F495182
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1645 | 581 | 3290 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300046458|Ga0495591_000040|Ga0495591_000040_62838_63881 |
| Length | 347 |
| Sequence | VRHFVTRLRGDDRLAFKCEDPGRAASLAQAQALGDNPALVASVIPIDSELPMSESVFTPAHLQASTLYLPPGPWLTVLDCLCERFSAIPREQWLDRIARGRVLDGEGNPIAVDLAYREGLRIHYFREVPNETLIPVQETILYADEHLVVADKPHFLPVTPAGEYVEQTLLRRLIRTLDNPDLVPLHRIDRHTAGLVLFSANKQTRSAYQALFPTRQIDKRYEAIAGALPELEFPRVHKSRLVDGEPFFRMQEGEGQSNTETRIEVCEKNGELWRYGLYPVTGKKHQLRVHMAALGAGICNDPFYPEVLKDAVDDYDKPLKLLAKGLRFVDPVSGQERFFESRIILDW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 51 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 52 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 144 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 145 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 164 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 165 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 166 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 167 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 170 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 171 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 172 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 173 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 174 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 175 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 176 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 177 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 178 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 179 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 180 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 181 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 182 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 183 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 184 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 185 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 186 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 187 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 188 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 189 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 190 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 191 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 192 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 193 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 196 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 197 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 198 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 199 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 200 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 309 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 320 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 323 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 324 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 326 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 328 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 329 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 330 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 331 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 332 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 333 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 334 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 335 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 336 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 337 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 338 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 339 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 340 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 341 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 342 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 343 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 344 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 345 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 346 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 347 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 348 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 349 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 350 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 351 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 352 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 353 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 354 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 355 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 356 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 357 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 358 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 359 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 360 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 361 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 362 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 363 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 364 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 365 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 366 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 367 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 368 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 369 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 370 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 371 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 372 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 373 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 374 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 375 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 376 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 377 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 378 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 379 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 380 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 381 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 382 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 383 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 384 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 385 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 386 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 387 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 388 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 389 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 390 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 391 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 392 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 393 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 394 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 395 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 396 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 397 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 398 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 399 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 400 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 401 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 402 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 403 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 404 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 405 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 406 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 407 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 408 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 409 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 410 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 411 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 412 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 413 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 414 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 415 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 416 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 417 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 418 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 419 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 420 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 421 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 422 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 423 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 424 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 425 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 426 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 427 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 428 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 429 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 430 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 431 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 432 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 433 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 434 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 435 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 436 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 437 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 438 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 439 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 440 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 441 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 442 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 443 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 444 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 445 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 446 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 447 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 448 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 449 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 450 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 451 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 452 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 453 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 454 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 455 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 456 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 457 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 458 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 459 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 460 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 461 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 462 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 463 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 464 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 465 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 466 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 467 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 468 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 469 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 470 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 471 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 472 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 473 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 474 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 475 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 476 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 477 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 478 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 479 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 480 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 481 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 482 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 483 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 484 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 485 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 486 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 487 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 488 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 489 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 490 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 491 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 492 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 493 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 494 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 495 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 496 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 497 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 498 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 499 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 500 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 501 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 502 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 503 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 504 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 505 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 506 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 507 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 508 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 509 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 510 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 511 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 512 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 513 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 514 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 515 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 516 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 517 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 518 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 519 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 520 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 521 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 522 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 523 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 524 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 525 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 526 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 527 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 528 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 529 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 530 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 531 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 532 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 533 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 534 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 535 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 536 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 537 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 538 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 539 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 540 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 541 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 542 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 543 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 544 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 545 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 546 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 547 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 548 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 549 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 550 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 551 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 552 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 553 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 554 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 555 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 556 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 557 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 558 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 559 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 560 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 561 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 562 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 563 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 564 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 565 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 566 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 567 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 568 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 569 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 570 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 571 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 572 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 573 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 574 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 575 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 576 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 577 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 578 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 579 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 580 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 581 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.62 |
| Metatranscriptomes | 0 |
| Isolates | 15.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.96 |
| Nodule | 1.82 |
| Rhizoplane | 4.74 |
| Rhizosphere | 76.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495591_000040 | 3300046458 | Bacteria | 155841 |
| 2 | MRS2a_Contig_45 | 2124908027 | Bacteria | 78063 |
| 3 | MRS2a_Contig_6898 | 2124908027 | Bacteria | 1810 |
| 4 | SwRhRL2b_contig_1400918 | 2162886007 | Bacteria | 5175 |
| 5 | MRS1b_contig_6133759 | 2162886011 | Bacteria | 2918 |
| 6 | JGI25162J39368_1000077 | 3300002737 | Bacteria | 120042 |
| 7 | JGI25154J39366_1002990 | 3300002738 | Bacteria | 3858 |
| 8 | JGI25163J39215_1000050 | 3300002771 | Bacteria | 53099 |
| 9 | JGI25163J39215_1000126 | 3300002771 | Bacteria | 31582 |
| 10 | JGI25164J39214_1000054 | 3300002772 | Bacteria | 120042 |
| 11 | JGI25164J39214_1000129 | 3300002772 | Bacteria | 72515 |
| 12 | JGI25164J39214_1001811 | 3300002772 | Bacteria | 4121 |
| 13 | JGI25165J46597_1000141 | 3300003214 | Bacteria | 120042 |
| 14 | JGI25165J46597_1000251 | 3300003214 | Bacteria | 72515 |
| 15 | JGI25165J46597_1000405 | 3300003214 | Bacteria | 45672 |
| 16 | Ga0055538_1000090 | 3300003751 | Bacteria | 78300 |
| 17 | Ga0055539_1000134 | 3300003752 | Bacteria | 78300 |
| 18 | Ga0055533_1000138 | 3300003756 | Bacteria | 78275 |
| 19 | Ga0055532_1000142 | 3300003758 | Bacteria | 69999 |
| 20 | Ga0055525_1000183 | 3300003759 | Bacteria | 78300 |
| 21 | Ga0055526_1000024 | 3300003771 | Bacteria | 158479 |
| 22 | Ga0055537_1000180 | 3300003773 | Bacteria | 47002 |
| 23 | Ga0055524_1000174 | 3300003775 | Bacteria | 73269 |
| 24 | Ga0055536_1000239 | 3300003781 | Bacteria | 44007 |
| 25 | Ga0055536_1000345 | 3300003781 | Bacteria | 34403 |
| 26 | Ga0055536_1013222 | 3300003781 | Bacteria | 2998 |
| 27 | Ga0055534_1000084 | 3300003784 | Bacteria | 73269 |
| 28 | Ga0055528_1000016 | 3300003790 | Bacteria | 158479 |
| 29 | Ga0055530_10000053 | 3300003791 | Bacteria | 102949 |
| 30 | Ga0055530_10000289 | 3300003791 | Bacteria | 45948 |
| 31 | Ga0055530_10001084 | 3300003791 | Bacteria | 21394 |
| 32 | Ga0055540_1000105 | 3300003792 | Bacteria | 93593 |
| 33 | Ga0055540_1000252 | 3300003792 | Bacteria | 48842 |
| 34 | Ga0055540_1000790 | 3300003792 | Bacteria | 21432 |
| 35 | Ga0055531_10000081 | 3300003794 | Bacteria | 103600 |
| 36 | Ga0055531_10003476 | 3300003794 | Bacteria | 10020 |
| 37 | Ga0055541_1000089 | 3300003841 | Bacteria | 78275 |
| 38 | Ga0058692_1000001 | 3300003856 | Bacteria | 834230 |
| 39 | Ga0065703_1000531 | 3300005272 | Bacteria | 9963 |
| 40 | Ga0065714_10000016 | 3300005288 | Bacteria | 18961 |
| 41 | Ga0065714_10002400 | 3300005288 | Bacteria | 22050 |
| 42 | Ga0065714_10002585 | 3300005288 | Bacteria | 18890 |
| 43 | Ga0065714_10002591 | 3300005288 | Bacteria | 24389 |
| 44 | Ga0065714_10002616 | 3300005288 | Bacteria | 13699 |
| 45 | Ga0065714_10003051 | 3300005288 | Bacteria | 8821 |
| 46 | Ga0065714_10012583 | 3300005288 | Bacteria | 2794 |
| 47 | Ga0065714_10028718 | 3300005288 | Bacteria | 2159 |
| 48 | Ga0065714_10064635 | 3300005288 | Bacteria | 26793 |
| 49 | Ga0065714_10066389 | 3300005288 | Bacteria | 6960 |
| 50 | Ga0065714_10068183 | 3300005288 | Bacteria | 4909 |
| 51 | Ga0065714_10071681 | 3300005288 | Bacteria | 3517 |
| 52 | Ga0065704_10072159 | 3300005289 | Bacteria | 9040 |
| 53 | Ga0065704_10078350 | 3300005289 | Bacteria | 4457 |
| 54 | Ga0065704_10078370 | 3300005289 | Bacteria | 4449 |
| 55 | Ga0065704_10083106 | 3300005289 | Bacteria | 3507 |
| 56 | Ga0065704_10156508 | 3300005289 | Bacteria | 1387 |
| 57 | Ga0065712_10002698 | 3300005290 | Bacteria | 6039 |
| 58 | Ga0065712_10069156 | 3300005290 | Bacteria | 7865 |
| 59 | Ga0065712_10096430 | 3300005290 | Bacteria | 2183 |
| 60 | Ga0070670_100001221 | 3300005331 | Bacteria | 20451 |
| 61 | Ga0070670_100037913 | 3300005331 | Bacteria | 4146 |
| 62 | Ga0070666_10118520 | 3300005335 | Bacteria | 1834 |
| 63 | Ga0070661_100006952 | 3300005344 | Bacteria | 7808 |
| 64 | Ga0070669_100000316 | 3300005353 | Bacteria | 37853 |
| 65 | Ga0070667_100000095 | 3300005367 | Bacteria | 109595 |
| 66 | Ga0070714_100000079 | 3300005435 | Bacteria | 82899 |
| 67 | Ga0070714_100190557 | 3300005435 | Bacteria | 1871 |
| 68 | Ga0070662_100002228 | 3300005457 | Bacteria | 11892 |
| 69 | Ga0070662_100043321 | 3300005457 | Bacteria | 3220 |
| 70 | Ga0068853_100008519 | 3300005539 | Bacteria | 8242 |
| 71 | Ga0068853_100107967 | 3300005539 | Bacteria | 2468 |
| 72 | Ga0070665_100002661 | 3300005548 | Bacteria | 19422 |
| 73 | Ga0070664_100000046 | 3300005564 | Bacteria | 74475 |
| 74 | Ga0068859_100029592 | 3300005617 | Bacteria | 5496 |
| 75 | Ga0068864_100000073 | 3300005618 | Bacteria | 109681 |
| 76 | Ga0068851_10000050 | 3300005834 | Bacteria | 72913 |
| 77 | Ga0068863_100043616 | 3300005841 | Bacteria | 4257 |
| 78 | Ga0068863_100178337 | 3300005841 | Bacteria | 2039 |
| 79 | Ga0075364_10081778 | 3300006051 | Bacteria | 2136 |
| 80 | Ga0075364_10103678 | 3300006051 | Bacteria | 1895 |
| 81 | Ga0075364_10170037 | 3300006051 | Bacteria | 1473 |
| 82 | Ga0075432_10005424 | 3300006058 | Bacteria | 4347 |
| 83 | Ga0075432_10008465 | 3300006058 | Bacteria | 3509 |
| 84 | Ga0075432_10016442 | 3300006058 | Bacteria | 2524 |
| 85 | Ga0075432_10025635 | 3300006058 | Bacteria | 2023 |
| 86 | Ga0075362_10029925 | 3300006177 | Bacteria | 2349 |
| 87 | Ga0075362_10052703 | 3300006177 | Bacteria | 1824 |
| 88 | Ga0075369_10021203 | 3300006186 | Bacteria | 2667 |
| 89 | Ga0075436_100040597 | 3300006914 | Bacteria | 3211 |
| 90 | Ga0075436_100329914 | 3300006914 | Bacteria | 1097 |
| 91 | Ga0097620_100029589 | 3300006931 | Bacteria | 5496 |
| 92 | Ga0099823_1007660 | 3300006944 | Bacteria | 10978 |
| 93 | Ga0099823_1044831 | 3300006944 | Bacteria | 2979 |
| 94 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 95 | Ga0079104_1000366 | 3300006946 | Bacteria | 53811 |
| 96 | Ga0079104_1028267 | 3300006946 | Bacteria | 1426 |
| 97 | Ga0099826_10025975 | 3300006948 | Bacteria | 4330 |
| 98 | Ga0105251_10002695 | 3300009011 | Bacteria | 13648 |
| 99 | Ga0105251_10002821 | 3300009011 | Bacteria | 13145 |
| 100 | Ga0105251_10002860 | 3300009011 | Bacteria | 13031 |
| 101 | Ga0105251_10004546 | 3300009011 | Bacteria | 9399 |
| 102 | Ga0105251_10012498 | 3300009011 | Bacteria | 4802 |
| 103 | Ga0105251_10015340 | 3300009011 | Bacteria | 4195 |
| 104 | Ga0105251_10023765 | 3300009011 | Bacteria | 3157 |
| 105 | Ga0105251_10035496 | 3300009011 | Bacteria | 2460 |
| 106 | Ga0105251_10043360 | 3300009011 | Bacteria | 2179 |
| 107 | Ga0105251_10077863 | 3300009011 | Bacteria | 1537 |
| 108 | Ga0105251_10093381 | 3300009011 | Bacteria | 1380 |
| 109 | Ga0105244_10000322 | 3300009036 | Bacteria | 45812 |
| 110 | Ga0105244_10000983 | 3300009036 | Bacteria | 23917 |
| 111 | Ga0105244_10001384 | 3300009036 | Bacteria | 19694 |
| 112 | Ga0105244_10002008 | 3300009036 | Bacteria | 15684 |
| 113 | Ga0105244_10002410 | 3300009036 | Bacteria | 14124 |
| 114 | Ga0105244_10011071 | 3300009036 | Bacteria | 5433 |
| 115 | Ga0105244_10011158 | 3300009036 | Bacteria | 5409 |
| 116 | Ga0105244_10013783 | 3300009036 | Bacteria | 4706 |
| 117 | Ga0105244_10024905 | 3300009036 | Bacteria | 3260 |
| 118 | Ga0105244_10035659 | 3300009036 | Bacteria | 2612 |
| 119 | Ga0105244_10045365 | 3300009036 | Bacteria | 2261 |
| 120 | Ga0105244_10046440 | 3300009036 | Bacteria | 2231 |
| 121 | Ga0105244_10046962 | 3300009036 | Bacteria | 2216 |
| 122 | Ga0105244_10082614 | 3300009036 | Bacteria | 1589 |
| 123 | Ga0105244_10093793 | 3300009036 | Bacteria | 1474 |
| 124 | Ga0105250_10000319 | 3300009092 | Bacteria | 37054 |
| 125 | Ga0105250_10001041 | 3300009092 | Bacteria | 15890 |
| 126 | Ga0105250_10019670 | 3300009092 | Bacteria | 2730 |
| 127 | Ga0105250_10039633 | 3300009092 | Bacteria | 1889 |
| 128 | Ga0105250_10059168 | 3300009092 | Bacteria | 1538 |
| 129 | Ga0105250_10062480 | 3300009092 | Bacteria | 1498 |
| 130 | Ga0105250_10079968 | 3300009092 | Bacteria | 1324 |
| 131 | Ga0105240_10060050 | 3300009093 | Bacteria | 4742 |
| 132 | Ga0105247_10001068 | 3300009101 | Bacteria | 20467 |
| 133 | Ga0105247_10015109 | 3300009101 | Bacteria | 4631 |
| 134 | Ga0105243_10000010 | 3300009148 | Bacteria | 316672 |
| 135 | Ga0105243_10000103 | 3300009148 | Bacteria | 97091 |
| 136 | Ga0105243_10000405 | 3300009148 | Bacteria | 45268 |
| 137 | Ga0105243_10067022 | 3300009148 | Bacteria | 2889 |
| 138 | Ga0105243_10547595 | 3300009148 | Bacteria | 1105 |
| 139 | Ga0105242_10000360 | 3300009176 | Bacteria | 36330 |
| 140 | Ga0105248_10087748 | 3300009177 | Bacteria | 3501 |
| 141 | Ga0105237_10007888 | 3300009545 | Bacteria | 11602 |
| 142 | Ga0105237_10046669 | 3300009545 | Bacteria | 4357 |
| 143 | Ga0105249_10074808 | 3300009553 | Bacteria | 3136 |
| 144 | Ga0105249_10107172 | 3300009553 | Bacteria | 2637 |
| 145 | Ga0105246_10000222 | 3300011119 | Bacteria | 28940 |
| 146 | Ga0105246_10000465 | 3300011119 | Bacteria | 21797 |
| 147 | Ga0105246_10011023 | 3300011119 | Bacteria | 5602 |
| 148 | Ga0157345_1000026 | 3300012498 | Bacteria | 37334 |
| 149 | Ga0157373_10000195 | 3300013100 | Bacteria | 50096 |
| 150 | Ga0157373_10003312 | 3300013100 | Bacteria | 12172 |
| 151 | Ga0157373_10008594 | 3300013100 | Bacteria | 7583 |
| 152 | Ga0157373_10014944 | 3300013100 | Bacteria | 5683 |
| 153 | Ga0157373_10016275 | 3300013100 | Bacteria | 5427 |
| 154 | Ga0157373_10084348 | 3300013100 | Bacteria | 2240 |
| 155 | Ga0157373_10107284 | 3300013100 | Bacteria | 1963 |
| 156 | Ga0157373_10115674 | 3300013100 | Bacteria | 1885 |
| 157 | Ga0157373_10186006 | 3300013100 | Bacteria | 1463 |
| 158 | Ga0157373_10195614 | 3300013100 | Bacteria | 1425 |
| 159 | Ga0157373_10329660 | 3300013100 | Bacteria | 1087 |
| 160 | Ga0157371_10000186 | 3300013102 | Bacteria | 91270 |
| 161 | Ga0157371_10000306 | 3300013102 | Bacteria | 64149 |
| 162 | Ga0157371_10000390 | 3300013102 | Bacteria | 55089 |
| 163 | Ga0157371_10003300 | 3300013102 | Bacteria | 14766 |
| 164 | Ga0157371_10143257 | 3300013102 | Bacteria | 1702 |
| 165 | Ga0157371_10211376 | 3300013102 | Bacteria | 1392 |
| 166 | Ga0157371_10278483 | 3300013102 | Bacteria | 1208 |
| 167 | Ga0157370_10002694 | 3300013104 | Bacteria | 21295 |
| 168 | Ga0157370_10006604 | 3300013104 | Bacteria | 12750 |
| 169 | Ga0157370_10031366 | 3300013104 | Bacteria | 5200 |
| 170 | Ga0157370_10081529 | 3300013104 | Bacteria | 3044 |
| 171 | Ga0157370_10123431 | 3300013104 | Bacteria | 2418 |
| 172 | Ga0157370_10177604 | 3300013104 | Bacteria | 1979 |
| 173 | Ga0157370_10179169 | 3300013104 | Bacteria | 1969 |
| 174 | Ga0157370_10371820 | 3300013104 | Bacteria | 1317 |
| 175 | Ga0157369_10001322 | 3300013105 | Bacteria | 30719 |
| 176 | Ga0157369_10003927 | 3300013105 | Bacteria | 17636 |
| 177 | Ga0157369_10036004 | 3300013105 | Bacteria | 5425 |
| 178 | Ga0157369_10142783 | 3300013105 | Bacteria | 2532 |
| 179 | Ga0157369_10163971 | 3300013105 | Bacteria | 2344 |
| 180 | Ga0157369_10163972 | 3300013105 | Bacteria | 2344 |
| 181 | Ga0157369_10632499 | 3300013105 | Bacteria | 1104 |
| 182 | Ga0163162_10000072 | 3300013306 | Bacteria | 92818 |
| 183 | Ga0163162_10223361 | 3300013306 | Bacteria | 2013 |
| 184 | Ga0163162_10614266 | 3300013306 | Bacteria | 1213 |
| 185 | Ga0157372_10003177 | 3300013307 | Bacteria | 17720 |
| 186 | Ga0157372_10551341 | 3300013307 | Bacteria | 1344 |
| 187 | Ga0157372_10771673 | 3300013307 | Bacteria | 1117 |
| 188 | Ga0157375_10002479 | 3300013308 | Bacteria | 15981 |
| 189 | Ga0157375_10002644 | 3300013308 | Bacteria | 15517 |
| 190 | Ga0157375_10231135 | 3300013308 | Bacteria | 2008 |
| 191 | Ga0157375_10237035 | 3300013308 | Bacteria | 1984 |
| 192 | Ga0163163_10000230 | 3300014325 | Bacteria | 57639 |
| 193 | Ga0182008_10000074 | 3300014497 | Bacteria | 78116 |
| 194 | Ga0182008_10001296 | 3300014497 | Bacteria | 17080 |
| 195 | Ga0182008_10001314 | 3300014497 | Bacteria | 16980 |
| 196 | Ga0182008_10002229 | 3300014497 | Bacteria | 12278 |
| 197 | Ga0182008_10002908 | 3300014497 | Bacteria | 10599 |
| 198 | Ga0182008_10014512 | 3300014497 | Bacteria | 4125 |
| 199 | Ga0182008_10104963 | 3300014497 | Bacteria | 1398 |
| 200 | Ga0182008_10127260 | 3300014497 | Bacteria | 1269 |
| 201 | Ga0182006_1000183 | 3300015261 | Bacteria | 65112 |
| 202 | Ga0182006_1000326 | 3300015261 | Bacteria | 41249 |
| 203 | Ga0182006_1000780 | 3300015261 | Bacteria | 21588 |
| 204 | Ga0182006_1001649 | 3300015261 | Bacteria | 13155 |
| 205 | Ga0182006_1011937 | 3300015261 | Bacteria | 3804 |
| 206 | Ga0182006_1045388 | 3300015261 | Bacteria | 1710 |
| 207 | Ga0182006_1049914 | 3300015261 | Bacteria | 1614 |
| 208 | Ga0182006_1059794 | 3300015261 | Bacteria | 1441 |
| 209 | Ga0182006_1061523 | 3300015261 | Bacteria | 1415 |
| 210 | Ga0182007_10000903 | 3300015262 | Bacteria | 16420 |
| 211 | Ga0182007_10005553 | 3300015262 | Bacteria | 5521 |
| 212 | Ga0182007_10023350 | 3300015262 | Bacteria | 2174 |
| 213 | Ga0182005_1000308 | 3300015265 | Bacteria | 29493 |
| 214 | Ga0182005_1002027 | 3300015265 | Bacteria | 7603 |
| 215 | Ga0182005_1033783 | 3300015265 | Bacteria | 1391 |
| 216 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 217 | Ga0163161_10000904 | 3300017792 | Bacteria | 22947 |
| 218 | Ga0163161_10001710 | 3300017792 | Bacteria | 16106 |
| 219 | Ga0163161_10003054 | 3300017792 | Bacteria | 11806 |
| 220 | Ga0163161_10004486 | 3300017792 | Bacteria | 9711 |
| 221 | Ga0163161_10006348 | 3300017792 | Bacteria | 8179 |
| 222 | Ga0163161_10016314 | 3300017792 | Bacteria | 5185 |
| 223 | Ga0163161_10031180 | 3300017792 | Bacteria | 3797 |
| 224 | Ga0163161_10045349 | 3300017792 | Bacteria | 3170 |
| 225 | Ga0163161_10171959 | 3300017792 | Bacteria | 1657 |
| 226 | Ga0163161_10180818 | 3300017792 | Bacteria | 1617 |
| 227 | Ga0163161_10256455 | 3300017792 | Bacteria | 1364 |
| 228 | Ga0209760_100043 | 3300025207 | Bacteria | 113964 |
| 229 | Ga0209760_100054 | 3300025207 | Bacteria | 102021 |
| 230 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 231 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 232 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 233 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 234 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 235 | Ga0209563_101021 | 3300025230 | Bacteria | 8148 |
| 236 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 237 | Ga0207427_100074 | 3300025231 | Bacteria | 153455 |
| 238 | Ga0207427_100123 | 3300025231 | Bacteria | 98859 |
| 239 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 240 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 241 | Ga0209437_100227 | 3300025233 | Bacteria | 98939 |
| 242 | Ga0209258_100490 | 3300025242 | Bacteria | 40292 |
| 243 | Ga0209646_1000383 | 3300025246 | Bacteria | 28428 |
| 244 | Ga0209677_100121 | 3300025253 | Bacteria | 80378 |
| 245 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 246 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 247 | Ga0209233_1000283 | 3300025261 | Bacteria | 70137 |
| 248 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 249 | Ga0209565_1009632 | 3300025263 | Bacteria | 2435 |
| 250 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 251 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 252 | Ga0209675_1003706 | 3300025291 | Bacteria | 7110 |
| 253 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 254 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 255 | Ga0209676_1000223 | 3300025292 | Bacteria | 124359 |
| 256 | Ga0209676_1000814 | 3300025292 | Bacteria | 40784 |
| 257 | Ga0209676_1003220 | 3300025292 | Bacteria | 10312 |
| 258 | Ga0209676_1003238 | 3300025292 | Bacteria | 10269 |
| 259 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 260 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 261 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 262 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 263 | Ga0209050_1000214 | 3300025298 | Bacteria | 129270 |
| 264 | Ga0209050_1000363 | 3300025298 | Bacteria | 86923 |
| 265 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 266 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 267 | Ga0209051_1000171 | 3300025303 | Bacteria | 118013 |
| 268 | Ga0209051_1000185 | 3300025303 | Bacteria | 110195 |
| 269 | Ga0209051_1013055 | 3300025303 | Bacteria | 3975 |
| 270 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 271 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 272 | Ga0209257_1000704 | 3300025304 | Bacteria | 51740 |
| 273 | Ga0209257_1015109 | 3300025304 | Bacteria | 3246 |
| 274 | Ga0207656_10000293 | 3300025321 | Bacteria | 17271 |
| 275 | Ga0207696_1000019 | 3300025711 | Bacteria | 476309 |
| 276 | Ga0207696_1000171 | 3300025711 | Bacteria | 102599 |
| 277 | Ga0207696_1000193 | 3300025711 | Bacteria | 94161 |
| 278 | Ga0207696_1002275 | 3300025711 | Bacteria | 9544 |
| 279 | Ga0207696_1005730 | 3300025711 | Bacteria | 5109 |
| 280 | Ga0207696_1020095 | 3300025711 | Bacteria | 2160 |
| 281 | Ga0207696_1035442 | 3300025711 | Bacteria | 1486 |
| 282 | Ga0207696_1040762 | 3300025711 | Bacteria | 1359 |
| 283 | Ga0207696_1057904 | 3300025711 | Bacteria | 1095 |
| 284 | Ga0207655_1000035 | 3300025728 | Bacteria | 359016 |
| 285 | Ga0207655_1000148 | 3300025728 | Bacteria | 130207 |
| 286 | Ga0207655_1000337 | 3300025728 | Bacteria | 68266 |
| 287 | Ga0207655_1000505 | 3300025728 | Bacteria | 49919 |
| 288 | Ga0207655_1000653 | 3300025728 | Bacteria | 41243 |
| 289 | Ga0207655_1001230 | 3300025728 | Bacteria | 24612 |
| 290 | Ga0207655_1002593 | 3300025728 | Bacteria | 14397 |
| 291 | Ga0207655_1002863 | 3300025728 | Bacteria | 13331 |
| 292 | Ga0207655_1004590 | 3300025728 | Bacteria | 9724 |
| 293 | Ga0207655_1004674 | 3300025728 | Bacteria | 9601 |
| 294 | Ga0207655_1005605 | 3300025728 | Bacteria | 8499 |
| 295 | Ga0207655_1007998 | 3300025728 | Bacteria | 6780 |
| 296 | Ga0207655_1013184 | 3300025728 | Bacteria | 4763 |
| 297 | Ga0207655_1015844 | 3300025728 | Bacteria | 4162 |
| 298 | Ga0207655_1018376 | 3300025728 | Bacteria | 3711 |
| 299 | Ga0207655_1026645 | 3300025728 | Bacteria | 2772 |
| 300 | Ga0207655_1035410 | 3300025728 | Bacteria | 2229 |
| 301 | Ga0207655_1053930 | 3300025728 | Bacteria | 1603 |
| 302 | Ga0207655_1059869 | 3300025728 | Bacteria | 1479 |
| 303 | Ga0207713_1000236 | 3300025735 | Bacteria | 73781 |
| 304 | Ga0207713_1000243 | 3300025735 | Bacteria | 70146 |
| 305 | Ga0207713_1000431 | 3300025735 | Bacteria | 44260 |
| 306 | Ga0207713_1000703 | 3300025735 | Bacteria | 31288 |
| 307 | Ga0207713_1001217 | 3300025735 | Bacteria | 21481 |
| 308 | Ga0207713_1003210 | 3300025735 | Bacteria | 11287 |
| 309 | Ga0207713_1003232 | 3300025735 | Bacteria | 11247 |
| 310 | Ga0207713_1003636 | 3300025735 | Bacteria | 10381 |
| 311 | Ga0207713_1003777 | 3300025735 | Bacteria | 10156 |
| 312 | Ga0207713_1006282 | 3300025735 | Bacteria | 7263 |
| 313 | Ga0207713_1019400 | 3300025735 | Bacteria | 3328 |
| 314 | Ga0207713_1026206 | 3300025735 | Bacteria | 2676 |
| 315 | Ga0207713_1040741 | 3300025735 | Bacteria | 1945 |
| 316 | Ga0207713_1064963 | 3300025735 | Bacteria | 1371 |
| 317 | Ga0207710_10000931 | 3300025900 | Bacteria | 15578 |
| 318 | Ga0207710_10005328 | 3300025900 | Bacteria | 5550 |
| 319 | Ga0207680_10024454 | 3300025903 | Bacteria | 3316 |
| 320 | Ga0207647_10002137 | 3300025904 | Bacteria | 15112 |
| 321 | Ga0207705_10014588 | 3300025909 | Bacteria | 5654 |
| 322 | Ga0207695_10126190 | 3300025913 | Bacteria | 2521 |
| 323 | Ga0207671_10000163 | 3300025914 | Bacteria | 103443 |
| 324 | Ga0207657_10028191 | 3300025919 | Bacteria | 5128 |
| 325 | Ga0207649_10000068 | 3300025920 | Bacteria | 91623 |
| 326 | Ga0207649_10005532 | 3300025920 | Bacteria | 6839 |
| 327 | Ga0207681_10000156 | 3300025923 | Bacteria | 56382 |
| 328 | Ga0207681_10000491 | 3300025923 | Bacteria | 27650 |
| 329 | Ga0207681_10070368 | 3300025923 | Bacteria | 2436 |
| 330 | Ga0207650_10000106 | 3300025925 | Bacteria | 110058 |
| 331 | Ga0207650_10000174 | 3300025925 | Bacteria | 75634 |
| 332 | Ga0207650_10004052 | 3300025925 | Bacteria | 10017 |
| 333 | Ga0207664_10000036 | 3300025929 | Bacteria | 173396 |
| 334 | Ga0207644_10000312 | 3300025931 | Bacteria | 31641 |
| 335 | Ga0207706_10001634 | 3300025933 | Bacteria | 22204 |
| 336 | Ga0207706_10018376 | 3300025933 | Bacteria | 6291 |
| 337 | Ga0207706_10110584 | 3300025933 | Bacteria | 2417 |
| 338 | Ga0207686_10007022 | 3300025934 | Bacteria | 6059 |
| 339 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 340 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 341 | Ga0207709_10000283 | 3300025935 | Bacteria | 57947 |
| 342 | Ga0207709_10005739 | 3300025935 | Bacteria | 7012 |
| 343 | Ga0207709_10009435 | 3300025935 | Bacteria | 5370 |
| 344 | Ga0207709_10468910 | 3300025935 | Bacteria | 977 |
| 345 | Ga0207711_10001196 | 3300025941 | Bacteria | 24599 |
| 346 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 347 | Ga0207667_10001738 | 3300025949 | Bacteria | 27400 |
| 348 | Ga0207712_10042824 | 3300025961 | Bacteria | 3120 |
| 349 | Ga0207658_10000073 | 3300025986 | Bacteria | 111738 |
| 350 | Ga0207703_10209064 | 3300026035 | Bacteria | 1739 |
| 351 | Ga0207639_10005291 | 3300026041 | Bacteria | 8709 |
| 352 | Ga0207702_10009573 | 3300026078 | Bacteria | 8135 |
| 353 | Ga0207641_10108168 | 3300026088 | Bacteria | 2460 |
| 354 | Ga0207641_10114991 | 3300026088 | Bacteria | 2391 |
| 355 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 356 | Ga0207674_10045305 | 3300026116 | Bacteria | 4525 |
| 357 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 358 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 359 | Ga0209281_1003883 | 3300027111 | Bacteria | 4690 |
| 360 | Ga0209389_1000183 | 3300027296 | Bacteria | 48155 |
| 361 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 362 | Ga0209282_1084162 | 3300027666 | Bacteria | 1689 |
| 363 | Ga0207428_10079005 | 3300027907 | Bacteria | 2573 |
| 364 | Ga0207428_10082776 | 3300027907 | Bacteria | 2504 |
| 365 | Ga0268266_10011671 | 3300028379 | Bacteria | 7626 |
| 366 | Ga0268265_10001641 | 3300028380 | Bacteria | 18332 |
| 367 | Ga0268265_10300420 | 3300028380 | Bacteria | 1445 |
| 368 | Ga0307517_10032127 | 3300028786 | Bacteria | 6080 |
| 369 | Ga0307515_10217506 | 3300028794 | Bacteria | 1738 |
| 370 | Ga0265324_10000297 | 3300029957 | Bacteria | 36970 |
| 371 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 372 | Ga0307511_10104950 | 3300030521 | Bacteria | 1832 |
| 373 | Ga0316179_1111071 | 3300030734 | Bacteria | 3080 |
| 374 | Ga0316178_1101239 | 3300030735 | Bacteria | 23092 |
| 375 | Ga0316181_1090174 | 3300030744 | Bacteria | 14092 |
| 376 | Ga0265331_10008951 | 3300031250 | Bacteria | 5657 |
| 377 | Ga0265327_10001967 | 3300031251 | Bacteria | 23494 |
| 378 | Ga0307513_10072433 | 3300031456 | Bacteria | 3591 |
| 379 | Ga0307408_100000081 | 3300031548 | Bacteria | 106920 |
| 380 | Ga0307408_100003463 | 3300031548 | Bacteria | 10789 |
| 381 | Ga0307408_100006501 | 3300031548 | Bacteria | 7752 |
| 382 | Ga0307408_100016487 | 3300031548 | Bacteria | 4932 |
| 383 | Ga0307408_100184706 | 3300031548 | Bacteria | 1675 |
| 384 | Ga0307408_100245987 | 3300031548 | Bacteria | 1472 |
| 385 | Ga0307408_100259451 | 3300031548 | Bacteria | 1437 |
| 386 | Ga0265314_10029286 | 3300031711 | Bacteria | 4095 |
| 387 | Ga0307405_10000154 | 3300031731 | Bacteria | 26250 |
| 388 | Ga0307405_10038238 | 3300031731 | Bacteria | 2890 |
| 389 | Ga0307405_10174571 | 3300031731 | Bacteria | 1536 |
| 390 | Ga0307405_10178476 | 3300031731 | Bacteria | 1522 |
| 391 | Ga0307413_10020405 | 3300031824 | Bacteria | 3523 |
| 392 | Ga0307406_10033549 | 3300031901 | Bacteria | 3143 |
| 393 | Ga0307406_10119493 | 3300031901 | Bacteria | 1829 |
| 394 | Ga0307406_10522625 | 3300031901 | Bacteria | 966 |
| 395 | Ga0307407_10025106 | 3300031903 | Bacteria | 3136 |
| 396 | Ga0307412_10000455 | 3300031911 | Bacteria | 24651 |
| 397 | Ga0307412_10013685 | 3300031911 | Bacteria | 4765 |
| 398 | Ga0307412_10018233 | 3300031911 | Bacteria | 4219 |
| 399 | Ga0307412_10164765 | 3300031911 | Bacteria | 1651 |
| 400 | Ga0307412_10404310 | 3300031911 | Bacteria | 1112 |
| 401 | Ga0307409_100054401 | 3300031995 | Bacteria | 3082 |
| 402 | Ga0307416_100320190 | 3300032002 | Bacteria | 1552 |
| 403 | Ga0307414_10001581 | 3300032004 | Bacteria | 11819 |
| 404 | Ga0307414_10003099 | 3300032004 | Bacteria | 8828 |
| 405 | Ga0307414_10013524 | 3300032004 | Bacteria | 4862 |
| 406 | Ga0307414_10102705 | 3300032004 | Bacteria | 2155 |
| 407 | Ga0307414_10210395 | 3300032004 | Bacteria | 1589 |
| 408 | Ga0307414_10234484 | 3300032004 | Bacteria | 1515 |
| 409 | Ga0307414_10277994 | 3300032004 | Bacteria | 1405 |
| 410 | Ga0307411_10096674 | 3300032005 | Bacteria | 2076 |
| 411 | Ga0307510_10001867 | 3300033180 | Bacteria | 23626 |
| 412 | Ga0395900_0275928 | 3300037418 | Bacteria | 1675 |
| 413 | Ga0395901_0003337 | 3300038443 | Bacteria | 16171 |
| 414 | Ga0237819_01027 | 3300038705 | Bacteria | 8377 |
| 415 | Ga0439438_000117 | 3300041405 | Bacteria | 36333 |
| 416 | Ga0439438_000138 | 3300041405 | Bacteria | 33094 |
| 417 | Ga0439438_000173 | 3300041405 | Bacteria | 28731 |
| 418 | Ga0439438_000239 | 3300041405 | Bacteria | 24317 |
| 419 | Ga0439438_000256 | 3300041405 | Bacteria | 23743 |
| 420 | Ga0439438_000363 | 3300041405 | Bacteria | 20308 |
| 421 | Ga0439438_000507 | 3300041405 | Bacteria | 17682 |
| 422 | Ga0439438_002416 | 3300041405 | Bacteria | 7957 |
| 423 | Ga0439438_004071 | 3300041405 | Bacteria | 5726 |
| 424 | Ga0439438_004981 | 3300041405 | Bacteria | 4960 |
| 425 | Ga0439438_005177 | 3300041405 | Bacteria | 4841 |
| 426 | Ga0439447_000140 | 3300041407 | Bacteria | 24638 |
| 427 | Ga0439447_000329 | 3300041407 | Bacteria | 17069 |
| 428 | Ga0439447_000342 | 3300041407 | Bacteria | 16803 |
| 429 | Ga0439447_000407 | 3300041407 | Bacteria | 15876 |
| 430 | Ga0439447_014373 | 3300041407 | Bacteria | 2222 |
| 431 | Ga0439447_015791 | 3300041407 | Bacteria | 2088 |
| 432 | Ga0439447_033029 | 3300041407 | Bacteria | 1291 |
| 433 | Ga0439466_0000132 | 3300041411 | Bacteria | 29242 |
| 434 | Ga0439466_0000162 | 3300041411 | Bacteria | 26711 |
| 435 | Ga0439466_0000743 | 3300041411 | Bacteria | 12349 |
| 436 | Ga0439466_0000788 | 3300041411 | Bacteria | 12036 |
| 437 | Ga0439466_0001964 | 3300041411 | Bacteria | 8060 |
| 438 | Ga0439466_0002036 | 3300041411 | Bacteria | 7929 |
| 439 | Ga0439466_0002608 | 3300041411 | Bacteria | 7055 |
| 440 | Ga0439466_0003203 | 3300041411 | Bacteria | 6371 |
| 441 | Ga0439466_0008029 | 3300041411 | Bacteria | 3979 |
| 442 | Ga0439466_0009942 | 3300041411 | Bacteria | 3539 |
| 443 | Ga0439466_0010992 | 3300041411 | Bacteria | 3355 |
| 444 | Ga0439466_0021770 | 3300041411 | Bacteria | 2268 |
| 445 | Ga0439466_0021989 | 3300041411 | Bacteria | 2254 |
| 446 | Ga0439466_0032499 | 3300041411 | Bacteria | 1778 |
| 447 | Ga0439466_0033826 | 3300041411 | Bacteria | 1735 |
| 448 | Ga0451791_1891926 | 3300041451 | Bacteria | 1569 |
| 449 | Ga0451802_1143217 | 3300041460 | Bacteria | 1124 |
| 450 | Ga0451843_0211047 | 3300041509 | Bacteria | 1488 |
| 451 | Ga0439431_0000105 | 3300041997 | Bacteria | 14310 |
| 452 | Ga0439431_0021791 | 3300041997 | Bacteria | 1540 |
| 453 | Ga0439437_002196 | 3300042000 | Bacteria | 2077 |
| 454 | Ga0439445_0004866 | 3300042004 | Bacteria | 3050 |
| 455 | Ga0439445_0013118 | 3300042004 | Bacteria | 2003 |
| 456 | Ga0439432_000089 | 3300042006 | Bacteria | 28832 |
| 457 | Ga0439432_000221 | 3300042006 | Bacteria | 20475 |
| 458 | Ga0439432_001589 | 3300042006 | Bacteria | 8497 |
| 459 | Ga0439432_001874 | 3300042006 | Bacteria | 7909 |
| 460 | Ga0439432_002497 | 3300042006 | Bacteria | 6930 |
| 461 | Ga0439432_002504 | 3300042006 | Bacteria | 6921 |
| 462 | Ga0439432_004120 | 3300042006 | Bacteria | 5312 |
| 463 | Ga0439432_010913 | 3300042006 | Bacteria | 3135 |
| 464 | Ga0439432_037642 | 3300042006 | Bacteria | 1543 |
| 465 | Ga0439451_000109 | 3300042009 | Bacteria | 14909 |
| 466 | Ga0439451_000212 | 3300042009 | Bacteria | 11268 |
| 467 | Ga0439451_000301 | 3300042009 | Bacteria | 9543 |
| 468 | Ga0439451_004702 | 3300042009 | Bacteria | 2776 |
| 469 | Ga0439452_000091 | 3300042010 | Bacteria | 78007 |
| 470 | Ga0439452_000164 | 3300042010 | Bacteria | 49561 |
| 471 | Ga0439452_000322 | 3300042010 | Bacteria | 30011 |
| 472 | Ga0439452_000524 | 3300042010 | Bacteria | 20546 |
| 473 | Ga0439452_001381 | 3300042010 | Bacteria | 9997 |
| 474 | Ga0439452_001571 | 3300042010 | Bacteria | 9102 |
| 475 | Ga0439452_002476 | 3300042010 | Bacteria | 6790 |
| 476 | Ga0439452_016994 | 3300042010 | Bacteria | 1966 |
| 477 | Ga0439452_031882 | 3300042010 | Bacteria | 1290 |
| 478 | Ga0439452_032230 | 3300042010 | Bacteria | 1281 |
| 479 | Ga0439456_000045 | 3300042013 | Bacteria | 44106 |
| 480 | Ga0439456_000591 | 3300042013 | Bacteria | 7601 |
| 481 | Ga0439456_001443 | 3300042013 | Bacteria | 4775 |
| 482 | Ga0439456_002921 | 3300042013 | Bacteria | 3455 |
| 483 | Ga0439456_007095 | 3300042013 | Bacteria | 2295 |
| 484 | Ga0439456_026218 | 3300042013 | Bacteria | 1239 |
| 485 | Ga0439463_000018 | 3300042016 | Bacteria | 36280 |
| 486 | Ga0439463_001447 | 3300042016 | Bacteria | 6306 |
| 487 | Ga0439463_003061 | 3300042016 | Bacteria | 4248 |
| 488 | Ga0439463_007616 | 3300042016 | Bacteria | 2671 |
| 489 | Ga0439463_025793 | 3300042016 | Bacteria | 1475 |
| 490 | Ga0439463_028765 | 3300042016 | Bacteria | 1401 |
| 491 | Ga0439463_029075 | 3300042016 | Bacteria | 1392 |
| 492 | Ga0450911_000025 | 3300042115 | Bacteria | 83941 |
| 493 | Ga0450911_000285 | 3300042115 | Bacteria | 18702 |
| 494 | Ga0450911_003117 | 3300042115 | Bacteria | 3013 |
| 495 | Ga0450919_000038 | 3300042121 | Bacteria | 11241 |
| 496 | Ga0450919_007800 | 3300042121 | Bacteria | 1246 |
| 497 | Ga0450920_000199 | 3300042122 | Bacteria | 8718 |
| 498 | Ga0450890_000152 | 3300042127 | Bacteria | 10857 |
| 499 | Ga0450891_001459 | 3300042129 | Bacteria | 2439 |
| 500 | Ga0450900_000722 | 3300042136 | Bacteria | 2812 |
| 501 | Ga0450902_001746 | 3300042137 | Bacteria | 3000 |
| 502 | Ga0450902_003138 | 3300042137 | Bacteria | 2391 |
| 503 | Ga0450902_003286 | 3300042137 | Bacteria | 2354 |
| 504 | Ga0450902_005800 | 3300042137 | Bacteria | 1879 |
| 505 | Ga0450902_010143 | 3300042137 | Bacteria | 1489 |
| 506 | Ga0450903_000362 | 3300042138 | Bacteria | 9999 |
| 507 | Ga0450903_001182 | 3300042138 | Bacteria | 4920 |
| 508 | Ga0450904_000293 | 3300042139 | Bacteria | 10833 |
| 509 | Ga0450904_000791 | 3300042139 | Bacteria | 5359 |
| 510 | Ga0450905_000727 | 3300042142 | Bacteria | 4029 |
| 511 | Ga0450905_003680 | 3300042142 | Bacteria | 2015 |
| 512 | Ga0450906_000028 | 3300042145 | Bacteria | 24042 |
| 513 | Ga0450906_004054 | 3300042145 | Bacteria | 3098 |
| 514 | Ga0450907_000038 | 3300042146 | Bacteria | 57421 |
| 515 | Ga0450907_000289 | 3300042146 | Bacteria | 16974 |
| 516 | Ga0450910_000392 | 3300042147 | Bacteria | 5166 |
| 517 | Ga0450910_001305 | 3300042147 | Bacteria | 3118 |
| 518 | Ga0439446_0000090 | 3300042156 | Bacteria | 15301 |
| 519 | Ga0439446_0000409 | 3300042156 | Bacteria | 8321 |
| 520 | Ga0439446_0026693 | 3300042156 | Bacteria | 1655 |
| 521 | Ga0450908_000046 | 3300042184 | Bacteria | 24524 |
| 522 | Ga0450909_000105 | 3300042185 | Bacteria | 8367 |
| 523 | Ga0450909_001359 | 3300042185 | Bacteria | 3398 |
| 524 | Ga0450909_013840 | 3300042185 | Bacteria | 1187 |
| 525 | Ga0439434_0000034 | 3300042435 | Bacteria | 32792 |
| 526 | Ga0439434_0000277 | 3300042435 | Bacteria | 14702 |
| 527 | Ga0439434_0007412 | 3300042435 | Bacteria | 3216 |
| 528 | Ga0439464_0001412 | 3300042439 | Bacteria | 5641 |
| 529 | Ga0439464_0061057 | 3300042439 | Bacteria | 1103 |
| 530 | Ga0439460_0000015 | 3300042461 | Bacteria | 25118 |
| 531 | Ga0439460_0000042 | 3300042461 | Bacteria | 18550 |
| 532 | Ga0439460_0000776 | 3300042461 | Bacteria | 7195 |
| 533 | Ga0450918_000605 | 3300042531 | Bacteria | 7701 |
| 534 | Ga0450918_016410 | 3300042531 | Bacteria | 1287 |
| 535 | Ga0450893_0004947 | 3300042532 | Bacteria | 2128 |
| 536 | Ga0450901_000332 | 3300042533 | Bacteria | 5784 |
| 537 | Ga0495617_000212 | 3300046452 | Bacteria | 35622 |
| 538 | Ga0495617_001755 | 3300046452 | Bacteria | 9259 |
| 539 | Ga0495617_002016 | 3300046452 | Bacteria | 8455 |
| 540 | Ga0495617_004691 | 3300046452 | Bacteria | 4942 |
| 541 | Ga0495617_007689 | 3300046452 | Bacteria | 3728 |
| 542 | Ga0495617_011768 | 3300046452 | Bacteria | 2984 |
| 543 | Ga0495617_018731 | 3300046452 | Bacteria | 2341 |
| 544 | Ga0495617_035688 | 3300046452 | Bacteria | 1669 |
| 545 | Ga0495617_048361 | 3300046452 | Bacteria | 1415 |
| 546 | Ga0495617_055422 | 3300046452 | Bacteria | 1315 |
| 547 | Ga0495627_000362 | 3300046453 | Bacteria | 42515 |
| 548 | Ga0495627_000447 | 3300046453 | Bacteria | 35930 |
| 549 | Ga0495627_000546 | 3300046453 | Bacteria | 31074 |
| 550 | Ga0495627_000709 | 3300046453 | Bacteria | 25383 |
| 551 | Ga0495627_001245 | 3300046453 | Bacteria | 15801 |
| 552 | Ga0495627_002123 | 3300046453 | Bacteria | 10005 |
| 553 | Ga0495627_002337 | 3300046453 | Bacteria | 9293 |
| 554 | Ga0495627_016192 | 3300046453 | Bacteria | 2557 |
| 555 | Ga0495627_034333 | 3300046453 | Bacteria | 1585 |
| 556 | Ga0495627_039660 | 3300046453 | Bacteria | 1452 |
| 557 | Ga0495627_052048 | 3300046453 | Bacteria | 1229 |
| 558 | Ga0495592_0005799 | 3300046454 | Bacteria | 9154 |
| 559 | Ga0495603_0003172 | 3300046455 | Bacteria | 9774 |
| 560 | Ga0495603_0021379 | 3300046455 | Bacteria | 3918 |
| 561 | Ga0495603_0048503 | 3300046455 | Bacteria | 2528 |
| 562 | Ga0495590_0000265 | 3300046457 | Bacteria | 28527 |
| 563 | Ga0495590_0001638 | 3300046457 | Bacteria | 9569 |
| 564 | Ga0495590_0001639 | 3300046457 | Bacteria | 9565 |
| 565 | Ga0495590_0003337 | 3300046457 | Bacteria | 6567 |
| 566 | Ga0495590_0026001 | 3300046457 | Bacteria | 2056 |
| 567 | Ga0495590_0033137 | 3300046457 | Bacteria | 1806 |
| 568 | Ga0495590_0047250 | 3300046457 | Bacteria | 1501 |
| 569 | Ga0495591_000107 | 3300046458 | Bacteria | 95742 |
| 570 | Ga0495591_000114 | 3300046458 | Bacteria | 93304 |
| 571 | Ga0495591_000510 | 3300046458 | Bacteria | 30508 |
| 572 | Ga0495591_000564 | 3300046458 | Bacteria | 28477 |
| 573 | Ga0495591_001029 | 3300046458 | Bacteria | 18870 |
| 574 | Ga0495591_001088 | 3300046458 | Bacteria | 18090 |
| 575 | Ga0495591_001477 | 3300046458 | Bacteria | 14540 |
| 576 | Ga0495591_001675 | 3300046458 | Bacteria | 13318 |
| 577 | Ga0495591_001731 | 3300046458 | Bacteria | 13007 |
| 578 | Ga0495591_002868 | 3300046458 | Bacteria | 9260 |
| 579 | Ga0495591_003614 | 3300046458 | Bacteria | 7876 |
| 580 | Ga0495591_005843 | 3300046458 | Bacteria | 5593 |
| 581 | Ga0495591_010336 | 3300046458 | Bacteria | 3625 |
| 582 | Ga0495591_014326 | 3300046458 | Bacteria | 2856 |
| 583 | Ga0495591_019943 | 3300046458 | Bacteria | 2229 |
| 584 | Ga0495591_029694 | 3300046458 | Bacteria | 1658 |
| 585 | Ga0495591_032121 | 3300046458 | Bacteria | 1566 |
| 586 | Ga0495591_033899 | 3300046458 | Bacteria | 1507 |
| 587 | Ga0495629_0024544 | 3300046459 | Bacteria | 4294 |
| 588 | Ga0495629_0273021 | 3300046459 | Bacteria | 1161 |
| 589 | Ga0495638_0000991 | 3300046460 | Bacteria | 28569 |
| 590 | Ga0495638_0001231 | 3300046460 | Bacteria | 24226 |
| 591 | Ga0495638_0001573 | 3300046460 | Bacteria | 20449 |
| 592 | Ga0495638_0002232 | 3300046460 | Bacteria | 16092 |
| 593 | Ga0495638_0003134 | 3300046460 | Bacteria | 13085 |
| 594 | Ga0495638_0003343 | 3300046460 | Bacteria | 12655 |
| 595 | Ga0495638_0004346 | 3300046460 | Bacteria | 10737 |
| 596 | Ga0495638_0010611 | 3300046460 | Bacteria | 6380 |
| 597 | Ga0495638_0017083 | 3300046460 | Bacteria | 4846 |
| 598 | Ga0495638_0019886 | 3300046460 | Bacteria | 4439 |
| 599 | Ga0495638_0026591 | 3300046460 | Bacteria | 3749 |
| 600 | Ga0495638_0027711 | 3300046460 | Bacteria | 3665 |
| 601 | Ga0495638_0028671 | 3300046460 | Bacteria | 3592 |
| 602 | Ga0495638_0030254 | 3300046460 | Bacteria | 3487 |
| 603 | Ga0495638_0053624 | 3300046460 | Bacteria | 2509 |
| 604 | Ga0495638_0148070 | 3300046460 | Bacteria | 1364 |
| 605 | Ga0495653_0000788 | 3300046463 | Bacteria | 24319 |
| 606 | Ga0495653_0002108 | 3300046463 | Bacteria | 15682 |
| 607 | Ga0495653_0011081 | 3300046463 | Bacteria | 7370 |
| 608 | Ga0495653_0012237 | 3300046463 | Bacteria | 6999 |
| 609 | Ga0495650_0001300 | 3300046471 | Bacteria | 25374 |
| 610 | Ga0495650_0001590 | 3300046471 | Bacteria | 21304 |
| 611 | Ga0495650_0001706 | 3300046471 | Bacteria | 20187 |
| 612 | Ga0495650_0002399 | 3300046471 | Bacteria | 15295 |
| 613 | Ga0495650_0002419 | 3300046471 | Bacteria | 15176 |
| 614 | Ga0495650_0006965 | 3300046471 | Bacteria | 6911 |
| 615 | Ga0495650_0007104 | 3300046471 | Bacteria | 6800 |
| 616 | Ga0495650_0010355 | 3300046471 | Bacteria | 5210 |
| 617 | Ga0495650_0012083 | 3300046471 | Bacteria | 4670 |
| 618 | Ga0495650_0012952 | 3300046471 | Bacteria | 4447 |
| 619 | Ga0495650_0021128 | 3300046471 | Bacteria | 3154 |
| 620 | Ga0495650_0023898 | 3300046471 | Bacteria | 2897 |
| 621 | Ga0495580_0139791 | 3300046472 | Bacteria | 1678 |
| 622 | Ga0495582_0026353 | 3300046473 | Bacteria | 3186 |
| 623 | Ga0495605_0000017 | 3300046474 | Bacteria | 273775 |
| 624 | Ga0495605_0000026 | 3300046474 | Bacteria | 221832 |
| 625 | Ga0495605_0000105 | 3300046474 | Bacteria | 105544 |
| 626 | Ga0495605_0000220 | 3300046474 | Bacteria | 70521 |
| 627 | Ga0495605_0000527 | 3300046474 | Bacteria | 32320 |
| 628 | Ga0495605_0000771 | 3300046474 | Bacteria | 23130 |
| 629 | Ga0495605_0002351 | 3300046474 | Bacteria | 11774 |
| 630 | Ga0495605_0003511 | 3300046474 | Bacteria | 9319 |
| 631 | Ga0495605_0008134 | 3300046474 | Bacteria | 5931 |
| 632 | Ga0495605_0011041 | 3300046474 | Bacteria | 5046 |
| 633 | Ga0495605_0011331 | 3300046474 | Bacteria | 4978 |
| 634 | Ga0495605_0012790 | 3300046474 | Bacteria | 4645 |
| 635 | Ga0495605_0015222 | 3300046474 | Bacteria | 4190 |
| 636 | Ga0495605_0032978 | 3300046474 | Bacteria | 2633 |
| 637 | Ga0495605_0123154 | 3300046474 | Bacteria | 1174 |
| 638 | Ga0495605_0161284 | 3300046474 | Bacteria | 995 |
| 639 | Ga0495639_0000013 | 3300046475 | Bacteria | 83505 |
| 640 | Ga0495639_0003712 | 3300046475 | Bacteria | 6571 |
| 641 | Ga0495664_0247964 | 3300046477 | Bacteria | 1077 |
| 642 | Ga0495584_0000278 | 3300046491 | Bacteria | 36319 |
| 643 | Ga0495584_0000387 | 3300046491 | Bacteria | 30269 |
| 644 | Ga0495584_0001274 | 3300046491 | Bacteria | 15340 |
| 645 | Ga0495584_0001924 | 3300046491 | Bacteria | 11940 |
| 646 | Ga0495584_0002861 | 3300046491 | Bacteria | 9639 |
| 647 | Ga0495584_0005446 | 3300046491 | Bacteria | 6744 |
| 648 | Ga0495584_0007713 | 3300046491 | Bacteria | 5602 |
| 649 | Ga0495584_0007797 | 3300046491 | Bacteria | 5569 |
| 650 | Ga0495584_0010038 | 3300046491 | Bacteria | 4860 |
| 651 | Ga0495584_0028688 | 3300046491 | Bacteria | 2821 |
| 652 | Ga0495584_0031935 | 3300046491 | Bacteria | 2665 |
| 653 | Ga0495584_0050768 | 3300046491 | Bacteria | 2088 |
| 654 | Ga0495584_0112683 | 3300046491 | Bacteria | 1376 |
| 655 | Ga0495585_0000517 | 3300046492 | Bacteria | 36490 |
| 656 | Ga0495585_0001652 | 3300046492 | Bacteria | 17059 |
| 657 | Ga0495585_0001662 | 3300046492 | Bacteria | 17002 |
| 658 | Ga0495585_0002225 | 3300046492 | Bacteria | 14052 |
| 659 | Ga0495585_0010737 | 3300046492 | Bacteria | 5439 |
| 660 | Ga0495585_0011757 | 3300046492 | Bacteria | 5173 |
| 661 | Ga0495585_0013369 | 3300046492 | Bacteria | 4807 |
| 662 | Ga0495585_0013745 | 3300046492 | Bacteria | 4730 |
| 663 | Ga0495585_0015029 | 3300046492 | Bacteria | 4501 |
| 664 | Ga0495585_0015780 | 3300046492 | Bacteria | 4386 |
| 665 | Ga0495585_0018382 | 3300046492 | Bacteria | 4032 |
| 666 | Ga0495585_0030948 | 3300046492 | Bacteria | 3042 |
| 667 | Ga0495585_0193086 | 3300046492 | Bacteria | 1040 |
| 668 | Ga0495594_0000140 | 3300046499 | Bacteria | 34465 |
| 669 | Ga0495594_0001728 | 3300046499 | Bacteria | 11329 |
| 670 | Ga0495594_0002505 | 3300046499 | Bacteria | 9566 |
| 671 | Ga0495594_0013395 | 3300046499 | Bacteria | 4282 |
| 672 | Ga0495596_0000107 | 3300046500 | Bacteria | 59095 |
| 673 | Ga0495596_0000805 | 3300046500 | Bacteria | 19001 |
| 674 | Ga0495596_0030167 | 3300046500 | Bacteria | 2171 |
| 675 | Ga0495596_0065907 | 3300046500 | Bacteria | 1408 |
| 676 | Ga0495596_0078758 | 3300046500 | Bacteria | 1279 |
| 677 | Ga0495596_0085338 | 3300046500 | Bacteria | 1225 |
| 678 | Ga0495607_0000013 | 3300046501 | Bacteria | 189755 |
| 679 | Ga0495607_0000022 | 3300046501 | Bacteria | 162516 |
| 680 | Ga0495607_0000159 | 3300046501 | Bacteria | 71580 |
| 681 | Ga0495607_0000309 | 3300046501 | Bacteria | 50842 |
| 682 | Ga0495607_0000481 | 3300046501 | Bacteria | 39927 |
| 683 | Ga0495607_0000840 | 3300046501 | Bacteria | 29047 |
| 684 | Ga0495607_0001111 | 3300046501 | Bacteria | 24385 |
| 685 | Ga0495607_0002005 | 3300046501 | Bacteria | 17079 |
| 686 | Ga0495607_0003922 | 3300046501 | Bacteria | 11209 |
| 687 | Ga0495607_0004541 | 3300046501 | Bacteria | 10189 |
| 688 | Ga0495607_0005301 | 3300046501 | Bacteria | 9270 |
| 689 | Ga0495607_0005426 | 3300046501 | Bacteria | 9132 |
| 690 | Ga0495607_0006347 | 3300046501 | Bacteria | 8330 |
| 691 | Ga0495607_0006901 | 3300046501 | Bacteria | 7917 |
| 692 | Ga0495607_0009223 | 3300046501 | Bacteria | 6702 |
| 693 | Ga0495607_0014841 | 3300046501 | Bacteria | 5062 |
| 694 | Ga0495607_0015338 | 3300046501 | Bacteria | 4969 |
| 695 | Ga0495607_0030346 | 3300046501 | Bacteria | 3320 |
| 696 | Ga0495607_0033184 | 3300046501 | Bacteria | 3142 |
| 697 | Ga0495607_0041669 | 3300046501 | Bacteria | 2725 |
| 698 | Ga0495607_0043446 | 3300046501 | Bacteria | 2657 |
| 699 | Ga0495607_0061470 | 3300046501 | Bacteria | 2134 |
| 700 | Ga0495607_0104522 | 3300046501 | Bacteria | 1511 |
| 701 | Ga0495607_0123425 | 3300046501 | Bacteria | 1356 |
| 702 | Ga0495607_0137929 | 3300046501 | Bacteria | 1261 |
| 703 | Ga0495583_0000043 | 3300046506 | Bacteria | 230804 |
| 704 | Ga0495583_0000192 | 3300046506 | Bacteria | 102223 |
| 705 | Ga0495583_0000645 | 3300046506 | Bacteria | 46022 |
| 706 | Ga0495583_0000684 | 3300046506 | Bacteria | 43822 |
| 707 | Ga0495583_0000714 | 3300046506 | Bacteria | 42527 |
| 708 | Ga0495583_0000940 | 3300046506 | Bacteria | 33943 |
| 709 | Ga0495583_0001057 | 3300046506 | Bacteria | 30806 |
| 710 | Ga0495583_0001472 | 3300046506 | Bacteria | 23588 |
| 711 | Ga0495583_0001622 | 3300046506 | Bacteria | 22043 |
| 712 | Ga0495583_0003309 | 3300046506 | Bacteria | 12486 |
| 713 | Ga0495583_0005709 | 3300046506 | Bacteria | 8362 |
| 714 | Ga0495583_0010559 | 3300046506 | Bacteria | 5371 |
| 715 | Ga0495606_0000362 | 3300046507 | Bacteria | 77675 |
| 716 | Ga0495606_0000367 | 3300046507 | Bacteria | 77313 |
| 717 | Ga0495606_0001081 | 3300046507 | Bacteria | 39097 |
| 718 | Ga0495606_0001228 | 3300046507 | Bacteria | 35889 |
| 719 | Ga0495606_0001261 | 3300046507 | Bacteria | 35236 |
| 720 | Ga0495606_0001308 | 3300046507 | Bacteria | 34303 |
| 721 | Ga0495606_0001970 | 3300046507 | Bacteria | 25345 |
| 722 | Ga0495606_0002333 | 3300046507 | Bacteria | 22368 |
| 723 | Ga0495606_0003639 | 3300046507 | Bacteria | 16183 |
| 724 | Ga0495606_0009526 | 3300046507 | Bacteria | 8203 |
| 725 | Ga0495606_0009574 | 3300046507 | Bacteria | 8173 |
| 726 | Ga0495606_0018779 | 3300046507 | Bacteria | 5172 |
| 727 | Ga0495606_0024039 | 3300046507 | Bacteria | 4402 |
| 728 | Ga0495606_0034007 | 3300046507 | Bacteria | 3505 |
| 729 | Ga0495606_0147229 | 3300046507 | Bacteria | 1385 |
| 730 | Ga0495606_0203747 | 3300046507 | Bacteria | 1126 |
| 731 | Ga0495606_0211197 | 3300046507 | Bacteria | 1099 |
| 732 | Ga0495610_0000723 | 3300046512 | Bacteria | 31412 |
| 733 | Ga0495610_0000761 | 3300046512 | Bacteria | 30382 |
| 734 | Ga0495610_0001455 | 3300046512 | Bacteria | 20932 |
| 735 | Ga0495610_0001620 | 3300046512 | Bacteria | 19788 |
| 736 | Ga0495610_0001992 | 3300046512 | Bacteria | 17435 |
| 737 | Ga0495610_0007995 | 3300046512 | Bacteria | 6930 |
| 738 | Ga0495610_0008038 | 3300046512 | Bacteria | 6903 |
| 739 | Ga0495610_0010674 | 3300046512 | Bacteria | 5685 |
| 740 | Ga0495610_0011001 | 3300046512 | Bacteria | 5568 |
| 741 | Ga0495610_0013504 | 3300046512 | Bacteria | 4850 |
| 742 | Ga0495610_0015957 | 3300046512 | Bacteria | 4343 |
| 743 | Ga0495610_0088072 | 3300046512 | Bacteria | 1411 |
| 744 | Ga0495616_0000340 | 3300046513 | Bacteria | 37043 |
| 745 | Ga0495616_0000482 | 3300046513 | Bacteria | 30327 |
| 746 | Ga0495616_0002159 | 3300046513 | Bacteria | 13139 |
| 747 | Ga0495616_0008773 | 3300046513 | Bacteria | 5957 |
| 748 | Ga0495616_0009458 | 3300046513 | Bacteria | 5700 |
| 749 | Ga0495616_0012758 | 3300046513 | Bacteria | 4756 |
| 750 | Ga0495616_0016266 | 3300046513 | Bacteria | 4121 |
| 751 | Ga0495616_0023177 | 3300046513 | Bacteria | 3342 |
| 752 | Ga0495616_0055908 | 3300046513 | Bacteria | 1951 |
| 753 | Ga0495616_0085043 | 3300046513 | Bacteria | 1507 |
| 754 | Ga0495616_0133127 | 3300046513 | Bacteria | 1137 |
| 755 | Ga0495616_0159055 | 3300046513 | Bacteria | 1017 |
| 756 | Ga0495620_0000075 | 3300046515 | Bacteria | 81405 |
| 757 | Ga0495620_0000114 | 3300046515 | Bacteria | 64421 |
| 758 | Ga0495620_0000170 | 3300046515 | Bacteria | 51293 |
| 759 | Ga0495620_0000307 | 3300046515 | Bacteria | 34934 |
| 760 | Ga0495620_0002176 | 3300046515 | Bacteria | 11384 |
| 761 | Ga0495620_0002439 | 3300046515 | Bacteria | 10769 |
| 762 | Ga0495620_0002887 | 3300046515 | Bacteria | 9878 |
| 763 | Ga0495620_0006034 | 3300046515 | Bacteria | 6707 |
| 764 | Ga0495620_0007339 | 3300046515 | Bacteria | 5999 |
| 765 | Ga0495620_0011137 | 3300046515 | Bacteria | 4707 |
| 766 | Ga0495620_0020589 | 3300046515 | Bacteria | 3220 |
| 767 | Ga0495620_0020799 | 3300046515 | Bacteria | 3197 |
| 768 | Ga0495620_0076483 | 3300046515 | Bacteria | 1360 |
| 769 | Ga0495630_0010683 | 3300046517 | Bacteria | 6628 |
| 770 | Ga0495630_0014997 | 3300046517 | Bacteria | 5654 |
| 771 | Ga0495631_0000020 | 3300046518 | Bacteria | 92958 |
| 772 | Ga0495631_0000384 | 3300046518 | Bacteria | 30478 |
| 773 | Ga0495631_0000609 | 3300046518 | Bacteria | 23559 |
| 774 | Ga0495631_0001218 | 3300046518 | Bacteria | 15891 |
| 775 | Ga0495631_0001327 | 3300046518 | Bacteria | 15168 |
| 776 | Ga0495631_0006461 | 3300046518 | Bacteria | 6049 |
| 777 | Ga0495631_0010943 | 3300046518 | Bacteria | 4478 |
| 778 | Ga0495631_0024729 | 3300046518 | Bacteria | 2771 |
| 779 | Ga0495631_0025838 | 3300046518 | Bacteria | 2700 |
| 780 | Ga0495631_0030128 | 3300046518 | Bacteria | 2464 |
| 781 | Ga0495631_0056485 | 3300046518 | Bacteria | 1709 |
| 782 | Ga0495631_0063302 | 3300046518 | Bacteria | 1602 |
| 783 | Ga0495632_0000255 | 3300046519 | Bacteria | 52928 |
| 784 | Ga0495632_0000436 | 3300046519 | Bacteria | 39746 |
| 785 | Ga0495632_0000790 | 3300046519 | Bacteria | 28178 |
| 786 | Ga0495632_0000965 | 3300046519 | Bacteria | 25128 |
| 787 | Ga0495632_0001749 | 3300046519 | Bacteria | 17563 |
| 788 | Ga0495632_0002297 | 3300046519 | Bacteria | 14725 |
| 789 | Ga0495632_0003622 | 3300046519 | Bacteria | 10860 |
| 790 | Ga0495632_0004384 | 3300046519 | Bacteria | 9596 |
| 791 | Ga0495632_0010001 | 3300046519 | Bacteria | 5657 |
| 792 | Ga0495632_0014829 | 3300046519 | Bacteria | 4394 |
| 793 | Ga0495632_0014837 | 3300046519 | Bacteria | 4393 |
| 794 | Ga0495632_0029689 | 3300046519 | Bacteria | 2844 |
| 795 | Ga0495632_0034296 | 3300046519 | Bacteria | 2598 |
| 796 | Ga0495632_0034571 | 3300046519 | Bacteria | 2585 |
| 797 | Ga0495632_0045524 | 3300046519 | Bacteria | 2185 |
| 798 | Ga0495632_0060478 | 3300046519 | Bacteria | 1840 |
| 799 | Ga0495632_0064189 | 3300046519 | Bacteria | 1776 |
| 800 | Ga0495632_0069523 | 3300046519 | Bacteria | 1695 |
| 801 | Ga0495632_0122043 | 3300046519 | Bacteria | 1217 |
| 802 | Ga0495637_0000043 | 3300046520 | Bacteria | 112526 |
| 803 | Ga0495637_0000420 | 3300046520 | Bacteria | 31089 |
| 804 | Ga0495637_0000442 | 3300046520 | Bacteria | 30284 |
| 805 | Ga0495637_0000447 | 3300046520 | Bacteria | 30138 |
| 806 | Ga0495637_0000616 | 3300046520 | Bacteria | 25212 |
| 807 | Ga0495637_0001545 | 3300046520 | Bacteria | 13418 |
| 808 | Ga0495637_0001927 | 3300046520 | Bacteria | 11790 |
| 809 | Ga0495637_0004671 | 3300046520 | Bacteria | 7072 |
| 810 | Ga0495637_0008453 | 3300046520 | Bacteria | 5056 |
| 811 | Ga0495637_0009920 | 3300046520 | Bacteria | 4632 |
| 812 | Ga0495637_0011626 | 3300046520 | Bacteria | 4225 |
| 813 | Ga0495637_0014251 | 3300046520 | Bacteria | 3751 |
| 814 | Ga0495637_0018855 | 3300046520 | Bacteria | 3195 |
| 815 | Ga0495637_0024902 | 3300046520 | Bacteria | 2704 |
| 816 | Ga0495637_0026502 | 3300046520 | Bacteria | 2600 |
| 817 | Ga0495637_0030811 | 3300046520 | Bacteria | 2376 |
| 818 | Ga0495643_0000049 | 3300046522 | Bacteria | 212242 |
| 819 | Ga0495643_0000401 | 3300046522 | Bacteria | 56732 |
| 820 | Ga0495643_0000647 | 3300046522 | Bacteria | 41199 |
| 821 | Ga0495643_0001444 | 3300046522 | Bacteria | 21900 |
| 822 | Ga0495643_0004481 | 3300046522 | Bacteria | 9750 |
| 823 | Ga0495643_0008120 | 3300046522 | Bacteria | 6684 |
| 824 | Ga0495643_0009497 | 3300046522 | Bacteria | 6042 |
| 825 | Ga0495643_0011154 | 3300046522 | Bacteria | 5492 |
| 826 | Ga0495643_0013208 | 3300046522 | Bacteria | 4952 |
| 827 | Ga0495643_0020133 | 3300046522 | Bacteria | 3854 |
| 828 | Ga0495643_0020193 | 3300046522 | Bacteria | 3846 |
| 829 | Ga0495643_0029136 | 3300046522 | Bacteria | 3090 |
| 830 | Ga0495643_0100509 | 3300046522 | Bacteria | 1483 |
| 831 | Ga0495644_0000193 | 3300046523 | Bacteria | 28686 |
| 832 | Ga0495644_0000508 | 3300046523 | Bacteria | 16641 |
| 833 | Ga0495644_0000998 | 3300046523 | Bacteria | 11777 |
| 834 | Ga0495644_0003222 | 3300046523 | Bacteria | 6445 |
| 835 | Ga0495644_0010173 | 3300046523 | Bacteria | 3624 |
| 836 | Ga0495644_0013086 | 3300046523 | Bacteria | 3188 |
| 837 | Ga0495644_0028333 | 3300046523 | Bacteria | 2119 |
| 838 | Ga0495648_0000327 | 3300046524 | Bacteria | 52513 |
| 839 | Ga0495648_0000627 | 3300046524 | Bacteria | 37754 |
| 840 | Ga0495648_0001249 | 3300046524 | Bacteria | 25427 |
| 841 | Ga0495648_0001427 | 3300046524 | Bacteria | 23379 |
| 842 | Ga0495648_0003384 | 3300046524 | Bacteria | 14029 |
| 843 | Ga0495648_0004361 | 3300046524 | Bacteria | 12115 |
| 844 | Ga0495648_0004765 | 3300046524 | Bacteria | 11481 |
| 845 | Ga0495648_0004814 | 3300046524 | Bacteria | 11389 |
| 846 | Ga0495648_0007585 | 3300046524 | Bacteria | 8664 |
| 847 | Ga0495648_0007721 | 3300046524 | Bacteria | 8567 |
| 848 | Ga0495648_0012937 | 3300046524 | Bacteria | 6197 |
| 849 | Ga0495648_0016013 | 3300046524 | Bacteria | 5415 |
| 850 | Ga0495648_0016995 | 3300046524 | Bacteria | 5220 |
| 851 | Ga0495648_0028598 | 3300046524 | Bacteria | 3710 |
| 852 | Ga0495648_0028614 | 3300046524 | Bacteria | 3708 |
| 853 | Ga0495648_0048002 | 3300046524 | Bacteria | 2632 |
| 854 | Ga0495648_0069536 | 3300046524 | Bacteria | 2048 |
| 855 | Ga0495648_0070245 | 3300046524 | Bacteria | 2035 |
| 856 | Ga0495648_0133717 | 3300046524 | Bacteria | 1315 |
| 857 | Ga0495663_0000254 | 3300046525 | Bacteria | 20648 |
| 858 | Ga0495666_0000190 | 3300046526 | Bacteria | 26331 |
| 859 | Ga0495666_0001791 | 3300046526 | Bacteria | 10608 |
| 860 | Ga0495666_0010302 | 3300046526 | Bacteria | 4660 |
| 861 | Ga0495666_0012665 | 3300046526 | Bacteria | 4203 |
| 862 | Ga0495666_0033403 | 3300046526 | Bacteria | 2513 |
| 863 | Ga0495666_0041931 | 3300046526 | Bacteria | 2214 |
| 864 | Ga0495642_0000033 | 3300046528 | Bacteria | 85849 |
| 865 | Ga0495642_0000251 | 3300046528 | Bacteria | 30079 |
| 866 | Ga0495642_0000900 | 3300046528 | Bacteria | 13938 |
| 867 | Ga0495654_0000111 | 3300046530 | Bacteria | 92977 |
| 868 | Ga0495654_0000298 | 3300046530 | Bacteria | 44337 |
| 869 | Ga0495654_0000324 | 3300046530 | Bacteria | 41969 |
| 870 | Ga0495654_0000784 | 3300046530 | Bacteria | 24497 |
| 871 | Ga0495654_0000841 | 3300046530 | Bacteria | 23266 |
| 872 | Ga0495654_0000936 | 3300046530 | Bacteria | 21636 |
| 873 | Ga0495654_0000982 | 3300046530 | Bacteria | 20977 |
| 874 | Ga0495654_0002582 | 3300046530 | Bacteria | 11570 |
| 875 | Ga0495654_0003751 | 3300046530 | Bacteria | 9200 |
| 876 | Ga0495654_0006337 | 3300046530 | Bacteria | 6728 |
| 877 | Ga0495654_0007625 | 3300046530 | Bacteria | 6023 |
| 878 | Ga0495654_0012184 | 3300046530 | Bacteria | 4626 |
| 879 | Ga0495654_0015224 | 3300046530 | Bacteria | 4088 |
| 880 | Ga0495654_0029278 | 3300046530 | Bacteria | 2809 |
| 881 | Ga0495654_0030089 | 3300046530 | Bacteria | 2764 |
| 882 | Ga0495654_0046569 | 3300046530 | Bacteria | 2135 |
| 883 | Ga0495654_0050675 | 3300046530 | Bacteria | 2027 |
| 884 | Ga0495654_0053809 | 3300046530 | Bacteria | 1954 |
| 885 | Ga0495654_0063978 | 3300046530 | Bacteria | 1759 |
| 886 | Ga0495654_0064557 | 3300046530 | Bacteria | 1750 |
| 887 | Ga0495654_0068608 | 3300046530 | Bacteria | 1685 |
| 888 | Ga0495654_0079416 | 3300046530 | Bacteria | 1541 |
| 889 | Ga0495654_0082682 | 3300046530 | Bacteria | 1502 |
| 890 | Ga0495654_0110814 | 3300046530 | Bacteria | 1252 |
| 891 | Ga0495654_0112973 | 3300046530 | Bacteria | 1237 |
| 892 | Ga0495587_0000454 | 3300046536 | Bacteria | 28585 |
| 893 | Ga0495587_0002320 | 3300046536 | Bacteria | 12723 |
| 894 | Ga0495587_0046233 | 3300046536 | Bacteria | 2584 |
| 895 | Ga0495587_0170833 | 3300046536 | Bacteria | 1235 |
| 896 | Ga0495609_0000036 | 3300046538 | Bacteria | 186358 |
| 897 | Ga0495609_0000045 | 3300046538 | Bacteria | 159595 |
| 898 | Ga0495609_0000049 | 3300046538 | Bacteria | 155608 |
| 899 | Ga0495609_0000405 | 3300046538 | Bacteria | 36116 |
| 900 | Ga0495609_0001082 | 3300046538 | Bacteria | 18993 |
| 901 | Ga0495609_0002678 | 3300046538 | Bacteria | 10775 |
| 902 | Ga0495609_0003612 | 3300046538 | Bacteria | 8785 |
| 903 | Ga0495609_0004013 | 3300046538 | Bacteria | 8216 |
| 904 | Ga0495609_0007819 | 3300046538 | Bacteria | 5292 |
| 905 | Ga0495609_0011375 | 3300046538 | Bacteria | 4240 |
| 906 | Ga0495609_0015814 | 3300046538 | Bacteria | 3526 |
| 907 | Ga0495609_0042453 | 3300046538 | Bacteria | 2042 |
| 908 | Ga0495609_0068490 | 3300046538 | Bacteria | 1561 |
| 909 | Ga0495609_0138747 | 3300046538 | Bacteria | 1038 |
| 910 | Ga0495597_0000013 | 3300046542 | Bacteria | 203829 |
| 911 | Ga0495597_0000574 | 3300046542 | Bacteria | 30588 |
| 912 | Ga0495597_0001021 | 3300046542 | Bacteria | 21440 |
| 913 | Ga0495597_0001346 | 3300046542 | Bacteria | 17840 |
| 914 | Ga0495597_0002441 | 3300046542 | Bacteria | 11796 |
| 915 | Ga0495597_0009911 | 3300046542 | Bacteria | 4682 |
| 916 | Ga0495597_0013507 | 3300046542 | Bacteria | 3907 |
| 917 | Ga0495597_0016615 | 3300046542 | Bacteria | 3474 |
| 918 | Ga0495597_0019026 | 3300046542 | Bacteria | 3217 |
| 919 | Ga0495597_0057294 | 3300046542 | Bacteria | 1705 |
| 920 | Ga0495645_0023776 | 3300046543 | Bacteria | 4441 |
| 921 | Ga0495645_0068352 | 3300046543 | Bacteria | 2565 |
| 922 | Ga0495645_0252176 | 3300046543 | Bacteria | 1172 |
| 923 | Ga0495622_0000346 | 3300046557 | Bacteria | 33256 |
| 924 | Ga0495622_0000757 | 3300046557 | Bacteria | 18043 |
| 925 | Ga0495622_0003859 | 3300046557 | Bacteria | 7002 |
| 926 | Ga0495622_0006630 | 3300046557 | Bacteria | 5365 |
| 927 | Ga0495622_0027975 | 3300046557 | Bacteria | 2631 |
| 928 | Ga0495622_0037699 | 3300046557 | Bacteria | 2251 |
| 929 | Ga0495622_0041437 | 3300046557 | Bacteria | 2141 |
| 930 | Ga0495622_0062426 | 3300046557 | Bacteria | 1724 |
| 931 | Ga0495622_0072793 | 3300046557 | Bacteria | 1585 |
| 932 | Ga0495633_0000229 | 3300046558 | Bacteria | 68402 |
| 933 | Ga0495633_0000960 | 3300046558 | Bacteria | 23854 |
| 934 | Ga0495633_0001099 | 3300046558 | Bacteria | 21829 |
| 935 | Ga0495633_0009543 | 3300046558 | Bacteria | 5350 |
| 936 | Ga0495633_0022014 | 3300046558 | Bacteria | 3179 |
| 937 | Ga0495633_0026649 | 3300046558 | Bacteria | 2834 |
| 938 | Ga0495656_0128887 | 3300046615 | Bacteria | 1202 |
| 939 | Ga0495668_0000568 | 3300046616 | Bacteria | 45426 |
| 940 | Ga0495668_0001696 | 3300046616 | Bacteria | 20376 |
| 941 | Ga0495668_0021584 | 3300046616 | Bacteria | 3689 |
| 942 | Ga0495668_0069885 | 3300046616 | Bacteria | 1930 |
| 943 | Ga0495668_0117648 | 3300046616 | Bacteria | 1453 |
| 944 | Ga0495668_0226720 | 3300046616 | Bacteria | 1023 |
| 945 | Ga0495634_0000604 | 3300046642 | Bacteria | 34740 |
| 946 | Ga0495634_0007150 | 3300046642 | Bacteria | 8418 |
| 947 | Ga0495611_0000220 | 3300046648 | Bacteria | 39983 |
| 948 | Ga0495611_0000472 | 3300046648 | Bacteria | 24021 |
| 949 | Ga0495611_0001173 | 3300046648 | Bacteria | 13640 |
| 950 | Ga0495611_0002514 | 3300046648 | Bacteria | 8342 |
| 951 | Ga0495611_0008346 | 3300046648 | Bacteria | 4385 |
| 952 | Ga0495611_0009865 | 3300046648 | Bacteria | 4040 |
| 953 | Ga0495611_0013461 | 3300046648 | Bacteria | 3484 |
| 954 | Ga0495611_0021500 | 3300046648 | Bacteria | 2786 |
| 955 | Ga0495625_0000070 | 3300046660 | Bacteria | 167336 |
| 956 | Ga0495625_0001145 | 3300046660 | Bacteria | 34203 |
| 957 | Ga0495625_0001301 | 3300046660 | Bacteria | 31222 |
| 958 | Ga0495625_0001848 | 3300046660 | Bacteria | 24155 |
| 959 | Ga0495625_0002099 | 3300046660 | Bacteria | 22263 |
| 960 | Ga0495625_0002421 | 3300046660 | Bacteria | 20214 |
| 961 | Ga0495625_0003237 | 3300046660 | Bacteria | 16478 |
| 962 | Ga0495625_0007897 | 3300046660 | Bacteria | 9161 |
| 963 | Ga0495625_0017092 | 3300046660 | Bacteria | 5685 |
| 964 | Ga0495625_0017490 | 3300046660 | Bacteria | 5613 |
| 965 | Ga0495625_0018386 | 3300046660 | Bacteria | 5459 |
| 966 | Ga0495625_0019131 | 3300046660 | Bacteria | 5326 |
| 967 | Ga0495625_0047775 | 3300046660 | Bacteria | 3085 |
| 968 | Ga0495625_0078182 | 3300046660 | Bacteria | 2309 |
| 969 | Ga0495625_0088804 | 3300046660 | Bacteria | 2140 |
| 970 | Ga0495625_0130411 | 3300046660 | Bacteria | 1703 |
| 971 | Ga0495625_0167679 | 3300046660 | Bacteria | 1467 |
| 972 | Ga0495635_0000247 | 3300046663 | Bacteria | 34285 |
| 973 | Ga0495635_0037121 | 3300046663 | Bacteria | 3373 |
| 974 | Ga0495659_0000162 | 3300046664 | Bacteria | 29900 |
| 975 | Ga0495659_0005203 | 3300046664 | Bacteria | 4089 |
| 976 | Ga0495661_0000042 | 3300046665 | Bacteria | 150599 |
| 977 | Ga0495661_0000312 | 3300046665 | Bacteria | 54893 |
| 978 | Ga0495661_0000545 | 3300046665 | Bacteria | 38934 |
| 979 | Ga0495661_0000867 | 3300046665 | Bacteria | 28166 |
| 980 | Ga0495661_0003095 | 3300046665 | Bacteria | 12492 |
| 981 | Ga0495661_0003984 | 3300046665 | Bacteria | 10770 |
| 982 | Ga0495661_0008243 | 3300046665 | Bacteria | 7218 |
| 983 | Ga0495661_0012485 | 3300046665 | Bacteria | 5736 |
| 984 | Ga0495661_0012911 | 3300046665 | Bacteria | 5627 |
| 985 | Ga0495661_0019090 | 3300046665 | Bacteria | 4497 |
| 986 | Ga0495661_0020701 | 3300046665 | Bacteria | 4291 |
| 987 | Ga0495661_0026075 | 3300046665 | Bacteria | 3766 |
| 988 | Ga0495661_0037357 | 3300046665 | Bacteria | 3032 |
| 989 | Ga0495661_0073479 | 3300046665 | Bacteria | 1992 |
| 990 | Ga0495661_0113131 | 3300046665 | Bacteria | 1510 |
| 991 | Ga0495661_0122272 | 3300046665 | Bacteria | 1436 |
| 992 | Ga0495588_0011494 | 3300046674 | Bacteria | 4157 |
| 993 | Ga0495588_0034802 | 3300046674 | Bacteria | 2549 |
| 994 | Ga0495588_0052241 | 3300046674 | Bacteria | 2106 |
| 995 | Ga0495588_0063121 | 3300046674 | Bacteria | 1920 |
| 996 | Ga0495588_0074595 | 3300046674 | Bacteria | 1766 |
| 997 | Ga0495599_0091482 | 3300046678 | Bacteria | 1898 |
| 998 | Ga0495623_0000555 | 3300046679 | Bacteria | 24919 |
| 999 | Ga0495623_0007106 | 3300046679 | Bacteria | 7274 |
| 1000 | Ga0495646_0000263 | 3300046680 | Bacteria | 26648 |
| 1001 | Ga0495646_0000651 | 3300046680 | Bacteria | 19026 |
| 1002 | Ga0495646_0006393 | 3300046680 | Bacteria | 7471 |
| 1003 | Ga0495669_0004289 | 3300046684 | Bacteria | 5884 |
| 1004 | Ga0495613_0010387 | 3300046689 | Bacteria | 6915 |
| 1005 | Ga0495613_0012057 | 3300046689 | Bacteria | 6423 |
| 1006 | Ga0495613_0012280 | 3300046689 | Bacteria | 6363 |
| 1007 | Ga0495624_0000533 | 3300046690 | Bacteria | 29812 |
| 1008 | Ga0495670_0000115 | 3300046691 | Bacteria | 35545 |
| 1009 | Ga0495670_0000146 | 3300046691 | Bacteria | 31027 |
| 1010 | Ga0495670_0000969 | 3300046691 | Bacteria | 13911 |
| 1011 | Ga0495670_0001578 | 3300046691 | Bacteria | 11133 |
| 1012 | Ga0495670_0002156 | 3300046691 | Bacteria | 9730 |
| 1013 | Ga0495670_0007144 | 3300046691 | Bacteria | 5497 |
| 1014 | Ga0495670_0011830 | 3300046691 | Bacteria | 4295 |
| 1015 | Ga0495670_0012118 | 3300046691 | Bacteria | 4241 |
| 1016 | Ga0495670_0015984 | 3300046691 | Bacteria | 3689 |
| 1017 | Ga0495670_0024246 | 3300046691 | Bacteria | 2998 |
| 1018 | Ga0495670_0067040 | 3300046691 | Bacteria | 1811 |
| 1019 | Ga0495671_0000380 | 3300046692 | Bacteria | 36521 |
| 1020 | Ga0495671_0000428 | 3300046692 | Bacteria | 33406 |
| 1021 | Ga0495671_0000808 | 3300046692 | Bacteria | 22380 |
| 1022 | Ga0495671_0001253 | 3300046692 | Bacteria | 17350 |
| 1023 | Ga0495671_0001430 | 3300046692 | Bacteria | 16054 |
| 1024 | Ga0495671_0002385 | 3300046692 | Bacteria | 11909 |
| 1025 | Ga0495671_0007610 | 3300046692 | Bacteria | 6158 |
| 1026 | Ga0495671_0008122 | 3300046692 | Bacteria | 5925 |
| 1027 | Ga0495671_0008423 | 3300046692 | Bacteria | 5802 |
| 1028 | Ga0495671_0009680 | 3300046692 | Bacteria | 5375 |
| 1029 | Ga0495671_0010341 | 3300046692 | Bacteria | 5174 |
| 1030 | Ga0495671_0011518 | 3300046692 | Bacteria | 4859 |
| 1031 | Ga0495671_0022607 | 3300046692 | Bacteria | 3293 |
| 1032 | Ga0495671_0025200 | 3300046692 | Bacteria | 3092 |
| 1033 | Ga0495671_0042494 | 3300046692 | Bacteria | 2284 |
| 1034 | Ga0495671_0045911 | 3300046692 | Bacteria | 2185 |
| 1035 | Ga0495671_0049801 | 3300046692 | Bacteria | 2087 |
| 1036 | Ga0495649_0000462 | 3300046694 | Bacteria | 34992 |
| 1037 | Ga0495649_0000580 | 3300046694 | Bacteria | 30670 |
| 1038 | Ga0495649_0000598 | 3300046694 | Bacteria | 30066 |
| 1039 | Ga0495649_0000666 | 3300046694 | Bacteria | 28081 |
| 1040 | Ga0495649_0002822 | 3300046694 | Bacteria | 12069 |
| 1041 | Ga0495649_0003938 | 3300046694 | Bacteria | 9812 |
| 1042 | Ga0495649_0004392 | 3300046694 | Bacteria | 9221 |
| 1043 | Ga0495649_0008504 | 3300046694 | Bacteria | 6168 |
| 1044 | Ga0495649_0013429 | 3300046694 | Bacteria | 4724 |
| 1045 | Ga0495649_0014238 | 3300046694 | Bacteria | 4566 |
| 1046 | Ga0495649_0015808 | 3300046694 | Bacteria | 4290 |
| 1047 | Ga0495649_0022217 | 3300046694 | Bacteria | 3549 |
| 1048 | Ga0495649_0059667 | 3300046694 | Bacteria | 2053 |
| 1049 | Ga0495649_0086164 | 3300046694 | Bacteria | 1676 |
| 1050 | Ga0495649_0119840 | 3300046694 | Bacteria | 1392 |
| 1051 | Ga0495589_0000127 | 3300046794 | Bacteria | 70424 |
| 1052 | Ga0495589_0000238 | 3300046794 | Bacteria | 46015 |
| 1053 | Ga0495589_0000399 | 3300046794 | Bacteria | 32701 |
| 1054 | Ga0495589_0000414 | 3300046794 | Bacteria | 32060 |
| 1055 | Ga0495589_0000943 | 3300046794 | Bacteria | 17818 |
| 1056 | Ga0495589_0002524 | 3300046794 | Bacteria | 10188 |
| 1057 | Ga0495589_0002598 | 3300046794 | Bacteria | 10025 |
| 1058 | Ga0495589_0003020 | 3300046794 | Bacteria | 9253 |
| 1059 | Ga0495589_0005006 | 3300046794 | Bacteria | 7018 |
| 1060 | Ga0495589_0013229 | 3300046794 | Bacteria | 4258 |
| 1061 | Ga0495589_0016357 | 3300046794 | Bacteria | 3813 |
| 1062 | Ga0495589_0018383 | 3300046794 | Bacteria | 3584 |
| 1063 | Ga0495600_0006341 | 3300046809 | Bacteria | 7194 |
| 1064 | Ga0495600_0026624 | 3300046809 | Bacteria | 3733 |
| 1065 | Ga0495600_0038331 | 3300046809 | Bacteria | 3118 |
| 1066 | Ga0495660_0000461 | 3300046810 | Bacteria | 33748 |
| 1067 | Ga0495660_0000535 | 3300046810 | Bacteria | 31085 |
| 1068 | Ga0495660_0000635 | 3300046810 | Bacteria | 27337 |
| 1069 | Ga0495660_0000750 | 3300046810 | Bacteria | 24463 |
| 1070 | Ga0495660_0001328 | 3300046810 | Bacteria | 17047 |
| 1071 | Ga0495660_0002832 | 3300046810 | Bacteria | 10901 |
| 1072 | Ga0495660_0005329 | 3300046810 | Bacteria | 7703 |
| 1073 | Ga0495660_0009503 | 3300046810 | Bacteria | 5668 |
| 1074 | Ga0495660_0011235 | 3300046810 | Bacteria | 5198 |
| 1075 | Ga0495660_0011581 | 3300046810 | Bacteria | 5115 |
| 1076 | Ga0495660_0014213 | 3300046810 | Bacteria | 4611 |
| 1077 | Ga0495660_0014638 | 3300046810 | Bacteria | 4536 |
| 1078 | Ga0495660_0016853 | 3300046810 | Bacteria | 4209 |
| 1079 | Ga0495660_0020663 | 3300046810 | Bacteria | 3774 |
| 1080 | Ga0495660_0022145 | 3300046810 | Bacteria | 3631 |
| 1081 | Ga0495660_0023097 | 3300046810 | Bacteria | 3549 |
| 1082 | Ga0495660_0028964 | 3300046810 | Bacteria | 3127 |
| 1083 | Ga0495660_0045215 | 3300046810 | Bacteria | 2418 |
| 1084 | Ga0495660_0064156 | 3300046810 | Bacteria | 1964 |
| 1085 | Ga0495660_0067161 | 3300046810 | Bacteria | 1910 |
| 1086 | Ga0495660_0140797 | 3300046810 | Bacteria | 1200 |
| 1087 | Ga0495581_0001342 | 3300047315 | Bacteria | 13602 |
| 1088 | Ga0495604_0022917 | 3300047317 | Bacteria | 4983 |
| 1089 | Ga0495604_0024534 | 3300047317 | Bacteria | 4810 |
| 1090 | Ga0495604_0029448 | 3300047317 | Bacteria | 4368 |
| 1091 | Ga0495636_0026303 | 3300047318 | Bacteria | 2366 |
| 1092 | Ga0495672_0000211 | 3300047320 | Bacteria | 83189 |
| 1093 | Ga0495672_0000540 | 3300047320 | Bacteria | 42937 |
| 1094 | Ga0495672_0000791 | 3300047320 | Bacteria | 34302 |
| 1095 | Ga0495672_0001244 | 3300047320 | Bacteria | 25587 |
| 1096 | Ga0495672_0002250 | 3300047320 | Bacteria | 17953 |
| 1097 | Ga0495672_0003287 | 3300047320 | Bacteria | 13982 |
| 1098 | Ga0495672_0006837 | 3300047320 | Bacteria | 8710 |
| 1099 | Ga0495672_0006878 | 3300047320 | Bacteria | 8676 |
| 1100 | Ga0495672_0008178 | 3300047320 | Bacteria | 7758 |
| 1101 | Ga0495672_0009838 | 3300047320 | Bacteria | 6879 |
| 1102 | Ga0495672_0011896 | 3300047320 | Bacteria | 6106 |
| 1103 | Ga0495672_0017798 | 3300047320 | Bacteria | 4742 |
| 1104 | Ga0495672_0019994 | 3300047320 | Bacteria | 4400 |
| 1105 | Ga0495672_0028652 | 3300047320 | Bacteria | 3519 |
| 1106 | Ga0495672_0050635 | 3300047320 | Bacteria | 2450 |
| 1107 | Ga0495672_0164898 | 3300047320 | Bacteria | 1135 |
| 1108 | Ga0495676_0000019 | 3300047321 | Bacteria | 167261 |
| 1109 | Ga0495676_0000568 | 3300047321 | Bacteria | 30309 |
| 1110 | Ga0495676_0004365 | 3300047321 | Bacteria | 12920 |
| 1111 | Ga0495680_0001631 | 3300047322 | Bacteria | 23845 |
| 1112 | Ga0495680_0001655 | 3300047322 | Bacteria | 23697 |
| 1113 | Ga0495680_0006403 | 3300047322 | Bacteria | 10948 |
| 1114 | Ga0495680_0006531 | 3300047322 | Bacteria | 10826 |
| 1115 | Ga0495680_0010690 | 3300047322 | Bacteria | 8185 |
| 1116 | Ga0495680_0014253 | 3300047322 | Bacteria | 6893 |
| 1117 | Ga0495683_0000003 | 3300047323 | Bacteria | 383992 |
| 1118 | Ga0495683_0000085 | 3300047323 | Bacteria | 93009 |
| 1119 | Ga0495683_0000455 | 3300047323 | Bacteria | 32160 |
| 1120 | Ga0495683_0002508 | 3300047323 | Bacteria | 11043 |
| 1121 | Ga0495683_0003443 | 3300047323 | Bacteria | 9229 |
| 1122 | Ga0495683_0003889 | 3300047323 | Bacteria | 8590 |
| 1123 | Ga0495683_0008100 | 3300047323 | Bacteria | 5641 |
| 1124 | Ga0495683_0023061 | 3300047323 | Bacteria | 3199 |
| 1125 | Ga0495683_0028422 | 3300047323 | Bacteria | 2859 |
| 1126 | Ga0495683_0028572 | 3300047323 | Bacteria | 2850 |
| 1127 | Ga0495683_0043328 | 3300047323 | Bacteria | 2266 |
| 1128 | Ga0495683_0047118 | 3300047323 | Bacteria | 2163 |
| 1129 | Ga0495683_0051041 | 3300047323 | Bacteria | 2069 |
| 1130 | Ga0495683_0058748 | 3300047323 | Bacteria | 1909 |
| 1131 | Ga0495683_0100932 | 3300047323 | Bacteria | 1387 |
| 1132 | Ga0495687_000975 | 3300047443 | Bacteria | 29034 |
| 1133 | Ga0495687_002082 | 3300047443 | Bacteria | 16813 |
| 1134 | Ga0495687_002345 | 3300047443 | Bacteria | 15376 |
| 1135 | Ga0495687_002731 | 3300047443 | Bacteria | 13695 |
| 1136 | Ga0495675_0002044 | 3300047444 | Bacteria | 12066 |
| 1137 | Ga0495675_0025696 | 3300047444 | Bacteria | 3753 |
| 1138 | Ga0495675_0109072 | 3300047444 | Bacteria | 1728 |
| 1139 | Ga0495677_0000245 | 3300047445 | Bacteria | 24005 |
| 1140 | Ga0495679_000049 | 3300047446 | Bacteria | 127408 |
| 1141 | Ga0495679_000380 | 3300047446 | Bacteria | 34062 |
| 1142 | Ga0495679_000475 | 3300047446 | Bacteria | 29071 |
| 1143 | Ga0495679_000621 | 3300047446 | Bacteria | 23962 |
| 1144 | Ga0495679_001516 | 3300047446 | Bacteria | 13123 |
| 1145 | Ga0495679_001581 | 3300047446 | Bacteria | 12841 |
| 1146 | Ga0495679_002650 | 3300047446 | Bacteria | 8988 |
| 1147 | Ga0495679_003180 | 3300047446 | Bacteria | 8004 |
| 1148 | Ga0495679_003673 | 3300047446 | Bacteria | 7317 |
| 1149 | Ga0495679_010071 | 3300047446 | Bacteria | 3739 |
| 1150 | Ga0495679_010728 | 3300047446 | Bacteria | 3578 |
| 1151 | Ga0495679_041769 | 3300047446 | Bacteria | 1418 |
| 1152 | Ga0495679_046501 | 3300047446 | Bacteria | 1320 |
| 1153 | Ga0495685_001299 | 3300047447 | Bacteria | 7618 |
| 1154 | Ga0495673_0000168 | 3300047469 | Bacteria | 108628 |
| 1155 | Ga0495673_0000345 | 3300047469 | Bacteria | 58540 |
| 1156 | Ga0495673_0000411 | 3300047469 | Bacteria | 50011 |
| 1157 | Ga0495673_0000637 | 3300047469 | Bacteria | 34475 |
| 1158 | Ga0495673_0000687 | 3300047469 | Bacteria | 33114 |
| 1159 | Ga0495673_0000702 | 3300047469 | Bacteria | 32531 |
| 1160 | Ga0495673_0000755 | 3300047469 | Bacteria | 30650 |
| 1161 | Ga0495673_0000806 | 3300047469 | Bacteria | 29458 |
| 1162 | Ga0495673_0000864 | 3300047469 | Bacteria | 28042 |
| 1163 | Ga0495673_0001319 | 3300047469 | Bacteria | 20205 |
| 1164 | Ga0495673_0003307 | 3300047469 | Bacteria | 10691 |
| 1165 | Ga0495673_0004244 | 3300047469 | Bacteria | 9046 |
| 1166 | Ga0495673_0004370 | 3300047469 | Bacteria | 8872 |
| 1167 | Ga0495673_0006513 | 3300047469 | Bacteria | 6853 |
| 1168 | Ga0495673_0007963 | 3300047469 | Bacteria | 6013 |
| 1169 | Ga0495673_0009701 | 3300047469 | Bacteria | 5302 |
| 1170 | Ga0495673_0011069 | 3300047469 | Bacteria | 4875 |
| 1171 | Ga0495673_0014724 | 3300047469 | Bacteria | 4059 |
| 1172 | Ga0495673_0014934 | 3300047469 | Bacteria | 4021 |
| 1173 | Ga0495673_0020243 | 3300047469 | Bacteria | 3316 |
| 1174 | Ga0495673_0023781 | 3300047469 | Bacteria | 2972 |
| 1175 | Ga0495673_0025990 | 3300047469 | Bacteria | 2806 |
| 1176 | Ga0495673_0072403 | 3300047469 | Bacteria | 1446 |
| 1177 | Ga0495681_0000172 | 3300047470 | Bacteria | 54252 |
| 1178 | Ga0495681_0000226 | 3300047470 | Bacteria | 47165 |
| 1179 | Ga0495681_0000352 | 3300047470 | Bacteria | 35925 |
| 1180 | Ga0495681_0000424 | 3300047470 | Bacteria | 32445 |
| 1181 | Ga0495681_0000504 | 3300047470 | Bacteria | 29850 |
| 1182 | Ga0495681_0000542 | 3300047470 | Bacteria | 28962 |
| 1183 | Ga0495681_0000727 | 3300047470 | Bacteria | 25281 |
| 1184 | Ga0495681_0002050 | 3300047470 | Bacteria | 14647 |
| 1185 | Ga0495681_0002613 | 3300047470 | Bacteria | 12793 |
| 1186 | Ga0495681_0004426 | 3300047470 | Bacteria | 9578 |
| 1187 | Ga0495681_0005793 | 3300047470 | Bacteria | 8210 |
| 1188 | Ga0495681_0014464 | 3300047470 | Bacteria | 4520 |
| 1189 | Ga0495681_0015293 | 3300047470 | Bacteria | 4348 |
| 1190 | Ga0495681_0021103 | 3300047470 | Bacteria | 3516 |
| 1191 | Ga0495681_0029618 | 3300047470 | Bacteria | 2800 |
| 1192 | Ga0495681_0032543 | 3300047470 | Bacteria | 2624 |
| 1193 | Ga0495681_0043502 | 3300047470 | Bacteria | 2165 |
| 1194 | Ga0495681_0049432 | 3300047470 | Bacteria | 1987 |
| 1195 | Ga0495681_0110579 | 3300047470 | Bacteria | 1190 |
| 1196 | Ga0495684_0006952 | 3300047471 | Bacteria | 8787 |
| 1197 | Ga0495684_0012754 | 3300047471 | Bacteria | 6487 |
| 1198 | Ga0495686_0001754 | 3300047472 | Bacteria | 22253 |
| 1199 | Ga0495686_0002862 | 3300047472 | Bacteria | 15544 |
| 1200 | Ga0495686_0006607 | 3300047472 | Bacteria | 8840 |
| 1201 | Ga0495686_0017096 | 3300047472 | Bacteria | 4896 |
| 1202 | Ga0495686_0068571 | 3300047472 | Bacteria | 2188 |
| 1203 | Ga0495686_0076716 | 3300047472 | Bacteria | 2047 |
| 1204 | Ga0495686_0116245 | 3300047472 | Bacteria | 1599 |
| 1205 | Ga0495686_0146749 | 3300047472 | Bacteria | 1388 |
| 1206 | Ga0495593_0000512 | 3300047673 | Bacteria | 21934 |
| 1207 | Ga0495593_0001705 | 3300047673 | Bacteria | 13006 |
| 1208 | Ga0495593_0009545 | 3300047673 | Bacteria | 5630 |
| 1209 | Ga0495593_0035310 | 3300047673 | Bacteria | 2715 |
| 1210 | Ga0495602_0001327 | 3300048088 | Bacteria | 24384 |
| 1211 | Ga0495626_0000080 | 3300048091 | Bacteria | 129112 |
| 1212 | Ga0495626_0000144 | 3300048091 | Bacteria | 89793 |
| 1213 | Ga0495626_0000179 | 3300048091 | Bacteria | 77215 |
| 1214 | Ga0495626_0000438 | 3300048091 | Bacteria | 42557 |
| 1215 | Ga0495626_0000558 | 3300048091 | Bacteria | 36958 |
| 1216 | Ga0495626_0000771 | 3300048091 | Bacteria | 29373 |
| 1217 | Ga0495626_0001050 | 3300048091 | Bacteria | 23620 |
| 1218 | Ga0495626_0003903 | 3300048091 | Bacteria | 9345 |
| 1219 | Ga0495626_0004945 | 3300048091 | Bacteria | 7996 |
| 1220 | Ga0495626_0010532 | 3300048091 | Bacteria | 4925 |
| 1221 | Ga0495626_0011000 | 3300048091 | Bacteria | 4801 |
| 1222 | Ga0495626_0013063 | 3300048091 | Bacteria | 4329 |
| 1223 | Ga0495626_0013210 | 3300048091 | Bacteria | 4297 |
| 1224 | Ga0495626_0032371 | 3300048091 | Bacteria | 2511 |
| 1225 | Ga0495626_0078676 | 3300048091 | Bacteria | 1468 |
| 1226 | Ga0495626_0121104 | 3300048091 | Bacteria | 1124 |
| 1227 | Ga0496102_0000250 | 3300048905 | Bacteria | 70330 |
| 1228 | Ga0496102_0013329 | 3300048905 | Bacteria | 7121 |
| 1229 | Ga0496103_0001523 | 3300048906 | Bacteria | 15476 |
| 1230 | Ga0496106_0011952 | 3300048909 | Bacteria | 6410 |
| 1231 | Ga0496110_0004050 | 3300048913 | Bacteria | 11309 |
| 1232 | Ga0496111_0100311 | 3300048914 | Bacteria | 2126 |
| 1233 | Ga0496114_0000940 | 3300048917 | Bacteria | 21794 |
| 1234 | Ga0496116_0000168 | 3300048919 | Bacteria | 132462 |
| 1235 | Ga0496116_0000419 | 3300048919 | Bacteria | 60095 |
| 1236 | Ga0496116_0001635 | 3300048919 | Bacteria | 24661 |
| 1237 | Ga0496116_0002610 | 3300048919 | Bacteria | 18717 |
| 1238 | Ga0496116_0007631 | 3300048919 | Bacteria | 9549 |
| 1239 | Ga0496116_0022181 | 3300048919 | Bacteria | 4765 |
| 1240 | Ga0496116_0031676 | 3300048919 | Bacteria | 3781 |
| 1241 | Ga0496117_0000349 | 3300048920 | Bacteria | 81440 |
| 1242 | Ga0496117_0001453 | 3300048920 | Bacteria | 34178 |
| 1243 | Ga0496117_0002256 | 3300048920 | Bacteria | 24887 |
| 1244 | Ga0496117_0003622 | 3300048920 | Bacteria | 17799 |
| 1245 | Ga0496117_0006009 | 3300048920 | Bacteria | 12492 |
| 1246 | Ga0496117_0006828 | 3300048920 | Bacteria | 11360 |
| 1247 | Ga0496117_0013274 | 3300048920 | Bacteria | 7198 |
| 1248 | Ga0496117_0035697 | 3300048920 | Bacteria | 3729 |
| 1249 | Ga0496117_0081725 | 3300048920 | Bacteria | 2119 |
| 1250 | Ga0496117_0194481 | 3300048920 | Bacteria | 1151 |
| 1251 | Ga0496117_0205200 | 3300048920 | Bacteria | 1110 |
| 1252 | Ga0496117_0230196 | 3300048920 | Bacteria | 1025 |
| 1253 | Ga0496118_0003199 | 3300048921 | Bacteria | 20896 |
| 1254 | Ga0496118_0003899 | 3300048921 | Bacteria | 18285 |
| 1255 | Ga0496118_0007046 | 3300048921 | Bacteria | 12085 |
| 1256 | Ga0496118_0007048 | 3300048921 | Bacteria | 12084 |
| 1257 | Ga0496118_0007530 | 3300048921 | Bacteria | 11503 |
| 1258 | Ga0496118_0008261 | 3300048921 | Bacteria | 10794 |
| 1259 | Ga0496118_0010074 | 3300048921 | Bacteria | 9406 |
| 1260 | Ga0496118_0020485 | 3300048921 | Bacteria | 5860 |
| 1261 | Ga0496118_0046138 | 3300048921 | Bacteria | 3393 |
| 1262 | Ga0496118_0073096 | 3300048921 | Bacteria | 2459 |
| 1263 | Ga0496118_0125382 | 3300048921 | Bacteria | 1663 |
| 1264 | Ga0496119_0025370 | 3300048922 | Bacteria | 4142 |
| 1265 | Ga0496119_0037982 | 3300048922 | Bacteria | 3117 |
| 1266 | Ga0496120_0004730 | 3300048923 | Bacteria | 11194 |
| 1267 | Ga0496121_0000199 | 3300048924 | Bacteria | 132751 |
| 1268 | Ga0496121_0000804 | 3300048924 | Bacteria | 57222 |
| 1269 | Ga0496121_0002628 | 3300048924 | Bacteria | 27099 |
| 1270 | Ga0496121_0003036 | 3300048924 | Bacteria | 24370 |
| 1271 | Ga0496121_0021408 | 3300048924 | Bacteria | 6333 |
| 1272 | Ga0496121_0024834 | 3300048924 | Bacteria | 5714 |
| 1273 | Ga0496121_0037191 | 3300048924 | Bacteria | 4326 |
| 1274 | Ga0496121_0050306 | 3300048924 | Bacteria | 3522 |
| 1275 | Ga0496121_0069321 | 3300048924 | Bacteria | 2847 |
| 1276 | Ga0496121_0101830 | 3300048924 | Bacteria | 2214 |
| 1277 | Ga0496121_0120179 | 3300048924 | Bacteria | 1985 |
| 1278 | Ga0496121_0209756 | 3300048924 | Bacteria | 1381 |
| 1279 | Ga0496121_0228854 | 3300048924 | Bacteria | 1303 |
| 1280 | Ga0496122_0000667 | 3300048925 | Bacteria | 69054 |
| 1281 | Ga0496122_0001732 | 3300048925 | Bacteria | 33838 |
| 1282 | Ga0496122_0002644 | 3300048925 | Bacteria | 25025 |
| 1283 | Ga0496122_0009182 | 3300048925 | Bacteria | 10472 |
| 1284 | Ga0496122_0027517 | 3300048925 | Bacteria | 4857 |
| 1285 | Ga0496122_0075863 | 3300048925 | Bacteria | 2369 |
| 1286 | Ga0496122_0080370 | 3300048925 | Bacteria | 2273 |
| 1287 | Ga0496122_0154944 | 3300048925 | Bacteria | 1407 |
| 1288 | Ga0496122_0154971 | 3300048925 | Bacteria | 1407 |
| 1289 | Ga0496123_0000163 | 3300048926 | Bacteria | 133536 |
| 1290 | Ga0496123_0000642 | 3300048926 | Bacteria | 58229 |
| 1291 | Ga0496123_0000869 | 3300048926 | Bacteria | 48057 |
| 1292 | Ga0496123_0017335 | 3300048926 | Bacteria | 5800 |
| 1293 | Ga0496123_0029467 | 3300048926 | Bacteria | 4040 |
| 1294 | Ga0496123_0039072 | 3300048926 | Bacteria | 3324 |
| 1295 | Ga0496123_0088580 | 3300048926 | Bacteria | 1848 |
| 1296 | Ga0496124_0000229 | 3300048927 | Bacteria | 109277 |
| 1297 | Ga0496124_0000714 | 3300048927 | Bacteria | 54365 |
| 1298 | Ga0496124_0000870 | 3300048927 | Bacteria | 49280 |
| 1299 | Ga0496124_0001848 | 3300048927 | Bacteria | 29235 |
| 1300 | Ga0496124_0002366 | 3300048927 | Bacteria | 24873 |
| 1301 | Ga0496124_0008162 | 3300048927 | Bacteria | 10989 |
| 1302 | Ga0496124_0014063 | 3300048927 | Bacteria | 7762 |
| 1303 | Ga0496124_0027256 | 3300048927 | Bacteria | 5133 |
| 1304 | Ga0496124_0032860 | 3300048927 | Bacteria | 4575 |
| 1305 | Ga0496124_0041571 | 3300048927 | Bacteria | 3965 |
| 1306 | Ga0496124_0044131 | 3300048927 | Bacteria | 3827 |
| 1307 | Ga0496124_0084516 | 3300048927 | Bacteria | 2602 |
| 1308 | Ga0496124_0100576 | 3300048927 | Bacteria | 2343 |
| 1309 | Ga0496124_0101261 | 3300048927 | Bacteria | 2334 |
| 1310 | Ga0496124_0123815 | 3300048927 | Bacteria | 2062 |
| 1311 | Ga0496124_0148849 | 3300048927 | Bacteria | 1839 |
| 1312 | Ga0496124_0273166 | 3300048927 | Bacteria | 1237 |
| 1313 | Ga0496124_0279294 | 3300048927 | Bacteria | 1218 |
| 1314 | Ga0496124_0289884 | 3300048927 | Bacteria | 1188 |
| 1315 | Ga0496125_0002339 | 3300048928 | Bacteria | 24857 |
| 1316 | Ga0496125_0002675 | 3300048928 | Bacteria | 22757 |
| 1317 | Ga0496125_0003616 | 3300048928 | Bacteria | 18558 |
| 1318 | Ga0496125_0004799 | 3300048928 | Bacteria | 15374 |
| 1319 | Ga0496125_0011474 | 3300048928 | Bacteria | 8859 |
| 1320 | Ga0496125_0014619 | 3300048928 | Bacteria | 7632 |
| 1321 | Ga0496125_0031060 | 3300048928 | Bacteria | 4767 |
| 1322 | Ga0496125_0031171 | 3300048928 | Bacteria | 4755 |
| 1323 | Ga0496125_0033883 | 3300048928 | Bacteria | 4511 |
| 1324 | Ga0496125_0049349 | 3300048928 | Bacteria | 3498 |
| 1325 | Ga0496125_0070266 | 3300048928 | Bacteria | 2742 |
| 1326 | Ga0496125_0102560 | 3300048928 | Bacteria | 2102 |
| 1327 | Ga0496126_0012494 | 3300048929 | Bacteria | 8695 |
| 1328 | Ga0496126_0016012 | 3300048929 | Bacteria | 7518 |
| 1329 | Ga0496126_0043720 | 3300048929 | Bacteria | 4130 |
| 1330 | Ga0496126_0127116 | 3300048929 | Bacteria | 2205 |
| 1331 | Ga0496126_0142895 | 3300048929 | Bacteria | 2058 |
| 1332 | Ga0496126_0148197 | 3300048929 | Bacteria | 2013 |
| 1333 | Ga0496126_0199345 | 3300048929 | Bacteria | 1691 |
| 1334 | Ga0495678_000007 | 3300049459 | Bacteria | 448039 |
| 1335 | Ga0495678_000047 | 3300049459 | Bacteria | 168805 |
| 1336 | Ga0495678_000802 | 3300049459 | Bacteria | 28143 |
| 1337 | Ga0495678_001017 | 3300049459 | Bacteria | 23934 |
| 1338 | Ga0495678_001022 | 3300049459 | Bacteria | 23793 |
| 1339 | Ga0495678_001038 | 3300049459 | Bacteria | 23535 |
| 1340 | Ga0495678_001095 | 3300049459 | Bacteria | 22842 |
| 1341 | Ga0495678_001852 | 3300049459 | Bacteria | 15476 |
| 1342 | Ga0495678_006674 | 3300049459 | Bacteria | 6103 |
| 1343 | Ga0495678_009007 | 3300049459 | Bacteria | 4984 |
| 1344 | Ga0495678_009877 | 3300049459 | Bacteria | 4678 |
| 1345 | Ga0495678_013665 | 3300049459 | Bacteria | 3800 |
| 1346 | Ga0495678_013776 | 3300049459 | Bacteria | 3784 |
| 1347 | Ga0495678_013843 | 3300049459 | Bacteria | 3775 |
| 1348 | Ga0495678_020767 | 3300049459 | Bacteria | 2901 |
| 1349 | Ga0495678_025480 | 3300049459 | Bacteria | 2538 |
| 1350 | Ga0495678_033049 | 3300049459 | Bacteria | 2138 |
| 1351 | Ga0495682_0000051 | 3300049460 | Bacteria | 109996 |
| 1352 | Ga0495682_0000899 | 3300049460 | Bacteria | 18321 |
| 1353 | Ga0495682_0001158 | 3300049460 | Bacteria | 15148 |
| 1354 | Ga0495682_0001812 | 3300049460 | Bacteria | 10755 |
| 1355 | Ga0495682_0007174 | 3300049460 | Bacteria | 4454 |
| 1356 | Ga0495682_0061187 | 3300049460 | Bacteria | 1359 |
| 1357 | Ga0495682_0079264 | 3300049460 | Bacteria | 1181 |
| 1358 | Ga0501031_0118652 | 3300049568 | Bacteria | 1728 |
| 1359 | Ga0501034_0001187 | 3300049571 | Bacteria | 35936 |
| 1360 | Ga0501037_0066593 | 3300049573 | Bacteria | 2623 |
| 1361 | Ga0501038_0098179 | 3300049574 | Bacteria | 2442 |
| 1362 | Ga0501038_0170375 | 3300049574 | Bacteria | 1763 |
| 1363 | Ga0501042_0288440 | 3300049578 | Bacteria | 1185 |
| 1364 | Ga0501043_0085365 | 3300049579 | Bacteria | 2480 |
| 1365 | Ga0501047_0094211 | 3300049581 | Bacteria | 2873 |
| 1366 | Ga0501074_0207602 | 3300049590 | Bacteria | 1396 |
| 1367 | Ga0501222_000116 | 3300049662 | Bacteria | 17922 |
| 1368 | Ga0501227_003954 | 3300049665 | Bacteria | 3192 |
| 1369 | Ga0501240_007882 | 3300049673 | Bacteria | 1351 |
| 1370 | Ga0501241_000142 | 3300049758 | Bacteria | 15922 |
| 1371 | Ga0501035_0149900 | 3300049822 | Bacteria | 2024 |
| 1372 | Ga0501035_0252960 | 3300049822 | Bacteria | 1495 |
| 1373 | Ga0501044_0191213 | 3300049823 | Bacteria | 2009 |
| 1374 | Ga0501044_0268794 | 3300049823 | Bacteria | 1641 |
| 1375 | Ga0501226_002129 | 3300049853 | Bacteria | 2456 |
| 1376 | nmdc:mga03683_3959_c1 | 3300050489 | Bacteria | 4850 |
| 1377 | nmdc:mga03683_71757_c1 | 3300050489 | Bacteria | 1482 |
| 1378 | nmdc:mga00v17_127726_c1 | 3300050491 | Bacteria | 1623 |
| 1379 | nmdc:mga00v17_40232_c1 | 3300050491 | Bacteria | 2804 |
| 1380 | nmdc:mga00v17_59921_c1 | 3300050491 | Bacteria | 2337 |
| 1381 | nmdc:mga08x19_32307_c1 | 3300050514 | Bacteria | 3296 |
| 1382 | nmdc:mga0sz30_17935_c1 | 3300050516 | Bacteria | 2828 |
| 1383 | Ga0500651_0039659 | 3300053093 | Bacteria | 2965 |
| 1384 | Ga0500572_000143 | 3300053111 | Bacteria | 24401 |
| 1385 | Ga0500595_002919 | 3300053119 | Bacteria | 8180 |
| 1386 | Ga0500621_015694 | 3300053126 | Bacteria | 2790 |
| 1387 | Ga0500659_0009556 | 3300053135 | Bacteria | 5323 |
| 1388 | Ga0500564_001328 | 3300053138 | Bacteria | 8457 |
| 1389 | Ga0500573_0001618 | 3300053140 | Bacteria | 10887 |
| 1390 | Ga0500577_0036661 | 3300053142 | Bacteria | 1757 |
| 1391 | Ga0500634_0001481 | 3300053161 | Bacteria | 9165 |
| 1392 | Ga0500636_0038956 | 3300053177 | Bacteria | 2811 |
| 1393 | 2511252812 | 2511231004 | Bacteria | 6669789 |
| 1394 | 2511264234 | 2511231006 | Bacteria | 6794709 |
| 1395 | 2511273103 | 2511231007 | Bacteria | 6306603 |
| 1396 | 2511275789 | 2511231008 | Bacteria | 6624100 |
| 1397 | 2511290606 | 2511231010 | Bacteria | 6373152 |
| 1398 | 2511298332 | 2511231011 | Bacteria | 6149768 |
| 1399 | 2511301068 | 2511231012 | Bacteria | 6738011 |
| 1400 | 2511312252 | 2511231014 | Bacteria | 6462302 |
| 1401 | 2511322766 | 2511231015 | Bacteria | 6598026 |
| 1402 | 2511326154 | 2511231016 | Bacteria | 6704427 |
| 1403 | 2511333930 | 2511231017 | Bacteria | 6503007 |
| 1404 | 2511339007 | 2511231018 | Bacteria | 6436256 |
| 1405 | 2511347189 | 2511231019 | Bacteria | 6520662 |
| 1406 | 2511349857 | 2511231020 | Bacteria | 6115223 |
| 1407 | 2511354002 | 2511231021 | Bacteria | 7302637 |
| 1408 | 2511365716 | 2511231022 | Bacteria | 6719296 |
| 1409 | 2511376556 | 2511231024 | Bacteria | 5835885 |
| 1410 | 2511410882 | 2511231031 | Bacteria | 6558529 |
| 1411 | 2511823716 | 2511231156 | Bacteria | 6845832 |
| 1412 | 2512323972 | 2512047018 | Bacteria | 6663241 |
| 1413 | 2552748235 | 2551306352 | Bacteria | 3873115 |
| 1414 | 2554815639 | 2554235132 | Bacteria | 6772433 |
| 1415 | 2555244823 | 2554235231 | Bacteria | 5215788 |
| 1416 | 2555671231 | 2554235341 | Bacteria | 6867980 |
| 1417 | 2583793645 | 2582580891 | Bacteria | 6800976 |
| 1418 | 2597859304 | 2597489887 | Bacteria | 6666321 |
| 1419 | 2597863032 | 2597489888 | Bacteria | 6179543 |
| 1420 | 2597868824 | 2597489889 | Bacteria | 6297495 |
| 1421 | 2599326778 | 2599185155 | Bacteria | 5827168 |
| 1422 | 2599354610 | 2599185160 | Bacteria | 6844013 |
| 1423 | 2599359677 | 2599185161 | Bacteria | 6960462 |
| 1424 | 2599365999 | 2599185162 | Bacteria | 6957254 |
| 1425 | 2599372789 | 2599185163 | Bacteria | 6995158 |
| 1426 | 2599379717 | 2599185164 | Bacteria | 6841688 |
| 1427 | 2599385304 | 2599185165 | Bacteria | 6843250 |
| 1428 | 2599391648 | 2599185166 | Bacteria | 6959206 |
| 1429 | 2599401614 | 2599185167 | Bacteria | 6353609 |
| 1430 | 2599403414 | 2599185168 | Bacteria | 6997636 |
| 1431 | 2599451845 | 2599185179 | Bacteria | 6611171 |
| 1432 | 2599461444 | 2599185181 | Bacteria | 6844519 |
| 1433 | 2599469987 | 2599185182 | Bacteria | 6883168 |
| 1434 | 2599482135 | 2599185185 | Bacteria | 6652270 |
| 1435 | 2599490463 | 2599185186 | Bacteria | 6831633 |
| 1436 | 2599504509 | 2599185188 | Bacteria | 6164180 |
| 1437 | 2599509615 | 2599185189 | Bacteria | 5862825 |
| 1438 | 2599514858 | 2599185190 | Bacteria | 6285678 |
| 1439 | 2599520956 | 2599185191 | Bacteria | 6297582 |
| 1440 | 2599611596 | 2599185212 | Bacteria | 6765997 |
| 1441 | 2599770309 | 2599185248 | Bacteria | 6696816 |
| 1442 | 2599804147 | 2599185257 | Bacteria | 6492581 |
| 1443 | 2599882203 | 2599185288 | Bacteria | 6666191 |
| 1444 | 2599887482 | 2599185289 | Bacteria | 6778765 |
| 1445 | 2599894345 | 2599185290 | Bacteria | 6289611 |
| 1446 | 2599901771 | 2599185291 | Bacteria | 6775623 |
| 1447 | 2599934323 | 2599185300 | Bacteria | 6062622 |
| 1448 | 2599941756 | 2599185302 | Bacteria | 5954930 |
| 1449 | 2599951553 | 2599185303 | Bacteria | 6512725 |
| 1450 | 2599952724 | 2599185304 | Bacteria | 5951361 |
| 1451 | 2599960615 | 2599185305 | Bacteria | 6748700 |
| 1452 | 2599964909 | 2599185306 | Bacteria | 6637356 |
| 1453 | 2599971456 | 2599185307 | Bacteria | 6194719 |
| 1454 | 2599975978 | 2599185308 | Bacteria | 6621546 |
| 1455 | 2599981925 | 2599185309 | Bacteria | 5969593 |
| 1456 | 2599987834 | 2599185310 | Bacteria | 6014457 |
| 1457 | 2599995329 | 2599185311 | Bacteria | 6354990 |
| 1458 | 2599998274 | 2599185312 | Bacteria | 5912071 |
| 1459 | 2600005438 | 2599185313 | Bacteria | 6658188 |
| 1460 | 2600010141 | 2599185314 | Bacteria | 6621749 |
| 1461 | 2600017344 | 2599185315 | Bacteria | 6771107 |
| 1462 | 2600022567 | 2599185316 | Bacteria | 6320029 |
| 1463 | 2600027587 | 2599185317 | Bacteria | 6435722 |
| 1464 | 2600034371 | 2599185318 | Bacteria | 6961590 |
| 1465 | 2600039867 | 2599185319 | Bacteria | 6637840 |
| 1466 | 2600046164 | 2599185320 | Bacteria | 5963263 |
| 1467 | 2600052167 | 2599185321 | Bacteria | 6764560 |
| 1468 | 2600057544 | 2599185322 | Bacteria | 6763055 |
| 1469 | 2600064705 | 2599185323 | Bacteria | 6688755 |
| 1470 | 2600072282 | 2599185324 | Bacteria | 6590677 |
| 1471 | 2600075842 | 2599185325 | Bacteria | 6324919 |
| 1472 | 2600214062 | 2599185356 | Bacteria | 6843884 |
| 1473 | 2600356704 | 2600254930 | Bacteria | 6431253 |
| 1474 | 2600364212 | 2600254931 | Bacteria | 6734225 |
| 1475 | 2600442985 | 2600254954 | Bacteria | 5100516 |
| 1476 | 2601624743 | 2600255283 | Bacteria | 6061572 |
| 1477 | 2601694259 | 2600255296 | Bacteria | 5784754 |
| 1478 | 2601774228 | 2600255313 | Bacteria | 6842543 |
| 1479 | 2601796224 | 2600255318 | Bacteria | 6383414 |
| 1480 | 2602009539 | 2600255389 | Bacteria | 5275336 |
| 1481 | 2606073373 | 2603880185 | Bacteria | 6379190 |
| 1482 | 2606126981 | 2603880199 | Bacteria | 6377649 |
| 1483 | 2608383943 | 2606217733 | Bacteria | 6360972 |
| 1484 | 2621300894 | 2619619299 | Bacteria | 6649820 |
| 1485 | 2624481873 | 2623620443 | Bacteria | 6427864 |
| 1486 | 2624491042 | 2623620446 | Bacteria | 6500345 |
| 1487 | 2640734782 | 2639762793 | Bacteria | 3943681 |
| 1488 | 2643830747 | 2643221562 | Bacteria | 4048635 |
| 1489 | 2643845576 | 2643221565 | Bacteria | 6216018 |
| 1490 | 2643871632 | 2643221571 | Bacteria | 6228673 |
| 1491 | 2643956453 | 2643221589 | Bacteria | 6250934 |
| 1492 | 2643974237 | 2643221593 | Bacteria | 6296053 |
| 1493 | 2644025505 | 2643221602 | Bacteria | 6249926 |
| 1494 | 2644187419 | 2643221633 | Bacteria | 6733554 |
| 1495 | 2644284895 | 2643221650 | Bacteria | 7029547 |
| 1496 | 2644623509 | 2643221713 | Bacteria | 6554480 |
| 1497 | 2652547528 | 2651869719 | Bacteria | 6047974 |
| 1498 | 2671094361 | 2667528170 | Bacteria | 6786960 |
| 1499 | 2671097191 | 2667528171 | Bacteria | 6900659 |
| 1500 | 2671126043 | 2667528176 | Bacteria | 6724917 |
| 1501 | 2671770285 | 2671180172 | Bacteria | 6495783 |
| 1502 | 2678231723 | 2675903507 | Bacteria | 3737791 |
| 1503 | 2678262648 | 2675903515 | Bacteria | 6580491 |
| 1504 | 2715751176 | 2713897148 | Bacteria | 5883533 |
| 1505 | 2715758176 | 2713897149 | Bacteria | 6506249 |
| 1506 | 2718635122 | 2718217725 | Bacteria | 5758958 |
| 1507 | 2723247849 | 2721755607 | Bacteria | 5841722 |
| 1508 | 2738670481 | 2738541265 | Bacteria | 6594665 |
| 1509 | 2738688863 | 2738541271 | Bacteria | 5657310 |
| 1510 | 2738748874 | 2738541282 | Bacteria | 6593925 |
| 1511 | 2738810856 | 2738541294 | Bacteria | 6925949 |
| 1512 | 2738857916 | 2738541303 | Bacteria | 6591772 |
| 1513 | 2738898216 | 2738541309 | Bacteria | 6926455 |
| 1514 | 2739201913 | 2738543004 | Bacteria | 6381073 |
| 1515 | 2739259284 | 2738543015 | Bacteria | 6750701 |
| 1516 | 2739264826 | 2738543016 | Bacteria | 5657564 |
| 1517 | 2739287492 | 2738543020 | Bacteria | 5718238 |
| 1518 | 2739292805 | 2738543021 | Bacteria | 5718241 |
| 1519 | 2739314115 | 2738543025 | Bacteria | 6600348 |
| 1520 | 2743738837 | 2740892503 | Bacteria | 6855563 |
| 1521 | 2745008988 | 2744054620 | Bacteria | 6551379 |
| 1522 | 2745160174 | 2744054655 | Bacteria | 3552603 |
| 1523 | 2774123398 | 2773857670 | Bacteria | 6407454 |
| 1524 | 2774132783 | 2773857673 | Bacteria | 6513460 |
| 1525 | 2774389418 | 2773857761 | Bacteria | 3837365 |
| 1526 | 2774436877 | 2773857770 | Bacteria | 3911866 |
| 1527 | 2784263405 | 2784132063 | Bacteria | 6262788 |
| 1528 | 2784316060 | 2784132072 | Bacteria | 6596533 |
| 1529 | 2794596452 | 2791355520 | Bacteria | 5948615 |
| 1530 | 2807409277 | 2806310737 | Bacteria | 5751088 |
| 1531 | 2807457579 | 2806310745 | Bacteria | 5742165 |
| 1532 | 2808855117 | 2808606361 | Bacteria | 6136259 |
| 1533 | 2808924394 | 2808606376 | Bacteria | 6248667 |
| 1534 | 2808930567 | 2808606377 | Bacteria | 6646337 |
| 1535 | 2808935773 | 2808606378 | Bacteria | 6177535 |
| 1536 | 2808942346 | 2808606379 | Bacteria | 5022697 |
| 1537 | 2808946508 | 2808606380 | Bacteria | 6248705 |
| 1538 | 2808952689 | 2808606381 | Bacteria | 6646461 |
| 1539 | 2808957317 | 2808606382 | Bacteria | 6841132 |
| 1540 | 2808963532 | 2808606383 | Bacteria | 6138645 |
| 1541 | 2808979430 | 2808606385 | Bacteria | 6711065 |
| 1542 | 2808995354 | 2808606388 | Bacteria | 6706662 |
| 1543 | 2808998510 | 2808606389 | Bacteria | 6138126 |
| 1544 | 2809218727 | 2808606445 | Bacteria | 6057339 |
| 1545 | 2817489805 | 2816332298 | Bacteria | 6852809 |
| 1546 | 2819655617 | 2818991456 | Bacteria | 6123676 |
| 1547 | 2819702288 | 2818991464 | Bacteria | 6907494 |
| 1548 | 2823424614 | 2823421272 | Bacteria | 5372474 |
| 1549 | 2825652986 | 2825651385 | Bacteria | 6715909 |
| 1550 | 2826583918 | 2826581358 | Bacteria | 5963467 |
| 1551 | 2834029682 | 2834028612 | Bacteria | 6354979 |
| 1552 | 2842806028 | 2842805378 | Bacteria | 5385175 |
| 1553 | 2842820242 | 2842815866 | Bacteria | 5947510 |
| 1554 | 2842831957 | 2842826826 | Bacteria | 5974129 |
| 1555 | 2842836467 | 2842832357 | Bacteria | 5959113 |
| 1556 | 2842841541 | 2842837860 | Bacteria | 6066181 |
| 1557 | 2842844581 | 2842843487 | Bacteria | 6004777 |
| 1558 | 2842850835 | 2842849001 | Bacteria | 5924277 |
| 1559 | 2844671761 | 2844665904 | Bacteria | 6817974 |
| 1560 | 2852618437 | 2852612431 | Bacteria | 6885235 |
| 1561 | 2852662384 | 2852657418 | Bacteria | 6472974 |
| 1562 | 2852673427 | 2852667396 | Bacteria | 6885555 |
| 1563 | 2860340754 | 2860339153 | Bacteria | 6846989 |
| 1564 | 2860869675 | 2860867994 | Bacteria | 5645326 |
| 1565 | 2878033857 | 2878029506 | Bacteria | 6418441 |
| 1566 | 2880234483 | 2880230671 | Bacteria | 6140320 |
| 1567 | 2904521377 | 2904518522 | Bacteria | 6068986 |
| 1568 | 2904555736 | 2904550169 | Bacteria | 6221258 |
| 1569 | 2908448596 | 2908446538 | Bacteria | 6829095 |
| 1570 | 2912967396 | 2912963787 | Bacteria | 5646108 |
| 1571 | 2913038627 | 2913036834 | Bacteria | 6704877 |
| 1572 | 2916702061 | 2916699645 | Bacteria | 3568996 |
| 1573 | 2917075092 | 2917070673 | Bacteria | 6868303 |
| 1574 | 2919068843 | 2919063839 | Bacteria | 6302690 |
| 1575 | 2919182890 | 2919182534 | Bacteria | 3907101 |
| 1576 | 2919387950 | 2919385768 | Bacteria | 5897293 |
| 1577 | 2919461115 | 2919456309 | Bacteria | 6586567 |
| 1578 | 2919481904 | 2919481497 | Bacteria | 6907839 |
| 1579 | 2919489868 | 2919487758 | Bacteria | 5929766 |
| 1580 | 2919504344 | 2919501602 | Bacteria | 5286340 |
| 1581 | 2919507980 | 2919506607 | Bacteria | 3392955 |
| 1582 | 2919702056 | 2919697872 | Bacteria | 6553725 |
| 1583 | 2923157909 | 2923153595 | Bacteria | 6870622 |
| 1584 | 2923520221 | 2923519811 | Bacteria | 6298479 |
| 1585 | 2923587261 | 2923586266 | Bacteria | 6565975 |
| 1586 | 2926065083 | 2926063275 | Bacteria | 5285848 |
| 1587 | 2929146081 | 2929144301 | Bacteria | 6622272 |
| 1588 | 2929191650 | 2929189879 | Bacteria | 5930554 |
| 1589 | 2931370583 | 2931369376 | Bacteria | 6847892 |
| 1590 | 2931392749 | 2931390751 | Bacteria | 6273349 |
| 1591 | 2931403307 | 2931396565 | Bacteria | 7251677 |
| 1592 | 2935356080 | 2935353572 | Unclassified | 6955622 |
| 1593 | 2939614459 | 2939611941 | Bacteria | 3892017 |
| 1594 | 2939637669 | 2939636861 | Bacteria | 6297853 |
| 1595 | 2939652912 | 2939651529 | Bacteria | 5895393 |
| 1596 | 2941493779 | 2941489479 | Bacteria | 6313767 |
| 1597 | 2945928916 | 2945928738 | Bacteria | 6053221 |
| 1598 | 2945962290 | 2945961074 | Bacteria | 7342064 |
| 1599 | 2946011139 | 2946006987 | Bacteria | 6705746 |
| 1600 | 2946029932 | 2946027586 | Bacteria | 6049274 |
| 1601 | 2947236504 | 2947233263 | Bacteria | 6439278 |
| 1602 | 2969308632 | 2969304461 | Bacteria | 6601805 |
| 1603 | 2974289994 | 2974289157 | Bacteria | 6080362 |
| 1604 | 2984288272 | 2984286254 | Bacteria | 6702062 |
| 1605 | 2988733611 | 2988728565 | Bacteria | 6124362 |
| 1606 | 2990198304 | 2990196909 | Bacteria | 4054280 |
| 1607 | 2998143937 | 2998139840 | Bacteria | 6073514 |
| 1608 | 3007397219 | 3007395558 | Bacteria | 6755444 |
| 1609 | 3007424246 | 3007419365 | Bacteria | 7026924 |
| 1610 | 3007515638 | 3007511990 | Bacteria | 6481491 |
| 1611 | 3007616914 | 3007614139 | Bacteria | 6053559 |
| 1612 | 3007625620 | 3007619802 | Bacteria | 6411688 |
| 1613 | 3007718864 | 3007718800 | Bacteria | 5971527 |
| 1614 | 3007865367 | 3007861166 | Bacteria | 6045338 |
| 1615 | 3007870223 | 3007866637 | Bacteria | 5899198 |
| 1616 | 3007875559 | 3007872151 | Bacteria | 5268868 |
| 1617 | 637321560 | 637000220 | Bacteria | 7074893 |
| 1618 | 8011354949 | 8011350971 | Bacteria | 6158957 |
| 1619 | 8015692007 | 8015687852 | Bacteria | 6613826 |
| 1620 | 8019774432 | 8019769354 | Bacteria | 6924660 |
| 1621 | 8019780925 | 8019775933 | Bacteria | 6858656 |
| 1622 | 8029996940 | 8029995093 | Bacteria | 5990776 |
| 1623 | 8033232796 | 8033232454 | Bacteria | 3202805 |
| 1624 | 8034962598 | 8034962539 | Bacteria | 4884839 |
| 1625 | 8052496295 | 8052494512 | Bacteria | 5765634 |
| 1626 | 8054288631 | 8054285046 | Bacteria | 6919322 |
| 1627 | 8054352111 | 8054347763 | Bacteria | 5901107 |
| 1628 | 8054505252 | 8054503363 | Bacteria | 6101651 |
| 1629 | 8054930352 | 8054929484 | Bacteria | 5599761 |
| 1630 | 8055775216 | 8055770955 | Bacteria | 6827675 |
| 1631 | 8055819795 | 8055817908 | Bacteria | 6609162 |
| 1632 | 8055880228 | 8055878733 | Bacteria | 5907058 |
| 1633 | 8056117932 | 8056115690 | Bacteria | 5527654 |
| 1634 | 8056124347 | 8056120720 | Bacteria | 5758328 |
| 1635 | 8056127621 | 8056125926 | Bacteria | 6228218 |
| 1636 | 8056133579 | 8056131705 | Bacteria | 6107031 |
| 1637 | 8056147212 | 8056143049 | Bacteria | 6307666 |
| 1638 | 8056150484 | 8056148874 | Bacteria | 6479865 |
| 1639 | 8056157243 | 8056155041 | Bacteria | 6486948 |
| 1640 | 8056165000 | 8056161164 | Bacteria | 6106669 |
| 1641 | 8056167339 | 8056166840 | Bacteria | 5820959 |
| 1642 | 8056173323 | 8056172158 | Bacteria | 6133900 |
| 1643 | 8056179517 | 8056177738 | Bacteria | 6748268 |
| 1644 | 8056572680 | 8056569372 | Bacteria | 5997322 |
| 1645 | 8057804041 | 8057798959 | Bacteria | 6713499 |
| 1646 | Ga0495591_000040 | |||
| 1647 | MRS2a_Contig_45 | |||
| 1648 | MRS2a_Contig_6898 | |||
| 1649 | SwRhRL2b_contig_1400918 | |||
| 1650 | MRS1b_contig_6133759 | |||
| 1651 | JGI25162J39368_1000077 | |||
| 1652 | JGI25154J39366_1002990 | |||
| 1653 | JGI25163J39215_1000050 | |||
| 1654 | JGI25163J39215_1000126 | |||
| 1655 | JGI25164J39214_1000054 | |||
| 1656 | JGI25164J39214_1000129 | |||
| 1657 | JGI25164J39214_1001811 | |||
| 1658 | JGI25165J46597_1000141 | |||
| 1659 | JGI25165J46597_1000251 | |||
| 1660 | JGI25165J46597_1000405 | |||
| 1661 | Ga0055538_1000090 | |||
| 1662 | Ga0055539_1000134 | |||
| 1663 | Ga0055533_1000138 | |||
| 1664 | Ga0055532_1000142 | |||
| 1665 | Ga0055525_1000183 | |||
| 1666 | Ga0055526_1000024 | |||
| 1667 | Ga0055537_1000180 | |||
| 1668 | Ga0055524_1000174 | |||
| 1669 | Ga0055536_1000239 | |||
| 1670 | Ga0055536_1000345 | |||
| 1671 | Ga0055536_1013222 | |||
| 1672 | Ga0055534_1000084 | |||
| 1673 | Ga0055528_1000016 | |||
| 1674 | Ga0055530_10000053 | |||
| 1675 | Ga0055530_10000289 | |||
| 1676 | Ga0055530_10001084 | |||
| 1677 | Ga0055540_1000105 | |||
| 1678 | Ga0055540_1000252 | |||
| 1679 | Ga0055540_1000790 | |||
| 1680 | Ga0055531_10000081 | |||
| 1681 | Ga0055531_10003476 | |||
| 1682 | Ga0055541_1000089 | |||
| 1683 | Ga0058692_1000001 | |||
| 1684 | Ga0065703_1000531 | |||
| 1685 | Ga0065714_10000016 | |||
| 1686 | Ga0065714_10002400 | |||
| 1687 | Ga0065714_10002585 | |||
| 1688 | Ga0065714_10002591 | |||
| 1689 | Ga0065714_10002616 | |||
| 1690 | Ga0065714_10003051 | |||
| 1691 | Ga0065714_10012583 | |||
| 1692 | Ga0065714_10028718 | |||
| 1693 | Ga0065714_10064635 | |||
| 1694 | Ga0065714_10066389 | |||
| 1695 | Ga0065714_10068183 | |||
| 1696 | Ga0065714_10071681 | |||
| 1697 | Ga0065704_10072159 | |||
| 1698 | Ga0065704_10078350 | |||
| 1699 | Ga0065704_10078370 | |||
| 1700 | Ga0065704_10083106 | |||
| 1701 | Ga0065704_10156508 | |||
| 1702 | Ga0065712_10002698 | |||
| 1703 | Ga0065712_10069156 | |||
| 1704 | Ga0065712_10096430 | |||
| 1705 | Ga0070670_100001221 | |||
| 1706 | Ga0070670_100037913 | |||
| 1707 | Ga0070666_10118520 | |||
| 1708 | Ga0070661_100006952 | |||
| 1709 | Ga0070669_100000316 | |||
| 1710 | Ga0070667_100000095 | |||
| 1711 | Ga0070714_100000079 | |||
| 1712 | Ga0070714_100190557 | |||
| 1713 | Ga0070662_100002228 | |||
| 1714 | Ga0070662_100043321 | |||
| 1715 | Ga0068853_100008519 | |||
| 1716 | Ga0068853_100107967 | |||
| 1717 | Ga0070665_100002661 | |||
| 1718 | Ga0070664_100000046 | |||
| 1719 | Ga0068859_100029592 | |||
| 1720 | Ga0068864_100000073 | |||
| 1721 | Ga0068851_10000050 | |||
| 1722 | Ga0068863_100043616 | |||
| 1723 | Ga0068863_100178337 | |||
| 1724 | Ga0075364_10081778 | |||
| 1725 | Ga0075364_10103678 | |||
| 1726 | Ga0075364_10170037 | |||
| 1727 | Ga0075432_10005424 | |||
| 1728 | Ga0075432_10008465 | |||
| 1729 | Ga0075432_10016442 | |||
| 1730 | Ga0075432_10025635 | |||
| 1731 | Ga0075362_10029925 | |||
| 1732 | Ga0075362_10052703 | |||
| 1733 | Ga0075369_10021203 | |||
| 1734 | Ga0075436_100040597 | |||
| 1735 | Ga0075436_100329914 | |||
| 1736 | Ga0097620_100029589 | |||
| 1737 | Ga0099823_1007660 | |||
| 1738 | Ga0099823_1044831 | |||
| 1739 | Ga0079104_1000124 | |||
| 1740 | Ga0079104_1000366 | |||
| 1741 | Ga0079104_1028267 | |||
| 1742 | Ga0099826_10025975 | |||
| 1743 | Ga0105251_10002695 | |||
| 1744 | Ga0105251_10002821 | |||
| 1745 | Ga0105251_10002860 | |||
| 1746 | Ga0105251_10004546 | |||
| 1747 | Ga0105251_10012498 | |||
| 1748 | Ga0105251_10015340 | |||
| 1749 | Ga0105251_10023765 | |||
| 1750 | Ga0105251_10035496 | |||
| 1751 | Ga0105251_10043360 | |||
| 1752 | Ga0105251_10077863 | |||
| 1753 | Ga0105251_10093381 | |||
| 1754 | Ga0105244_10000322 | |||
| 1755 | Ga0105244_10000983 | |||
| 1756 | Ga0105244_10001384 | |||
| 1757 | Ga0105244_10002008 | |||
| 1758 | Ga0105244_10002410 | |||
| 1759 | Ga0105244_10011071 | |||
| 1760 | Ga0105244_10011158 | |||
| 1761 | Ga0105244_10013783 | |||
| 1762 | Ga0105244_10024905 | |||
| 1763 | Ga0105244_10035659 | |||
| 1764 | Ga0105244_10045365 | |||
| 1765 | Ga0105244_10046440 | |||
| 1766 | Ga0105244_10046962 | |||
| 1767 | Ga0105244_10082614 | |||
| 1768 | Ga0105244_10093793 | |||
| 1769 | Ga0105250_10000319 | |||
| 1770 | Ga0105250_10001041 | |||
| 1771 | Ga0105250_10019670 | |||
| 1772 | Ga0105250_10039633 | |||
| 1773 | Ga0105250_10059168 | |||
| 1774 | Ga0105250_10062480 | |||
| 1775 | Ga0105250_10079968 | |||
| 1776 | Ga0105240_10060050 | |||
| 1777 | Ga0105247_10001068 | |||
| 1778 | Ga0105247_10015109 | |||
| 1779 | Ga0105243_10000010 | |||
| 1780 | Ga0105243_10000103 | |||
| 1781 | Ga0105243_10000405 | |||
| 1782 | Ga0105243_10067022 | |||
| 1783 | Ga0105243_10547595 | |||
| 1784 | Ga0105242_10000360 | |||
| 1785 | Ga0105248_10087748 | |||
| 1786 | Ga0105237_10007888 | |||
| 1787 | Ga0105237_10046669 | |||
| 1788 | Ga0105249_10074808 | |||
| 1789 | Ga0105249_10107172 | |||
| 1790 | Ga0105246_10000222 | |||
| 1791 | Ga0105246_10000465 | |||
| 1792 | Ga0105246_10011023 | |||
| 1793 | Ga0157345_1000026 | |||
| 1794 | Ga0157373_10000195 | |||
| 1795 | Ga0157373_10003312 | |||
| 1796 | Ga0157373_10008594 | |||
| 1797 | Ga0157373_10014944 | |||
| 1798 | Ga0157373_10016275 | |||
| 1799 | Ga0157373_10084348 | |||
| 1800 | Ga0157373_10107284 | |||
| 1801 | Ga0157373_10115674 | |||
| 1802 | Ga0157373_10186006 | |||
| 1803 | Ga0157373_10195614 | |||
| 1804 | Ga0157373_10329660 | |||
| 1805 | Ga0157371_10000186 | |||
| 1806 | Ga0157371_10000306 | |||
| 1807 | Ga0157371_10000390 | |||
| 1808 | Ga0157371_10003300 | |||
| 1809 | Ga0157371_10143257 | |||
| 1810 | Ga0157371_10211376 | |||
| 1811 | Ga0157371_10278483 | |||
| 1812 | Ga0157370_10002694 | |||
| 1813 | Ga0157370_10006604 | |||
| 1814 | Ga0157370_10031366 | |||
| 1815 | Ga0157370_10081529 | |||
| 1816 | Ga0157370_10123431 | |||
| 1817 | Ga0157370_10177604 | |||
| 1818 | Ga0157370_10179169 | |||
| 1819 | Ga0157370_10371820 | |||
| 1820 | Ga0157369_10001322 | |||
| 1821 | Ga0157369_10003927 | |||
| 1822 | Ga0157369_10036004 | |||
| 1823 | Ga0157369_10142783 | |||
| 1824 | Ga0157369_10163971 | |||
| 1825 | Ga0157369_10163972 | |||
| 1826 | Ga0157369_10632499 | |||
| 1827 | Ga0163162_10000072 | |||
| 1828 | Ga0163162_10223361 | |||
| 1829 | Ga0163162_10614266 | |||
| 1830 | Ga0157372_10003177 | |||
| 1831 | Ga0157372_10551341 | |||
| 1832 | Ga0157372_10771673 | |||
| 1833 | Ga0157375_10002479 | |||
| 1834 | Ga0157375_10002644 | |||
| 1835 | Ga0157375_10231135 | |||
| 1836 | Ga0157375_10237035 | |||
| 1837 | Ga0163163_10000230 | |||
| 1838 | Ga0182008_10000074 | |||
| 1839 | Ga0182008_10001296 | |||
| 1840 | Ga0182008_10001314 | |||
| 1841 | Ga0182008_10002229 | |||
| 1842 | Ga0182008_10002908 | |||
| 1843 | Ga0182008_10014512 | |||
| 1844 | Ga0182008_10104963 | |||
| 1845 | Ga0182008_10127260 | |||
| 1846 | Ga0182006_1000183 | |||
| 1847 | Ga0182006_1000326 | |||
| 1848 | Ga0182006_1000780 | |||
| 1849 | Ga0182006_1001649 | |||
| 1850 | Ga0182006_1011937 | |||
| 1851 | Ga0182006_1045388 | |||
| 1852 | Ga0182006_1049914 | |||
| 1853 | Ga0182006_1059794 | |||
| 1854 | Ga0182006_1061523 | |||
| 1855 | Ga0182007_10000903 | |||
| 1856 | Ga0182007_10005553 | |||
| 1857 | Ga0182007_10023350 | |||
| 1858 | Ga0182005_1000308 | |||
| 1859 | Ga0182005_1002027 | |||
| 1860 | Ga0182005_1033783 | |||
| 1861 | Ga0183360_10001 | |||
| 1862 | Ga0163161_10000904 | |||
| 1863 | Ga0163161_10001710 | |||
| 1864 | Ga0163161_10003054 | |||
| 1865 | Ga0163161_10004486 | |||
| 1866 | Ga0163161_10006348 | |||
| 1867 | Ga0163161_10016314 | |||
| 1868 | Ga0163161_10031180 | |||
| 1869 | Ga0163161_10045349 | |||
| 1870 | Ga0163161_10171959 | |||
| 1871 | Ga0163161_10180818 | |||
| 1872 | Ga0163161_10256455 | |||
| 1873 | Ga0209760_100043 | |||
| 1874 | Ga0209760_100054 | |||
| 1875 | Ga0209784_100040 | |||
| 1876 | Ga0209566_100051 | |||
| 1877 | Ga0209674_100072 | |||
| 1878 | Ga0209147_100067 | |||
| 1879 | Ga0209563_100073 | |||
| 1880 | Ga0209563_101021 | |||
| 1881 | Ga0207427_100047 | |||
| 1882 | Ga0207427_100074 | |||
| 1883 | Ga0207427_100123 | |||
| 1884 | Ga0209437_100006 | |||
| 1885 | Ga0209437_100009 | |||
| 1886 | Ga0209437_100227 | |||
| 1887 | Ga0209258_100490 | |||
| 1888 | Ga0209646_1000383 | |||
| 1889 | Ga0209677_100121 | |||
| 1890 | Ga0209233_1000032 | |||
| 1891 | Ga0209233_1000105 | |||
| 1892 | Ga0209233_1000283 | |||
| 1893 | Ga0209565_1000001 | |||
| 1894 | Ga0209565_1009632 | |||
| 1895 | Ga0209673_1000001 | |||
| 1896 | Ga0209675_1000001 | |||
| 1897 | Ga0209675_1003706 | |||
| 1898 | Ga0209676_1000006 | |||
| 1899 | Ga0209676_1000010 | |||
| 1900 | Ga0209676_1000223 | |||
| 1901 | Ga0209676_1000814 | |||
| 1902 | Ga0209676_1003220 | |||
| 1903 | Ga0209676_1003238 | |||
| 1904 | Ga0209025_1000015 | |||
| 1905 | Ga0209564_1000001 | |||
| 1906 | Ga0209050_1000009 | |||
| 1907 | Ga0209050_1000081 | |||
| 1908 | Ga0209050_1000214 | |||
| 1909 | Ga0209050_1000363 | |||
| 1910 | Ga0209256_1000002 | |||
| 1911 | Ga0209051_1000008 | |||
| 1912 | Ga0209051_1000171 | |||
| 1913 | Ga0209051_1000185 | |||
| 1914 | Ga0209051_1013055 | |||
| 1915 | Ga0209257_1000040 | |||
| 1916 | Ga0209257_1000065 | |||
| 1917 | Ga0209257_1000704 | |||
| 1918 | Ga0209257_1015109 | |||
| 1919 | Ga0207656_10000293 | |||
| 1920 | Ga0207696_1000019 | |||
| 1921 | Ga0207696_1000171 | |||
| 1922 | Ga0207696_1000193 | |||
| 1923 | Ga0207696_1002275 | |||
| 1924 | Ga0207696_1005730 | |||
| 1925 | Ga0207696_1020095 | |||
| 1926 | Ga0207696_1035442 | |||
| 1927 | Ga0207696_1040762 | |||
| 1928 | Ga0207696_1057904 | |||
| 1929 | Ga0207655_1000035 | |||
| 1930 | Ga0207655_1000148 | |||
| 1931 | Ga0207655_1000337 | |||
| 1932 | Ga0207655_1000505 | |||
| 1933 | Ga0207655_1000653 | |||
| 1934 | Ga0207655_1001230 | |||
| 1935 | Ga0207655_1002593 | |||
| 1936 | Ga0207655_1002863 | |||
| 1937 | Ga0207655_1004590 | |||
| 1938 | Ga0207655_1004674 | |||
| 1939 | Ga0207655_1005605 | |||
| 1940 | Ga0207655_1007998 | |||
| 1941 | Ga0207655_1013184 | |||
| 1942 | Ga0207655_1015844 | |||
| 1943 | Ga0207655_1018376 | |||
| 1944 | Ga0207655_1026645 | |||
| 1945 | Ga0207655_1035410 | |||
| 1946 | Ga0207655_1053930 | |||
| 1947 | Ga0207655_1059869 | |||
| 1948 | Ga0207713_1000236 | |||
| 1949 | Ga0207713_1000243 | |||
| 1950 | Ga0207713_1000431 | |||
| 1951 | Ga0207713_1000703 | |||
| 1952 | Ga0207713_1001217 | |||
| 1953 | Ga0207713_1003210 | |||
| 1954 | Ga0207713_1003232 | |||
| 1955 | Ga0207713_1003636 | |||
| 1956 | Ga0207713_1003777 | |||
| 1957 | Ga0207713_1006282 | |||
| 1958 | Ga0207713_1019400 | |||
| 1959 | Ga0207713_1026206 | |||
| 1960 | Ga0207713_1040741 | |||
| 1961 | Ga0207713_1064963 | |||
| 1962 | Ga0207710_10000931 | |||
| 1963 | Ga0207710_10005328 | |||
| 1964 | Ga0207680_10024454 | |||
| 1965 | Ga0207647_10002137 | |||
| 1966 | Ga0207705_10014588 | |||
| 1967 | Ga0207695_10126190 | |||
| 1968 | Ga0207671_10000163 | |||
| 1969 | Ga0207657_10028191 | |||
| 1970 | Ga0207649_10000068 | |||
| 1971 | Ga0207649_10005532 | |||
| 1972 | Ga0207681_10000156 | |||
| 1973 | Ga0207681_10000491 | |||
| 1974 | Ga0207681_10070368 | |||
| 1975 | Ga0207650_10000106 | |||
| 1976 | Ga0207650_10000174 | |||
| 1977 | Ga0207650_10004052 | |||
| 1978 | Ga0207664_10000036 | |||
| 1979 | Ga0207644_10000312 | |||
| 1980 | Ga0207706_10001634 | |||
| 1981 | Ga0207706_10018376 | |||
| 1982 | Ga0207706_10110584 | |||
| 1983 | Ga0207686_10007022 | |||
| 1984 | Ga0207709_10000001 | |||
| 1985 | Ga0207709_10000035 | |||
| 1986 | Ga0207709_10000283 | |||
| 1987 | Ga0207709_10005739 | |||
| 1988 | Ga0207709_10009435 | |||
| 1989 | Ga0207709_10468910 | |||
| 1990 | Ga0207711_10001196 | |||
| 1991 | Ga0207679_10000018 | |||
| 1992 | Ga0207667_10001738 | |||
| 1993 | Ga0207712_10042824 | |||
| 1994 | Ga0207658_10000073 | |||
| 1995 | Ga0207703_10209064 | |||
| 1996 | Ga0207639_10005291 | |||
| 1997 | Ga0207702_10009573 | |||
| 1998 | Ga0207641_10108168 | |||
| 1999 | Ga0207641_10114991 | |||
| 2000 | Ga0207676_10000010 | |||
| 2001 | Ga0207674_10045305 | |||
| 2002 | Ga0209281_1000018 | |||
| 2003 | Ga0209281_1000077 | |||
| 2004 | Ga0209281_1003883 | |||
| 2005 | Ga0209389_1000183 | |||
| 2006 | Ga0209371_1000008 | |||
| 2007 | Ga0209282_1084162 | |||
| 2008 | Ga0207428_10079005 | |||
| 2009 | Ga0207428_10082776 | |||
| 2010 | Ga0268266_10011671 | |||
| 2011 | Ga0268265_10001641 | |||
| 2012 | Ga0268265_10300420 | |||
| 2013 | Ga0307517_10032127 | |||
| 2014 | Ga0307515_10217506 | |||
| 2015 | Ga0265324_10000297 | |||
| 2016 | Ga0268256_1000009 | |||
| 2017 | Ga0307511_10104950 | |||
| 2018 | Ga0316179_1111071 | |||
| 2019 | Ga0316178_1101239 | |||
| 2020 | Ga0316181_1090174 | |||
| 2021 | Ga0265331_10008951 | |||
| 2022 | Ga0265327_10001967 | |||
| 2023 | Ga0307513_10072433 | |||
| 2024 | Ga0307408_100000081 | |||
| 2025 | Ga0307408_100003463 | |||
| 2026 | Ga0307408_100006501 | |||
| 2027 | Ga0307408_100016487 | |||
| 2028 | Ga0307408_100184706 | |||
| 2029 | Ga0307408_100245987 | |||
| 2030 | Ga0307408_100259451 | |||
| 2031 | Ga0265314_10029286 | |||
| 2032 | Ga0307405_10000154 | |||
| 2033 | Ga0307405_10038238 | |||
| 2034 | Ga0307405_10174571 | |||
| 2035 | Ga0307405_10178476 | |||
| 2036 | Ga0307413_10020405 | |||
| 2037 | Ga0307406_10033549 | |||
| 2038 | Ga0307406_10119493 | |||
| 2039 | Ga0307406_10522625 | |||
| 2040 | Ga0307407_10025106 | |||
| 2041 | Ga0307412_10000455 | |||
| 2042 | Ga0307412_10013685 | |||
| 2043 | Ga0307412_10018233 | |||
| 2044 | Ga0307412_10164765 | |||
| 2045 | Ga0307412_10404310 | |||
| 2046 | Ga0307409_100054401 | |||
| 2047 | Ga0307416_100320190 | |||
| 2048 | Ga0307414_10001581 | |||
| 2049 | Ga0307414_10003099 | |||
| 2050 | Ga0307414_10013524 | |||
| 2051 | Ga0307414_10102705 | |||
| 2052 | Ga0307414_10210395 | |||
| 2053 | Ga0307414_10234484 | |||
| 2054 | Ga0307414_10277994 | |||
| 2055 | Ga0307411_10096674 | |||
| 2056 | Ga0307510_10001867 | |||
| 2057 | Ga0395900_0275928 | |||
| 2058 | Ga0395901_0003337 | |||
| 2059 | Ga0237819_01027 | |||
| 2060 | Ga0439438_000117 | |||
| 2061 | Ga0439438_000138 | |||
| 2062 | Ga0439438_000173 | |||
| 2063 | Ga0439438_000239 | |||
| 2064 | Ga0439438_000256 | |||
| 2065 | Ga0439438_000363 | |||
| 2066 | Ga0439438_000507 | |||
| 2067 | Ga0439438_002416 | |||
| 2068 | Ga0439438_004071 | |||
| 2069 | Ga0439438_004981 | |||
| 2070 | Ga0439438_005177 | |||
| 2071 | Ga0439447_000140 | |||
| 2072 | Ga0439447_000329 | |||
| 2073 | Ga0439447_000342 | |||
| 2074 | Ga0439447_000407 | |||
| 2075 | Ga0439447_014373 | |||
| 2076 | Ga0439447_015791 | |||
| 2077 | Ga0439447_033029 | |||
| 2078 | Ga0439466_0000132 | |||
| 2079 | Ga0439466_0000162 | |||
| 2080 | Ga0439466_0000743 | |||
| 2081 | Ga0439466_0000788 | |||
| 2082 | Ga0439466_0001964 | |||
| 2083 | Ga0439466_0002036 | |||
| 2084 | Ga0439466_0002608 | |||
| 2085 | Ga0439466_0003203 | |||
| 2086 | Ga0439466_0008029 | |||
| 2087 | Ga0439466_0009942 | |||
| 2088 | Ga0439466_0010992 | |||
| 2089 | Ga0439466_0021770 | |||
| 2090 | Ga0439466_0021989 | |||
| 2091 | Ga0439466_0032499 | |||
| 2092 | Ga0439466_0033826 | |||
| 2093 | Ga0451791_1891926 | |||
| 2094 | Ga0451802_1143217 | |||
| 2095 | Ga0451843_0211047 | |||
| 2096 | Ga0439431_0000105 | |||
| 2097 | Ga0439431_0021791 | |||
| 2098 | Ga0439437_002196 | |||
| 2099 | Ga0439445_0004866 | |||
| 2100 | Ga0439445_0013118 | |||
| 2101 | Ga0439432_000089 | |||
| 2102 | Ga0439432_000221 | |||
| 2103 | Ga0439432_001589 | |||
| 2104 | Ga0439432_001874 | |||
| 2105 | Ga0439432_002497 | |||
| 2106 | Ga0439432_002504 | |||
| 2107 | Ga0439432_004120 | |||
| 2108 | Ga0439432_010913 | |||
| 2109 | Ga0439432_037642 | |||
| 2110 | Ga0439451_000109 | |||
| 2111 | Ga0439451_000212 | |||
| 2112 | Ga0439451_000301 | |||
| 2113 | Ga0439451_004702 | |||
| 2114 | Ga0439452_000091 | |||
| 2115 | Ga0439452_000164 | |||
| 2116 | Ga0439452_000322 | |||
| 2117 | Ga0439452_000524 | |||
| 2118 | Ga0439452_001381 | |||
| 2119 | Ga0439452_001571 | |||
| 2120 | Ga0439452_002476 | |||
| 2121 | Ga0439452_016994 | |||
| 2122 | Ga0439452_031882 | |||
| 2123 | Ga0439452_032230 | |||
| 2124 | Ga0439456_000045 | |||
| 2125 | Ga0439456_000591 | |||
| 2126 | Ga0439456_001443 | |||
| 2127 | Ga0439456_002921 | |||
| 2128 | Ga0439456_007095 | |||
| 2129 | Ga0439456_026218 | |||
| 2130 | Ga0439463_000018 | |||
| 2131 | Ga0439463_001447 | |||
| 2132 | Ga0439463_003061 | |||
| 2133 | Ga0439463_007616 | |||
| 2134 | Ga0439463_025793 | |||
| 2135 | Ga0439463_028765 | |||
| 2136 | Ga0439463_029075 | |||
| 2137 | Ga0450911_000025 | |||
| 2138 | Ga0450911_000285 | |||
| 2139 | Ga0450911_003117 | |||
| 2140 | Ga0450919_000038 | |||
| 2141 | Ga0450919_007800 | |||
| 2142 | Ga0450920_000199 | |||
| 2143 | Ga0450890_000152 | |||
| 2144 | Ga0450891_001459 | |||
| 2145 | Ga0450900_000722 | |||
| 2146 | Ga0450902_001746 | |||
| 2147 | Ga0450902_003138 | |||
| 2148 | Ga0450902_003286 | |||
| 2149 | Ga0450902_005800 | |||
| 2150 | Ga0450902_010143 | |||
| 2151 | Ga0450903_000362 | |||
| 2152 | Ga0450903_001182 | |||
| 2153 | Ga0450904_000293 | |||
| 2154 | Ga0450904_000791 | |||
| 2155 | Ga0450905_000727 | |||
| 2156 | Ga0450905_003680 | |||
| 2157 | Ga0450906_000028 | |||
| 2158 | Ga0450906_004054 | |||
| 2159 | Ga0450907_000038 | |||
| 2160 | Ga0450907_000289 | |||
| 2161 | Ga0450910_000392 | |||
| 2162 | Ga0450910_001305 | |||
| 2163 | Ga0439446_0000090 | |||
| 2164 | Ga0439446_0000409 | |||
| 2165 | Ga0439446_0026693 | |||
| 2166 | Ga0450908_000046 | |||
| 2167 | Ga0450909_000105 | |||
| 2168 | Ga0450909_001359 | |||
| 2169 | Ga0450909_013840 | |||
| 2170 | Ga0439434_0000034 | |||
| 2171 | Ga0439434_0000277 | |||
| 2172 | Ga0439434_0007412 | |||
| 2173 | Ga0439464_0001412 | |||
| 2174 | Ga0439464_0061057 | |||
| 2175 | Ga0439460_0000015 | |||
| 2176 | Ga0439460_0000042 | |||
| 2177 | Ga0439460_0000776 | |||
| 2178 | Ga0450918_000605 | |||
| 2179 | Ga0450918_016410 | |||
| 2180 | Ga0450893_0004947 | |||
| 2181 | Ga0450901_000332 | |||
| 2182 | Ga0495617_000212 | |||
| 2183 | Ga0495617_001755 | |||
| 2184 | Ga0495617_002016 | |||
| 2185 | Ga0495617_004691 | |||
| 2186 | Ga0495617_007689 | |||
| 2187 | Ga0495617_011768 | |||
| 2188 | Ga0495617_018731 | |||
| 2189 | Ga0495617_035688 | |||
| 2190 | Ga0495617_048361 | |||
| 2191 | Ga0495617_055422 | |||
| 2192 | Ga0495627_000362 | |||
| 2193 | Ga0495627_000447 | |||
| 2194 | Ga0495627_000546 | |||
| 2195 | Ga0495627_000709 | |||
| 2196 | Ga0495627_001245 | |||
| 2197 | Ga0495627_002123 | |||
| 2198 | Ga0495627_002337 | |||
| 2199 | Ga0495627_016192 | |||
| 2200 | Ga0495627_034333 | |||
| 2201 | Ga0495627_039660 | |||
| 2202 | Ga0495627_052048 | |||
| 2203 | Ga0495592_0005799 | |||
| 2204 | Ga0495603_0003172 | |||
| 2205 | Ga0495603_0021379 | |||
| 2206 | Ga0495603_0048503 | |||
| 2207 | Ga0495590_0000265 | |||
| 2208 | Ga0495590_0001638 | |||
| 2209 | Ga0495590_0001639 | |||
| 2210 | Ga0495590_0003337 | |||
| 2211 | Ga0495590_0026001 | |||
| 2212 | Ga0495590_0033137 | |||
| 2213 | Ga0495590_0047250 | |||
| 2214 | Ga0495591_000107 | |||
| 2215 | Ga0495591_000114 | |||
| 2216 | Ga0495591_000510 | |||
| 2217 | Ga0495591_000564 | |||
| 2218 | Ga0495591_001029 | |||
| 2219 | Ga0495591_001088 | |||
| 2220 | Ga0495591_001477 | |||
| 2221 | Ga0495591_001675 | |||
| 2222 | Ga0495591_001731 | |||
| 2223 | Ga0495591_002868 | |||
| 2224 | Ga0495591_003614 | |||
| 2225 | Ga0495591_005843 | |||
| 2226 | Ga0495591_010336 | |||
| 2227 | Ga0495591_014326 | |||
| 2228 | Ga0495591_019943 | |||
| 2229 | Ga0495591_029694 | |||
| 2230 | Ga0495591_032121 | |||
| 2231 | Ga0495591_033899 | |||
| 2232 | Ga0495629_0024544 | |||
| 2233 | Ga0495629_0273021 | |||
| 2234 | Ga0495638_0000991 | |||
| 2235 | Ga0495638_0001231 | |||
| 2236 | Ga0495638_0001573 | |||
| 2237 | Ga0495638_0002232 | |||
| 2238 | Ga0495638_0003134 | |||
| 2239 | Ga0495638_0003343 | |||
| 2240 | Ga0495638_0004346 | |||
| 2241 | Ga0495638_0010611 | |||
| 2242 | Ga0495638_0017083 | |||
| 2243 | Ga0495638_0019886 | |||
| 2244 | Ga0495638_0026591 | |||
| 2245 | Ga0495638_0027711 | |||
| 2246 | Ga0495638_0028671 | |||
| 2247 | Ga0495638_0030254 | |||
| 2248 | Ga0495638_0053624 | |||
| 2249 | Ga0495638_0148070 | |||
| 2250 | Ga0495653_0000788 | |||
| 2251 | Ga0495653_0002108 | |||
| 2252 | Ga0495653_0011081 | |||
| 2253 | Ga0495653_0012237 | |||
| 2254 | Ga0495650_0001300 | |||
| 2255 | Ga0495650_0001590 | |||
| 2256 | Ga0495650_0001706 | |||
| 2257 | Ga0495650_0002399 | |||
| 2258 | Ga0495650_0002419 | |||
| 2259 | Ga0495650_0006965 | |||
| 2260 | Ga0495650_0007104 | |||
| 2261 | Ga0495650_0010355 | |||
| 2262 | Ga0495650_0012083 | |||
| 2263 | Ga0495650_0012952 | |||
| 2264 | Ga0495650_0021128 | |||
| 2265 | Ga0495650_0023898 | |||
| 2266 | Ga0495580_0139791 | |||
| 2267 | Ga0495582_0026353 | |||
| 2268 | Ga0495605_0000017 | |||
| 2269 | Ga0495605_0000026 | |||
| 2270 | Ga0495605_0000105 | |||
| 2271 | Ga0495605_0000220 | |||
| 2272 | Ga0495605_0000527 | |||
| 2273 | Ga0495605_0000771 | |||
| 2274 | Ga0495605_0002351 | |||
| 2275 | Ga0495605_0003511 | |||
| 2276 | Ga0495605_0008134 | |||
| 2277 | Ga0495605_0011041 | |||
| 2278 | Ga0495605_0011331 | |||
| 2279 | Ga0495605_0012790 | |||
| 2280 | Ga0495605_0015222 | |||
| 2281 | Ga0495605_0032978 | |||
| 2282 | Ga0495605_0123154 | |||
| 2283 | Ga0495605_0161284 | |||
| 2284 | Ga0495639_0000013 | |||
| 2285 | Ga0495639_0003712 | |||
| 2286 | Ga0495664_0247964 | |||
| 2287 | Ga0495584_0000278 | |||
| 2288 | Ga0495584_0000387 | |||
| 2289 | Ga0495584_0001274 | |||
| 2290 | Ga0495584_0001924 | |||
| 2291 | Ga0495584_0002861 | |||
| 2292 | Ga0495584_0005446 | |||
| 2293 | Ga0495584_0007713 | |||
| 2294 | Ga0495584_0007797 | |||
| 2295 | Ga0495584_0010038 | |||
| 2296 | Ga0495584_0028688 | |||
| 2297 | Ga0495584_0031935 | |||
| 2298 | Ga0495584_0050768 | |||
| 2299 | Ga0495584_0112683 | |||
| 2300 | Ga0495585_0000517 | |||
| 2301 | Ga0495585_0001652 | |||
| 2302 | Ga0495585_0001662 | |||
| 2303 | Ga0495585_0002225 | |||
| 2304 | Ga0495585_0010737 | |||
| 2305 | Ga0495585_0011757 | |||
| 2306 | Ga0495585_0013369 | |||
| 2307 | Ga0495585_0013745 | |||
| 2308 | Ga0495585_0015029 | |||
| 2309 | Ga0495585_0015780 | |||
| 2310 | Ga0495585_0018382 | |||
| 2311 | Ga0495585_0030948 | |||
| 2312 | Ga0495585_0193086 | |||
| 2313 | Ga0495594_0000140 | |||
| 2314 | Ga0495594_0001728 | |||
| 2315 | Ga0495594_0002505 | |||
| 2316 | Ga0495594_0013395 | |||
| 2317 | Ga0495596_0000107 | |||
| 2318 | Ga0495596_0000805 | |||
| 2319 | Ga0495596_0030167 | |||
| 2320 | Ga0495596_0065907 | |||
| 2321 | Ga0495596_0078758 | |||
| 2322 | Ga0495596_0085338 | |||
| 2323 | Ga0495607_0000013 | |||
| 2324 | Ga0495607_0000022 | |||
| 2325 | Ga0495607_0000159 | |||
| 2326 | Ga0495607_0000309 | |||
| 2327 | Ga0495607_0000481 | |||
| 2328 | Ga0495607_0000840 | |||
| 2329 | Ga0495607_0001111 | |||
| 2330 | Ga0495607_0002005 | |||
| 2331 | Ga0495607_0003922 | |||
| 2332 | Ga0495607_0004541 | |||
| 2333 | Ga0495607_0005301 | |||
| 2334 | Ga0495607_0005426 | |||
| 2335 | Ga0495607_0006347 | |||
| 2336 | Ga0495607_0006901 | |||
| 2337 | Ga0495607_0009223 | |||
| 2338 | Ga0495607_0014841 | |||
| 2339 | Ga0495607_0015338 | |||
| 2340 | Ga0495607_0030346 | |||
| 2341 | Ga0495607_0033184 | |||
| 2342 | Ga0495607_0041669 | |||
| 2343 | Ga0495607_0043446 | |||
| 2344 | Ga0495607_0061470 | |||
| 2345 | Ga0495607_0104522 | |||
| 2346 | Ga0495607_0123425 | |||
| 2347 | Ga0495607_0137929 | |||
| 2348 | Ga0495583_0000043 | |||
| 2349 | Ga0495583_0000192 | |||
| 2350 | Ga0495583_0000645 | |||
| 2351 | Ga0495583_0000684 | |||
| 2352 | Ga0495583_0000714 | |||
| 2353 | Ga0495583_0000940 | |||
| 2354 | Ga0495583_0001057 | |||
| 2355 | Ga0495583_0001472 | |||
| 2356 | Ga0495583_0001622 | |||
| 2357 | Ga0495583_0003309 | |||
| 2358 | Ga0495583_0005709 | |||
| 2359 | Ga0495583_0010559 | |||
| 2360 | Ga0495606_0000362 | |||
| 2361 | Ga0495606_0000367 | |||
| 2362 | Ga0495606_0001081 | |||
| 2363 | Ga0495606_0001228 | |||
| 2364 | Ga0495606_0001261 | |||
| 2365 | Ga0495606_0001308 | |||
| 2366 | Ga0495606_0001970 | |||
| 2367 | Ga0495606_0002333 | |||
| 2368 | Ga0495606_0003639 | |||
| 2369 | Ga0495606_0009526 | |||
| 2370 | Ga0495606_0009574 | |||
| 2371 | Ga0495606_0018779 | |||
| 2372 | Ga0495606_0024039 | |||
| 2373 | Ga0495606_0034007 | |||
| 2374 | Ga0495606_0147229 | |||
| 2375 | Ga0495606_0203747 | |||
| 2376 | Ga0495606_0211197 | |||
| 2377 | Ga0495610_0000723 | |||
| 2378 | Ga0495610_0000761 | |||
| 2379 | Ga0495610_0001455 | |||
| 2380 | Ga0495610_0001620 | |||
| 2381 | Ga0495610_0001992 | |||
| 2382 | Ga0495610_0007995 | |||
| 2383 | Ga0495610_0008038 | |||
| 2384 | Ga0495610_0010674 | |||
| 2385 | Ga0495610_0011001 | |||
| 2386 | Ga0495610_0013504 | |||
| 2387 | Ga0495610_0015957 | |||
| 2388 | Ga0495610_0088072 | |||
| 2389 | Ga0495616_0000340 | |||
| 2390 | Ga0495616_0000482 | |||
| 2391 | Ga0495616_0002159 | |||
| 2392 | Ga0495616_0008773 | |||
| 2393 | Ga0495616_0009458 | |||
| 2394 | Ga0495616_0012758 | |||
| 2395 | Ga0495616_0016266 | |||
| 2396 | Ga0495616_0023177 | |||
| 2397 | Ga0495616_0055908 | |||
| 2398 | Ga0495616_0085043 | |||
| 2399 | Ga0495616_0133127 | |||
| 2400 | Ga0495616_0159055 | |||
| 2401 | Ga0495620_0000075 | |||
| 2402 | Ga0495620_0000114 | |||
| 2403 | Ga0495620_0000170 | |||
| 2404 | Ga0495620_0000307 | |||
| 2405 | Ga0495620_0002176 | |||
| 2406 | Ga0495620_0002439 | |||
| 2407 | Ga0495620_0002887 | |||
| 2408 | Ga0495620_0006034 | |||
| 2409 | Ga0495620_0007339 | |||
| 2410 | Ga0495620_0011137 | |||
| 2411 | Ga0495620_0020589 | |||
| 2412 | Ga0495620_0020799 | |||
| 2413 | Ga0495620_0076483 | |||
| 2414 | Ga0495630_0010683 | |||
| 2415 | Ga0495630_0014997 | |||
| 2416 | Ga0495631_0000020 | |||
| 2417 | Ga0495631_0000384 | |||
| 2418 | Ga0495631_0000609 | |||
| 2419 | Ga0495631_0001218 | |||
| 2420 | Ga0495631_0001327 | |||
| 2421 | Ga0495631_0006461 | |||
| 2422 | Ga0495631_0010943 | |||
| 2423 | Ga0495631_0024729 | |||
| 2424 | Ga0495631_0025838 | |||
| 2425 | Ga0495631_0030128 | |||
| 2426 | Ga0495631_0056485 | |||
| 2427 | Ga0495631_0063302 | |||
| 2428 | Ga0495632_0000255 | |||
| 2429 | Ga0495632_0000436 | |||
| 2430 | Ga0495632_0000790 | |||
| 2431 | Ga0495632_0000965 | |||
| 2432 | Ga0495632_0001749 | |||
| 2433 | Ga0495632_0002297 | |||
| 2434 | Ga0495632_0003622 | |||
| 2435 | Ga0495632_0004384 | |||
| 2436 | Ga0495632_0010001 | |||
| 2437 | Ga0495632_0014829 | |||
| 2438 | Ga0495632_0014837 | |||
| 2439 | Ga0495632_0029689 | |||
| 2440 | Ga0495632_0034296 | |||
| 2441 | Ga0495632_0034571 | |||
| 2442 | Ga0495632_0045524 | |||
| 2443 | Ga0495632_0060478 | |||
| 2444 | Ga0495632_0064189 | |||
| 2445 | Ga0495632_0069523 | |||
| 2446 | Ga0495632_0122043 | |||
| 2447 | Ga0495637_0000043 | |||
| 2448 | Ga0495637_0000420 | |||
| 2449 | Ga0495637_0000442 | |||
| 2450 | Ga0495637_0000447 | |||
| 2451 | Ga0495637_0000616 | |||
| 2452 | Ga0495637_0001545 | |||
| 2453 | Ga0495637_0001927 | |||
| 2454 | Ga0495637_0004671 | |||
| 2455 | Ga0495637_0008453 | |||
| 2456 | Ga0495637_0009920 | |||
| 2457 | Ga0495637_0011626 | |||
| 2458 | Ga0495637_0014251 | |||
| 2459 | Ga0495637_0018855 | |||
| 2460 | Ga0495637_0024902 | |||
| 2461 | Ga0495637_0026502 | |||
| 2462 | Ga0495637_0030811 | |||
| 2463 | Ga0495643_0000049 | |||
| 2464 | Ga0495643_0000401 | |||
| 2465 | Ga0495643_0000647 | |||
| 2466 | Ga0495643_0001444 | |||
| 2467 | Ga0495643_0004481 | |||
| 2468 | Ga0495643_0008120 | |||
| 2469 | Ga0495643_0009497 | |||
| 2470 | Ga0495643_0011154 | |||
| 2471 | Ga0495643_0013208 | |||
| 2472 | Ga0495643_0020133 | |||
| 2473 | Ga0495643_0020193 | |||
| 2474 | Ga0495643_0029136 | |||
| 2475 | Ga0495643_0100509 | |||
| 2476 | Ga0495644_0000193 | |||
| 2477 | Ga0495644_0000508 | |||
| 2478 | Ga0495644_0000998 | |||
| 2479 | Ga0495644_0003222 | |||
| 2480 | Ga0495644_0010173 | |||
| 2481 | Ga0495644_0013086 | |||
| 2482 | Ga0495644_0028333 | |||
| 2483 | Ga0495648_0000327 | |||
| 2484 | Ga0495648_0000627 | |||
| 2485 | Ga0495648_0001249 | |||
| 2486 | Ga0495648_0001427 | |||
| 2487 | Ga0495648_0003384 | |||
| 2488 | Ga0495648_0004361 | |||
| 2489 | Ga0495648_0004765 | |||
| 2490 | Ga0495648_0004814 | |||
| 2491 | Ga0495648_0007585 | |||
| 2492 | Ga0495648_0007721 | |||
| 2493 | Ga0495648_0012937 | |||
| 2494 | Ga0495648_0016013 | |||
| 2495 | Ga0495648_0016995 | |||
| 2496 | Ga0495648_0028598 | |||
| 2497 | Ga0495648_0028614 | |||
| 2498 | Ga0495648_0048002 | |||
| 2499 | Ga0495648_0069536 | |||
| 2500 | Ga0495648_0070245 | |||
| 2501 | Ga0495648_0133717 | |||
| 2502 | Ga0495663_0000254 | |||
| 2503 | Ga0495666_0000190 | |||
| 2504 | Ga0495666_0001791 | |||
| 2505 | Ga0495666_0010302 | |||
| 2506 | Ga0495666_0012665 | |||
| 2507 | Ga0495666_0033403 | |||
| 2508 | Ga0495666_0041931 | |||
| 2509 | Ga0495642_0000033 | |||
| 2510 | Ga0495642_0000251 | |||
| 2511 | Ga0495642_0000900 | |||
| 2512 | Ga0495654_0000111 | |||
| 2513 | Ga0495654_0000298 | |||
| 2514 | Ga0495654_0000324 | |||
| 2515 | Ga0495654_0000784 | |||
| 2516 | Ga0495654_0000841 | |||
| 2517 | Ga0495654_0000936 | |||
| 2518 | Ga0495654_0000982 | |||
| 2519 | Ga0495654_0002582 | |||
| 2520 | Ga0495654_0003751 | |||
| 2521 | Ga0495654_0006337 | |||
| 2522 | Ga0495654_0007625 | |||
| 2523 | Ga0495654_0012184 | |||
| 2524 | Ga0495654_0015224 | |||
| 2525 | Ga0495654_0029278 | |||
| 2526 | Ga0495654_0030089 | |||
| 2527 | Ga0495654_0046569 | |||
| 2528 | Ga0495654_0050675 | |||
| 2529 | Ga0495654_0053809 | |||
| 2530 | Ga0495654_0063978 | |||
| 2531 | Ga0495654_0064557 | |||
| 2532 | Ga0495654_0068608 | |||
| 2533 | Ga0495654_0079416 | |||
| 2534 | Ga0495654_0082682 | |||
| 2535 | Ga0495654_0110814 | |||
| 2536 | Ga0495654_0112973 | |||
| 2537 | Ga0495587_0000454 | |||
| 2538 | Ga0495587_0002320 | |||
| 2539 | Ga0495587_0046233 | |||
| 2540 | Ga0495587_0170833 | |||
| 2541 | Ga0495609_0000036 | |||
| 2542 | Ga0495609_0000045 | |||
| 2543 | Ga0495609_0000049 | |||
| 2544 | Ga0495609_0000405 | |||
| 2545 | Ga0495609_0001082 | |||
| 2546 | Ga0495609_0002678 | |||
| 2547 | Ga0495609_0003612 | |||
| 2548 | Ga0495609_0004013 | |||
| 2549 | Ga0495609_0007819 | |||
| 2550 | Ga0495609_0011375 | |||
| 2551 | Ga0495609_0015814 | |||
| 2552 | Ga0495609_0042453 | |||
| 2553 | Ga0495609_0068490 | |||
| 2554 | Ga0495609_0138747 | |||
| 2555 | Ga0495597_0000013 | |||
| 2556 | Ga0495597_0000574 | |||
| 2557 | Ga0495597_0001021 | |||
| 2558 | Ga0495597_0001346 | |||
| 2559 | Ga0495597_0002441 | |||
| 2560 | Ga0495597_0009911 | |||
| 2561 | Ga0495597_0013507 | |||
| 2562 | Ga0495597_0016615 | |||
| 2563 | Ga0495597_0019026 | |||
| 2564 | Ga0495597_0057294 | |||
| 2565 | Ga0495645_0023776 | |||
| 2566 | Ga0495645_0068352 | |||
| 2567 | Ga0495645_0252176 | |||
| 2568 | Ga0495622_0000346 | |||
| 2569 | Ga0495622_0000757 | |||
| 2570 | Ga0495622_0003859 | |||
| 2571 | Ga0495622_0006630 | |||
| 2572 | Ga0495622_0027975 | |||
| 2573 | Ga0495622_0037699 | |||
| 2574 | Ga0495622_0041437 | |||
| 2575 | Ga0495622_0062426 | |||
| 2576 | Ga0495622_0072793 | |||
| 2577 | Ga0495633_0000229 | |||
| 2578 | Ga0495633_0000960 | |||
| 2579 | Ga0495633_0001099 | |||
| 2580 | Ga0495633_0009543 | |||
| 2581 | Ga0495633_0022014 | |||
| 2582 | Ga0495633_0026649 | |||
| 2583 | Ga0495656_0128887 | |||
| 2584 | Ga0495668_0000568 | |||
| 2585 | Ga0495668_0001696 | |||
| 2586 | Ga0495668_0021584 | |||
| 2587 | Ga0495668_0069885 | |||
| 2588 | Ga0495668_0117648 | |||
| 2589 | Ga0495668_0226720 | |||
| 2590 | Ga0495634_0000604 | |||
| 2591 | Ga0495634_0007150 | |||
| 2592 | Ga0495611_0000220 | |||
| 2593 | Ga0495611_0000472 | |||
| 2594 | Ga0495611_0001173 | |||
| 2595 | Ga0495611_0002514 | |||
| 2596 | Ga0495611_0008346 | |||
| 2597 | Ga0495611_0009865 | |||
| 2598 | Ga0495611_0013461 | |||
| 2599 | Ga0495611_0021500 | |||
| 2600 | Ga0495625_0000070 | |||
| 2601 | Ga0495625_0001145 | |||
| 2602 | Ga0495625_0001301 | |||
| 2603 | Ga0495625_0001848 | |||
| 2604 | Ga0495625_0002099 | |||
| 2605 | Ga0495625_0002421 | |||
| 2606 | Ga0495625_0003237 | |||
| 2607 | Ga0495625_0007897 | |||
| 2608 | Ga0495625_0017092 | |||
| 2609 | Ga0495625_0017490 | |||
| 2610 | Ga0495625_0018386 | |||
| 2611 | Ga0495625_0019131 | |||
| 2612 | Ga0495625_0047775 | |||
| 2613 | Ga0495625_0078182 | |||
| 2614 | Ga0495625_0088804 | |||
| 2615 | Ga0495625_0130411 | |||
| 2616 | Ga0495625_0167679 | |||
| 2617 | Ga0495635_0000247 | |||
| 2618 | Ga0495635_0037121 | |||
| 2619 | Ga0495659_0000162 | |||
| 2620 | Ga0495659_0005203 | |||
| 2621 | Ga0495661_0000042 | |||
| 2622 | Ga0495661_0000312 | |||
| 2623 | Ga0495661_0000545 | |||
| 2624 | Ga0495661_0000867 | |||
| 2625 | Ga0495661_0003095 | |||
| 2626 | Ga0495661_0003984 | |||
| 2627 | Ga0495661_0008243 | |||
| 2628 | Ga0495661_0012485 | |||
| 2629 | Ga0495661_0012911 | |||
| 2630 | Ga0495661_0019090 | |||
| 2631 | Ga0495661_0020701 | |||
| 2632 | Ga0495661_0026075 | |||
| 2633 | Ga0495661_0037357 | |||
| 2634 | Ga0495661_0073479 | |||
| 2635 | Ga0495661_0113131 | |||
| 2636 | Ga0495661_0122272 | |||
| 2637 | Ga0495588_0011494 | |||
| 2638 | Ga0495588_0034802 | |||
| 2639 | Ga0495588_0052241 | |||
| 2640 | Ga0495588_0063121 | |||
| 2641 | Ga0495588_0074595 | |||
| 2642 | Ga0495599_0091482 | |||
| 2643 | Ga0495623_0000555 | |||
| 2644 | Ga0495623_0007106 | |||
| 2645 | Ga0495646_0000263 | |||
| 2646 | Ga0495646_0000651 | |||
| 2647 | Ga0495646_0006393 | |||
| 2648 | Ga0495669_0004289 | |||
| 2649 | Ga0495613_0010387 | |||
| 2650 | Ga0495613_0012057 | |||
| 2651 | Ga0495613_0012280 | |||
| 2652 | Ga0495624_0000533 | |||
| 2653 | Ga0495670_0000115 | |||
| 2654 | Ga0495670_0000146 | |||
| 2655 | Ga0495670_0000969 | |||
| 2656 | Ga0495670_0001578 | |||
| 2657 | Ga0495670_0002156 | |||
| 2658 | Ga0495670_0007144 | |||
| 2659 | Ga0495670_0011830 | |||
| 2660 | Ga0495670_0012118 | |||
| 2661 | Ga0495670_0015984 | |||
| 2662 | Ga0495670_0024246 | |||
| 2663 | Ga0495670_0067040 | |||
| 2664 | Ga0495671_0000380 | |||
| 2665 | Ga0495671_0000428 | |||
| 2666 | Ga0495671_0000808 | |||
| 2667 | Ga0495671_0001253 | |||
| 2668 | Ga0495671_0001430 | |||
| 2669 | Ga0495671_0002385 | |||
| 2670 | Ga0495671_0007610 | |||
| 2671 | Ga0495671_0008122 | |||
| 2672 | Ga0495671_0008423 | |||
| 2673 | Ga0495671_0009680 | |||
| 2674 | Ga0495671_0010341 | |||
| 2675 | Ga0495671_0011518 | |||
| 2676 | Ga0495671_0022607 | |||
| 2677 | Ga0495671_0025200 | |||
| 2678 | Ga0495671_0042494 | |||
| 2679 | Ga0495671_0045911 | |||
| 2680 | Ga0495671_0049801 | |||
| 2681 | Ga0495649_0000462 | |||
| 2682 | Ga0495649_0000580 | |||
| 2683 | Ga0495649_0000598 | |||
| 2684 | Ga0495649_0000666 | |||
| 2685 | Ga0495649_0002822 | |||
| 2686 | Ga0495649_0003938 | |||
| 2687 | Ga0495649_0004392 | |||
| 2688 | Ga0495649_0008504 | |||
| 2689 | Ga0495649_0013429 | |||
| 2690 | Ga0495649_0014238 | |||
| 2691 | Ga0495649_0015808 | |||
| 2692 | Ga0495649_0022217 | |||
| 2693 | Ga0495649_0059667 | |||
| 2694 | Ga0495649_0086164 | |||
| 2695 | Ga0495649_0119840 | |||
| 2696 | Ga0495589_0000127 | |||
| 2697 | Ga0495589_0000238 | |||
| 2698 | Ga0495589_0000399 | |||
| 2699 | Ga0495589_0000414 | |||
| 2700 | Ga0495589_0000943 | |||
| 2701 | Ga0495589_0002524 | |||
| 2702 | Ga0495589_0002598 | |||
| 2703 | Ga0495589_0003020 | |||
| 2704 | Ga0495589_0005006 | |||
| 2705 | Ga0495589_0013229 | |||
| 2706 | Ga0495589_0016357 | |||
| 2707 | Ga0495589_0018383 | |||
| 2708 | Ga0495600_0006341 | |||
| 2709 | Ga0495600_0026624 | |||
| 2710 | Ga0495600_0038331 | |||
| 2711 | Ga0495660_0000461 | |||
| 2712 | Ga0495660_0000535 | |||
| 2713 | Ga0495660_0000635 | |||
| 2714 | Ga0495660_0000750 | |||
| 2715 | Ga0495660_0001328 | |||
| 2716 | Ga0495660_0002832 | |||
| 2717 | Ga0495660_0005329 | |||
| 2718 | Ga0495660_0009503 | |||
| 2719 | Ga0495660_0011235 | |||
| 2720 | Ga0495660_0011581 | |||
| 2721 | Ga0495660_0014213 | |||
| 2722 | Ga0495660_0014638 | |||
| 2723 | Ga0495660_0016853 | |||
| 2724 | Ga0495660_0020663 | |||
| 2725 | Ga0495660_0022145 | |||
| 2726 | Ga0495660_0023097 | |||
| 2727 | Ga0495660_0028964 | |||
| 2728 | Ga0495660_0045215 | |||
| 2729 | Ga0495660_0064156 | |||
| 2730 | Ga0495660_0067161 | |||
| 2731 | Ga0495660_0140797 | |||
| 2732 | Ga0495581_0001342 | |||
| 2733 | Ga0495604_0022917 | |||
| 2734 | Ga0495604_0024534 | |||
| 2735 | Ga0495604_0029448 | |||
| 2736 | Ga0495636_0026303 | |||
| 2737 | Ga0495672_0000211 | |||
| 2738 | Ga0495672_0000540 | |||
| 2739 | Ga0495672_0000791 | |||
| 2740 | Ga0495672_0001244 | |||
| 2741 | Ga0495672_0002250 | |||
| 2742 | Ga0495672_0003287 | |||
| 2743 | Ga0495672_0006837 | |||
| 2744 | Ga0495672_0006878 | |||
| 2745 | Ga0495672_0008178 | |||
| 2746 | Ga0495672_0009838 | |||
| 2747 | Ga0495672_0011896 | |||
| 2748 | Ga0495672_0017798 | |||
| 2749 | Ga0495672_0019994 | |||
| 2750 | Ga0495672_0028652 | |||
| 2751 | Ga0495672_0050635 | |||
| 2752 | Ga0495672_0164898 | |||
| 2753 | Ga0495676_0000019 | |||
| 2754 | Ga0495676_0000568 | |||
| 2755 | Ga0495676_0004365 | |||
| 2756 | Ga0495680_0001631 | |||
| 2757 | Ga0495680_0001655 | |||
| 2758 | Ga0495680_0006403 | |||
| 2759 | Ga0495680_0006531 | |||
| 2760 | Ga0495680_0010690 | |||
| 2761 | Ga0495680_0014253 | |||
| 2762 | Ga0495683_0000003 | |||
| 2763 | Ga0495683_0000085 | |||
| 2764 | Ga0495683_0000455 | |||
| 2765 | Ga0495683_0002508 | |||
| 2766 | Ga0495683_0003443 | |||
| 2767 | Ga0495683_0003889 | |||
| 2768 | Ga0495683_0008100 | |||
| 2769 | Ga0495683_0023061 | |||
| 2770 | Ga0495683_0028422 | |||
| 2771 | Ga0495683_0028572 | |||
| 2772 | Ga0495683_0043328 | |||
| 2773 | Ga0495683_0047118 | |||
| 2774 | Ga0495683_0051041 | |||
| 2775 | Ga0495683_0058748 | |||
| 2776 | Ga0495683_0100932 | |||
| 2777 | Ga0495687_000975 | |||
| 2778 | Ga0495687_002082 | |||
| 2779 | Ga0495687_002345 | |||
| 2780 | Ga0495687_002731 | |||
| 2781 | Ga0495675_0002044 | |||
| 2782 | Ga0495675_0025696 | |||
| 2783 | Ga0495675_0109072 | |||
| 2784 | Ga0495677_0000245 | |||
| 2785 | Ga0495679_000049 | |||
| 2786 | Ga0495679_000380 | |||
| 2787 | Ga0495679_000475 | |||
| 2788 | Ga0495679_000621 | |||
| 2789 | Ga0495679_001516 | |||
| 2790 | Ga0495679_001581 | |||
| 2791 | Ga0495679_002650 | |||
| 2792 | Ga0495679_003180 | |||
| 2793 | Ga0495679_003673 | |||
| 2794 | Ga0495679_010071 | |||
| 2795 | Ga0495679_010728 | |||
| 2796 | Ga0495679_041769 | |||
| 2797 | Ga0495679_046501 | |||
| 2798 | Ga0495685_001299 | |||
| 2799 | Ga0495673_0000168 | |||
| 2800 | Ga0495673_0000345 | |||
| 2801 | Ga0495673_0000411 | |||
| 2802 | Ga0495673_0000637 | |||
| 2803 | Ga0495673_0000687 | |||
| 2804 | Ga0495673_0000702 | |||
| 2805 | Ga0495673_0000755 | |||
| 2806 | Ga0495673_0000806 | |||
| 2807 | Ga0495673_0000864 | |||
| 2808 | Ga0495673_0001319 | |||
| 2809 | Ga0495673_0003307 | |||
| 2810 | Ga0495673_0004244 | |||
| 2811 | Ga0495673_0004370 | |||
| 2812 | Ga0495673_0006513 | |||
| 2813 | Ga0495673_0007963 | |||
| 2814 | Ga0495673_0009701 | |||
| 2815 | Ga0495673_0011069 | |||
| 2816 | Ga0495673_0014724 | |||
| 2817 | Ga0495673_0014934 | |||
| 2818 | Ga0495673_0020243 | |||
| 2819 | Ga0495673_0023781 | |||
| 2820 | Ga0495673_0025990 | |||
| 2821 | Ga0495673_0072403 | |||
| 2822 | Ga0495681_0000172 | |||
| 2823 | Ga0495681_0000226 | |||
| 2824 | Ga0495681_0000352 | |||
| 2825 | Ga0495681_0000424 | |||
| 2826 | Ga0495681_0000504 | |||
| 2827 | Ga0495681_0000542 | |||
| 2828 | Ga0495681_0000727 | |||
| 2829 | Ga0495681_0002050 | |||
| 2830 | Ga0495681_0002613 | |||
| 2831 | Ga0495681_0004426 | |||
| 2832 | Ga0495681_0005793 | |||
| 2833 | Ga0495681_0014464 | |||
| 2834 | Ga0495681_0015293 | |||
| 2835 | Ga0495681_0021103 | |||
| 2836 | Ga0495681_0029618 | |||
| 2837 | Ga0495681_0032543 | |||
| 2838 | Ga0495681_0043502 | |||
| 2839 | Ga0495681_0049432 | |||
| 2840 | Ga0495681_0110579 | |||
| 2841 | Ga0495684_0006952 | |||
| 2842 | Ga0495684_0012754 | |||
| 2843 | Ga0495686_0001754 | |||
| 2844 | Ga0495686_0002862 | |||
| 2845 | Ga0495686_0006607 | |||
| 2846 | Ga0495686_0017096 | |||
| 2847 | Ga0495686_0068571 | |||
| 2848 | Ga0495686_0076716 | |||
| 2849 | Ga0495686_0116245 | |||
| 2850 | Ga0495686_0146749 | |||
| 2851 | Ga0495593_0000512 | |||
| 2852 | Ga0495593_0001705 | |||
| 2853 | Ga0495593_0009545 | |||
| 2854 | Ga0495593_0035310 | |||
| 2855 | Ga0495602_0001327 | |||
| 2856 | Ga0495626_0000080 | |||
| 2857 | Ga0495626_0000144 | |||
| 2858 | Ga0495626_0000179 | |||
| 2859 | Ga0495626_0000438 | |||
| 2860 | Ga0495626_0000558 | |||
| 2861 | Ga0495626_0000771 | |||
| 2862 | Ga0495626_0001050 | |||
| 2863 | Ga0495626_0003903 | |||
| 2864 | Ga0495626_0004945 | |||
| 2865 | Ga0495626_0010532 | |||
| 2866 | Ga0495626_0011000 | |||
| 2867 | Ga0495626_0013063 | |||
| 2868 | Ga0495626_0013210 | |||
| 2869 | Ga0495626_0032371 | |||
| 2870 | Ga0495626_0078676 | |||
| 2871 | Ga0495626_0121104 | |||
| 2872 | Ga0496102_0000250 | |||
| 2873 | Ga0496102_0013329 | |||
| 2874 | Ga0496103_0001523 | |||
| 2875 | Ga0496106_0011952 | |||
| 2876 | Ga0496110_0004050 | |||
| 2877 | Ga0496111_0100311 | |||
| 2878 | Ga0496114_0000940 | |||
| 2879 | Ga0496116_0000168 | |||
| 2880 | Ga0496116_0000419 | |||
| 2881 | Ga0496116_0001635 | |||
| 2882 | Ga0496116_0002610 | |||
| 2883 | Ga0496116_0007631 | |||
| 2884 | Ga0496116_0022181 | |||
| 2885 | Ga0496116_0031676 | |||
| 2886 | Ga0496117_0000349 | |||
| 2887 | Ga0496117_0001453 | |||
| 2888 | Ga0496117_0002256 | |||
| 2889 | Ga0496117_0003622 | |||
| 2890 | Ga0496117_0006009 | |||
| 2891 | Ga0496117_0006828 | |||
| 2892 | Ga0496117_0013274 | |||
| 2893 | Ga0496117_0035697 | |||
| 2894 | Ga0496117_0081725 | |||
| 2895 | Ga0496117_0194481 | |||
| 2896 | Ga0496117_0205200 | |||
| 2897 | Ga0496117_0230196 | |||
| 2898 | Ga0496118_0003199 | |||
| 2899 | Ga0496118_0003899 | |||
| 2900 | Ga0496118_0007046 | |||
| 2901 | Ga0496118_0007048 | |||
| 2902 | Ga0496118_0007530 | |||
| 2903 | Ga0496118_0008261 | |||
| 2904 | Ga0496118_0010074 | |||
| 2905 | Ga0496118_0020485 | |||
| 2906 | Ga0496118_0046138 | |||
| 2907 | Ga0496118_0073096 | |||
| 2908 | Ga0496118_0125382 | |||
| 2909 | Ga0496119_0025370 | |||
| 2910 | Ga0496119_0037982 | |||
| 2911 | Ga0496120_0004730 | |||
| 2912 | Ga0496121_0000199 | |||
| 2913 | Ga0496121_0000804 | |||
| 2914 | Ga0496121_0002628 | |||
| 2915 | Ga0496121_0003036 | |||
| 2916 | Ga0496121_0021408 | |||
| 2917 | Ga0496121_0024834 | |||
| 2918 | Ga0496121_0037191 | |||
| 2919 | Ga0496121_0050306 | |||
| 2920 | Ga0496121_0069321 | |||
| 2921 | Ga0496121_0101830 | |||
| 2922 | Ga0496121_0120179 | |||
| 2923 | Ga0496121_0209756 | |||
| 2924 | Ga0496121_0228854 | |||
| 2925 | Ga0496122_0000667 | |||
| 2926 | Ga0496122_0001732 | |||
| 2927 | Ga0496122_0002644 | |||
| 2928 | Ga0496122_0009182 | |||
| 2929 | Ga0496122_0027517 | |||
| 2930 | Ga0496122_0075863 | |||
| 2931 | Ga0496122_0080370 | |||
| 2932 | Ga0496122_0154944 | |||
| 2933 | Ga0496122_0154971 | |||
| 2934 | Ga0496123_0000163 | |||
| 2935 | Ga0496123_0000642 | |||
| 2936 | Ga0496123_0000869 | |||
| 2937 | Ga0496123_0017335 | |||
| 2938 | Ga0496123_0029467 | |||
| 2939 | Ga0496123_0039072 | |||
| 2940 | Ga0496123_0088580 | |||
| 2941 | Ga0496124_0000229 | |||
| 2942 | Ga0496124_0000714 | |||
| 2943 | Ga0496124_0000870 | |||
| 2944 | Ga0496124_0001848 | |||
| 2945 | Ga0496124_0002366 | |||
| 2946 | Ga0496124_0008162 | |||
| 2947 | Ga0496124_0014063 | |||
| 2948 | Ga0496124_0027256 | |||
| 2949 | Ga0496124_0032860 | |||
| 2950 | Ga0496124_0041571 | |||
| 2951 | Ga0496124_0044131 | |||
| 2952 | Ga0496124_0084516 | |||
| 2953 | Ga0496124_0100576 | |||
| 2954 | Ga0496124_0101261 | |||
| 2955 | Ga0496124_0123815 | |||
| 2956 | Ga0496124_0148849 | |||
| 2957 | Ga0496124_0273166 | |||
| 2958 | Ga0496124_0279294 | |||
| 2959 | Ga0496124_0289884 | |||
| 2960 | Ga0496125_0002339 | |||
| 2961 | Ga0496125_0002675 | |||
| 2962 | Ga0496125_0003616 | |||
| 2963 | Ga0496125_0004799 | |||
| 2964 | Ga0496125_0011474 | |||
| 2965 | Ga0496125_0014619 | |||
| 2966 | Ga0496125_0031060 | |||
| 2967 | Ga0496125_0031171 | |||
| 2968 | Ga0496125_0033883 | |||
| 2969 | Ga0496125_0049349 | |||
| 2970 | Ga0496125_0070266 | |||
| 2971 | Ga0496125_0102560 | |||
| 2972 | Ga0496126_0012494 | |||
| 2973 | Ga0496126_0016012 | |||
| 2974 | Ga0496126_0043720 | |||
| 2975 | Ga0496126_0127116 | |||
| 2976 | Ga0496126_0142895 | |||
| 2977 | Ga0496126_0148197 | |||
| 2978 | Ga0496126_0199345 | |||
| 2979 | Ga0495678_000007 | |||
| 2980 | Ga0495678_000047 | |||
| 2981 | Ga0495678_000802 | |||
| 2982 | Ga0495678_001017 | |||
| 2983 | Ga0495678_001022 | |||
| 2984 | Ga0495678_001038 | |||
| 2985 | Ga0495678_001095 | |||
| 2986 | Ga0495678_001852 | |||
| 2987 | Ga0495678_006674 | |||
| 2988 | Ga0495678_009007 | |||
| 2989 | Ga0495678_009877 | |||
| 2990 | Ga0495678_013665 | |||
| 2991 | Ga0495678_013776 | |||
| 2992 | Ga0495678_013843 | |||
| 2993 | Ga0495678_020767 | |||
| 2994 | Ga0495678_025480 | |||
| 2995 | Ga0495678_033049 | |||
| 2996 | Ga0495682_0000051 | |||
| 2997 | Ga0495682_0000899 | |||
| 2998 | Ga0495682_0001158 | |||
| 2999 | Ga0495682_0001812 | |||
| 3000 | Ga0495682_0007174 | |||
| 3001 | Ga0495682_0061187 | |||
| 3002 | Ga0495682_0079264 | |||
| 3003 | Ga0501031_0118652 | |||
| 3004 | Ga0501034_0001187 | |||
| 3005 | Ga0501037_0066593 | |||
| 3006 | Ga0501038_0098179 | |||
| 3007 | Ga0501038_0170375 | |||
| 3008 | Ga0501042_0288440 | |||
| 3009 | Ga0501043_0085365 | |||
| 3010 | Ga0501047_0094211 | |||
| 3011 | Ga0501074_0207602 | |||
| 3012 | Ga0501222_000116 | |||
| 3013 | Ga0501227_003954 | |||
| 3014 | Ga0501240_007882 | |||
| 3015 | Ga0501241_000142 | |||
| 3016 | Ga0501035_0149900 | |||
| 3017 | Ga0501035_0252960 | |||
| 3018 | Ga0501044_0191213 | |||
| 3019 | Ga0501044_0268794 | |||
| 3020 | Ga0501226_002129 | |||
| 3021 | nmdc:mga03683_3959_c1 | |||
| 3022 | nmdc:mga03683_71757_c1 | |||
| 3023 | nmdc:mga00v17_127726_c1 | |||
| 3024 | nmdc:mga00v17_40232_c1 | |||
| 3025 | nmdc:mga00v17_59921_c1 | |||
| 3026 | nmdc:mga08x19_32307_c1 | |||
| 3027 | nmdc:mga0sz30_17935_c1 | |||
| 3028 | Ga0500651_0039659 | |||
| 3029 | Ga0500572_000143 | |||
| 3030 | Ga0500595_002919 | |||
| 3031 | Ga0500621_015694 | |||
| 3032 | Ga0500659_0009556 | |||
| 3033 | Ga0500564_001328 | |||
| 3034 | Ga0500573_0001618 | |||
| 3035 | Ga0500577_0036661 | |||
| 3036 | Ga0500634_0001481 | |||
| 3037 | Ga0500636_0038956 | |||
| 3038 | 2511252812 | |||
| 3039 | 2511264234 | |||
| 3040 | 2511273103 | |||
| 3041 | 2511275789 | |||
| 3042 | 2511290606 | |||
| 3043 | 2511298332 | |||
| 3044 | 2511301068 | |||
| 3045 | 2511312252 | |||
| 3046 | 2511322766 | |||
| 3047 | 2511326154 | |||
| 3048 | 2511333930 | |||
| 3049 | 2511339007 | |||
| 3050 | 2511347189 | |||
| 3051 | 2511349857 | |||
| 3052 | 2511354002 | |||
| 3053 | 2511365716 | |||
| 3054 | 2511376556 | |||
| 3055 | 2511410882 | |||
| 3056 | 2511823716 | |||
| 3057 | 2512323972 | |||
| 3058 | 2552748235 | |||
| 3059 | 2554815639 | |||
| 3060 | 2555244823 | |||
| 3061 | 2555671231 | |||
| 3062 | 2583793645 | |||
| 3063 | 2597859304 | |||
| 3064 | 2597863032 | |||
| 3065 | 2597868824 | |||
| 3066 | 2599326778 | |||
| 3067 | 2599354610 | |||
| 3068 | 2599359677 | |||
| 3069 | 2599365999 | |||
| 3070 | 2599372789 | |||
| 3071 | 2599379717 | |||
| 3072 | 2599385304 | |||
| 3073 | 2599391648 | |||
| 3074 | 2599401614 | |||
| 3075 | 2599403414 | |||
| 3076 | 2599451845 | |||
| 3077 | 2599461444 | |||
| 3078 | 2599469987 | |||
| 3079 | 2599482135 | |||
| 3080 | 2599490463 | |||
| 3081 | 2599504509 | |||
| 3082 | 2599509615 | |||
| 3083 | 2599514858 | |||
| 3084 | 2599520956 | |||
| 3085 | 2599611596 | |||
| 3086 | 2599770309 | |||
| 3087 | 2599804147 | |||
| 3088 | 2599882203 | |||
| 3089 | 2599887482 | |||
| 3090 | 2599894345 | |||
| 3091 | 2599901771 | |||
| 3092 | 2599934323 | |||
| 3093 | 2599941756 | |||
| 3094 | 2599951553 | |||
| 3095 | 2599952724 | |||
| 3096 | 2599960615 | |||
| 3097 | 2599964909 | |||
| 3098 | 2599971456 | |||
| 3099 | 2599975978 | |||
| 3100 | 2599981925 | |||
| 3101 | 2599987834 | |||
| 3102 | 2599995329 | |||
| 3103 | 2599998274 | |||
| 3104 | 2600005438 | |||
| 3105 | 2600010141 | |||
| 3106 | 2600017344 | |||
| 3107 | 2600022567 | |||
| 3108 | 2600027587 | |||
| 3109 | 2600034371 | |||
| 3110 | 2600039867 | |||
| 3111 | 2600046164 | |||
| 3112 | 2600052167 | |||
| 3113 | 2600057544 | |||
| 3114 | 2600064705 | |||
| 3115 | 2600072282 | |||
| 3116 | 2600075842 | |||
| 3117 | 2600214062 | |||
| 3118 | 2600356704 | |||
| 3119 | 2600364212 | |||
| 3120 | 2600442985 | |||
| 3121 | 2601624743 | |||
| 3122 | 2601694259 | |||
| 3123 | 2601774228 | |||
| 3124 | 2601796224 | |||
| 3125 | 2602009539 | |||
| 3126 | 2606073373 | |||
| 3127 | 2606126981 | |||
| 3128 | 2608383943 | |||
| 3129 | 2621300894 | |||
| 3130 | 2624481873 | |||
| 3131 | 2624491042 | |||
| 3132 | 2640734782 | |||
| 3133 | 2643830747 | |||
| 3134 | 2643845576 | |||
| 3135 | 2643871632 | |||
| 3136 | 2643956453 | |||
| 3137 | 2643974237 | |||
| 3138 | 2644025505 | |||
| 3139 | 2644187419 | |||
| 3140 | 2644284895 | |||
| 3141 | 2644623509 | |||
| 3142 | 2652547528 | |||
| 3143 | 2671094361 | |||
| 3144 | 2671097191 | |||
| 3145 | 2671126043 | |||
| 3146 | 2671770285 | |||
| 3147 | 2678231723 | |||
| 3148 | 2678262648 | |||
| 3149 | 2715751176 | |||
| 3150 | 2715758176 | |||
| 3151 | 2718635122 | |||
| 3152 | 2723247849 | |||
| 3153 | 2738670481 | |||
| 3154 | 2738688863 | |||
| 3155 | 2738748874 | |||
| 3156 | 2738810856 | |||
| 3157 | 2738857916 | |||
| 3158 | 2738898216 | |||
| 3159 | 2739201913 | |||
| 3160 | 2739259284 | |||
| 3161 | 2739264826 | |||
| 3162 | 2739287492 | |||
| 3163 | 2739292805 | |||
| 3164 | 2739314115 | |||
| 3165 | 2743738837 | |||
| 3166 | 2745008988 | |||
| 3167 | 2745160174 | |||
| 3168 | 2774123398 | |||
| 3169 | 2774132783 | |||
| 3170 | 2774389418 | |||
| 3171 | 2774436877 | |||
| 3172 | 2784263405 | |||
| 3173 | 2784316060 | |||
| 3174 | 2794596452 | |||
| 3175 | 2807409277 | |||
| 3176 | 2807457579 | |||
| 3177 | 2808855117 | |||
| 3178 | 2808924394 | |||
| 3179 | 2808930567 | |||
| 3180 | 2808935773 | |||
| 3181 | 2808942346 | |||
| 3182 | 2808946508 | |||
| 3183 | 2808952689 | |||
| 3184 | 2808957317 | |||
| 3185 | 2808963532 | |||
| 3186 | 2808979430 | |||
| 3187 | 2808995354 | |||
| 3188 | 2808998510 | |||
| 3189 | 2809218727 | |||
| 3190 | 2817489805 | |||
| 3191 | 2819655617 | |||
| 3192 | 2819702288 | |||
| 3193 | 2823424614 | |||
| 3194 | 2825652986 | |||
| 3195 | 2826583918 | |||
| 3196 | 2834029682 | |||
| 3197 | 2842806028 | |||
| 3198 | 2842820242 | |||
| 3199 | 2842831957 | |||
| 3200 | 2842836467 | |||
| 3201 | 2842841541 | |||
| 3202 | 2842844581 | |||
| 3203 | 2842850835 | |||
| 3204 | 2844671761 | |||
| 3205 | 2852618437 | |||
| 3206 | 2852662384 | |||
| 3207 | 2852673427 | |||
| 3208 | 2860340754 | |||
| 3209 | 2860869675 | |||
| 3210 | 2878033857 | |||
| 3211 | 2880234483 | |||
| 3212 | 2904521377 | |||
| 3213 | 2904555736 | |||
| 3214 | 2908448596 | |||
| 3215 | 2912967396 | |||
| 3216 | 2913038627 | |||
| 3217 | 2916702061 | |||
| 3218 | 2917075092 | |||
| 3219 | 2919068843 | |||
| 3220 | 2919182890 | |||
| 3221 | 2919387950 | |||
| 3222 | 2919461115 | |||
| 3223 | 2919481904 | |||
| 3224 | 2919489868 | |||
| 3225 | 2919504344 | |||
| 3226 | 2919507980 | |||
| 3227 | 2919702056 | |||
| 3228 | 2923157909 | |||
| 3229 | 2923520221 | |||
| 3230 | 2923587261 | |||
| 3231 | 2926065083 | |||
| 3232 | 2929146081 | |||
| 3233 | 2929191650 | |||
| 3234 | 2931370583 | |||
| 3235 | 2931392749 | |||
| 3236 | 2931403307 | |||
| 3237 | 2935356080 | |||
| 3238 | 2939614459 | |||
| 3239 | 2939637669 | |||
| 3240 | 2939652912 | |||
| 3241 | 2941493779 | |||
| 3242 | 2945928916 | |||
| 3243 | 2945962290 | |||
| 3244 | 2946011139 | |||
| 3245 | 2946029932 | |||
| 3246 | 2947236504 | |||
| 3247 | 2969308632 | |||
| 3248 | 2974289994 | |||
| 3249 | 2984288272 | |||
| 3250 | 2988733611 | |||
| 3251 | 2990198304 | |||
| 3252 | 2998143937 | |||
| 3253 | 3007397219 | |||
| 3254 | 3007424246 | |||
| 3255 | 3007515638 | |||
| 3256 | 3007616914 | |||
| 3257 | 3007625620 | |||
| 3258 | 3007718864 | |||
| 3259 | 3007865367 | |||
| 3260 | 3007870223 | |||
| 3261 | 3007875559 | |||
| 3262 | 637321560 | |||
| 3263 | 8011354949 | |||
| 3264 | 8015692007 | |||
| 3265 | 8019774432 | |||
| 3266 | 8019780925 | |||
| 3267 | 8029996940 | |||
| 3268 | 8033232796 | |||
| 3269 | 8034962598 | |||
| 3270 | 8052496295 | |||
| 3271 | 8054288631 | |||
| 3272 | 8054352111 | |||
| 3273 | 8054505252 | |||
| 3274 | 8054930352 | |||
| 3275 | 8055775216 | |||
| 3276 | 8055819795 | |||
| 3277 | 8055880228 | |||
| 3278 | 8056117932 | |||
| 3279 | 8056124347 | |||
| 3280 | 8056127621 | |||
| 3281 | 8056133579 | |||
| 3282 | 8056147212 | |||
| 3283 | 8056150484 | |||
| 3284 | 8056157243 | |||
| 3285 | 8056165000 | |||
| 3286 | 8056167339 | |||
| 3287 | 8056173323 | |||
| 3288 | 8056179517 | |||
| 3289 | 8056572680 | |||
| 3290 | 8057804041 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xpi-assembly2.cif.gz_B | crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc | 0.851 | 89 | 292 |
| 1v9k-assembly2.cif.gz_B | the crystal structure of the catalytic domain of pseudouridine synthase rluc from escherichia coli | 0.8461 | 89 | 292 |
| 2i82-assembly2.cif.gz_B | crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure | 0.8288 | 87 | 295 |
| 1prz-assembly1.cif.gz_A | crystal structure of pseudouridine synthase rlud catalytic module | 0.826 | 81 | 292 |
| 1xpi-assembly1.cif.gz_A | crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc | 0.8146 | 89 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07166_77_287_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.937 | 79 | 291 | 3.30.2350.10 |
| af_O07166_77_287_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9327 | 79 | 291 | 3.30.2350.10 |
| af_Q12069_190_394_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9186 | 90 | 253 | 3.30.2350.10 |
| af_Q9VKU8_216_417_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9038 | 88 | 255 | 3.30.2350.10 |
| af_Q2FZQ6_75_272_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.8781 | 88 | 289 | 3.30.2350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833KNC8-F1-model_v4 | deleted | 0.978 | 85 | 231 |
|
| AF-A0A645E1Q1-F1-model_v4 | Ribosomal large subunit pseudouridine synthase A (EC 5.4.99.28) | 0.9779 | 100 | 294 |
GO:0000455
GO:0003723 GO:0160151 |
| AF-A0A4V3MV30-F1-model_v4 | deleted | 0.9721 | 13 | 294 |
|
| AF-A0A369ARD3-F1-model_v4 | tRNA pseudouridine32 synthase/23S rRNA pseudouridine746 synthase | 0.9685 | 26 | 295 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A843YPX1-F1-model_v4 | Pseudouridine synthase | 0.9664 | 13 | 293 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |