009 3300025233 Bacteria 915954
241 Ga0209437_100227 3300025233 Bacteria 98939
242 Ga0209258_100490 3300025242 Bacteria 40292
243 Ga0209646_1000383 3300025246 Bacteria 28428
244 Ga0209677_100121 3300025253 Bacteria 80378
245 Ga0209233_1000032 3300025261 Bacteria 623596
246 Ga0209233_1000105 3300025261 Bacteria 272035
247 Ga0209233_1000283 3300025261 Bacteria 70137
248 Ga0209565_1000001 3300025263 Bacteria 2950419
249 Ga0209565_1009632 3300025263 Bacteria 2435
250 Ga0209673_1000001 3300025273 Bacteria 3176258
251 Ga0209675_1000001 3300025291 Bacteria 2950293
252 Ga0209675_1003706 3300025291 Bacteria 7110
253 Ga0209676_1000006 3300025292 Bacteria 1039588
254 Ga0209676_1000010 3300025292 Bacteria 954025
255 Ga0209676_1000223 3300025292 Bacteria 124359
256 Ga0209676_1000814 3300025292 Bacteria 40784
257 Ga0209676_1003220 3300025292 Bacteria 10312
258 Ga0209676_1003238 3300025292 Bacteria 10269
259 Ga0209025_1000015 3300025294 Bacteria 808120
260 Ga0209564_1000001 3300025295 Bacteria 3176258
261 Ga0209050_1000009 3300025298 Bacteria 1047265
262 Ga0209050_1000081 3300025298 Bacteria 267533
263 Ga0209050_1000214 3300025298 Bacteria 129270
264 Ga0209050_1000363 3300025298 Bacteria 86923
265 Ga0209256_1000002 3300025299 Bacteria 1906740
266 Ga0209051_1000008 3300025303 Bacteria 706935
267 Ga0209051_1000171 3300025303 Bacteria 118013
268 Ga0209051_1000185 3300025303 Bacteria 110195
269 Ga0209051_1013055 3300025303 Bacteria 3975
270 Ga0209257_1000040 3300025304 Bacteria 538759
271 Ga0209257_1000065 3300025304 Bacteria 353604
272 Ga0209257_1000704 3300025304 Bacteria 51740
273 Ga0209257_1015109 3300025304 Bacteria 3246
274 Ga0207656_10000293 3300025321 Bacteria 17271
275 Ga0207696_1000019 3300025711 Bacteria 476309
276 Ga0207696_1000171 3300025711 Bacteria 102599
277 Ga0207696_1000193 3300025711 Bacteria 94161
278 Ga0207696_1002275 3300025711 Bacteria 9544
279 Ga0207696_1005730 3300025711 Bacteria 5109
280 Ga0207696_1020095 3300025711 Bacteria 2160
281 Ga0207696_1035442 3300025711 Bacteria 1486
282 Ga0207696_1040762 3300025711 Bacteria 1359
283 Ga0207696_1057904 3300025711 Bacteria 1095
284 Ga0207655_1000035 3300025728 Bacteria 359016
285 Ga0207655_1000148 3300025728 Bacteria 130207
286 Ga0207655_1000337 3300025728 Bacteria 68266
287 Ga0207655_1000505 3300025728 Bacteria 49919
288 Ga0207655_1000653 3300025728 Bacteria 41243
289 Ga0207655_1001230 3300025728 Bacteria 24612
290 Ga0207655_1002593 3300025728 Bacteria 14397
291 Ga0207655_1002863 3300025728 Bacteria 13331
292 Ga0207655_1004590 3300025728 Bacteria 9724
293 Ga0207655_1004674 3300025728 Bacteria 9601
294 Ga0207655_1005605 3300025728 Bacteria 8499
295 Ga0207655_1007998 3300025728 Bacteria 6780
296 Ga0207655_1013184 3300025728 Bacteria 4763
297 Ga0207655_1015844 3300025728 Bacteria 4162
298 Ga0207655_1018376 3300025728 Bacteria 3711
299 Ga0207655_1026645 3300025728 Bacteria 2772
300 Ga0207655_1035410 3300025728 Bacteria 2229
301 Ga0207655_1053930 3300025728 Bacteria 1603
302 Ga0207655_1059869 3300025728 Bacteria 1479
303 Ga0207713_1000236 3300025735 Bacteria 73781
304 Ga0207713_1000243 3300025735 Bacteria 70146
305 Ga0207713_1000431 3300025735 Bacteria 44260
306 Ga0207713_1000703 3300025735 Bacteria 31288
307 Ga0207713_1001217 3300025735 Bacteria 21481
308 Ga0207713_1003210 3300025735 Bacteria 11287
309 Ga0207713_1003232 3300025735 Bacteria 11247
310 Ga0207713_1003636 3300025735 Bacteria 10381
311 Ga0207713_1003777 3300025735 Bacteria 10156
312 Ga0207713_1006282 3300025735 Bacteria 7263
313 Ga0207713_1019400 3300025735 Bacteria 3328
314 Ga0207713_1026206 3300025735 Bacteria 2676
315 Ga0207713_1040741 3300025735 Bacteria 1945
316 Ga0207713_1064963 3300025735 Bacteria 1371
317 Ga0207710_10000931 3300025900 Bacteria 15578
318 Ga0207710_10005328 3300025900 Bacteria 5550
319 Ga0207680_10024454 3300025903 Bacteria 3316
320 Ga0207647_10002137 3300025904 Bacteria 15112
321 Ga0207705_10014588 3300025909 Bacteria 5654
322 Ga0207695_10126190 3300025913 Bacteria 2521
323 Ga0207671_10000163 3300025914 Bacteria 103443
324 Ga0207657_10028191 3300025919 Bacteria 5128
325 Ga0207649_10000068 3300025920 Bacteria 91623
326 Ga0207649_10005532 3300025920 Bacteria 6839
327 Ga0207681_10000156 3300025923 Bacteria 56382
328 Ga0207681_10000491 3300025923 Bacteria 27650
329 Ga0207681_10070368 3300025923 Bacteria 2436
330 Ga0207650_10000106 3300025925 Bacteria 110058
331 Ga0207650_10000174 3300025925 Bacteria 75634
332 Ga0207650_10004052 3300025925 Bacteria 10017
333 Ga0207664_10000036 3300025929 Bacteria 173396
334 Ga0207644_10000312 3300025931 Bacteria 31641
335 Ga0207706_10001634 3300025933 Bacteria 22204
336 Ga0207706_10018376 3300025933 Bacteria 6291
337 Ga0207706_10110584 3300025933 Bacteria 2417
338 Ga0207686_10007022 3300025934 Bacteria 6059
339 Ga0207709_10000001 3300025935 Bacteria 2228154
340 Ga0207709_10000035 3300025935 Bacteria 300968
341 Ga0207709_10000283 3300025935 Bacteria 57947
342 Ga0207709_10005739 3300025935 Bacteria 7012
343 Ga0207709_10009435 3300025935 Bacteria 5370
344 Ga0207709_10468910 3300025935 Bacteria 977
345 Ga0207711_10001196 3300025941 Bacteria 24599
346 Ga0207679_10000018 3300025945 Bacteria 238375
347 Ga0207667_10001738 3300025949 Bacteria 27400
348 Ga0207712_10042824 3300025961 Bacteria 3120
349 Ga0207658_10000073 3300025986 Bacteria 111738
350 Ga0207703_10209064 3300026035 Bacteria 1739
351 Ga0207639_10005291 3300026041 Bacteria 8709
352 Ga0207702_10009573 3300026078 Bacteria 8135
353 Ga0207641_10108168 3300026088 Bacteria 2460
354 Ga0207641_10114991 3300026088 Bacteria 2391
355 Ga0207676_10000010 3300026095 Bacteria 519402
356 Ga0207674_10045305 3300026116 Bacteria 4525
357 Ga0209281_1000018 3300027111 Bacteria 579091
358 Ga0209281_1000077 3300027111 Bacteria 262887
359 Ga0209281_1003883 3300027111 Bacteria 4690
360 Ga0209389_1000183 3300027296 Bacteria 48155
361 Ga0209371_1000008 3300027312 Bacteria 1024606
362 Ga0209282_1084162 3300027666 Bacteria 1689
363 Ga0207428_10079005 3300027907 Bacteria 2573
364 Ga0207428_10082776 3300027907 Bacteria 2504
365 Ga0268266_10011671 3300028379 Bacteria 7626
366 Ga0268265_10001641 3300028380 Bacteria 18332
367 Ga0268265_10300420 3300028380 Bacteria 1445
368 Ga0307517_10032127 3300028786 Bacteria 6080
369 Ga0307515_10217506 3300028794 Bacteria 1738
370 Ga0265324_10000297 3300029957 Bacteria 36970
371 Ga0268256_1000009 3300030500 Bacteria 1022625
372 Ga0307511_10104950 3300030521 Bacteria 1832
373 Ga0316179_1111071 3300030734 Bacteria 3080
374 Ga0316178_1101239 3300030735 Bacteria 23092
375 Ga0316181_1090174 3300030744 Bacteria 14092
376 Ga0265331_10008951 3300031250 Bacteria 5657
377 Ga0265327_10001967 3300031251 Bacteria 23494
378 Ga0307513_10072433 3300031456 Bacteria 3591
379 Ga0307408_100000081 3300031548 Bacteria 106920
380 Ga0307408_100003463 3300031548 Bacteria 10789
381 Ga0307408_100006501 3300031548 Bacteria 7752
382 Ga0307408_100016487 3300031548 Bacteria 4932
383 Ga0307408_100184706 3300031548 Bacteria 1675
384 Ga0307408_100245987 3300031548 Bacteria 1472
385 Ga0307408_100259451 3300031548 Bacteria 1437
386 Ga0265314_10029286 3300031711 Bacteria 4095
387 Ga0307405_10000154 3300031731 Bacteria 26250
388 Ga0307405_10038238 3300031731 Bacteria 2890
389 Ga0307405_10174571 3300031731 Bacteria 1536
390 Ga0307405_10178476 3300031731 Bacteria 1522
391 Ga0307413_10020405 3300031824 Bacteria 3523
392 Ga0307406_10033549 3300031901 Bacteria 3143
393 Ga0307406_10119493 3300031901 Bacteria 1829
394 Ga0307406_10522625 3300031901 Bacteria 966
395 Ga0307407_10025106 3300031903 Bacteria 3136
396 Ga0307412_10000455 3300031911 Bacteria 24651
397 Ga0307412_10013685 3300031911 Bacteria 4765
398 Ga0307412_10018233 3300031911 Bacteria 4219
399 Ga0307412_10164765 3300031911 Bacteria 1651
400 Ga0307412_10404310 3300031911 Bacteria 1112
401 Ga0307409_100054401 3300031995 Bacteria 3082
402 Ga0307416_100320190 3300032002 Bacteria 1552
403 Ga0307414_10001581 3300032004 Bacteria 11819
404 Ga0307414_10003099 3300032004 Bacteria 8828
405 Ga0307414_10013524 3300032004 Bacteria 4862
406 Ga0307414_10102705 3300032004 Bacteria 2155
407 Ga0307414_10210395 3300032004 Bacteria 1589
408 Ga0307414_10234484 3300032004 Bacteria 1515
409 Ga0307414_10277994 3300032004 Bacteria 1405
410 Ga0307411_10096674 3300032005 Bacteria 2076
411 Ga0307510_10001867 3300033180 Bacteria 23626
412 Ga0395900_0275928 3300037418 Bacteria 1675
413 Ga0395901_0003337 3300038443 Bacteria 16171
414 Ga0237819_01027 3300038705 Bacteria 8377
415 Ga0439438_000117 3300041405 Bacteria 36333
416 Ga0439438_000138 3300041405 Bacteria 33094
417 Ga0439438_000173 3300041405 Bacteria 28731
418 Ga0439438_000239 3300041405 Bacteria 24317
419 Ga0439438_000256 3300041405 Bacteria 23743
420 Ga0439438_000363 3300041405 Bacteria 20308
421 Ga0439438_000507 3300041405 Bacteria 17682
422 Ga0439438_002416 3300041405 Bacteria 7957
423 Ga0439438_004071 3300041405 Bacteria 5726
424 Ga0439438_004981 3300041405 Bacteria 4960
425 Ga0439438_005177 3300041405 Bacteria 4841
426 Ga0439447_000140 3300041407 Bacteria 24638
427 Ga0439447_000329 3300041407 Bacteria 17069
428 Ga0439447_000342 3300041407 Bacteria 16803
429 Ga0439447_000407 3300041407 Bacteria 15876
430 Ga0439447_014373 3300041407 Bacteria 2222
431 Ga0439447_015791 3300041407 Bacteria 2088
432 Ga0439447_033029 3300041407 Bacteria 1291
433 Ga0439466_0000132 3300041411 Bacteria 29242
434 Ga0439466_0000162 3300041411 Bacteria 26711
435 Ga0439466_0000743 3300041411 Bacteria 12349
436 Ga0439466_0000788 3300041411 Bacteria 12036
437 Ga0439466_0001964 3300041411 Bacteria 8060
438 Ga0439466_0002036 3300041411 Bacteria 7929
439 Ga0439466_0002608 3300041411 Bacteria 7055
440 Ga0439466_0003203 3300041411 Bacteria 6371
441 Ga0439466_0008029 3300041411 Bacteria 3979
442 Ga0439466_0009942 3300041411 Bacteria 3539
443 Ga0439466_0010992 3300041411 Bacteria 3355
444 Ga0439466_0021770 3300041411 Bacteria 2268
445 Ga0439466_0021989 3300041411 Bacteria 2254
446 Ga0439466_0032499 3300041411 Bacteria 1778
447 Ga0439466_0033826 3300041411 Bacteria 1735
448 Ga0451791_1891926 3300041451 Bacteria 1569
449 Ga0451802_1143217 3300041460 Bacteria 1124
450 Ga0451843_0211047 3300041509 Bacteria 1488
451 Ga0439431_0000105 3300041997 Bacteria 14310
452 Ga0439431_0021791 3300041997 Bacteria 1540
453 Ga0439437_002196 3300042000 Bacteria 2077
454 Ga0439445_0004866 3300042004 Bacteria 3050
455 Ga0439445_0013118 3300042004 Bacteria 2003
456 Ga0439432_000089 3300042006 Bacteria 28832
457 Ga0439432_000221 3300042006 Bacteria 20475
458 Ga0439432_001589 3300042006 Bacteria 8497
459 Ga0439432_001874 3300042006 Bacteria 7909
460 Ga0439432_002497 3300042006 Bacteria 6930
461 Ga0439432_002504 3300042006 Bacteria 6921
462 Ga0439432_004120 3300042006 Bacteria 5312
463 Ga0439432_010913 3300042006 Bacteria 3135
464 Ga0439432_037642 3300042006 Bacteria 1543
465 Ga0439451_000109 3300042009 Bacteria 14909
466 Ga0439451_000212 3300042009 Bacteria 11268
467 Ga0439451_000301 3300042009 Bacteria 9543
468 Ga0439451_004702 3300042009 Bacteria 2776
469 Ga0439452_000091 3300042010 Bacteria 78007
470 Ga0439452_000164 3300042010 Bacteria 49561
471 Ga0439452_000322 3300042010 Bacteria 30011
472 Ga0439452_000524 3300042010 Bacteria 20546
473 Ga0439452_001381 3300042010 Bacteria 9997
474 Ga0439452_001571 3300042010 Bacteria 9102
475 Ga0439452_002476 3300042010 Bacteria 6790
476 Ga0439452_016994 3300042010 Bacteria 1966
477 Ga0439452_031882 3300042010 Bacteria 1290
478 Ga0439452_032230 3300042010 Bacteria 1281
479 Ga0439456_000045 3300042013 Bacteria 44106
480 Ga0439456_000591 3300042013 Bacteria 7601
481 Ga0439456_001443 3300042013 Bacteria 4775
482 Ga0439456_002921 3300042013 Bacteria 3455
483 Ga0439456_007095 3300042013 Bacteria 2295
484 Ga0439456_026218 3300042013 Bacteria 1239
485 Ga0439463_000018 3300042016 Bacteria 36280
486 Ga0439463_001447 3300042016 Bacteria 6306
487 Ga0439463_003061 3300042016 Bacteria 4248
488 Ga0439463_007616 3300042016 Bacteria 2671
489 Ga0439463_025793 3300042016 Bacteria 1475
490 Ga0439463_028765 3300042016 Bacteria 1401
491 Ga0439463_029075 3300042016 Bacteria 1392
492 Ga0450911_000025 3300042115 Bacteria 83941
493 Ga0450911_000285 3300042115 Bacteria 18702
494 Ga0450911_003117 3300042115 Bacteria 3013
495 Ga0450919_000038 3300042121 Bacteria 11241
496 Ga0450919_007800 3300042121 Bacteria 1246
497 Ga0450920_000199 3300042122 Bacteria 8718
498 Ga0450890_000152 3300042127 Bacteria 10857
499 Ga0450891_001459 3300042129 Bacteria 2439
500 Ga0450900_000722 3300042136 Bacteria 2812
501 Ga0450902_001746 3300042137 Bacteria 3000
502 Ga0450902_003138 3300042137 Bacteria 2391
503 Ga0450902_003286 3300042137 Bacteria 2354
504 Ga0450902_005800 3300042137 Bacteria 1879
505 Ga0450902_010143 3300042137 Bacteria 1489
506 Ga0450903_000362 3300042138 Bacteria 9999
507 Ga0450903_001182 3300042138 Bacteria 4920
508 Ga0450904_000293 3300042139 Bacteria 10833
509 Ga0450904_000791 3300042139 Bacteria 5359
510 Ga0450905_000727 3300042142 Bacteria 4029
511 Ga0450905_003680 3300042142 Bacteria 2015
512 Ga0450906_000028 3300042145 Bacteria 24042
513 Ga0450906_004054 3300042145 Bacteria 3098
514 Ga0450907_000038 3300042146 Bacteria 57421
515 Ga0450907_000289 3300042146 Bacteria 16974
516 Ga0450910_000392 3300042147 Bacteria 5166
517 Ga0450910_001305 3300042147 Bacteria 3118
518 Ga0439446_0000090 3300042156 Bacteria 15301
519 Ga0439446_0000409 3300042156 Bacteria 8321
520 Ga0439446_0026693 3300042156 Bacteria 1655
521 Ga0450908_000046 3300042184 Bacteria 24524
522 Ga0450909_000105 3300042185 Bacteria 8367
523 Ga0450909_001359 3300042185 Bacteria 3398
524 Ga0450909_013840 3300042185 Bacteria 1187
525 Ga0439434_0000034 3300042435 Bacteria 32792
526 Ga0439434_0000277 3300042435 Bacteria 14702
527 Ga0439434_0007412 3300042435 Bacteria 3216
528 Ga0439464_0001412 3300042439 Bacteria 5641
529 Ga0439464_0061057 3300042439 Bacteria 1103
530 Ga0439460_0000015 3300042461 Bacteria 25118
531 Ga0439460_0000042 3300042461 Bacteria 18550
532 Ga0439460_0000776 3300042461 Bacteria 7195
533 Ga0450918_000605 3300042531 Bacteria 7701
534 Ga0450918_016410 3300042531 Bacteria 1287
535 Ga0450893_0004947 3300042532 Bacteria 2128
536 Ga0450901_000332 3300042533 Bacteria 5784
537 Ga0495617_000212 3300046452 Bacteria 35622
538 Ga0495617_001755 3300046452 Bacteria 9259
539 Ga0495617_002016 3300046452 Bacteria 8455
540 Ga0495617_004691 3300046452 Bacteria 4942
541 Ga0495617_007689 3300046452 Bacteria 3728
542 Ga0495617_011768 3300046452 Bacteria 2984
543 Ga0495617_018731 3300046452 Bacteria 2341
544 Ga0495617_035688 3300046452 Bacteria 1669
545 Ga0495617_048361 3300046452 Bacteria 1415
546 Ga0495617_055422 3300046452 Bacteria 1315
547 Ga0495627_000362 3300046453 Bacteria 42515
548 Ga0495627_000447 3300046453 Bacteria 35930
549 Ga0495627_000546 3300046453 Bacteria 31074
550 Ga0495627_000709 3300046453 Bacteria 25383
551 Ga0495627_001245 3300046453 Bacteria 15801
552 Ga0495627_002123 3300046453 Bacteria 10005
553 Ga0495627_002337 3300046453 Bacteria 9293
554 Ga0495627_016192 3300046453 Bacteria 2557
555 Ga0495627_034333 3300046453 Bacteria 1585
556 Ga0495627_039660 3300046453 Bacteria 1452
557 Ga0495627_052048 3300046453 Bacteria 1229
558 Ga0495592_0005799 3300046454 Bacteria 9154
559 Ga0495603_0003172 3300046455 Bacteria 9774
560 Ga0495603_0021379 3300046455 Bacteria 3918
561 Ga0495603_0048503 3300046455 Bacteria 2528
562 Ga0495590_0000265 3300046457 Bacteria 28527
563 Ga0495590_0001638 3300046457 Bacteria 9569
564 Ga0495590_0001639 3300046457 Bacteria 9565
565 Ga0495590_0003337 3300046457 Bacteria 6567
566 Ga0495590_0026001 3300046457 Bacteria 2056
567 Ga0495590_0033137 3300046457 Bacteria 1806
568 Ga0495590_0047250 3300046457 Bacteria 1501
569 Ga0495591_000107 3300046458 Bacteria 95742
570 Ga0495591_000114 3300046458 Bacteria 93304
571 Ga0495591_000510 3300046458 Bacteria 30508
572 Ga0495591_000564 3300046458 Bacteria 28477
573 Ga0495591_001029 3300046458 Bacteria 18870
574 Ga0495591_001088 3300046458 Bacteria 18090
575 Ga0495591_001477 3300046458 Bacteria 14540
576 Ga0495591_001675 3300046458 Bacteria 13318
577 Ga0495591_001731 3300046458 Bacteria 13007
578 Ga0495591_002868 3300046458 Bacteria 9260
579 Ga0495591_003614 3300046458 Bacteria 7876
580 Ga0495591_005843 3300046458 Bacteria 5593
581 Ga0495591_010336 3300046458 Bacteria 3625
582 Ga0495591_014326 3300046458 Bacteria 2856
583 Ga0495591_019943 3300046458 Bacteria 2229
584 Ga0495591_029694 3300046458 Bacteria 1658
585 Ga0495591_032121 3300046458 Bacteria 1566
586 Ga0495591_033899 3300046458 Bacteria 1507
587 Ga0495629_0024544 3300046459 Bacteria 4294
588 Ga0495629_0273021 3300046459 Bacteria 1161
589 Ga0495638_0000991 3300046460 Bacteria 28569
590 Ga0495638_0001231 3300046460 Bacteria 24226
591 Ga0495638_0001573 3300046460 Bacteria 20449
592 Ga0495638_0002232 3300046460 Bacteria 16092
593 Ga0495638_0003134 3300046460 Bacteria 13085
594 Ga0495638_0003343 3300046460 Bacteria 12655
595 Ga0495638_0004346 3300046460 Bacteria 10737
596 Ga0495638_0010611 3300046460 Bacteria 6380
597 Ga0495638_0017083 3300046460 Bacteria 4846
598 Ga0495638_0019886 3300046460 Bacteria 4439
599 Ga0495638_0026591 3300046460 Bacteria 3749
600 Ga0495638_0027711 3300046460 Bacteria 3665
601 Ga0495638_0028671 3300046460 Bacteria 3592
602 Ga0495638_0030254 3300046460 Bacteria 3487
603 Ga0495638_0053624 3300046460 Bacteria 2509
604 Ga0495638_0148070 3300046460 Bacteria 1364
605 Ga0495653_0000788 3300046463 Bacteria 24319
606 Ga0495653_0002108 3300046463 Bacteria 15682
607 Ga0495653_0011081 3300046463 Bacteria 7370
608 Ga0495653_0012237 3300046463 Bacteria 6999
609 Ga0495650_0001300 3300046471 Bacteria 25374
610 Ga0495650_0001590 3300046471 Bacteria 21304
611 Ga0495650_0001706 3300046471 Bacteria 20187
612 Ga0495650_0002399 3300046471 Bacteria 15295
613 Ga0495650_0002419 3300046471 Bacteria 15176
614 Ga0495650_0006965 3300046471 Bacteria 6911
615 Ga0495650_0007104 3300046471 Bacteria 6800
616 Ga0495650_0010355 3300046471 Bacteria 5210
617 Ga0495650_0012083 3300046471 Bacteria 4670
618 Ga0495650_0012952 3300046471 Bacteria 4447
619 Ga0495650_0021128 3300046471 Bacteria 3154
620 Ga0495650_0023898 3300046471 Bacteria 2897
621 Ga0495580_0139791 3300046472 Bacteria 1678
622 Ga0495582_0026353 3300046473 Bacteria 3186
623 Ga0495605_0000017 3300046474 Bacteria 273775
624 Ga0495605_0000026 3300046474 Bacteria 221832
625 Ga0495605_0000105 3300046474 Bacteria 105544
626 Ga0495605_0000220 3300046474 Bacteria 70521
627 Ga0495605_0000527 3300046474 Bacteria 32320
628 Ga0495605_0000771 3300046474 Bacteria 23130
629 Ga0495605_0002351 3300046474 Bacteria 11774
630 Ga0495605_0003511 3300046474 Bacteria 9319
631 Ga0495605_0008134 3300046474 Bacteria 5931
632 Ga0495605_0011041 3300046474 Bacteria 5046
633 Ga0495605_0011331 3300046474 Bacteria 4978
634 Ga0495605_0012790 3300046474 Bacteria 4645
635 Ga0495605_0015222 3300046474 Bacteria 4190
636 Ga0495605_0032978 3300046474 Bacteria 2633
637 Ga0495605_0123154 3300046474 Bacteria 1174
638 Ga0495605_0161284 3300046474 Bacteria 995
639 Ga0495639_0000013 3300046475 Bacteria 83505
640 Ga0495639_0003712 3300046475 Bacteria 6571
641 Ga0495664_0247964 3300046477 Bacteria 1077
642 Ga0495584_0000278 3300046491 Bacteria 36319
643 Ga0495584_0000387 3300046491 Bacteria 30269
644 Ga0495584_0001274 3300046491 Bacteria 15340
645 Ga0495584_0001924 3300046491 Bacteria 11940
646 Ga0495584_0002861 3300046491 Bacteria 9639
647 Ga0495584_0005446 3300046491 Bacteria 6744
648 Ga0495584_0007713 3300046491 Bacteria 5602
649 Ga0495584_0007797 3300046491 Bacteria 5569
650 Ga0495584_0010038 3300046491 Bacteria 4860
651 Ga0495584_0028688 3300046491 Bacteria 2821
652 Ga0495584_0031935 3300046491 Bacteria 2665
653 Ga0495584_0050768 3300046491 Bacteria 2088
654 Ga0495584_0112683 3300046491 Bacteria 1376
655 Ga0495585_0000517 3300046492 Bacteria 36490
656 Ga0495585_0001652 3300046492 Bacteria 17059
657 Ga0495585_0001662 3300046492 Bacteria 17002
658 Ga0495585_0002225 3300046492 Bacteria 14052
659 Ga0495585_0010737 3300046492 Bacteria 5439
660 Ga0495585_0011757 3300046492 Bacteria 5173
661 Ga0495585_0013369 3300046492 Bacteria 4807
662 Ga0495585_0013745 3300046492 Bacteria 4730
663 Ga0495585_0015029 3300046492 Bacteria 4501
664 Ga0495585_0015780 3300046492 Bacteria 4386
665 Ga0495585_0018382 3300046492 Bacteria 4032
666 Ga0495585_0030948 3300046492 Bacteria 3042
667 Ga0495585_0193086 3300046492 Bacteria 1040
668 Ga0495594_0000140 3300046499 Bacteria 34465
669 Ga0495594_0001728 3300046499 Bacteria 11329
670 Ga0495594_0002505 3300046499 Bacteria 9566
671 Ga0495594_0013395 3300046499 Bacteria 4282
672 Ga0495596_0000107 3300046500 Bacteria 59095
673 Ga0495596_0000805 3300046500 Bacteria 19001
674 Ga0495596_0030167 3300046500 Bacteria 2171
675 Ga0495596_0065907 3300046500 Bacteria 1408
676 Ga0495596_0078758 3300046500 Bacteria 1279
677 Ga0495596_0085338 3300046500 Bacteria 1225
678 Ga0495607_0000013 3300046501 Bacteria 189755
679 Ga0495607_0000022 3300046501 Bacteria 162516
680 Ga0495607_0000159 3300046501 Bacteria 71580
681 Ga0495607_0000309 3300046501 Bacteria 50842
682 Ga0495607_0000481 3300046501 Bacteria 39927
683 Ga0495607_0000840 3300046501 Bacteria 29047
684 Ga0495607_0001111 3300046501 Bacteria 24385
685 Ga0495607_0002005 3300046501 Bacteria 17079
686 Ga0495607_0003922 3300046501 Bacteria 11209
687 Ga0495607_0004541 3300046501 Bacteria 10189
688 Ga0495607_0005301 3300046501 Bacteria 9270
689 Ga0495607_0005426 3300046501 Bacteria 9132
690 Ga0495607_0006347 3300046501 Bacteria 8330
691 Ga0495607_0006901 3300046501 Bacteria 7917
692 Ga0495607_0009223 3300046501 Bacteria 6702
693 Ga0495607_0014841 3300046501 Bacteria 5062
694 Ga0495607_0015338 3300046501 Bacteria 4969
695 Ga0495607_0030346 3300046501 Bacteria 3320
696 Ga0495607_0033184 3300046501 Bacteria 3142
697 Ga0495607_0041669 3300046501 Bacteria 2725
698 Ga0495607_0043446 3300046501 Bacteria 2657
699 Ga0495607_0061470 3300046501 Bacteria 2134
700 Ga0495607_0104522 3300046501 Bacteria 1511
701 Ga0495607_0123425 3300046501 Bacteria 1356
702 Ga0495607_0137929 3300046501 Bacteria 1261
703 Ga0495583_0000043 3300046506 Bacteria 230804
704 Ga0495583_0000192 3300046506 Bacteria 102223
705 Ga0495583_0000645 3300046506 Bacteria 46022
706 Ga0495583_0000684 3300046506 Bacteria 43822
707 Ga0495583_0000714 3300046506 Bacteria 42527
708 Ga0495583_0000940 3300046506 Bacteria 33943
709 Ga0495583_0001057 3300046506 Bacteria 30806
710 Ga0495583_0001472 3300046506 Bacteria 23588
711 Ga0495583_0001622 3300046506 Bacteria 22043
712 Ga0495583_0003309 3300046506 Bacteria 12486
713 Ga0495583_0005709 3300046506 Bacteria 8362
714 Ga0495583_0010559 3300046506 Bacteria 5371
715 Ga0495606_0000362 3300046507 Bacteria 77675
716 Ga0495606_0000367 3300046507 Bacteria 77313
717 Ga0495606_0001081 3300046507 Bacteria 39097
718 Ga0495606_0001228 3300046507 Bacteria 35889
719 Ga0495606_0001261 3300046507 Bacteria 35236
720 Ga0495606_0001308 3300046507 Bacteria 34303
721 Ga0495606_0001970 3300046507 Bacteria 25345
722 Ga0495606_0002333 3300046507 Bacteria 22368
723 Ga0495606_0003639 3300046507 Bacteria 16183
724 Ga0495606_0009526 3300046507 Bacteria 8203
725 Ga0495606_0009574 3300046507 Bacteria 8173
726 Ga0495606_0018779 3300046507 Bacteria 5172
727 Ga0495606_0024039 3300046507 Bacteria 4402
728 Ga0495606_0034007 3300046507 Bacteria 3505
729 Ga0495606_0147229 3300046507 Bacteria 1385
730 Ga0495606_0203747 3300046507 Bacteria 1126
731 Ga0495606_0211197 3300046507 Bacteria 1099
732 Ga0495610_0000723 3300046512 Bacteria 31412
733 Ga0495610_0000761 3300046512 Bacteria 30382
734 Ga0495610_0001455 3300046512 Bacteria 20932
735 Ga0495610_0001620 3300046512 Bacteria 19788
736 Ga0495610_0001992 3300046512 Bacteria 17435
737 Ga0495610_0007995 3300046512 Bacteria 6930
738 Ga0495610_0008038 3300046512 Bacteria 6903
739 Ga0495610_0010674 3300046512 Bacteria 5685
740 Ga0495610_0011001 3300046512 Bacteria 5568
741 Ga0495610_0013504 3300046512 Bacteria 4850
742 Ga0495610_0015957 3300046512 Bacteria 4343
743 Ga0495610_0088072 3300046512 Bacteria 1411
744 Ga0495616_0000340 3300046513 Bacteria 37043
745 Ga0495616_0000482 3300046513 Bacteria 30327
746 Ga0495616_0002159 3300046513 Bacteria 13139
747 Ga0495616_0008773 3300046513 Bacteria 5957
748 Ga0495616_0009458 3300046513 Bacteria 5700
749 Ga0495616_0012758 3300046513 Bacteria 4756
750 Ga0495616_0016266 3300046513 Bacteria 4121
751 Ga0495616_0023177 3300046513 Bacteria 3342
752 Ga0495616_0055908 3300046513 Bacteria 1951
753 Ga0495616_0085043 3300046513 Bacteria 1507
754 Ga0495616_0133127 3300046513 Bacteria 1137
755 Ga0495616_0159055 3300046513 Bacteria 1017
756 Ga0495620_0000075 3300046515 Bacteria 81405
757 Ga0495620_0000114 3300046515 Bacteria 64421
758 Ga0495620_0000170 3300046515 Bacteria 51293
759 Ga0495620_0000307 3300046515 Bacteria 34934
760 Ga0495620_0002176 3300046515 Bacteria 11384
761 Ga0495620_0002439 3300046515 Bacteria 10769
762 Ga0495620_0002887 3300046515 Bacteria 9878
763 Ga0495620_0006034 3300046515 Bacteria 6707
764 Ga0495620_0007339 3300046515 Bacteria 5999
765 Ga0495620_0011137 3300046515 Bacteria 4707
766 Ga0495620_0020589 3300046515 Bacteria 3220
767 Ga0495620_0020799 3300046515 Bacteria 3197
768 Ga0495620_0076483 3300046515 Bacteria 1360
769 Ga0495630_0010683 3300046517 Bacteria 6628
770 Ga0495630_0014997 3300046517 Bacteria 5654
771 Ga0495631_0000020 3300046518 Bacteria 92958
772 Ga0495631_0000384 3300046518 Bacteria 30478
773 Ga0495631_0000609 3300046518 Bacteria 23559
774 Ga0495631_0001218 3300046518 Bacteria 15891
775 Ga0495631_0001327 3300046518 Bacteria 15168
776 Ga0495631_0006461 3300046518 Bacteria 6049
777 Ga0495631_0010943 3300046518 Bacteria 4478
778 Ga0495631_0024729 3300046518 Bacteria 2771
779 Ga0495631_0025838 3300046518 Bacteria 2700
780 Ga0495631_0030128 3300046518 Bacteria 2464
781 Ga0495631_0056485 3300046518 Bacteria 1709
782 Ga0495631_0063302 3300046518 Bacteria 1602
783 Ga0495632_0000255 3300046519 Bacteria 52928
784 Ga0495632_0000436 3300046519 Bacteria 39746
785 Ga0495632_0000790 3300046519 Bacteria 28178
786 Ga0495632_0000965 3300046519 Bacteria 25128
787 Ga0495632_0001749 3300046519 Bacteria 17563
788 Ga0495632_0002297 3300046519 Bacteria 14725
789 Ga0495632_0003622 3300046519 Bacteria 10860
790 Ga0495632_0004384 3300046519 Bacteria 9596
791 Ga0495632_0010001 3300046519 Bacteria 5657
792 Ga0495632_0014829 3300046519 Bacteria 4394
793 Ga0495632_0014837 3300046519 Bacteria 4393
794 Ga0495632_0029689 3300046519 Bacteria 2844
795 Ga0495632_0034296 3300046519 Bacteria 2598
796 Ga0495632_0034571 3300046519 Bacteria 2585
797 Ga0495632_0045524 3300046519 Bacteria 2185
798 Ga0495632_0060478 3300046519 Bacteria 1840
799 Ga0495632_0064189 3300046519 Bacteria 1776
800 Ga0495632_0069523 3300046519 Bacteria 1695
801 Ga0495632_0122043 3300046519 Bacteria 1217
802 Ga0495637_0000043 3300046520 Bacteria 112526
803 Ga0495637_0000420 3300046520 Bacteria 31089
804 Ga0495637_0000442 3300046520 Bacteria 30284
805 Ga0495637_0000447 3300046520 Bacteria 30138
806 Ga0495637_0000616 3300046520 Bacteria 25212
807 Ga0495637_0001545 3300046520 Bacteria 13418
808 Ga0495637_0001927 3300046520 Bacteria 11790
809 Ga0495637_0004671 3300046520 Bacteria 7072
810 Ga0495637_0008453 3300046520 Bacteria 5056
811 Ga0495637_0009920 3300046520 Bacteria 4632
812 Ga0495637_0011626 3300046520 Bacteria 4225
813 Ga0495637_0014251 3300046520 Bacteria 3751
814 Ga0495637_0018855 3300046520 Bacteria 3195
815 Ga0495637_0024902 3300046520 Bacteria 2704
816 Ga0495637_0026502 3300046520 Bacteria 2600
817 Ga0495637_0030811 3300046520 Bacteria 2376
818 Ga0495643_0000049 3300046522 Bacteria 212242
819 Ga0495643_0000401 3300046522 Bacteria 56732
820 Ga0495643_0000647 3300046522 Bacteria 41199
821 Ga0495643_0001444 3300046522 Bacteria 21900
822 Ga0495643_0004481 3300046522 Bacteria 9750
823 Ga0495643_0008120 3300046522 Bacteria 6684
824 Ga0495643_0009497 3300046522 Bacteria 6042
825 Ga0495643_0011154 3300046522 Bacteria 5492
826 Ga0495643_0013208 3300046522 Bacteria 4952
827 Ga0495643_0020133 3300046522 Bacteria 3854
828 Ga0495643_0020193 3300046522 Bacteria 3846
829 Ga0495643_0029136 3300046522 Bacteria 3090
830 Ga0495643_0100509 3300046522 Bacteria 1483
831 Ga0495644_0000193 3300046523 Bacteria 28686
832 Ga0495644_0000508 3300046523 Bacteria 16641
833 Ga0495644_0000998 3300046523 Bacteria 11777
834 Ga0495644_0003222 3300046523 Bacteria 6445
835 Ga0495644_0010173 3300046523 Bacteria 3624
836 Ga0495644_0013086 3300046523 Bacteria 3188
837 Ga0495644_0028333 3300046523 Bacteria 2119
838 Ga0495648_0000327 3300046524 Bacteria 52513
839 Ga0495648_0000627 3300046524 Bacteria 37754
840 Ga0495648_0001249 3300046524 Bacteria 25427
841 Ga0495648_0001427 3300046524 Bacteria 23379
842 Ga0495648_0003384 3300046524 Bacteria 14029
843 Ga0495648_0004361 3300046524 Bacteria 12115
844 Ga0495648_0004765 3300046524 Bacteria 11481
845 Ga0495648_0004814 3300046524 Bacteria 11389
846 Ga0495648_0007585 3300046524 Bacteria 8664
847 Ga0495648_0007721 3300046524 Bacteria 8567
848 Ga0495648_0012937 3300046524 Bacteria 6197
849 Ga0495648_0016013 3300046524 Bacteria 5415
850 Ga0495648_0016995 3300046524 Bacteria 5220
851 Ga0495648_0028598 3300046524 Bacteria 3710
852 Ga0495648_0028614 3300046524 Bacteria 3708
853 Ga0495648_0048002 3300046524 Bacteria 2632
854 Ga0495648_0069536 3300046524 Bacteria 2048
855 Ga0495648_0070245 3300046524 Bacteria 2035
856 Ga0495648_0133717 3300046524 Bacteria 1315
857 Ga0495663_0000254 3300046525 Bacteria 20648
858 Ga0495666_0000190 3300046526 Bacteria 26331
859 Ga0495666_0001791 3300046526 Bacteria 10608
860 Ga0495666_0010302 3300046526 Bacteria 4660
861 Ga0495666_0012665 3300046526 Bacteria 4203
862 Ga0495666_0033403 3300046526 Bacteria 2513
863 Ga0495666_0041931 3300046526 Bacteria 2214
864 Ga0495642_0000033 3300046528 Bacteria 85849
865 Ga0495642_0000251 3300046528 Bacteria 30079
866 Ga0495642_0000900 3300046528 Bacteria 13938
867 Ga0495654_0000111 3300046530 Bacteria 92977
868 Ga0495654_0000298 3300046530 Bacteria 44337
869 Ga0495654_0000324 3300046530 Bacteria 41969
870 Ga0495654_0000784 3300046530 Bacteria 24497
871 Ga0495654_0000841 3300046530 Bacteria 23266
872 Ga0495654_0000936 3300046530 Bacteria 21636
873 Ga0495654_0000982 3300046530 Bacteria 20977
874 Ga0495654_0002582 3300046530 Bacteria 11570
875 Ga0495654_0003751 3300046530 Bacteria 9200
876 Ga0495654_0006337 3300046530 Bacteria 6728
877 Ga0495654_0007625 3300046530 Bacteria 6023
878 Ga0495654_0012184 3300046530 Bacteria 4626
879 Ga0495654_0015224 3300046530 Bacteria 4088
880 Ga0495654_0029278 3300046530 Bacteria 2809
881 Ga0495654_0030089 3300046530 Bacteria 2764
882 Ga0495654_0046569 3300046530 Bacteria 2135
883 Ga0495654_0050675 3300046530 Bacteria 2027
884 Ga0495654_0053809 3300046530 Bacteria 1954
885 Ga0495654_0063978 3300046530 Bacteria 1759
886 Ga0495654_0064557 3300046530 Bacteria 1750
887 Ga0495654_0068608 3300046530 Bacteria 1685
888 Ga0495654_0079416 3300046530 Bacteria 1541
889 Ga0495654_0082682 3300046530 Bacteria 1502
890 Ga0495654_0110814 3300046530 Bacteria 1252
891 Ga0495654_0112973 3300046530 Bacteria 1237
892 Ga0495587_0000454 3300046536 Bacteria 28585
893 Ga0495587_0002320 3300046536 Bacteria 12723
894 Ga0495587_0046233 3300046536 Bacteria 2584
895 Ga0495587_0170833 3300046536 Bacteria 1235
896 Ga0495609_0000036 3300046538 Bacteria 186358
897 Ga0495609_0000045 3300046538 Bacteria 159595
898 Ga0495609_0000049 3300046538 Bacteria 155608
899 Ga0495609_0000405 3300046538 Bacteria 36116
900 Ga0495609_0001082 3300046538 Bacteria 18993
901 Ga0495609_0002678 3300046538 Bacteria 10775
902 Ga0495609_0003612 3300046538 Bacteria 8785
903 Ga0495609_0004013 3300046538 Bacteria 8216
904 Ga0495609_0007819 3300046538 Bacteria 5292
905 Ga0495609_0011375 3300046538 Bacteria 4240
906 Ga0495609_0015814 3300046538 Bacteria 3526
907 Ga0495609_0042453 3300046538 Bacteria 2042
908 Ga0495609_0068490 3300046538 Bacteria 1561
909 Ga0495609_0138747 3300046538 Bacteria 1038
910 Ga0495597_0000013 3300046542 Bacteria 203829
911 Ga0495597_0000574 3300046542 Bacteria 30588
912 Ga0495597_0001021 3300046542 Bacteria 21440
913 Ga0495597_0001346 3300046542 Bacteria 17840
914 Ga0495597_0002441 3300046542 Bacteria 11796
915 Ga0495597_0009911 3300046542 Bacteria 4682
916 Ga0495597_0013507 3300046542 Bacteria 3907
917 Ga0495597_0016615 3300046542 Bacteria 3474
918 Ga0495597_0019026 3300046542 Bacteria 3217
919 Ga0495597_0057294 3300046542 Bacteria 1705
920 Ga0495645_0023776 3300046543 Bacteria 4441
921 Ga0495645_0068352 3300046543 Bacteria 2565
922 Ga0495645_0252176 3300046543 Bacteria 1172
923 Ga0495622_0000346 3300046557 Bacteria 33256
924 Ga0495622_0000757 3300046557 Bacteria 18043
925 Ga0495622_0003859 3300046557 Bacteria 7002
926 Ga0495622_0006630 3300046557 Bacteria 5365
927 Ga0495622_0027975 3300046557 Bacteria 2631
928 Ga0495622_0037699 3300046557 Bacteria 2251
929 Ga0495622_0041437 3300046557 Bacteria 2141
930 Ga0495622_0062426 3300046557 Bacteria 1724
931 Ga0495622_0072793 3300046557 Bacteria 1585
932 Ga0495633_0000229 3300046558 Bacteria 68402
933 Ga0495633_0000960 3300046558 Bacteria 23854
934 Ga0495633_0001099 3300046558 Bacteria 21829
935 Ga0495633_0009543 3300046558 Bacteria 5350
936 Ga0495633_0022014 3300046558 Bacteria 3179
937 Ga0495633_0026649 3300046558 Bacteria 2834
938 Ga0495656_0128887 3300046615 Bacteria 1202
939 Ga0495668_0000568 3300046616 Bacteria 45426
940 Ga0495668_0001696 3300046616 Bacteria 20376
941 Ga0495668_0021584 3300046616 Bacteria 3689
942 Ga0495668_0069885 3300046616 Bacteria 1930
943 Ga0495668_0117648 3300046616 Bacteria 1453
944 Ga0495668_0226720 3300046616 Bacteria 1023
945 Ga0495634_0000604 3300046642 Bacteria 34740
946 Ga0495634_0007150 3300046642 Bacteria 8418
947 Ga0495611_0000220 3300046648 Bacteria 39983
948 Ga0495611_0000472 3300046648 Bacteria 24021
949 Ga0495611_0001173 3300046648 Bacteria 13640
950 Ga0495611_0002514 3300046648 Bacteria 8342
951 Ga0495611_0008346 3300046648 Bacteria 4385
952 Ga0495611_0009865 3300046648 Bacteria 4040
953 Ga0495611_0013461 3300046648 Bacteria 3484
954 Ga0495611_0021500 3300046648 Bacteria 2786
955 Ga0495625_0000070 3300046660 Bacteria 167336
956 Ga0495625_0001145 3300046660 Bacteria 34203
957 Ga0495625_0001301 3300046660 Bacteria 31222
958 Ga0495625_0001848 3300046660 Bacteria 24155
959 Ga0495625_0002099 3300046660 Bacteria 22263
960 Ga0495625_0002421 3300046660 Bacteria 20214
961 Ga0495625_0003237 3300046660 Bacteria 16478
962 Ga0495625_0007897 3300046660 Bacteria 9161
963 Ga0495625_0017092 3300046660 Bacteria 5685
964 Ga0495625_0017490 3300046660 Bacteria 5613
965 Ga0495625_0018386 3300046660 Bacteria 5459
966 Ga0495625_0019131 3300046660 Bacteria 5326
967 Ga0495625_0047775 3300046660 Bacteria 3085
968 Ga0495625_0078182 3300046660 Bacteria 2309
969 Ga0495625_0088804 3300046660 Bacteria 2140
970 Ga0495625_0130411 3300046660 Bacteria 1703
971 Ga0495625_0167679 3300046660 Bacteria 1467
972 Ga0495635_0000247 3300046663 Bacteria 34285
973 Ga0495635_0037121 3300046663 Bacteria 3373
974 Ga0495659_0000162 3300046664 Bacteria 29900
975 Ga0495659_0005203 3300046664 Bacteria 4089
976 Ga0495661_0000042 3300046665 Bacteria 150599
977 Ga0495661_0000312 3300046665 Bacteria 54893
978 Ga0495661_0000545 3300046665 Bacteria 38934
979 Ga0495661_0000867 3300046665 Bacteria 28166
980 Ga0495661_0003095 3300046665 Bacteria 12492
981 Ga0495661_0003984 3300046665 Bacteria 10770
982 Ga0495661_0008243 3300046665 Bacteria 7218
983 Ga0495661_0012485 3300046665 Bacteria 5736
984 Ga0495661_0012911 3300046665 Bacteria 5627
985 Ga0495661_0019090 3300046665 Bacteria 4497
986 Ga0495661_0020701 3300046665 Bacteria 4291
987 Ga0495661_0026075 3300046665 Bacteria 3766
988 Ga0495661_0037357 3300046665 Bacteria 3032
989 Ga0495661_0073479 3300046665 Bacteria 1992
990 Ga0495661_0113131 3300046665 Bacteria 1510
991 Ga0495661_0122272 3300046665 Bacteria 1436
992 Ga0495588_0011494 3300046674 Bacteria 4157
993 Ga0495588_0034802 3300046674 Bacteria 2549
994 Ga0495588_0052241 3300046674 Bacteria 2106
995 Ga0495588_0063121 3300046674 Bacteria 1920
996 Ga0495588_0074595 3300046674 Bacteria 1766
997 Ga0495599_0091482 3300046678 Bacteria 1898
998 Ga0495623_0000555 3300046679 Bacteria 24919
999 Ga0495623_0007106 3300046679 Bacteria 7274
1000 Ga0495646_0000263 3300046680 Bacteria 26648
1001 Ga0495646_0000651 3300046680 Bacteria 19026
1002 Ga0495646_0006393 3300046680 Bacteria 7471
1003 Ga0495669_0004289 3300046684 Bacteria 5884
1004 Ga0495613_0010387 3300046689 Bacteria 6915
1005 Ga0495613_0012057 3300046689 Bacteria 6423
1006 Ga0495613_0012280 3300046689 Bacteria 6363
1007 Ga0495624_0000533 3300046690 Bacteria 29812
1008 Ga0495670_0000115 3300046691 Bacteria 35545
1009 Ga0495670_0000146 3300046691 Bacteria 31027
1010 Ga0495670_0000969 3300046691 Bacteria 13911
1011 Ga0495670_0001578 3300046691 Bacteria 11133
1012 Ga0495670_0002156 3300046691 Bacteria 9730
1013 Ga0495670_0007144 3300046691 Bacteria 5497
1014 Ga0495670_0011830 3300046691 Bacteria 4295
1015 Ga0495670_0012118 3300046691 Bacteria 4241
1016 Ga0495670_0015984 3300046691 Bacteria 3689
1017 Ga0495670_0024246 3300046691 Bacteria 2998
1018 Ga0495670_0067040 3300046691 Bacteria 1811
1019 Ga0495671_0000380 3300046692 Bacteria 36521
1020 Ga0495671_0000428 3300046692 Bacteria 33406
1021 Ga0495671_0000808 3300046692 Bacteria 22380
1022 Ga0495671_0001253 3300046692 Bacteria 17350
1023 Ga0495671_0001430 3300046692 Bacteria 16054
1024 Ga0495671_0002385 3300046692 Bacteria 11909
1025 Ga0495671_0007610 3300046692 Bacteria 6158
1026 Ga0495671_0008122 3300046692 Bacteria 5925
1027 Ga0495671_0008423 3300046692 Bacteria 5802
1028 Ga0495671_0009680 3300046692 Bacteria 5375
1029 Ga0495671_0010341 3300046692 Bacteria 5174
1030 Ga0495671_0011518 3300046692 Bacteria 4859
1031 Ga0495671_0022607 3300046692 Bacteria 3293
1032 Ga0495671_0025200 3300046692 Bacteria 3092
1033 Ga0495671_0042494 3300046692 Bacteria 2284
1034 Ga0495671_0045911 3300046692 Bacteria 2185
1035 Ga0495671_0049801 3300046692 Bacteria 2087
1036 Ga0495649_0000462 3300046694 Bacteria 34992
1037 Ga0495649_0000580 3300046694 Bacteria 30670
1038 Ga0495649_0000598 3300046694 Bacteria 30066
1039 Ga0495649_0000666 3300046694 Bacteria 28081
1040 Ga0495649_0002822 3300046694 Bacteria 12069
1041 Ga0495649_0003938 3300046694 Bacteria 9812
1042 Ga0495649_0004392 3300046694 Bacteria 9221
1043 Ga0495649_0008504 3300046694 Bacteria 6168
1044 Ga0495649_0013429 3300046694 Bacteria 4724
1045 Ga0495649_0014238 3300046694 Bacteria 4566
1046 Ga0495649_0015808 3300046694 Bacteria 4290
1047 Ga0495649_0022217 3300046694 Bacteria 3549
1048 Ga0495649_0059667 3300046694 Bacteria 2053
1049 Ga0495649_0086164 3300046694 Bacteria 1676
1050 Ga0495649_0119840 3300046694 Bacteria 1392
1051 Ga0495589_0000127 3300046794 Bacteria 70424
1052 Ga0495589_0000238 3300046794 Bacteria 46015
1053 Ga0495589_0000399 3300046794 Bacteria 32701
1054 Ga0495589_0000414 3300046794 Bacteria 32060
1055 Ga0495589_0000943 3300046794 Bacteria 17818
1056 Ga0495589_0002524 3300046794 Bacteria 10188
1057 Ga0495589_0002598 3300046794 Bacteria 10025
1058 Ga0495589_0003020 3300046794 Bacteria 9253
1059 Ga0495589_0005006 3300046794 Bacteria 7018
1060 Ga0495589_0013229 3300046794 Bacteria 4258
1061 Ga0495589_0016357 3300046794 Bacteria 3813
1062 Ga0495589_0018383 3300046794 Bacteria 3584
1063 Ga0495600_0006341 3300046809 Bacteria 7194
1064 Ga0495600_0026624 3300046809 Bacteria 3733
1065 Ga0495600_0038331 3300046809 Bacteria 3118
1066 Ga0495660_0000461 3300046810 Bacteria 33748
1067 Ga0495660_0000535 3300046810 Bacteria 31085
1068 Ga0495660_0000635 3300046810 Bacteria 27337
1069 Ga0495660_0000750 3300046810 Bacteria 24463
1070 Ga0495660_0001328 3300046810 Bacteria 17047
1071 Ga0495660_0002832 3300046810 Bacteria 10901
1072 Ga0495660_0005329 3300046810 Bacteria 7703
1073 Ga0495660_0009503 3300046810 Bacteria 5668
1074 Ga0495660_0011235 3300046810 Bacteria 5198
1075 Ga0495660_0011581 3300046810 Bacteria 5115
1076 Ga0495660_0014213 3300046810 Bacteria 4611
1077 Ga0495660_0014638 3300046810 Bacteria 4536
1078 Ga0495660_0016853 3300046810 Bacteria 4209
1079 Ga0495660_0020663 3300046810 Bacteria 3774
1080 Ga0495660_0022145 3300046810 Bacteria 3631
1081 Ga0495660_0023097 3300046810 Bacteria 3549
1082 Ga0495660_0028964 3300046810 Bacteria 3127
1083 Ga0495660_0045215 3300046810 Bacteria 2418
1084 Ga0495660_0064156 3300046810 Bacteria 1964
1085 Ga0495660_0067161 3300046810 Bacteria 1910
1086 Ga0495660_0140797 3300046810 Bacteria 1200
1087 Ga0495581_0001342 3300047315 Bacteria 13602
1088 Ga0495604_0022917 3300047317 Bacteria 4983
1089 Ga0495604_0024534 3300047317 Bacteria 4810
1090 Ga0495604_0029448 3300047317 Bacteria 4368
1091 Ga0495636_0026303 3300047318 Bacteria 2366
1092 Ga0495672_0000211 3300047320 Bacteria 83189
1093 Ga0495672_0000540 3300047320 Bacteria 42937
1094 Ga0495672_0000791 3300047320 Bacteria 34302
1095 Ga0495672_0001244 3300047320 Bacteria 25587
1096 Ga0495672_0002250 3300047320 Bacteria 17953
1097 Ga0495672_0003287 3300047320 Bacteria 13982
1098 Ga0495672_0006837 3300047320 Bacteria 8710
1099 Ga0495672_0006878 3300047320 Bacteria 8676
1100 Ga0495672_0008178 3300047320 Bacteria 7758
1101 Ga0495672_0009838 3300047320 Bacteria 6879
1102 Ga0495672_0011896 3300047320 Bacteria 6106
1103 Ga0495672_0017798 3300047320 Bacteria 4742
1104 Ga0495672_0019994 3300047320 Bacteria 4400
1105 Ga0495672_0028652 3300047320 Bacteria 3519
1106 Ga0495672_0050635 3300047320 Bacteria 2450
1107 Ga0495672_0164898 3300047320 Bacteria 1135
1108 Ga0495676_0000019 3300047321 Bacteria 167261
1109 Ga0495676_0000568 3300047321 Bacteria 30309
1110 Ga0495676_0004365 3300047321 Bacteria 12920
1111 Ga0495680_0001631 3300047322 Bacteria 23845
1112 Ga0495680_0001655 3300047322 Bacteria 23697
1113 Ga0495680_0006403 3300047322 Bacteria 10948
1114 Ga0495680_0006531 3300047322 Bacteria 10826
1115 Ga0495680_0010690 3300047322 Bacteria 8185
1116 Ga0495680_0014253 3300047322 Bacteria 6893
1117 Ga0495683_0000003 3300047323 Bacteria 383992
1118 Ga0495683_0000085 3300047323 Bacteria 93009
1119 Ga0495683_0000455 3300047323 Bacteria 32160
1120 Ga0495683_0002508 3300047323 Bacteria 11043
1121 Ga0495683_0003443 3300047323 Bacteria 9229
1122 Ga0495683_0003889 3300047323 Bacteria 8590
1123 Ga0495683_0008100 3300047323 Bacteria 5641
1124 Ga0495683_0023061 3300047323 Bacteria 3199
1125 Ga0495683_0028422 3300047323 Bacteria 2859
1126 Ga0495683_0028572 3300047323 Bacteria 2850
1127 Ga0495683_0043328 3300047323 Bacteria 2266
1128 Ga0495683_0047118 3300047323 Bacteria 2163
1129 Ga0495683_0051041 3300047323 Bacteria 2069
1130 Ga0495683_0058748 3300047323 Bacteria 1909
1131 Ga0495683_0100932 3300047323 Bacteria 1387
1132 Ga0495687_000975 3300047443 Bacteria 29034
1133 Ga0495687_002082 3300047443 Bacteria 16813
1134 Ga0495687_002345 3300047443 Bacteria 15376
1135 Ga0495687_002731 3300047443 Bacteria 13695
1136 Ga0495675_0002044 3300047444 Bacteria 12066
1137 Ga0495675_0025696 3300047444 Bacteria 3753
1138 Ga0495675_0109072 3300047444 Bacteria 1728
1139 Ga0495677_0000245 3300047445 Bacteria 24005
1140 Ga0495679_000049 3300047446 Bacteria 127408
1141 Ga0495679_000380 3300047446 Bacteria 34062
1142 Ga0495679_000475 3300047446 Bacteria 29071
1143 Ga0495679_000621 3300047446 Bacteria 23962
1144 Ga0495679_001516 3300047446 Bacteria 13123
1145 Ga0495679_001581 3300047446 Bacteria 12841
1146 Ga0495679_002650 3300047446 Bacteria 8988
1147 Ga0495679_003180 3300047446 Bacteria 8004
1148 Ga0495679_003673 3300047446 Bacteria 7317
1149 Ga0495679_010071 3300047446 Bacteria 3739
1150 Ga0495679_010728 3300047446 Bacteria 3578
1151 Ga0495679_041769 3300047446 Bacteria 1418
1152 Ga0495679_046501 3300047446 Bacteria 1320
1153 Ga0495685_001299 3300047447 Bacteria 7618
1154 Ga0495673_0000168 3300047469 Bacteria 108628
1155 Ga0495673_0000345 3300047469 Bacteria 58540
1156 Ga0495673_0000411 3300047469 Bacteria 50011
1157 Ga0495673_0000637 3300047469 Bacteria 34475
1158 Ga0495673_0000687 3300047469 Bacteria 33114
1159 Ga0495673_0000702 3300047469 Bacteria 32531
1160 Ga0495673_0000755 3300047469 Bacteria 30650
1161 Ga0495673_0000806 3300047469 Bacteria 29458
1162 Ga0495673_0000864 3300047469 Bacteria 28042
1163 Ga0495673_0001319 3300047469 Bacteria 20205
1164 Ga0495673_0003307 3300047469 Bacteria 10691
1165 Ga0495673_0004244 3300047469 Bacteria 9046
1166 Ga0495673_0004370 3300047469 Bacteria 8872
1167 Ga0495673_0006513 3300047469 Bacteria 6853
1168 Ga0495673_0007963 3300047469 Bacteria 6013
1169 Ga0495673_0009701 3300047469 Bacteria 5302
1170 Ga0495673_0011069 3300047469 Bacteria 4875
1171 Ga0495673_0014724 3300047469 Bacteria 4059
1172 Ga0495673_0014934 3300047469 Bacteria 4021
1173 Ga0495673_0020243 3300047469 Bacteria 3316
1174 Ga0495673_0023781 3300047469 Bacteria 2972
1175 Ga0495673_0025990 3300047469 Bacteria 2806
1176 Ga0495673_0072403 3300047469 Bacteria 1446
1177 Ga0495681_0000172 3300047470 Bacteria 54252
1178 Ga0495681_0000226 3300047470 Bacteria 47165
1179 Ga0495681_0000352 3300047470 Bacteria 35925
1180 Ga0495681_0000424 3300047470 Bacteria 32445
1181 Ga0495681_0000504 3300047470 Bacteria 29850
1182 Ga0495681_0000542 3300047470 Bacteria 28962
1183 Ga0495681_0000727 3300047470 Bacteria 25281
1184 Ga0495681_0002050 3300047470 Bacteria 14647
1185 Ga0495681_0002613 3300047470 Bacteria 12793
1186 Ga0495681_0004426 3300047470 Bacteria 9578
1187 Ga0495681_0005793 3300047470 Bacteria 8210
1188 Ga0495681_0014464 3300047470 Bacteria 4520
1189 Ga0495681_0015293 3300047470 Bacteria 4348
1190 Ga0495681_0021103 3300047470 Bacteria 3516
1191 Ga0495681_0029618 3300047470 Bacteria 2800
1192 Ga0495681_0032543 3300047470 Bacteria 2624
1193 Ga0495681_0043502 3300047470 Bacteria 2165
1194 Ga0495681_0049432 3300047470 Bacteria 1987
1195 Ga0495681_0110579 3300047470 Bacteria 1190
1196 Ga0495684_0006952 3300047471 Bacteria 8787
1197 Ga0495684_0012754 3300047471 Bacteria 6487
1198 Ga0495686_0001754 3300047472 Bacteria 22253
1199 Ga0495686_0002862 3300047472 Bacteria 15544
1200 Ga0495686_0006607 3300047472 Bacteria 8840
1201 Ga0495686_0017096 3300047472 Bacteria 4896
1202 Ga0495686_0068571 3300047472 Bacteria 2188
1203 Ga0495686_0076716 3300047472 Bacteria 2047
1204 Ga0495686_0116245 3300047472 Bacteria 1599
1205 Ga0495686_0146749 3300047472 Bacteria 1388
1206 Ga0495593_0000512 3300047673 Bacteria 21934
1207 Ga0495593_0001705 3300047673 Bacteria 13006
1208 Ga0495593_0009545 3300047673 Bacteria 5630
1209 Ga0495593_0035310 3300047673 Bacteria 2715
1210 Ga0495602_0001327 3300048088 Bacteria 24384
1211 Ga0495626_0000080 3300048091 Bacteria 129112
1212 Ga0495626_0000144 3300048091 Bacteria 89793
1213 Ga0495626_0000179 3300048091 Bacteria 77215
1214 Ga0495626_0000438 3300048091 Bacteria 42557
1215 Ga0495626_0000558 3300048091 Bacteria 36958
1216 Ga0495626_0000771 3300048091 Bacteria 29373
1217 Ga0495626_0001050 3300048091 Bacteria 23620
1218 Ga0495626_0003903 3300048091 Bacteria 9345
1219 Ga0495626_0004945 3300048091 Bacteria 7996
1220 Ga0495626_0010532 3300048091 Bacteria 4925
1221 Ga0495626_0011000 3300048091 Bacteria 4801
1222 Ga0495626_0013063 3300048091 Bacteria 4329
1223 Ga0495626_0013210 3300048091 Bacteria 4297
1224 Ga0495626_0032371 3300048091 Bacteria 2511
1225 Ga0495626_0078676 3300048091 Bacteria 1468
1226 Ga0495626_0121104 3300048091 Bacteria 1124
1227 Ga0496102_0000250 3300048905 Bacteria 70330
1228 Ga0496102_0013329 3300048905 Bacteria 7121
1229 Ga0496103_0001523 3300048906 Bacteria 15476
1230 Ga0496106_0011952 3300048909 Bacteria 6410
1231 Ga0496110_0004050 3300048913 Bacteria 11309
1232 Ga0496111_0100311 3300048914 Bacteria 2126
1233 Ga0496114_0000940 3300048917 Bacteria 21794
1234 Ga0496116_0000168 3300048919 Bacteria 132462
1235 Ga0496116_0000419 3300048919 Bacteria 60095
1236 Ga0496116_0001635 3300048919 Bacteria 24661
1237 Ga0496116_0002610 3300048919 Bacteria 18717
1238 Ga0496116_0007631 3300048919 Bacteria 9549
1239 Ga0496116_0022181 3300048919 Bacteria 4765
1240 Ga0496116_0031676 3300048919 Bacteria 3781
1241 Ga0496117_0000349 3300048920 Bacteria 81440
1242 Ga0496117_0001453 3300048920 Bacteria 34178
1243 Ga0496117_0002256 3300048920 Bacteria 24887
1244 Ga0496117_0003622 3300048920 Bacteria 17799
1245 Ga0496117_0006009 3300048920 Bacteria 12492
1246 Ga0496117_0006828 3300048920 Bacteria 11360
1247 Ga0496117_0013274 3300048920 Bacteria 7198
1248 Ga0496117_0035697 3300048920 Bacteria 3729
1249 Ga0496117_0081725 3300048920 Bacteria 2119
1250 Ga0496117_0194481 3300048920 Bacteria 1151
1251 Ga0496117_0205200 3300048920 Bacteria 1110
1252 Ga0496117_0230196 3300048920 Bacteria 1025
1253 Ga0496118_0003199 3300048921 Bacteria 20896
1254 Ga0496118_0003899 3300048921 Bacteria 18285
1255 Ga0496118_0007046 3300048921 Bacteria 12085
1256 Ga0496118_0007048 3300048921 Bacteria 12084
1257 Ga0496118_0007530 3300048921 Bacteria 11503
1258 Ga0496118_0008261 3300048921 Bacteria 10794
1259 Ga0496118_0010074 3300048921 Bacteria 9406
1260 Ga0496118_0020485 3300048921 Bacteria 5860
1261 Ga0496118_0046138 3300048921 Bacteria 3393
1262 Ga0496118_0073096 3300048921 Bacteria 2459
1263 Ga0496118_0125382 3300048921 Bacteria 1663
1264 Ga0496119_0025370 3300048922 Bacteria 4142
1265 Ga0496119_0037982 3300048922 Bacteria 3117
1266 Ga0496120_0004730 3300048923 Bacteria 11194
1267 Ga0496121_0000199 3300048924 Bacteria 132751
1268 Ga0496121_0000804 3300048924 Bacteria 57222
1269 Ga0496121_0002628 3300048924 Bacteria 27099
1270 Ga0496121_0003036 3300048924 Bacteria 24370
1271 Ga0496121_0021408 3300048924 Bacteria 6333
1272 Ga0496121_0024834 3300048924 Bacteria 5714
1273 Ga0496121_0037191 3300048924 Bacteria 4326
1274 Ga0496121_0050306 3300048924 Bacteria 3522
1275 Ga0496121_0069321 3300048924 Bacteria 2847
1276 Ga0496121_0101830 3300048924 Bacteria 2214
1277 Ga0496121_0120179 3300048924 Bacteria 1985
1278 Ga0496121_0209756 3300048924 Bacteria 1381
1279 Ga0496121_0228854 3300048924 Bacteria 1303
1280 Ga0496122_0000667 3300048925 Bacteria 69054
1281 Ga0496122_0001732 3300048925 Bacteria 33838
1282 Ga0496122_0002644 3300048925 Bacteria 25025
1283 Ga0496122_0009182 3300048925 Bacteria 10472
1284 Ga0496122_0027517 3300048925 Bacteria 4857
1285 Ga0496122_0075863 3300048925 Bacteria 2369
1286 Ga0496122_0080370 3300048925 Bacteria 2273
1287 Ga0496122_0154944 3300048925 Bacteria 1407
1288 Ga0496122_0154971 3300048925 Bacteria 1407
1289 Ga0496123_0000163 3300048926 Bacteria 133536
1290 Ga0496123_0000642 3300048926 Bacteria 58229
1291 Ga0496123_0000869 3300048926 Bacteria 48057
1292 Ga0496123_0017335 3300048926 Bacteria 5800
1293 Ga0496123_0029467 3300048926 Bacteria 4040
1294 Ga0496123_0039072 3300048926 Bacteria 3324
1295 Ga0496123_0088580 3300048926 Bacteria 1848
1296 Ga0496124_0000229 3300048927 Bacteria 109277
1297 Ga0496124_0000714 3300048927 Bacteria 54365
1298 Ga0496124_0000870 3300048927 Bacteria 49280
1299 Ga0496124_0001848 3300048927 Bacteria 29235
1300 Ga0496124_0002366 3300048927 Bacteria 24873
1301 Ga0496124_0008162 3300048927 Bacteria 10989
1302 Ga0496124_0014063 3300048927 Bacteria 7762
1303 Ga0496124_0027256 3300048927 Bacteria 5133
1304 Ga0496124_0032860 3300048927 Bacteria 4575
1305 Ga0496124_0041571 3300048927 Bacteria 3965
1306 Ga0496124_0044131 3300048927 Bacteria 3827
1307 Ga0496124_0084516 3300048927 Bacteria 2602
1308 Ga0496124_0100576 3300048927 Bacteria 2343
1309 Ga0496124_0101261 3300048927 Bacteria 2334
1310 Ga0496124_0123815 3300048927 Bacteria 2062
1311 Ga0496124_0148849 3300048927 Bacteria 1839
1312 Ga0496124_0273166 3300048927 Bacteria 1237
1313 Ga0496124_0279294 3300048927 Bacteria 1218
1314 Ga0496124_0289884 3300048927 Bacteria 1188
1315 Ga0496125_0002339 3300048928 Bacteria 24857
1316 Ga0496125_0002675 3300048928 Bacteria 22757
1317 Ga0496125_0003616 3300048928 Bacteria 18558
1318 Ga0496125_0004799 3300048928 Bacteria 15374
1319 Ga0496125_0011474 3300048928 Bacteria 8859
1320 Ga0496125_0014619 3300048928 Bacteria 7632
1321 Ga0496125_0031060 3300048928 Bacteria 4767
1322 Ga0496125_0031171 3300048928 Bacteria 4755
1323 Ga0496125_0033883 3300048928 Bacteria 4511
1324 Ga0496125_0049349 3300048928 Bacteria 3498
1325 Ga0496125_0070266 3300048928 Bacteria 2742
1326 Ga0496125_0102560 3300048928 Bacteria 2102
1327 Ga0496126_0012494 3300048929 Bacteria 8695
1328 Ga0496126_0016012 3300048929 Bacteria 7518
1329 Ga0496126_0043720 3300048929 Bacteria 4130
1330 Ga0496126_0127116 3300048929 Bacteria 2205
1331 Ga0496126_0142895 3300048929 Bacteria 2058
1332 Ga0496126_0148197 3300048929 Bacteria 2013
1333 Ga0496126_0199345 3300048929 Bacteria 1691
1334 Ga0495678_000007 3300049459 Bacteria 448039
1335 Ga0495678_000047 3300049459 Bacteria 168805
1336 Ga0495678_000802 3300049459 Bacteria 28143
1337 Ga0495678_001017 3300049459 Bacteria 23934
1338 Ga0495678_001022 3300049459 Bacteria 23793
1339 Ga0495678_001038 3300049459 Bacteria 23535
1340 Ga0495678_001095 3300049459 Bacteria 22842
1341 Ga0495678_001852 3300049459 Bacteria 15476
1342 Ga0495678_006674 3300049459 Bacteria 6103
1343 Ga0495678_009007 3300049459 Bacteria 4984
1344 Ga0495678_009877 3300049459 Bacteria 4678
1345 Ga0495678_013665 3300049459 Bacteria 3800
1346 Ga0495678_013776 3300049459 Bacteria 3784
1347 Ga0495678_013843 3300049459 Bacteria 3775
1348 Ga0495678_020767 3300049459 Bacteria 2901
1349 Ga0495678_025480 3300049459 Bacteria 2538
1350 Ga0495678_033049 3300049459 Bacteria 2138
1351 Ga0495682_0000051 3300049460 Bacteria 109996
1352 Ga0495682_0000899 3300049460 Bacteria 18321
1353 Ga0495682_0001158 3300049460 Bacteria 15148
1354 Ga0495682_0001812 3300049460 Bacteria 10755
1355 Ga0495682_0007174 3300049460 Bacteria 4454
1356 Ga0495682_0061187 3300049460 Bacteria 1359
1357 Ga0495682_0079264 3300049460 Bacteria 1181
1358 Ga0501031_0118652 3300049568 Bacteria 1728
1359 Ga0501034_0001187 3300049571 Bacteria 35936
1360 Ga0501037_0066593 3300049573 Bacteria 2623
1361 Ga0501038_0098179 3300049574 Bacteria 2442
1362 Ga0501038_0170375 3300049574 Bacteria 1763
1363 Ga0501042_0288440 3300049578 Bacteria 1185
1364 Ga0501043_0085365 3300049579 Bacteria 2480
1365 Ga0501047_0094211 3300049581 Bacteria 2873
1366 Ga0501074_0207602 3300049590 Bacteria 1396
1367 Ga0501222_000116 3300049662 Bacteria 17922
1368 Ga0501227_003954 3300049665 Bacteria 3192
1369 Ga0501240_007882 3300049673 Bacteria 1351
1370 Ga0501241_000142 3300049758 Bacteria 15922
1371 Ga0501035_0149900 3300049822 Bacteria 2024
1372 Ga0501035_0252960 3300049822 Bacteria 1495
1373 Ga0501044_0191213 3300049823 Bacteria 2009
1374 Ga0501044_0268794 3300049823 Bacteria 1641
1375 Ga0501226_002129 3300049853 Bacteria 2456
1376 nmdc:mga03683_3959_c1 3300050489 Bacteria 4850
1377 nmdc:mga03683_71757_c1 3300050489 Bacteria 1482
1378 nmdc:mga00v17_127726_c1 3300050491 Bacteria 1623
1379 nmdc:mga00v17_40232_c1 3300050491 Bacteria 2804
1380 nmdc:mga00v17_59921_c1 3300050491 Bacteria 2337
1381 nmdc:mga08x19_32307_c1 3300050514 Bacteria 3296
1382 nmdc:mga0sz30_17935_c1 3300050516 Bacteria 2828
1383 Ga0500651_0039659 3300053093 Bacteria 2965
1384 Ga0500572_000143 3300053111 Bacteria 24401
1385 Ga0500595_002919 3300053119 Bacteria 8180
1386 Ga0500621_015694 3300053126 Bacteria 2790
1387 Ga0500659_0009556 3300053135 Bacteria 5323
1388 Ga0500564_001328 3300053138 Bacteria 8457
1389 Ga0500573_0001618 3300053140 Bacteria 10887
1390 Ga0500577_0036661 3300053142 Bacteria 1757
1391 Ga0500634_0001481 3300053161 Bacteria 9165
1392 Ga0500636_0038956 3300053177 Bacteria 2811
1393 2511252812 2511231004 Bacteria 6669789
1394 2511264234 2511231006 Bacteria 6794709
1395 2511273103 2511231007 Bacteria 6306603
1396 2511275789 2511231008 Bacteria 6624100
1397 2511290606 2511231010 Bacteria 6373152
1398 2511298332 2511231011 Bacteria 6149768
1399 2511301068 2511231012 Bacteria 6738011
1400 2511312252 2511231014 Bacteria 6462302
1401 2511322766 2511231015 Bacteria 6598026
1402 2511326154 2511231016 Bacteria 6704427
1403 2511333930 2511231017 Bacteria 6503007
1404 2511339007 2511231018 Bacteria 6436256
1405 2511347189 2511231019 Bacteria 6520662
1406 2511349857 2511231020 Bacteria 6115223
1407 2511354002 2511231021 Bacteria 7302637
1408 2511365716 2511231022 Bacteria 6719296
1409 2511376556 2511231024 Bacteria 5835885
1410 2511410882 2511231031 Bacteria 6558529
1411 2511823716 2511231156 Bacteria 6845832
1412 2512323972 2512047018 Bacteria 6663241
1413 2552748235 2551306352 Bacteria 3873115
1414 2554815639 2554235132 Bacteria 6772433
1415 2555244823 2554235231 Bacteria 5215788
1416 2555671231 2554235341 Bacteria 6867980
1417 2583793645 2582580891 Bacteria 6800976
1418 2597859304 2597489887 Bacteria 6666321
1419 2597863032 2597489888 Bacteria 6179543
1420 2597868824 2597489889 Bacteria 6297495
1421 2599326778 2599185155 Bacteria 5827168
1422 2599354610 2599185160 Bacteria 6844013
1423 2599359677 2599185161 Bacteria 6960462
1424 2599365999 2599185162 Bacteria 6957254
1425 2599372789 2599185163 Bacteria 6995158
1426 2599379717 2599185164 Bacteria 6841688
1427 2599385304 2599185165 Bacteria 6843250
1428 2599391648 2599185166 Bacteria 6959206
1429 2599401614 2599185167 Bacteria 6353609
1430 2599403414 2599185168 Bacteria 6997636
1431 2599451845 2599185179 Bacteria 6611171
1432 2599461444 2599185181 Bacteria 6844519
1433 2599469987 2599185182 Bacteria 6883168
1434 2599482135 2599185185 Bacteria 6652270
1435 2599490463 2599185186 Bacteria 6831633
1436 2599504509 2599185188 Bacteria 6164180
1437 2599509615 2599185189 Bacteria 5862825
1438 2599514858 2599185190 Bacteria 6285678
1439 2599520956 2599185191 Bacteria 6297582
1440 2599611596 2599185212 Bacteria 6765997
1441 2599770309 2599185248 Bacteria 6696816
1442 2599804147 2599185257 Bacteria 6492581
1443 2599882203 2599185288 Bacteria 6666191
1444 2599887482 2599185289 Bacteria 6778765
1445 2599894345 2599185290 Bacteria 6289611
1446 2599901771 2599185291 Bacteria 6775623
1447 2599934323 2599185300 Bacteria 6062622
1448 2599941756 2599185302 Bacteria 5954930
1449 2599951553 2599185303 Bacteria 6512725
1450 2599952724 2599185304 Bacteria 5951361
1451 2599960615 2599185305 Bacteria 6748700
1452 2599964909 2599185306 Bacteria 6637356
1453 2599971456 2599185307 Bacteria 6194719
1454 2599975978 2599185308 Bacteria 6621546
1455 2599981925 2599185309 Bacteria 5969593
1456 2599987834 2599185310 Bacteria 6014457
1457 2599995329 2599185311 Bacteria 6354990
1458 2599998274 2599185312 Bacteria 5912071
1459 2600005438 2599185313 Bacteria 6658188
1460 2600010141 2599185314 Bacteria 6621749
1461 2600017344 2599185315 Bacteria 6771107
1462 2600022567 2599185316 Bacteria 6320029
1463 2600027587 2599185317 Bacteria 6435722
1464 2600034371 2599185318 Bacteria 6961590
1465 2600039867 2599185319 Bacteria 6637840
1466 2600046164 2599185320 Bacteria 5963263
1467 2600052167 2599185321 Bacteria 6764560
1468 2600057544 2599185322 Bacteria 6763055
1469 2600064705 2599185323 Bacteria 6688755
1470 2600072282 2599185324 Bacteria 6590677
1471 2600075842 2599185325 Bacteria 6324919
1472 2600214062 2599185356 Bacteria 6843884
1473 2600356704 2600254930 Bacteria 6431253
1474 2600364212 2600254931 Bacteria 6734225
1475 2600442985 2600254954 Bacteria 5100516
1476 2601624743 2600255283 Bacteria 6061572
1477 2601694259 2600255296 Bacteria 5784754
1478 2601774228 2600255313 Bacteria 6842543
1479 2601796224 2600255318 Bacteria 6383414
1480 2602009539 2600255389 Bacteria 5275336
1481 2606073373 2603880185 Bacteria 6379190
1482 2606126981 2603880199 Bacteria 6377649
1483 2608383943 2606217733 Bacteria 6360972
1484 2621300894 2619619299 Bacteria 6649820
1485 2624481873 2623620443 Bacteria 6427864
1486 2624491042 2623620446 Bacteria 6500345
1487 2640734782 2639762793 Bacteria 3943681
1488 2643830747 2643221562 Bacteria 4048635
1489 2643845576 2643221565 Bacteria 6216018
1490 2643871632 2643221571 Bacteria 6228673
1491 2643956453 2643221589 Bacteria 6250934
1492 2643974237 2643221593 Bacteria 6296053
1493 2644025505 2643221602 Bacteria 6249926
1494 2644187419 2643221633 Bacteria 6733554
1495 2644284895 2643221650 Bacteria 7029547
1496 2644623509 2643221713 Bacteria 6554480
1497 2652547528 2651869719 Bacteria 6047974
1498 2671094361 2667528170 Bacteria 6786960
1499 2671097191 2667528171 Bacteria 6900659
1500 2671126043 2667528176 Bacteria 6724917
1501 2671770285 2671180172 Bacteria 6495783
1502 2678231723 2675903507 Bacteria 3737791
1503 2678262648 2675903515 Bacteria 6580491
1504 2715751176 2713897148 Bacteria 5883533
1505 2715758176 2713897149 Bacteria 6506249
1506 2718635122 2718217725 Bacteria 5758958
1507 2723247849 2721755607 Bacteria 5841722
1508 2738670481 2738541265 Bacteria 6594665
1509 2738688863 2738541271 Bacteria 5657310
1510 2738748874 2738541282 Bacteria 6593925
1511 2738810856 2738541294 Bacteria 6925949
1512 2738857916 2738541303 Bacteria 6591772
1513 2738898216 2738541309 Bacteria 6926455
1514 2739201913 2738543004 Bacteria 6381073
1515 2739259284 2738543015 Bacteria 6750701
1516 2739264826 2738543016 Bacteria 5657564
1517 2739287492 2738543020 Bacteria 5718238
1518 2739292805 2738543021 Bacteria 5718241
1519 2739314115 2738543025 Bacteria 6600348
1520 2743738837 2740892503 Bacteria 6855563
1521 2745008988 2744054620 Bacteria 6551379
1522 2745160174 2744054655 Bacteria 3552603
1523 2774123398 2773857670 Bacteria 6407454
1524 2774132783 2773857673 Bacteria 6513460
1525 2774389418 2773857761 Bacteria 3837365
1526 2774436877 2773857770 Bacteria 3911866
1527 2784263405 2784132063 Bacteria 6262788
1528 2784316060 2784132072 Bacteria 6596533
1529 2794596452 2791355520 Bacteria 5948615
1530 2807409277 2806310737 Bacteria 5751088
1531 2807457579 2806310745 Bacteria 5742165
1532 2808855117 2808606361 Bacteria 6136259
1533 2808924394 2808606376 Bacteria 6248667
1534 2808930567 2808606377 Bacteria 6646337
1535 2808935773 2808606378 Bacteria 6177535
1536 2808942346 2808606379 Bacteria 5022697
1537 2808946508 2808606380 Bacteria 6248705
1538 2808952689 2808606381 Bacteria 6646461
1539 2808957317 2808606382 Bacteria 6841132
1540 2808963532 2808606383 Bacteria 6138645
1541 2808979430 2808606385 Bacteria 6711065
1542 2808995354 2808606388 Bacteria 6706662
1543 2808998510 2808606389 Bacteria 6138126
1544 2809218727 2808606445 Bacteria 6057339
1545 2817489805 2816332298 Bacteria 6852809
1546 2819655617 2818991456 Bacteria 6123676
1547 2819702288 2818991464 Bacteria 6907494
1548 2823424614 2823421272 Bacteria 5372474
1549 2825652986 2825651385 Bacteria 6715909
1550 2826583918 2826581358 Bacteria 5963467
1551 2834029682 2834028612 Bacteria 6354979
1552 2842806028 2842805378 Bacteria 5385175
1553 2842820242 2842815866 Bacteria 5947510
1554 2842831957 2842826826 Bacteria 5974129
1555 2842836467 2842832357 Bacteria 5959113
1556 2842841541 2842837860 Bacteria 6066181
1557 2842844581 2842843487 Bacteria 6004777
1558 2842850835 2842849001 Bacteria 5924277
1559 2844671761 2844665904 Bacteria 6817974
1560 2852618437 2852612431 Bacteria 6885235
1561 2852662384 2852657418 Bacteria 6472974
1562 2852673427 2852667396 Bacteria 6885555
1563 2860340754 2860339153 Bacteria 6846989
1564 2860869675 2860867994 Bacteria 5645326
1565 2878033857 2878029506 Bacteria 6418441
1566 2880234483 2880230671 Bacteria 6140320
1567 2904521377 2904518522 Bacteria 6068986
1568 2904555736 2904550169 Bacteria 6221258
1569 2908448596 2908446538 Bacteria 6829095
1570 2912967396 2912963787 Bacteria 5646108
1571 2913038627 2913036834 Bacteria 6704877
1572 2916702061 2916699645 Bacteria 3568996
1573 2917075092 2917070673 Bacteria 6868303
1574 2919068843 2919063839 Bacteria 6302690
1575 2919182890 2919182534 Bacteria 3907101
1576 2919387950 2919385768 Bacteria 5897293
1577 2919461115 2919456309 Bacteria 6586567
1578 2919481904 2919481497 Bacteria 6907839
1579 2919489868 2919487758 Bacteria 5929766
1580 2919504344 2919501602 Bacteria 5286340
1581 2919507980 2919506607 Bacteria 3392955
1582 2919702056 2919697872 Bacteria 6553725
1583 2923157909 2923153595 Bacteria 6870622
1584 2923520221 2923519811 Bacteria 6298479
1585 2923587261 2923586266 Bacteria 6565975
1586 2926065083 2926063275 Bacteria 5285848
1587 2929146081 2929144301 Bacteria 6622272
1588 2929191650 2929189879 Bacteria 5930554
1589 2931370583 2931369376 Bacteria 6847892
1590 2931392749 2931390751 Bacteria 6273349
1591 2931403307 2931396565 Bacteria 7251677
1592 2935356080 2935353572 Unclassified 6955622
1593 2939614459 2939611941 Bacteria 3892017
1594 2939637669 2939636861 Bacteria 6297853
1595 2939652912 2939651529 Bacteria 5895393
1596 2941493779 2941489479 Bacteria 6313767
1597 2945928916 2945928738 Bacteria 6053221
1598 2945962290 2945961074 Bacteria 7342064
1599 2946011139 2946006987 Bacteria 6705746
1600 2946029932 2946027586 Bacteria 6049274
1601 2947236504 2947233263 Bacteria 6439278
1602 2969308632 2969304461 Bacteria 6601805
1603 2974289994 2974289157 Bacteria 6080362
1604 2984288272 2984286254 Bacteria 6702062
1605 2988733611 2988728565 Bacteria 6124362
1606 2990198304 2990196909 Bacteria 4054280
1607 2998143937 2998139840 Bacteria 6073514
1608 3007397219 3007395558 Bacteria 6755444
1609 3007424246 3007419365 Bacteria 7026924
1610 3007515638 3007511990 Bacteria 6481491
1611 3007616914 3007614139 Bacteria 6053559
1612 3007625620 3007619802 Bacteria 6411688
1613 3007718864 3007718800 Bacteria 5971527
1614 3007865367 3007861166 Bacteria 6045338
1615 3007870223 3007866637 Bacteria 5899198
1616 3007875559 3007872151 Bacteria 5268868
1617 637321560 637000220 Bacteria 7074893
1618 8011354949 8011350971 Bacteria 6158957
1619 8015692007 8015687852 Bacteria 6613826
1620 8019774432 8019769354 Bacteria 6924660
1621 8019780925 8019775933 Bacteria 6858656
1622 8029996940 8029995093 Bacteria 5990776
1623 8033232796 8033232454 Bacteria 3202805
1624 8034962598 8034962539 Bacteria 4884839
1625 8052496295 8052494512 Bacteria 5765634
1626 8054288631 8054285046 Bacteria 6919322
1627 8054352111 8054347763 Bacteria 5901107
1628 8054505252 8054503363 Bacteria 6101651
1629 8054930352 8054929484 Bacteria 5599761
1630 8055775216 8055770955 Bacteria 6827675
1631 8055819795 8055817908 Bacteria 6609162
1632 8055880228 8055878733 Bacteria 5907058
1633 8056117932 8056115690 Bacteria 5527654
1634 8056124347 8056120720 Bacteria 5758328
1635 8056127621 8056125926 Bacteria 6228218
1636 8056133579 8056131705 Bacteria 6107031
1637 8056147212 8056143049 Bacteria 6307666
1638 8056150484 8056148874 Bacteria 6479865
1639 8056157243 8056155041 Bacteria 6486948
1640 8056165000 8056161164 Bacteria 6106669
1641 8056167339 8056166840 Bacteria 5820959
1642 8056173323 8056172158 Bacteria 6133900
1643 8056179517 8056177738 Bacteria 6748268
1644 8056572680 8056569372 Bacteria 5997322
1645 8057804041 8057798959 Bacteria 6713499
1646 Ga0495591_000040
1647 MRS2a_Contig_45
1648 MRS2a_Contig_6898
1649 SwRhRL2b_contig_1400918
1650 MRS1b_contig_6133759
1651 JGI25162J39368_1000077
1652 JGI25154J39366_1002990
1653 JGI25163J39215_1000050
1654 JGI25163J39215_1000126
1655 JGI25164J39214_1000054
1656 JGI25164J39214_1000129
1657 JGI25164J39214_1001811
1658 JGI25165J46597_1000141
1659 JGI25165J46597_1000251
1660 JGI25165J46597_1000405
1661 Ga0055538_1000090
1662 Ga0055539_1000134
1663 Ga0055533_1000138
1664 Ga0055532_1000142
1665 Ga0055525_1000183
1666 Ga0055526_1000024
1667 Ga0055537_1000180
1668 Ga0055524_1000174
1669 Ga0055536_1000239
1670 Ga0055536_1000345
1671 Ga0055536_1013222
1672 Ga0055534_1000084
1673 Ga0055528_1000016
1674 Ga0055530_10000053
1675 Ga0055530_10000289
1676 Ga0055530_10001084
1677 Ga0055540_1000105
1678 Ga0055540_1000252
1679 Ga0055540_1000790
1680 Ga0055531_10000081
1681 Ga0055531_10003476
1682 Ga0055541_1000089
1683 Ga0058692_1000001
1684 Ga0065703_1000531
1685 Ga0065714_10000016
1686 Ga0065714_10002400
1687 Ga0065714_10002585
1688 Ga0065714_10002591
1689 Ga0065714_10002616
1690 Ga0065714_10003051
1691 Ga0065714_10012583
1692 Ga0065714_10028718
1693 Ga0065714_10064635
1694 Ga0065714_10066389
1695 Ga0065714_10068183
1696 Ga0065714_10071681
1697 Ga0065704_10072159
1698 Ga0065704_10078350
1699 Ga0065704_10078370
1700 Ga0065704_10083106
1701 Ga0065704_10156508
1702 Ga0065712_10002698
1703 Ga0065712_10069156
1704 Ga0065712_10096430
1705 Ga0070670_100001221
1706 Ga0070670_100037913
1707 Ga0070666_10118520
1708 Ga0070661_100006952
1709 Ga0070669_100000316
1710 Ga0070667_100000095
1711 Ga0070714_100000079
1712 Ga0070714_100190557
1713 Ga0070662_100002228
1714 Ga0070662_100043321
1715 Ga0068853_100008519
1716 Ga0068853_100107967
1717 Ga0070665_100002661
1718 Ga0070664_100000046
1719 Ga0068859_100029592
1720 Ga0068864_100000073
1721 Ga0068851_10000050
1722 Ga0068863_100043616
1723 Ga0068863_100178337
1724 Ga0075364_10081778
1725 Ga0075364_10103678
1726 Ga0075364_10170037
1727 Ga0075432_10005424
1728 Ga0075432_10008465
1729 Ga0075432_10016442
1730 Ga0075432_10025635
1731 Ga0075362_10029925
1732 Ga0075362_10052703
1733 Ga0075369_10021203
1734 Ga0075436_100040597
1735 Ga0075436_100329914
1736 Ga0097620_100029589
1737 Ga0099823_1007660
1738 Ga0099823_1044831
1739 Ga0079104_1000124
1740 Ga0079104_1000366
1741 Ga0079104_1028267
1742 Ga0099826_10025975
1743 Ga0105251_10002695
1744 Ga0105251_10002821
1745 Ga0105251_10002860
1746 Ga0105251_10004546
1747 Ga0105251_10012498
1748 Ga0105251_10015340
1749 Ga0105251_10023765
1750 Ga0105251_10035496
1751 Ga0105251_10043360
1752 Ga0105251_10077863
1753 Ga0105251_10093381
1754 Ga0105244_10000322
1755 Ga0105244_10000983
1756 Ga0105244_10001384
1757 Ga0105244_10002008
1758 Ga0105244_10002410
1759 Ga0105244_10011071
1760 Ga0105244_10011158
1761 Ga0105244_10013783
1762 Ga0105244_10024905
1763 Ga0105244_10035659
1764 Ga0105244_10045365
1765 Ga0105244_10046440
1766 Ga0105244_10046962
1767 Ga0105244_10082614
1768 Ga0105244_10093793
1769 Ga0105250_10000319
1770 Ga0105250_10001041
1771 Ga0105250_10019670
1772 Ga0105250_10039633
1773 Ga0105250_10059168
1774 Ga0105250_10062480
1775 Ga0105250_10079968
1776 Ga0105240_10060050
1777 Ga0105247_10001068
1778 Ga0105247_10015109
1779 Ga0105243_10000010
1780 Ga0105243_10000103
1781 Ga0105243_10000405
1782 Ga0105243_10067022
1783 Ga0105243_10547595
1784 Ga0105242_10000360
1785 Ga0105248_10087748
1786 Ga0105237_10007888
1787 Ga0105237_10046669
1788 Ga0105249_10074808
1789 Ga0105249_10107172
1790 Ga0105246_10000222
1791 Ga0105246_10000465
1792 Ga0105246_10011023
1793 Ga0157345_1000026
1794 Ga0157373_10000195
1795 Ga0157373_10003312
1796 Ga0157373_10008594
1797 Ga0157373_10014944
1798 Ga0157373_10016275
1799 Ga0157373_10084348
1800 Ga0157373_10107284
1801 Ga0157373_10115674
1802 Ga0157373_10186006
1803 Ga0157373_10195614
1804 Ga0157373_10329660
1805 Ga0157371_10000186
1806 Ga0157371_10000306
1807 Ga0157371_10000390
1808 Ga0157371_10003300
1809 Ga0157371_10143257
1810 Ga0157371_10211376
1811 Ga0157371_10278483
1812 Ga0157370_10002694
1813 Ga0157370_10006604
1814 Ga0157370_10031366
1815 Ga0157370_10081529
1816 Ga0157370_10123431
1817 Ga0157370_10177604
1818 Ga0157370_10179169
1819 Ga0157370_10371820
1820 Ga0157369_10001322
1821 Ga0157369_10003927
1822 Ga0157369_10036004
1823 Ga0157369_10142783
1824 Ga0157369_10163971
1825 Ga0157369_10163972
1826 Ga0157369_10632499
1827 Ga0163162_10000072
1828 Ga0163162_10223361
1829 Ga0163162_10614266
1830 Ga0157372_10003177
1831 Ga0157372_10551341
1832 Ga0157372_10771673
1833 Ga0157375_10002479
1834 Ga0157375_10002644
1835 Ga0157375_10231135
1836 Ga0157375_10237035
1837 Ga0163163_10000230
1838 Ga0182008_10000074
1839 Ga0182008_10001296
1840 Ga0182008_10001314
1841 Ga0182008_10002229
1842 Ga0182008_10002908
1843 Ga0182008_10014512
1844 Ga0182008_10104963
1845 Ga0182008_10127260
1846 Ga0182006_1000183
1847 Ga0182006_1000326
1848 Ga0182006_1000780
1849 Ga0182006_1001649
1850 Ga0182006_1011937
1851 Ga0182006_1045388
1852 Ga0182006_1049914
1853 Ga0182006_1059794
1854 Ga0182006_1061523
1855 Ga0182007_10000903
1856 Ga0182007_10005553
1857 Ga0182007_10023350
1858 Ga0182005_1000308
1859 Ga0182005_1002027
1860 Ga0182005_1033783
1861 Ga0183360_10001
1862 Ga0163161_10000904
1863 Ga0163161_10001710
1864 Ga0163161_10003054
1865 Ga0163161_10004486
1866 Ga0163161_10006348
1867 Ga0163161_10016314
1868 Ga0163161_10031180
1869 Ga0163161_10045349
1870 Ga0163161_10171959
1871 Ga0163161_10180818
1872 Ga0163161_10256455
1873 Ga0209760_100043
1874 Ga0209760_100054
1875 Ga0209784_100040
1876 Ga0209566_100051
1877 Ga0209674_100072
1878 Ga0209147_100067
1879 Ga0209563_100073
1880 Ga0209563_101021
1881 Ga0207427_100047
1882 Ga0207427_100074
1883 Ga0207427_100123
1884 Ga0209437_100006
1885 Ga0209437_100009
1886 Ga0209437_100227
1887 Ga0209258_100490
1888 Ga0209646_1000383
1889 Ga0209677_100121
1890 Ga0209233_1000032
1891 Ga0209233_1000105
1892 Ga0209233_1000283
1893 Ga0209565_1000001
1894 Ga0209565_1009632
1895 Ga0209673_1000001
1896 Ga0209675_1000001
1897 Ga0209675_1003706
1898 Ga0209676_1000006
1899 Ga0209676_1000010
1900 Ga0209676_1000223
1901 Ga0209676_1000814
1902 Ga0209676_1003220
1903 Ga0209676_1003238
1904 Ga0209025_1000015
1905 Ga0209564_1000001
1906 Ga0209050_1000009
1907 Ga0209050_1000081
1908 Ga0209050_1000214
1909 Ga0209050_1000363
1910 Ga0209256_1000002
1911 Ga0209051_1000008
1912 Ga0209051_1000171
1913 Ga0209051_1000185
1914 Ga0209051_1013055
1915 Ga0209257_1000040
1916 Ga0209257_1000065
1917 Ga0209257_1000704
1918 Ga0209257_1015109
1919 Ga0207656_10000293
1920 Ga0207696_1000019
1921 Ga0207696_1000171
1922 Ga0207696_1000193
1923 Ga0207696_1002275
1924 Ga0207696_1005730
1925 Ga0207696_1020095
1926 Ga0207696_1035442
1927 Ga0207696_1040762
1928 Ga0207696_1057904
1929 Ga0207655_1000035
1930 Ga0207655_1000148
1931 Ga0207655_1000337
1932 Ga0207655_1000505
1933 Ga0207655_1000653
1934 Ga0207655_1001230
1935 Ga0207655_1002593
1936 Ga0207655_1002863
1937 Ga0207655_1004590
1938 Ga0207655_1004674
1939 Ga0207655_1005605
1940 Ga0207655_1007998
1941 Ga0207655_1013184
1942 Ga0207655_1015844
1943 Ga0207655_1018376
1944 Ga0207655_1026645
1945 Ga0207655_1035410
1946 Ga0207655_1053930
1947 Ga0207655_1059869
1948 Ga0207713_1000236
1949 Ga0207713_1000243
1950 Ga0207713_1000431
1951 Ga0207713_1000703
1952 Ga0207713_1001217
1953 Ga0207713_1003210
1954 Ga0207713_1003232
1955 Ga0207713_1003636
1956 Ga0207713_1003777
1957 Ga0207713_1006282
1958 Ga0207713_1019400
1959 Ga0207713_1026206
1960 Ga0207713_1040741
1961 Ga0207713_1064963
1962 Ga0207710_10000931
1963 Ga0207710_10005328
1964 Ga0207680_10024454
1965 Ga0207647_10002137
1966 Ga0207705_10014588
1967 Ga0207695_10126190
1968 Ga0207671_10000163
1969 Ga0207657_10028191
1970 Ga0207649_10000068
1971 Ga0207649_10005532
1972 Ga0207681_10000156
1973 Ga0207681_10000491
1974 Ga0207681_10070368
1975 Ga0207650_10000106
1976 Ga0207650_10000174
1977 Ga0207650_10004052
1978 Ga0207664_10000036
1979 Ga0207644_10000312
1980 Ga0207706_10001634
1981 Ga0207706_10018376
1982 Ga0207706_10110584
1983 Ga0207686_10007022
1984 Ga0207709_10000001
1985 Ga0207709_10000035
1986 Ga0207709_10000283
1987 Ga0207709_10005739
1988 Ga0207709_10009435
1989 Ga0207709_10468910
1990 Ga0207711_10001196
1991 Ga0207679_10000018
1992 Ga0207667_10001738
1993 Ga0207712_10042824
1994 Ga0207658_10000073
1995 Ga0207703_10209064
1996 Ga0207639_10005291
1997 Ga0207702_10009573
1998 Ga0207641_10108168
1999 Ga0207641_10114991
2000 Ga0207676_10000010
2001 Ga0207674_10045305
2002 Ga0209281_1000018
2003 Ga0209281_1000077
2004 Ga0209281_1003883
2005 Ga0209389_1000183
2006 Ga0209371_1000008
2007 Ga0209282_1084162
2008 Ga0207428_10079005
2009 Ga0207428_10082776
2010 Ga0268266_10011671
2011 Ga0268265_10001641
2012 Ga0268265_10300420
2013 Ga0307517_10032127
2014 Ga0307515_10217506
2015 Ga0265324_10000297
2016 Ga0268256_1000009
2017 Ga0307511_10104950
2018 Ga0316179_1111071
2019 Ga0316178_1101239
2020 Ga0316181_1090174
2021 Ga0265331_10008951
2022 Ga0265327_10001967
2023 Ga0307513_10072433
2024 Ga0307408_100000081
2025 Ga0307408_100003463
2026 Ga0307408_100006501
2027 Ga0307408_100016487
2028 Ga0307408_100184706
2029 Ga0307408_100245987
2030 Ga0307408_100259451
2031 Ga0265314_10029286
2032 Ga0307405_10000154
2033 Ga0307405_10038238
2034 Ga0307405_10174571
2035 Ga0307405_10178476
2036 Ga0307413_10020405
2037 Ga0307406_10033549
2038 Ga0307406_10119493
2039 Ga0307406_10522625
2040 Ga0307407_10025106
2041 Ga0307412_10000455
2042 Ga0307412_10013685
2043 Ga0307412_10018233
2044 Ga0307412_10164765
2045 Ga0307412_10404310
2046 Ga0307409_100054401
2047 Ga0307416_100320190
2048 Ga0307414_10001581
2049 Ga0307414_10003099
2050 Ga0307414_10013524
2051 Ga0307414_10102705
2052 Ga0307414_10210395
2053 Ga0307414_10234484
2054 Ga0307414_10277994
2055 Ga0307411_10096674
2056 Ga0307510_10001867
2057 Ga0395900_0275928
2058 Ga0395901_0003337
2059 Ga0237819_01027
2060 Ga0439438_000117
2061 Ga0439438_000138
2062 Ga0439438_000173
2063 Ga0439438_000239
2064 Ga0439438_000256
2065 Ga0439438_000363
2066 Ga0439438_000507
2067 Ga0439438_002416
2068 Ga0439438_004071
2069 Ga0439438_004981
2070 Ga0439438_005177
2071 Ga0439447_000140
2072 Ga0439447_000329
2073 Ga0439447_000342
2074 Ga0439447_000407
2075 Ga0439447_014373
2076 Ga0439447_015791
2077 Ga0439447_033029
2078 Ga0439466_0000132
2079 Ga0439466_0000162
2080 Ga0439466_0000743
2081 Ga0439466_0000788
2082 Ga0439466_0001964
2083 Ga0439466_0002036
2084 Ga0439466_0002608
2085 Ga0439466_0003203
2086 Ga0439466_0008029
2087 Ga0439466_0009942
2088 Ga0439466_0010992
2089 Ga0439466_0021770
2090 Ga0439466_0021989
2091 Ga0439466_0032499
2092 Ga0439466_0033826
2093 Ga0451791_1891926
2094 Ga0451802_1143217
2095 Ga0451843_0211047
2096 Ga0439431_0000105
2097 Ga0439431_0021791
2098 Ga0439437_002196
2099 Ga0439445_0004866
2100 Ga0439445_0013118
2101 Ga0439432_000089
2102 Ga0439432_000221
2103 Ga0439432_001589
2104 Ga0439432_001874
2105 Ga0439432_002497
2106 Ga0439432_002504
2107 Ga0439432_004120
2108 Ga0439432_010913
2109 Ga0439432_037642
2110 Ga0439451_000109
2111 Ga0439451_000212
2112 Ga0439451_000301
2113 Ga0439451_004702
2114 Ga0439452_000091
2115 Ga0439452_000164
2116 Ga0439452_000322
2117 Ga0439452_000524
2118 Ga0439452_001381
2119 Ga0439452_001571
2120 Ga0439452_002476
2121 Ga0439452_016994
2122 Ga0439452_031882
2123 Ga0439452_032230
2124 Ga0439456_000045
2125 Ga0439456_000591
2126 Ga0439456_001443
2127 Ga0439456_002921
2128 Ga0439456_007095
2129 Ga0439456_026218
2130 Ga0439463_000018
2131 Ga0439463_001447
2132 Ga0439463_003061
2133 Ga0439463_007616
2134 Ga0439463_025793
2135 Ga0439463_028765
2136 Ga0439463_029075
2137 Ga0450911_000025
2138 Ga0450911_000285
2139 Ga0450911_003117
2140 Ga0450919_000038
2141 Ga0450919_007800
2142 Ga0450920_000199
2143 Ga0450890_000152
2144 Ga0450891_001459
2145 Ga0450900_000722
2146 Ga0450902_001746
2147 Ga0450902_003138
2148 Ga0450902_003286
2149 Ga0450902_005800
2150 Ga0450902_010143
2151 Ga0450903_000362
2152 Ga0450903_001182
2153 Ga0450904_000293
2154 Ga0450904_000791
2155 Ga0450905_000727
2156 Ga0450905_003680
2157 Ga0450906_000028
2158 Ga0450906_004054
2159 Ga0450907_000038
2160 Ga0450907_000289
2161 Ga0450910_000392
2162 Ga0450910_001305
2163 Ga0439446_0000090
2164 Ga0439446_0000409
2165 Ga0439446_0026693
2166 Ga0450908_000046
2167 Ga0450909_000105
2168 Ga0450909_001359
2169 Ga0450909_013840
2170 Ga0439434_0000034
2171 Ga0439434_0000277
2172 Ga0439434_0007412
2173 Ga0439464_0001412
2174 Ga0439464_0061057
2175 Ga0439460_0000015
2176 Ga0439460_0000042
2177 Ga0439460_0000776
2178 Ga0450918_000605
2179 Ga0450918_016410
2180 Ga0450893_0004947
2181 Ga0450901_000332
2182 Ga0495617_000212
2183 Ga0495617_001755
2184 Ga0495617_002016
2185 Ga0495617_004691
2186 Ga0495617_007689
2187 Ga0495617_011768
2188 Ga0495617_018731
2189 Ga0495617_035688
2190 Ga0495617_048361
2191 Ga0495617_055422
2192 Ga0495627_000362
2193 Ga0495627_000447
2194 Ga0495627_000546
2195 Ga0495627_000709
2196 Ga0495627_001245
2197 Ga0495627_002123
2198 Ga0495627_002337
2199 Ga0495627_016192
2200 Ga0495627_034333
2201 Ga0495627_039660
2202 Ga0495627_052048
2203 Ga0495592_0005799
2204 Ga0495603_0003172
2205 Ga0495603_0021379
2206 Ga0495603_0048503
2207 Ga0495590_0000265
2208 Ga0495590_0001638
2209 Ga0495590_0001639
2210 Ga0495590_0003337
2211 Ga0495590_0026001
2212 Ga0495590_0033137
2213 Ga0495590_0047250
2214 Ga0495591_000107
2215 Ga0495591_000114
2216 Ga0495591_000510
2217 Ga0495591_000564
2218 Ga0495591_001029
2219 Ga0495591_001088
2220 Ga0495591_001477
2221 Ga0495591_001675
2222 Ga0495591_001731
2223 Ga0495591_002868
2224 Ga0495591_003614
2225 Ga0495591_005843
2226 Ga0495591_010336
2227 Ga0495591_014326
2228 Ga0495591_019943
2229 Ga0495591_029694
2230 Ga0495591_032121
2231 Ga0495591_033899
2232 Ga0495629_0024544
2233 Ga0495629_0273021
2234 Ga0495638_0000991
2235 Ga0495638_0001231
2236 Ga0495638_0001573
2237 Ga0495638_0002232
2238 Ga0495638_0003134
2239 Ga0495638_0003343
2240 Ga0495638_0004346
2241 Ga0495638_0010611
2242 Ga0495638_0017083
2243 Ga0495638_0019886
2244 Ga0495638_0026591
2245 Ga0495638_0027711
2246 Ga0495638_0028671
2247 Ga0495638_0030254
2248 Ga0495638_0053624
2249 Ga0495638_0148070
2250 Ga0495653_0000788
2251 Ga0495653_0002108
2252 Ga0495653_0011081
2253 Ga0495653_0012237
2254 Ga0495650_0001300
2255 Ga0495650_0001590
2256 Ga0495650_0001706
2257 Ga0495650_0002399
2258 Ga0495650_0002419
2259 Ga0495650_0006965
2260 Ga0495650_0007104
2261 Ga0495650_0010355
2262 Ga0495650_0012083
2263 Ga0495650_0012952
2264 Ga0495650_0021128
2265 Ga0495650_0023898
2266 Ga0495580_0139791
2267 Ga0495582_0026353
2268 Ga0495605_0000017
2269 Ga0495605_0000026
2270 Ga0495605_0000105
2271 Ga0495605_0000220
2272 Ga0495605_0000527
2273 Ga0495605_0000771
2274 Ga0495605_0002351
2275 Ga0495605_0003511
2276 Ga0495605_0008134
2277 Ga0495605_0011041
2278 Ga0495605_0011331
2279 Ga0495605_0012790
2280 Ga0495605_0015222
2281 Ga0495605_0032978
2282 Ga0495605_0123154
2283 Ga0495605_0161284
2284 Ga0495639_0000013
2285 Ga0495639_0003712
2286 Ga0495664_0247964
2287 Ga0495584_0000278
2288 Ga0495584_0000387
2289 Ga0495584_0001274
2290 Ga0495584_0001924
2291 Ga0495584_0002861
2292 Ga0495584_0005446
2293 Ga0495584_0007713
2294 Ga0495584_0007797
2295 Ga0495584_0010038
2296 Ga0495584_0028688
2297 Ga0495584_0031935
2298 Ga0495584_0050768
2299 Ga0495584_0112683
2300 Ga0495585_0000517
2301 Ga0495585_0001652
2302 Ga0495585_0001662
2303 Ga0495585_0002225
2304 Ga0495585_0010737
2305 Ga0495585_0011757
2306 Ga0495585_0013369
2307 Ga0495585_0013745
2308 Ga0495585_0015029
2309 Ga0495585_0015780
2310 Ga0495585_0018382
2311 Ga0495585_0030948
2312 Ga0495585_0193086
2313 Ga0495594_0000140
2314 Ga0495594_0001728
2315 Ga0495594_0002505
2316 Ga0495594_0013395
2317 Ga0495596_0000107
2318 Ga0495596_0000805
2319 Ga0495596_0030167
2320 Ga0495596_0065907
2321 Ga0495596_0078758
2322 Ga0495596_0085338
2323 Ga0495607_0000013
2324 Ga0495607_0000022
2325 Ga0495607_0000159
2326 Ga0495607_0000309
2327 Ga0495607_0000481
2328 Ga0495607_0000840
2329 Ga0495607_0001111
2330 Ga0495607_0002005
2331 Ga0495607_0003922
2332 Ga0495607_0004541
2333 Ga0495607_0005301
2334 Ga0495607_0005426
2335 Ga0495607_0006347
2336 Ga0495607_0006901
2337 Ga0495607_0009223
2338 Ga0495607_0014841
2339 Ga0495607_0015338
2340 Ga0495607_0030346
2341 Ga0495607_0033184
2342 Ga0495607_0041669
2343 Ga0495607_0043446
2344 Ga0495607_0061470
2345 Ga0495607_0104522
2346 Ga0495607_0123425
2347 Ga0495607_0137929
2348 Ga0495583_0000043
2349 Ga0495583_0000192
2350 Ga0495583_0000645
2351 Ga0495583_0000684
2352 Ga0495583_0000714
2353 Ga0495583_0000940
2354 Ga0495583_0001057
2355 Ga0495583_0001472
2356 Ga0495583_0001622
2357 Ga0495583_0003309
2358 Ga0495583_0005709
2359 Ga0495583_0010559
2360 Ga0495606_0000362
2361 Ga0495606_0000367
2362 Ga0495606_0001081
2363 Ga0495606_0001228
2364 Ga0495606_0001261
2365 Ga0495606_0001308
2366 Ga0495606_0001970
2367 Ga0495606_0002333
2368 Ga0495606_0003639
2369 Ga0495606_0009526
2370 Ga0495606_0009574
2371 Ga0495606_0018779
2372 Ga0495606_0024039
2373 Ga0495606_0034007
2374 Ga0495606_0147229
2375 Ga0495606_0203747
2376 Ga0495606_0211197
2377 Ga0495610_0000723
2378 Ga0495610_0000761
2379 Ga0495610_0001455
2380 Ga0495610_0001620
2381 Ga0495610_0001992
2382 Ga0495610_0007995
2383 Ga0495610_0008038
2384 Ga0495610_0010674
2385 Ga0495610_0011001
2386 Ga0495610_0013504
2387 Ga0495610_0015957
2388 Ga0495610_0088072
2389 Ga0495616_0000340
2390 Ga0495616_0000482
2391 Ga0495616_0002159
2392 Ga0495616_0008773
2393 Ga0495616_0009458
2394 Ga0495616_0012758
2395 Ga0495616_0016266
2396 Ga0495616_0023177
2397 Ga0495616_0055908
2398 Ga0495616_0085043
2399 Ga0495616_0133127
2400 Ga0495616_0159055
2401 Ga0495620_0000075
2402 Ga0495620_0000114
2403 Ga0495620_0000170
2404 Ga0495620_0000307
2405 Ga0495620_0002176
2406 Ga0495620_0002439
2407 Ga0495620_0002887
2408 Ga0495620_0006034
2409 Ga0495620_0007339
2410 Ga0495620_0011137
2411 Ga0495620_0020589
2412 Ga0495620_0020799
2413 Ga0495620_0076483
2414 Ga0495630_0010683
2415 Ga0495630_0014997
2416 Ga0495631_0000020
2417 Ga0495631_0000384
2418 Ga0495631_0000609
2419 Ga0495631_0001218
2420 Ga0495631_0001327
2421 Ga0495631_0006461
2422 Ga0495631_0010943
2423 Ga0495631_0024729
2424 Ga0495631_0025838
2425 Ga0495631_0030128
2426 Ga0495631_0056485
2427 Ga0495631_0063302
2428 Ga0495632_0000255
2429 Ga0495632_0000436
2430 Ga0495632_0000790
2431 Ga0495632_0000965
2432 Ga0495632_0001749
2433 Ga0495632_0002297
2434 Ga0495632_0003622
2435 Ga0495632_0004384
2436 Ga0495632_0010001
2437 Ga0495632_0014829
2438 Ga0495632_0014837
2439 Ga0495632_0029689
2440 Ga0495632_0034296
2441 Ga0495632_0034571
2442 Ga0495632_0045524
2443 Ga0495632_0060478
2444 Ga0495632_0064189
2445 Ga0495632_0069523
2446 Ga0495632_0122043
2447 Ga0495637_0000043
2448 Ga0495637_0000420
2449 Ga0495637_0000442
2450 Ga0495637_0000447
2451 Ga0495637_0000616
2452 Ga0495637_0001545
2453 Ga0495637_0001927
2454 Ga0495637_0004671
2455 Ga0495637_0008453
2456 Ga0495637_0009920
2457 Ga0495637_0011626
2458 Ga0495637_0014251
2459 Ga0495637_0018855
2460 Ga0495637_0024902
2461 Ga0495637_0026502
2462 Ga0495637_0030811
2463 Ga0495643_0000049
2464 Ga0495643_0000401
2465 Ga0495643_0000647
2466 Ga0495643_0001444
2467 Ga0495643_0004481
2468 Ga0495643_0008120
2469 Ga0495643_0009497
2470 Ga0495643_0011154
2471 Ga0495643_0013208
2472 Ga0495643_0020133
2473 Ga0495643_0020193
2474 Ga0495643_0029136
2475 Ga0495643_0100509
2476 Ga0495644_0000193
2477 Ga0495644_0000508
2478 Ga0495644_0000998
2479 Ga0495644_0003222
2480 Ga0495644_0010173
2481 Ga0495644_0013086
2482 Ga0495644_0028333
2483 Ga0495648_0000327
2484 Ga0495648_0000627
2485 Ga0495648_0001249
2486 Ga0495648_0001427
2487 Ga0495648_0003384
2488 Ga0495648_0004361
2489 Ga0495648_0004765
2490 Ga0495648_0004814
2491 Ga0495648_0007585
2492 Ga0495648_0007721
2493 Ga0495648_0012937
2494 Ga0495648_0016013
2495 Ga0495648_0016995
2496 Ga0495648_0028598
2497 Ga0495648_0028614
2498 Ga0495648_0048002
2499 Ga0495648_0069536
2500 Ga0495648_0070245
2501 Ga0495648_0133717
2502 Ga0495663_0000254
2503 Ga0495666_0000190
2504 Ga0495666_0001791
2505 Ga0495666_0010302
2506 Ga0495666_0012665
2507 Ga0495666_0033403
2508 Ga0495666_0041931
2509 Ga0495642_0000033
2510 Ga0495642_0000251
2511 Ga0495642_0000900
2512 Ga0495654_0000111
2513 Ga0495654_0000298
2514 Ga0495654_0000324
2515 Ga0495654_0000784
2516 Ga0495654_0000841
2517 Ga0495654_0000936
2518 Ga0495654_0000982
2519 Ga0495654_0002582
2520 Ga0495654_0003751
2521 Ga0495654_0006337
2522 Ga0495654_0007625
2523 Ga0495654_0012184
2524 Ga0495654_0015224
2525 Ga0495654_0029278
2526 Ga0495654_0030089
2527 Ga0495654_0046569
2528 Ga0495654_0050675
2529 Ga0495654_0053809
2530 Ga0495654_0063978
2531 Ga0495654_0064557
2532 Ga0495654_0068608
2533 Ga0495654_0079416
2534 Ga0495654_0082682
2535 Ga0495654_0110814
2536 Ga0495654_0112973
2537 Ga0495587_0000454
2538 Ga0495587_0002320
2539 Ga0495587_0046233
2540 Ga0495587_0170833
2541 Ga0495609_0000036
2542 Ga0495609_0000045
2543 Ga0495609_0000049
2544 Ga0495609_0000405
2545 Ga0495609_0001082
2546 Ga0495609_0002678
2547 Ga0495609_0003612
2548 Ga0495609_0004013
2549 Ga0495609_0007819
2550 Ga0495609_0011375
2551 Ga0495609_0015814
2552 Ga0495609_0042453
2553 Ga0495609_0068490
2554 Ga0495609_0138747
2555 Ga0495597_0000013
2556 Ga0495597_0000574
2557 Ga0495597_0001021
2558 Ga0495597_0001346
2559 Ga0495597_0002441
2560 Ga0495597_0009911
2561 Ga0495597_0013507
2562 Ga0495597_0016615
2563 Ga0495597_0019026
2564 Ga0495597_0057294
2565 Ga0495645_0023776
2566 Ga0495645_0068352
2567 Ga0495645_0252176
2568 Ga0495622_0000346
2569 Ga0495622_0000757
2570 Ga0495622_0003859
2571 Ga0495622_0006630
2572 Ga0495622_0027975
2573 Ga0495622_0037699
2574 Ga0495622_0041437
2575 Ga0495622_0062426
2576 Ga0495622_0072793
2577 Ga0495633_0000229
2578 Ga0495633_0000960
2579 Ga0495633_0001099
2580 Ga0495633_0009543
2581 Ga0495633_0022014
2582 Ga0495633_0026649
2583 Ga0495656_0128887
2584 Ga0495668_0000568
2585 Ga0495668_0001696
2586 Ga0495668_0021584
2587 Ga0495668_0069885
2588 Ga0495668_0117648
2589 Ga0495668_0226720
2590 Ga0495634_0000604
2591 Ga0495634_0007150
2592 Ga0495611_0000220
2593 Ga0495611_0000472
2594 Ga0495611_0001173
2595 Ga0495611_0002514
2596 Ga0495611_0008346
2597 Ga0495611_0009865
2598 Ga0495611_0013461
2599 Ga0495611_0021500
2600 Ga0495625_0000070
2601 Ga0495625_0001145
2602 Ga0495625_0001301
2603 Ga0495625_0001848
2604 Ga0495625_0002099
2605 Ga0495625_0002421
2606 Ga0495625_0003237
2607 Ga0495625_0007897
2608 Ga0495625_0017092
2609 Ga0495625_0017490
2610 Ga0495625_0018386
2611 Ga0495625_0019131
2612 Ga0495625_0047775
2613 Ga0495625_0078182
2614 Ga0495625_0088804
2615 Ga0495625_0130411
2616 Ga0495625_0167679
2617 Ga0495635_0000247
2618 Ga0495635_0037121
2619 Ga0495659_0000162
2620 Ga0495659_0005203
2621 Ga0495661_0000042
2622 Ga0495661_0000312
2623 Ga0495661_0000545
2624 Ga0495661_0000867
2625 Ga0495661_0003095
2626 Ga0495661_0003984
2627 Ga0495661_0008243
2628 Ga0495661_0012485
2629 Ga0495661_0012911
2630 Ga0495661_0019090
2631 Ga0495661_0020701
2632 Ga0495661_0026075
2633 Ga0495661_0037357
2634 Ga0495661_0073479
2635 Ga0495661_0113131
2636 Ga0495661_0122272
2637 Ga0495588_0011494
2638 Ga0495588_0034802
2639 Ga0495588_0052241
2640 Ga0495588_0063121
2641 Ga0495588_0074595
2642 Ga0495599_0091482
2643 Ga0495623_0000555
2644 Ga0495623_0007106
2645 Ga0495646_0000263
2646 Ga0495646_0000651
2647 Ga0495646_0006393
2648 Ga0495669_0004289
2649 Ga0495613_0010387
2650 Ga0495613_0012057
2651 Ga0495613_0012280
2652 Ga0495624_0000533
2653 Ga0495670_0000115
2654 Ga0495670_0000146
2655 Ga0495670_0000969
2656 Ga0495670_0001578
2657 Ga0495670_0002156
2658 Ga0495670_0007144
2659 Ga0495670_0011830
2660 Ga0495670_0012118
2661 Ga0495670_0015984
2662 Ga0495670_0024246
2663 Ga0495670_0067040
2664 Ga0495671_0000380
2665 Ga0495671_0000428
2666 Ga0495671_0000808
2667 Ga0495671_0001253
2668 Ga0495671_0001430
2669 Ga0495671_0002385
2670 Ga0495671_0007610
2671 Ga0495671_0008122
2672 Ga0495671_0008423
2673 Ga0495671_0009680
2674 Ga0495671_0010341
2675 Ga0495671_0011518
2676 Ga0495671_0022607
2677 Ga0495671_0025200
2678 Ga0495671_0042494
2679 Ga0495671_0045911
2680 Ga0495671_0049801
2681 Ga0495649_0000462
2682 Ga0495649_0000580
2683 Ga0495649_0000598
2684 Ga0495649_0000666
2685 Ga0495649_0002822
2686 Ga0495649_0003938
2687 Ga0495649_0004392
2688 Ga0495649_0008504
2689 Ga0495649_0013429
2690 Ga0495649_0014238
2691 Ga0495649_0015808
2692 Ga0495649_0022217
2693 Ga0495649_0059667
2694 Ga0495649_0086164
2695 Ga0495649_0119840
2696 Ga0495589_0000127
2697 Ga0495589_0000238
2698 Ga0495589_0000399
2699 Ga0495589_0000414
2700 Ga0495589_0000943
2701 Ga0495589_0002524
2702 Ga0495589_0002598
2703 Ga0495589_0003020
2704 Ga0495589_0005006
2705 Ga0495589_0013229
2706 Ga0495589_0016357
2707 Ga0495589_0018383
2708 Ga0495600_0006341
2709 Ga0495600_0026624
2710 Ga0495600_0038331
2711 Ga0495660_0000461
2712 Ga0495660_0000535
2713 Ga0495660_0000635
2714 Ga0495660_0000750
2715 Ga0495660_0001328
2716 Ga0495660_0002832
2717 Ga0495660_0005329
2718 Ga0495660_0009503
2719 Ga0495660_0011235
2720 Ga0495660_0011581
2721 Ga0495660_0014213
2722 Ga0495660_0014638
2723 Ga0495660_0016853
2724 Ga0495660_0020663
2725 Ga0495660_0022145
2726 Ga0495660_0023097
2727 Ga0495660_0028964
2728 Ga0495660_0045215
2729 Ga0495660_0064156
2730 Ga0495660_0067161
2731 Ga0495660_0140797
2732 Ga0495581_0001342
2733 Ga0495604_0022917
2734 Ga0495604_0024534
2735 Ga0495604_0029448
2736 Ga0495636_0026303
2737 Ga0495672_0000211
2738 Ga0495672_0000540
2739 Ga0495672_0000791
2740 Ga0495672_0001244
2741 Ga0495672_0002250
2742 Ga0495672_0003287
2743 Ga0495672_0006837
2744 Ga0495672_0006878
2745 Ga0495672_0008178
2746 Ga0495672_0009838
2747 Ga0495672_0011896
2748 Ga0495672_0017798
2749 Ga0495672_0019994
2750 Ga0495672_0028652
2751 Ga0495672_0050635
2752 Ga0495672_0164898
2753 Ga0495676_0000019
2754 Ga0495676_0000568
2755 Ga0495676_0004365
2756 Ga0495680_0001631
2757 Ga0495680_0001655
2758 Ga0495680_0006403
2759 Ga0495680_0006531
2760 Ga0495680_0010690
2761 Ga0495680_0014253
2762 Ga0495683_0000003
2763 Ga0495683_0000085
2764 Ga0495683_0000455
2765 Ga0495683_0002508
2766 Ga0495683_0003443
2767 Ga0495683_0003889
2768 Ga0495683_0008100
2769 Ga0495683_0023061
2770 Ga0495683_0028422
2771 Ga0495683_0028572
2772 Ga0495683_0043328
2773 Ga0495683_0047118
2774 Ga0495683_0051041
2775 Ga0495683_0058748
2776 Ga0495683_0100932
2777 Ga0495687_000975
2778 Ga0495687_002082
2779 Ga0495687_002345
2780 Ga0495687_002731
2781 Ga0495675_0002044
2782 Ga0495675_0025696
2783 Ga0495675_0109072
2784 Ga0495677_0000245
2785 Ga0495679_000049
2786 Ga0495679_000380
2787 Ga0495679_000475
2788 Ga0495679_000621
2789 Ga0495679_001516
2790 Ga0495679_001581
2791 Ga0495679_002650
2792 Ga0495679_003180
2793 Ga0495679_003673
2794 Ga0495679_010071
2795 Ga0495679_010728
2796 Ga0495679_041769
2797 Ga0495679_046501
2798 Ga0495685_001299
2799 Ga0495673_0000168
2800 Ga0495673_0000345
2801 Ga0495673_0000411
2802 Ga0495673_0000637
2803 Ga0495673_0000687
2804 Ga0495673_0000702
2805 Ga0495673_0000755
2806 Ga0495673_0000806
2807 Ga0495673_0000864
2808 Ga0495673_0001319
2809 Ga0495673_0003307
2810 Ga0495673_0004244
2811 Ga0495673_0004370
2812 Ga0495673_0006513
2813 Ga0495673_0007963
2814 Ga0495673_0009701
2815 Ga0495673_0011069
2816 Ga0495673_0014724
2817 Ga0495673_0014934
2818 Ga0495673_0020243
2819 Ga0495673_0023781
2820 Ga0495673_0025990
2821 Ga0495673_0072403
2822 Ga0495681_0000172
2823 Ga0495681_0000226
2824 Ga0495681_0000352
2825 Ga0495681_0000424
2826 Ga0495681_0000504
2827 Ga0495681_0000542
2828 Ga0495681_0000727
2829 Ga0495681_0002050
2830 Ga0495681_0002613
2831 Ga0495681_0004426
2832 Ga0495681_0005793
2833 Ga0495681_0014464
2834 Ga0495681_0015293
2835 Ga0495681_0021103
2836 Ga0495681_0029618
2837 Ga0495681_0032543
2838 Ga0495681_0043502
2839 Ga0495681_0049432
2840 Ga0495681_0110579
2841 Ga0495684_0006952
2842 Ga0495684_0012754
2843 Ga0495686_0001754
2844 Ga0495686_0002862
2845 Ga0495686_0006607
2846 Ga0495686_0017096
2847 Ga0495686_0068571
2848 Ga0495686_0076716
2849 Ga0495686_0116245
2850 Ga0495686_0146749
2851 Ga0495593_0000512
2852 Ga0495593_0001705
2853 Ga0495593_0009545
2854 Ga0495593_0035310
2855 Ga0495602_0001327
2856 Ga0495626_0000080
2857 Ga0495626_0000144
2858 Ga0495626_0000179
2859 Ga0495626_0000438
2860 Ga0495626_0000558
2861 Ga0495626_0000771
2862 Ga0495626_0001050
2863 Ga0495626_0003903
2864 Ga0495626_0004945
2865 Ga0495626_0010532
2866 Ga0495626_0011000
2867 Ga0495626_0013063
2868 Ga0495626_0013210
2869 Ga0495626_0032371
2870 Ga0495626_0078676
2871 Ga0495626_0121104
2872 Ga0496102_0000250
2873 Ga0496102_0013329
2874 Ga0496103_0001523
2875 Ga0496106_0011952
2876 Ga0496110_0004050
2877 Ga0496111_0100311
2878 Ga0496114_0000940
2879 Ga0496116_0000168
2880 Ga0496116_0000419
2881 Ga0496116_0001635
2882 Ga0496116_0002610
2883 Ga0496116_0007631
2884 Ga0496116_0022181
2885 Ga0496116_0031676
2886 Ga0496117_0000349
2887 Ga0496117_0001453
2888 Ga0496117_0002256
2889 Ga0496117_0003622
2890 Ga0496117_0006009
2891 Ga0496117_0006828
2892 Ga0496117_0013274
2893 Ga0496117_0035697
2894 Ga0496117_0081725
2895 Ga0496117_0194481
2896 Ga0496117_0205200
2897 Ga0496117_0230196
2898 Ga0496118_0003199
2899 Ga0496118_0003899
2900 Ga0496118_0007046
2901 Ga0496118_0007048
2902 Ga0496118_0007530
2903 Ga0496118_0008261
2904 Ga0496118_0010074
2905 Ga0496118_0020485
2906 Ga0496118_0046138
2907 Ga0496118_0073096
2908 Ga0496118_0125382
2909 Ga0496119_0025370
2910 Ga0496119_0037982
2911 Ga0496120_0004730
2912 Ga0496121_0000199
2913 Ga0496121_0000804
2914 Ga0496121_0002628
2915 Ga0496121_0003036
2916 Ga0496121_0021408
2917 Ga0496121_0024834
2918 Ga0496121_0037191
2919 Ga0496121_0050306
2920 Ga0496121_0069321
2921 Ga0496121_0101830
2922 Ga0496121_0120179
2923 Ga0496121_0209756
2924 Ga0496121_0228854
2925 Ga0496122_0000667
2926 Ga0496122_0001732
2927 Ga0496122_0002644
2928 Ga0496122_0009182
2929 Ga0496122_0027517
2930 Ga0496122_0075863
2931 Ga0496122_0080370
2932 Ga0496122_0154944
2933 Ga0496122_0154971
2934 Ga0496123_0000163
2935 Ga0496123_0000642
2936 Ga0496123_0000869
2937 Ga0496123_0017335
2938 Ga0496123_0029467
2939 Ga0496123_0039072
2940 Ga0496123_0088580
2941 Ga0496124_0000229
2942 Ga0496124_0000714
2943 Ga0496124_0000870
2944 Ga0496124_0001848
2945 Ga0496124_0002366
2946 Ga0496124_0008162
2947 Ga0496124_0014063
2948 Ga0496124_0027256
2949 Ga0496124_0032860
2950 Ga0496124_0041571
2951 Ga0496124_0044131
2952 Ga0496124_0084516
2953 Ga0496124_0100576
2954 Ga0496124_0101261
2955 Ga0496124_0123815
2956 Ga0496124_0148849
2957 Ga0496124_0273166
2958 Ga0496124_0279294
2959 Ga0496124_0289884
2960 Ga0496125_0002339
2961 Ga0496125_0002675
2962 Ga0496125_0003616
2963 Ga0496125_0004799
2964 Ga0496125_0011474
2965 Ga0496125_0014619
2966 Ga0496125_0031060
2967 Ga0496125_0031171
2968 Ga0496125_0033883
2969 Ga0496125_0049349
2970 Ga0496125_0070266
2971 Ga0496125_0102560
2972 Ga0496126_0012494
2973 Ga0496126_0016012
2974 Ga0496126_0043720
2975 Ga0496126_0127116
2976 Ga0496126_0142895
2977 Ga0496126_0148197
2978 Ga0496126_0199345
2979 Ga0495678_000007
2980 Ga0495678_000047
2981 Ga0495678_000802
2982 Ga0495678_001017
2983 Ga0495678_001022
2984 Ga0495678_001038
2985 Ga0495678_001095
2986 Ga0495678_001852
2987 Ga0495678_006674
2988 Ga0495678_009007
2989 Ga0495678_009877
2990 Ga0495678_013665
2991 Ga0495678_013776
2992 Ga0495678_013843
2993 Ga0495678_020767
2994 Ga0495678_025480
2995 Ga0495678_033049
2996 Ga0495682_0000051
2997 Ga0495682_0000899
2998 Ga0495682_0001158
2999 Ga0495682_0001812
3000 Ga0495682_0007174
3001 Ga0495682_0061187
3002 Ga0495682_0079264
3003 Ga0501031_0118652
3004 Ga0501034_0001187
3005 Ga0501037_0066593
3006 Ga0501038_0098179
3007 Ga0501038_0170375
3008 Ga0501042_0288440
3009 Ga0501043_0085365
3010 Ga0501047_0094211
3011 Ga0501074_0207602
3012 Ga0501222_000116
3013 Ga0501227_003954
3014 Ga0501240_007882
3015 Ga0501241_000142
3016 Ga0501035_0149900
3017 Ga0501035_0252960
3018 Ga0501044_0191213
3019 Ga0501044_0268794
3020 Ga0501226_002129
3021 nmdc:mga03683_3959_c1
3022 nmdc:mga03683_71757_c1
3023 nmdc:mga00v17_127726_c1
3024 nmdc:mga00v17_40232_c1
3025 nmdc:mga00v17_59921_c1
3026 nmdc:mga08x19_32307_c1
3027 nmdc:mga0sz30_17935_c1
3028 Ga0500651_0039659
3029 Ga0500572_000143
3030 Ga0500595_002919
3031 Ga0500621_015694
3032 Ga0500659_0009556
3033 Ga0500564_001328
3034 Ga0500573_0001618
3035 Ga0500577_0036661
3036 Ga0500634_0001481
3037 Ga0500636_0038956
3038 2511252812
3039 2511264234
3040 2511273103
3041 2511275789
3042 2511290606
3043 2511298332
3044 2511301068
3045 2511312252
3046 2511322766
3047 2511326154
3048 2511333930
3049 2511339007
3050 2511347189
3051 2511349857
3052 2511354002
3053 2511365716
3054 2511376556
3055 2511410882
3056 2511823716
3057 2512323972
3058 2552748235
3059 2554815639
3060 2555244823
3061 2555671231
3062 2583793645
3063 2597859304
3064 2597863032
3065 2597868824
3066 2599326778
3067 2599354610
3068 2599359677
3069 2599365999
3070 2599372789
3071 2599379717
3072 2599385304
3073 2599391648
3074 2599401614
3075 2599403414
3076 2599451845
3077 2599461444
3078 2599469987
3079 2599482135
3080 2599490463
3081 2599504509
3082 2599509615
3083 2599514858
3084 2599520956
3085 2599611596
3086 2599770309
3087 2599804147
3088 2599882203
3089 2599887482
3090 2599894345
3091 2599901771
3092 2599934323
3093 2599941756
3094 2599951553
3095 2599952724
3096 2599960615
3097 2599964909
3098 2599971456
3099 2599975978
3100 2599981925
3101 2599987834
3102 2599995329
3103 2599998274
3104 2600005438
3105 2600010141
3106 2600017344
3107 2600022567
3108 2600027587
3109 2600034371
3110 2600039867
3111 2600046164
3112 2600052167
3113 2600057544
3114 2600064705
3115 2600072282
3116 2600075842
3117 2600214062
3118 2600356704
3119 2600364212
3120 2600442985
3121 2601624743
3122 2601694259
3123 2601774228
3124 2601796224
3125 2602009539
3126 2606073373
3127 2606126981
3128 2608383943
3129 2621300894
3130 2624481873
3131 2624491042
3132 2640734782
3133 2643830747
3134 2643845576
3135 2643871632
3136 2643956453
3137 2643974237
3138 2644025505
3139 2644187419
3140 2644284895
3141 2644623509
3142 2652547528
3143 2671094361
3144 2671097191
3145 2671126043
3146 2671770285
3147 2678231723
3148 2678262648
3149 2715751176
3150 2715758176
3151 2718635122
3152 2723247849
3153 2738670481
3154 2738688863
3155 2738748874
3156 2738810856
3157 2738857916
3158 2738898216
3159 2739201913
3160 2739259284
3161 2739264826
3162 2739287492
3163 2739292805
3164 2739314115
3165 2743738837
3166 2745008988
3167 2745160174
3168 2774123398
3169 2774132783
3170 2774389418
3171 2774436877
3172 2784263405
3173 2784316060
3174 2794596452
3175 2807409277
3176 2807457579
3177 2808855117
3178 2808924394
3179 2808930567
3180 2808935773
3181 2808942346
3182 2808946508
3183 2808952689
3184 2808957317
3185 2808963532
3186 2808979430
3187 2808995354
3188 2808998510
3189 2809218727
3190 2817489805
3191 2819655617
3192 2819702288
3193 2823424614
3194 2825652986
3195 2826583918
3196 2834029682
3197 2842806028
3198 2842820242
3199 2842831957
3200 2842836467
3201 2842841541
3202 2842844581
3203 2842850835
3204 2844671761
3205 2852618437
3206 2852662384
3207 2852673427
3208 2860340754
3209 2860869675
3210 2878033857
3211 2880234483
3212 2904521377
3213 2904555736
3214 2908448596
3215 2912967396
3216 2913038627
3217 2916702061
3218 2917075092
3219 2919068843
3220 2919182890
3221 2919387950
3222 2919461115
3223 2919481904
3224 2919489868
3225 2919504344
3226 2919507980
3227 2919702056
3228 2923157909
3229 2923520221
3230 2923587261
3231 2926065083
3232 2929146081
3233 2929191650
3234 2931370583
3235 2931392749
3236 2931403307
3237 2935356080
3238 2939614459
3239 2939637669
3240 2939652912
3241 2941493779
3242 2945928916
3243 2945962290
3244 2946011139
3245 2946029932
3246 2947236504
3247 2969308632
3248 2974289994
3249 2984288272
3250 2988733611
3251 2990198304
3252 2998143937
3253 3007397219
3254 3007424246
3255 3007515638
3256 3007616914
3257 3007625620
3258 3007718864
3259 3007865367
3260 3007870223
3261 3007875559
3262 637321560
3263 8011354949
3264 8015692007
3265 8019774432
3266 8019780925
3267 8029996940
3268 8033232796
3269 8034962598
3270 8052496295
3271 8054288631
3272 8054352111
3273 8054505252
3274 8054930352
3275 8055775216
3276 8055819795
3277 8055880228
3278 8056117932
3279 8056124347
3280 8056127621
3281 8056133579
3282 8056147212
3283 8056150484
3284 8056157243
3285 8056165000
3286 8056167339
3287 8056173323
3288 8056179517
3289 8056572680
3290 8057804041

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

146

293

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xpi-assembly2.cif.gz_B crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.851 89 292
1v9k-assembly2.cif.gz_B the crystal structure of the catalytic domain of pseudouridine synthase rluc from escherichia coli 0.8461 89 292
2i82-assembly2.cif.gz_B crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure 0.8288 87 295
1prz-assembly1.cif.gz_A crystal structure of pseudouridine synthase rlud catalytic module 0.826 81 292
1xpi-assembly1.cif.gz_A crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.8146 89 292
ID Description Score Start End Superfamily
af_O07166_77_287_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.937 79 291 3.30.2350.10
af_O07166_77_287_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9327 79 291 3.30.2350.10
af_Q12069_190_394_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9186 90 253 3.30.2350.10
af_Q9VKU8_216_417_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9038 88 255 3.30.2350.10
af_Q2FZQ6_75_272_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8781 88 289 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A833KNC8-F1-model_v4 deleted 0.978 85 231
AF-A0A645E1Q1-F1-model_v4 Ribosomal large subunit pseudouridine synthase A (EC 5.4.99.28) 0.9779 100 294 GO:0000455
GO:0003723
GO:0160151
AF-A0A4V3MV30-F1-model_v4 deleted 0.9721 13 294
AF-A0A369ARD3-F1-model_v4 tRNA pseudouridine32 synthase/23S rRNA pseudouridine746 synthase 0.9685 26 295 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A843YPX1-F1-model_v4 Pseudouridine synthase 0.9664 13 293 GO:0000455
GO:0003723
GO:0009982
GO:0140098

Map