F495183
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1646 | 630 | 3292 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300003751|Ga0055538_1000229|Ga0055538_100022917 |
| Length | 244 |
| Sequence | MEATAGAGGQPGSTRQGTHDIMAYQFDFLSTFDYSDVIVKGVLTTIELIAIGGVLGVAVGIFGAWARSQGPGWLKPIVSGYVEIIRNTPFLVQLFFIFFGLPSLDIHISEIAAAILAMVINLGAYSTEIIRAGVQAIPRGQIEAAQSLSMSRMQIFRHIILRPALQKIWPALSSQVVIVMLGSAVCSQIAVEELSFAANFIQGRNFRAFEAYIVATLIYLVLAVLLRQVLRLIGHYFITARRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 61 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 87 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 159 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 160 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 161 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 191 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 192 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 193 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 194 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 195 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 196 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 197 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 198 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 199 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 205 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 206 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 207 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 208 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 209 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 210 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 211 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 212 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 215 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 216 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 217 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 218 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 219 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 220 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 221 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 222 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 223 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 224 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 225 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 228 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 229 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 230 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 231 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 232 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 339 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 342 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 345 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 356 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 360 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 369 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 370 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 372 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 373 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 374 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 375 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 376 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 377 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 378 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 379 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 380 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 381 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 382 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 383 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 384 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 385 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 386 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 387 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 388 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 389 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 390 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 391 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 392 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 393 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 394 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 395 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 396 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 397 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 398 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 399 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 400 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 401 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 402 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 403 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 404 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 405 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 406 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 407 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 408 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 409 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 410 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 411 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 412 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 413 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 414 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 415 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 416 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 417 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 418 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 419 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 420 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 421 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 422 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 423 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 424 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 425 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 426 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 427 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 428 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 429 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 430 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 431 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 432 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 433 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 434 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 435 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 436 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 437 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 438 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 439 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 440 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 441 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 442 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 443 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 444 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 445 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 446 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 447 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 448 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 449 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 450 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 451 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 452 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 453 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 454 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 455 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 456 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 457 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 458 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 459 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 460 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 461 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 462 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 463 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 464 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 465 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 466 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 467 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 468 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 469 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 470 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 471 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 472 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 473 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 474 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 475 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 476 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 477 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 478 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 479 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 480 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 481 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 482 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 483 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 484 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 485 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 486 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 487 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 488 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 489 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 490 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 491 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 492 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 493 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 494 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 495 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 496 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 497 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 498 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 499 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 500 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 501 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 502 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 503 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 504 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 505 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 506 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 507 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 508 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 509 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 510 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 511 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 512 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 513 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 514 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 515 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 516 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 517 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 518 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 519 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 520 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 521 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 522 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 523 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 524 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 525 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 526 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 527 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 528 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 529 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 530 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 531 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 532 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 533 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 534 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 535 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 536 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 537 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 538 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 539 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 540 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 541 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 542 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 543 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 544 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 545 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 546 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 547 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 548 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 549 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 550 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 551 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 552 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 553 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 554 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 555 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 556 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 557 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 558 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 559 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 560 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 561 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 562 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 563 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 564 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 565 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 566 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 567 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 568 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 569 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 570 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 571 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 572 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 573 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 574 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 575 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 576 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 577 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 578 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 579 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 580 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 581 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 582 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 583 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 584 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 585 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 586 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 587 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 588 | 2941479691 | |||
| 589 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 590 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 591 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 592 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 593 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 594 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 595 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 596 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 597 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 598 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 599 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 600 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 601 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 602 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 603 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 604 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 605 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 606 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 607 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 608 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 609 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 610 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 611 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 612 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 613 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 614 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 615 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 616 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 617 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 618 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 619 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 620 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 621 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 622 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 623 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 624 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 625 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 626 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 627 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 628 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 629 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 630 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.02 |
| Metatranscriptomes | 0 |
| Isolates | 15.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.84 |
| Nodule | 2.49 |
| Rhizoplane | 4.25 |
| Rhizosphere | 69.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055538_1000229 | 3300003751 | Bacteria | 31274 |
| 2 | MRS2a_Contig_718 | 2124908027 | Bacteria | 55855 |
| 3 | SwRhRL2b_contig_3259057 | 2162886007 | Bacteria | 954 |
| 4 | JGI24741J21665_1006777 | 3300001915 | Bacteria | 2272 |
| 5 | JGI25155J39150_1000370 | 3300002704 | Bacteria | 13442 |
| 6 | JGI25155J39150_1000428 | 3300002704 | Bacteria | 11253 |
| 7 | JGI25155J39150_1000795 | 3300002704 | Bacteria | 5027 |
| 8 | JGI25155J39150_1001260 | 3300002704 | Bacteria | 2038 |
| 9 | JGI25156J39149_1000117 | 3300002705 | Bacteria | 57700 |
| 10 | JGI25156J39149_1000989 | 3300002705 | Bacteria | 13442 |
| 11 | JGI25156J39149_1002357 | 3300002705 | Bacteria | 6870 |
| 12 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 13 | JGI25162J39368_1000378 | 3300002737 | Bacteria | 37854 |
| 14 | JGI25162J39368_1004300 | 3300002737 | Bacteria | 3396 |
| 15 | JGI25162J39368_1004556 | 3300002737 | Bacteria | 3157 |
| 16 | JGI25154J39366_1000107 | 3300002738 | Bacteria | 73482 |
| 17 | JGI25154J39366_1000249 | 3300002738 | Bacteria | 34973 |
| 18 | JGI25154J39366_1000826 | 3300002738 | Bacteria | 13442 |
| 19 | JGI25154J39366_1004380 | 3300002738 | Bacteria | 2555 |
| 20 | JGI25157J39369_1000966 | 3300002741 | Bacteria | 13433 |
| 21 | JGI25157J39369_1001016 | 3300002741 | Bacteria | 13010 |
| 22 | JGI25163J39215_1001139 | 3300002771 | Bacteria | 5240 |
| 23 | JGI25164J39214_1000273 | 3300002772 | Bacteria | 37854 |
| 24 | JGI25151J46595_10001598 | 3300003187 | Bacteria | 15033 |
| 25 | JGI25151J46595_10001939 | 3300003187 | Bacteria | 13112 |
| 26 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 27 | JGI25165J46597_1000498 | 3300003214 | Bacteria | 37854 |
| 28 | rootH2_10020080 | 3300003320 | Bacteria | 1260 |
| 29 | rootL2_10082487 | 3300003322 | Bacteria | 5783 |
| 30 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 31 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 32 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 33 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 34 | Ga0055539_1000269 | 3300003752 | Bacteria | 31274 |
| 35 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 36 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 37 | Ga0055533_1000258 | 3300003756 | Bacteria | 31274 |
| 38 | Ga0055532_1000044 | 3300003758 | Bacteria | 191110 |
| 39 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 40 | Ga0055532_1000647 | 3300003758 | Bacteria | 13442 |
| 41 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 42 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 43 | Ga0055525_1000359 | 3300003759 | Bacteria | 31274 |
| 44 | Ga0055535_1002174 | 3300003761 | Bacteria | 7556 |
| 45 | Ga0055535_1006556 | 3300003761 | Bacteria | 2336 |
| 46 | Ga0055529_1008064 | 3300003763 | Bacteria | 1409 |
| 47 | Ga0055526_1002434 | 3300003771 | Bacteria | 12611 |
| 48 | Ga0055524_1000061 | 3300003775 | Bacteria | 135241 |
| 49 | Ga0055536_1000081 | 3300003781 | Bacteria | 81966 |
| 50 | Ga0055536_1000201 | 3300003781 | Bacteria | 48808 |
| 51 | Ga0055536_1000704 | 3300003781 | Bacteria | 22401 |
| 52 | Ga0055536_1011459 | 3300003781 | Bacteria | 3399 |
| 53 | Ga0055534_1000104 | 3300003784 | Bacteria | 64767 |
| 54 | Ga0055534_1000470 | 3300003784 | Bacteria | 22861 |
| 55 | Ga0055530_10000324 | 3300003791 | Bacteria | 43140 |
| 56 | Ga0055530_10000800 | 3300003791 | Bacteria | 26158 |
| 57 | Ga0055530_10001011 | 3300003791 | Bacteria | 22475 |
| 58 | Ga0055530_10001044 | 3300003791 | Bacteria | 22066 |
| 59 | Ga0055530_10003143 | 3300003791 | Bacteria | 9737 |
| 60 | Ga0055540_1000026 | 3300003792 | Bacteria | 189071 |
| 61 | Ga0055540_1000745 | 3300003792 | Bacteria | 22100 |
| 62 | Ga0055540_1003757 | 3300003792 | Bacteria | 7161 |
| 63 | Ga0055540_1003950 | 3300003792 | Bacteria | 6924 |
| 64 | Ga0055531_10000404 | 3300003794 | Bacteria | 41520 |
| 65 | Ga0055531_10001242 | 3300003794 | Bacteria | 19363 |
| 66 | Ga0055531_10006377 | 3300003794 | Bacteria | 6709 |
| 67 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 68 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 69 | Ga0055541_1000168 | 3300003841 | Bacteria | 31274 |
| 70 | Ga0065714_10000115 | 3300005288 | Bacteria | 10449 |
| 71 | Ga0065714_10007511 | 3300005288 | Bacteria | 3527 |
| 72 | Ga0065714_10009964 | 3300005288 | Bacteria | 3262 |
| 73 | Ga0065714_10015263 | 3300005288 | Bacteria | 1723 |
| 74 | Ga0065714_10016786 | 3300005288 | Bacteria | 1373 |
| 75 | Ga0065714_10018929 | 3300005288 | Bacteria | 1393 |
| 76 | Ga0065714_10040903 | 3300005288 | Bacteria | 1013 |
| 77 | Ga0065714_10065087 | 3300005288 | Bacteria | 13133 |
| 78 | Ga0065714_10065569 | 3300005288 | Bacteria | 9352 |
| 79 | Ga0065714_10072683 | 3300005288 | Bacteria | 3320 |
| 80 | Ga0065714_10078533 | 3300005288 | Bacteria | 2591 |
| 81 | Ga0065714_10092492 | 3300005288 | Bacteria | 1876 |
| 82 | Ga0065714_10129168 | 3300005288 | Bacteria | 1267 |
| 83 | Ga0065714_10135547 | 3300005288 | Bacteria | 1213 |
| 84 | Ga0065704_10008310 | 3300005289 | Bacteria | 4618 |
| 85 | Ga0065704_10024159 | 3300005289 | Bacteria | 1633 |
| 86 | Ga0065704_10073325 | 3300005289 | Bacteria | 7307 |
| 87 | Ga0065704_10076165 | 3300005289 | Bacteria | 5230 |
| 88 | Ga0065704_10080568 | 3300005289 | Bacteria | 3921 |
| 89 | Ga0065712_10067900 | 3300005290 | Bacteria | 22102 |
| 90 | Ga0065712_10068537 | 3300005290 | Bacteria | 10000 |
| 91 | Ga0065715_10117248 | 3300005293 | Bacteria | 2348 |
| 92 | Ga0070670_100001343 | 3300005331 | Bacteria | 19676 |
| 93 | Ga0070670_100005930 | 3300005331 | Bacteria | 10333 |
| 94 | Ga0070670_100024674 | 3300005331 | Bacteria | 5171 |
| 95 | Ga0070666_10044566 | 3300005335 | Bacteria | 2972 |
| 96 | Ga0070660_100439878 | 3300005339 | Bacteria | 1081 |
| 97 | Ga0070660_100663137 | 3300005339 | Bacteria | 874 |
| 98 | Ga0070661_100000126 | 3300005344 | Bacteria | 63357 |
| 99 | Ga0070661_100568593 | 3300005344 | Bacteria | 914 |
| 100 | Ga0070669_100000764 | 3300005353 | Bacteria | 23404 |
| 101 | Ga0070669_100002215 | 3300005353 | Bacteria | 14088 |
| 102 | Ga0070669_100010461 | 3300005353 | Bacteria | 6588 |
| 103 | Ga0070673_100336409 | 3300005364 | Bacteria | 1337 |
| 104 | Ga0070667_100025826 | 3300005367 | Bacteria | 4885 |
| 105 | Ga0070714_100523115 | 3300005435 | Bacteria | 1133 |
| 106 | Ga0070663_100590763 | 3300005455 | Bacteria | 933 |
| 107 | Ga0070662_100000426 | 3300005457 | Bacteria | 24961 |
| 108 | Ga0070662_100025623 | 3300005457 | Bacteria | 4074 |
| 109 | Ga0068853_100002460 | 3300005539 | Bacteria | 13865 |
| 110 | Ga0068853_100167212 | 3300005539 | Bacteria | 1988 |
| 111 | Ga0068853_100247147 | 3300005539 | Bacteria | 1636 |
| 112 | Ga0070665_100045202 | 3300005548 | Bacteria | 4422 |
| 113 | Ga0070665_100055165 | 3300005548 | Bacteria | 3985 |
| 114 | Ga0070665_100244070 | 3300005548 | Bacteria | 1796 |
| 115 | Ga0070665_100289486 | 3300005548 | Bacteria | 1640 |
| 116 | Ga0070665_100719054 | 3300005548 | Bacteria | 1012 |
| 117 | Ga0070665_101406873 | 3300005548 | Bacteria | 706 |
| 118 | Ga0068855_100000083 | 3300005563 | Bacteria | 114159 |
| 119 | Ga0068855_100075954 | 3300005563 | Bacteria | 3900 |
| 120 | Ga0068855_100156925 | 3300005563 | Bacteria | 2585 |
| 121 | Ga0068855_100230745 | 3300005563 | Bacteria | 2073 |
| 122 | Ga0070664_100002791 | 3300005564 | Bacteria | 14105 |
| 123 | Ga0070664_100385963 | 3300005564 | Bacteria | 1279 |
| 124 | Ga0068854_100009626 | 3300005578 | Bacteria | 6240 |
| 125 | Ga0068854_100042852 | 3300005578 | Bacteria | 3205 |
| 126 | Ga0068856_100045478 | 3300005614 | Bacteria | 4323 |
| 127 | Ga0068856_100062089 | 3300005614 | Bacteria | 3691 |
| 128 | Ga0068852_100010440 | 3300005616 | Bacteria | 6942 |
| 129 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 130 | Ga0075365_10085235 | 3300006038 | Bacteria | 2146 |
| 131 | Ga0075365_10145557 | 3300006038 | Bacteria | 1646 |
| 132 | Ga0075364_10129569 | 3300006051 | Bacteria | 1692 |
| 133 | Ga0075364_10373248 | 3300006051 | Bacteria | 973 |
| 134 | Ga0075432_10011631 | 3300006058 | Bacteria | 2990 |
| 135 | Ga0075432_10028200 | 3300006058 | Bacteria | 1936 |
| 136 | Ga0075432_10032413 | 3300006058 | Bacteria | 1810 |
| 137 | Ga0075432_10074428 | 3300006058 | Bacteria | 1223 |
| 138 | Ga0070716_100037343 | 3300006173 | Bacteria | 2684 |
| 139 | Ga0075362_10034210 | 3300006177 | Bacteria | 2214 |
| 140 | Ga0075362_10037732 | 3300006177 | Bacteria | 2120 |
| 141 | Ga0075362_10108739 | 3300006177 | Bacteria | 1303 |
| 142 | Ga0075366_10005256 | 3300006195 | Bacteria | 7011 |
| 143 | Ga0075366_10024685 | 3300006195 | Bacteria | 3506 |
| 144 | Ga0075370_10004516 | 3300006353 | Bacteria | 6774 |
| 145 | Ga0075436_100042606 | 3300006914 | Bacteria | 3131 |
| 146 | Ga0075436_100176405 | 3300006914 | Bacteria | 1509 |
| 147 | Ga0075436_100235249 | 3300006914 | Bacteria | 1302 |
| 148 | Ga0075436_100269535 | 3300006914 | Bacteria | 1216 |
| 149 | Ga0075436_100494052 | 3300006914 | Bacteria | 895 |
| 150 | Ga0075436_100536753 | 3300006914 | Bacteria | 858 |
| 151 | Ga0079104_1000093 | 3300006946 | Bacteria | 130633 |
| 152 | Ga0079104_1000518 | 3300006946 | Bacteria | 41295 |
| 153 | Ga0079104_1000754 | 3300006946 | Bacteria | 27883 |
| 154 | Ga0079104_1001469 | 3300006946 | Bacteria | 15717 |
| 155 | Ga0079104_1010922 | 3300006946 | Bacteria | 2953 |
| 156 | Ga0099826_10000039 | 3300006948 | Bacteria | 99286 |
| 157 | Ga0099826_10004941 | 3300006948 | Bacteria | 9450 |
| 158 | Ga0105251_10000009 | 3300009011 | Bacteria | 192384 |
| 159 | Ga0105251_10000133 | 3300009011 | Bacteria | 74942 |
| 160 | Ga0105251_10004529 | 3300009011 | Bacteria | 9422 |
| 161 | Ga0105251_10006398 | 3300009011 | Bacteria | 7511 |
| 162 | Ga0105251_10008326 | 3300009011 | Bacteria | 6260 |
| 163 | Ga0105251_10009680 | 3300009011 | Bacteria | 5664 |
| 164 | Ga0105251_10014310 | 3300009011 | Bacteria | 4394 |
| 165 | Ga0105251_10016733 | 3300009011 | Bacteria | 3952 |
| 166 | Ga0105251_10017668 | 3300009011 | Bacteria | 3816 |
| 167 | Ga0105251_10034134 | 3300009011 | Bacteria | 2520 |
| 168 | Ga0105251_10037689 | 3300009011 | Bacteria | 2370 |
| 169 | Ga0105251_10044660 | 3300009011 | Bacteria | 2139 |
| 170 | Ga0105251_10162951 | 3300009011 | Bacteria | 1005 |
| 171 | Ga0105251_10175120 | 3300009011 | Bacteria | 967 |
| 172 | Ga0105244_10000008 | 3300009036 | Bacteria | 302297 |
| 173 | Ga0105244_10001453 | 3300009036 | Bacteria | 19179 |
| 174 | Ga0105244_10003377 | 3300009036 | Bacteria | 11430 |
| 175 | Ga0105244_10008099 | 3300009036 | Bacteria | 6601 |
| 176 | Ga0105244_10034271 | 3300009036 | Bacteria | 2674 |
| 177 | Ga0105244_10061120 | 3300009036 | Bacteria | 1897 |
| 178 | Ga0105244_10067665 | 3300009036 | Bacteria | 1786 |
| 179 | Ga0105244_10076791 | 3300009036 | Bacteria | 1658 |
| 180 | Ga0105244_10097516 | 3300009036 | Bacteria | 1440 |
| 181 | Ga0105244_10098580 | 3300009036 | Bacteria | 1431 |
| 182 | Ga0105244_10276542 | 3300009036 | Bacteria | 779 |
| 183 | Ga0105250_10000605 | 3300009092 | Bacteria | 23408 |
| 184 | Ga0105250_10002587 | 3300009092 | Bacteria | 9012 |
| 185 | Ga0105250_10003447 | 3300009092 | Bacteria | 7496 |
| 186 | Ga0105250_10003816 | 3300009092 | Bacteria | 7075 |
| 187 | Ga0105250_10004205 | 3300009092 | Bacteria | 6671 |
| 188 | Ga0105250_10011988 | 3300009092 | Bacteria | 3589 |
| 189 | Ga0105250_10030034 | 3300009092 | Bacteria | 2186 |
| 190 | Ga0105250_10032680 | 3300009092 | Bacteria | 2089 |
| 191 | Ga0105250_10057968 | 3300009092 | Bacteria | 1554 |
| 192 | Ga0105250_10101348 | 3300009092 | Bacteria | 1175 |
| 193 | Ga0105240_10003351 | 3300009093 | Bacteria | 24930 |
| 194 | Ga0105240_10028663 | 3300009093 | Bacteria | 7266 |
| 195 | Ga0105240_10118802 | 3300009093 | Bacteria | 3186 |
| 196 | Ga0105243_10007062 | 3300009148 | Bacteria | 8635 |
| 197 | Ga0105243_10007538 | 3300009148 | Bacteria | 8366 |
| 198 | Ga0105243_10013877 | 3300009148 | Bacteria | 6099 |
| 199 | Ga0105243_10053584 | 3300009148 | Bacteria | 3200 |
| 200 | Ga0105243_10170509 | 3300009148 | Bacteria | 1884 |
| 201 | Ga0105242_10004917 | 3300009176 | Bacteria | 10346 |
| 202 | Ga0105242_10033598 | 3300009176 | Bacteria | 4109 |
| 203 | Ga0105242_10164967 | 3300009176 | Bacteria | 1942 |
| 204 | Ga0105242_10440437 | 3300009176 | Bacteria | 1226 |
| 205 | Ga0105237_10005994 | 3300009545 | Bacteria | 13608 |
| 206 | Ga0105237_10093575 | 3300009545 | Bacteria | 2995 |
| 207 | Ga0105237_10149362 | 3300009545 | Bacteria | 2333 |
| 208 | Ga0105237_10268524 | 3300009545 | Bacteria | 1709 |
| 209 | Ga0105237_10340359 | 3300009545 | Bacteria | 1505 |
| 210 | Ga0105238_10000037 | 3300009551 | Bacteria | 163954 |
| 211 | Ga0105238_10080399 | 3300009551 | Bacteria | 3249 |
| 212 | Ga0105239_10013749 | 3300010375 | Bacteria | 8985 |
| 213 | Ga0105239_10092298 | 3300010375 | Bacteria | 3342 |
| 214 | Ga0105246_10000162 | 3300011119 | Bacteria | 32137 |
| 215 | Ga0105246_10000432 | 3300011119 | Bacteria | 22385 |
| 216 | Ga0105246_10019035 | 3300011119 | Bacteria | 4380 |
| 217 | Ga0105246_10025124 | 3300011119 | Bacteria | 3881 |
| 218 | Ga0105246_10111801 | 3300011119 | Bacteria | 2008 |
| 219 | Ga0105246_10169006 | 3300011119 | Bacteria | 1673 |
| 220 | Ga0157345_1000059 | 3300012498 | Bacteria | 23613 |
| 221 | Ga0157373_10003992 | 3300013100 | Bacteria | 11124 |
| 222 | Ga0157373_10007482 | 3300013100 | Bacteria | 8124 |
| 223 | Ga0157373_10011402 | 3300013100 | Bacteria | 6538 |
| 224 | Ga0157373_10043148 | 3300013100 | Bacteria | 3222 |
| 225 | Ga0157373_10043917 | 3300013100 | Bacteria | 3191 |
| 226 | Ga0157373_10085841 | 3300013100 | Bacteria | 2218 |
| 227 | Ga0157373_10129501 | 3300013100 | Bacteria | 1774 |
| 228 | Ga0157373_10152386 | 3300013100 | Bacteria | 1626 |
| 229 | Ga0157373_10178942 | 3300013100 | Bacteria | 1493 |
| 230 | Ga0157371_10000039 | 3300013102 | Bacteria | 207724 |
| 231 | Ga0157371_10011165 | 3300013102 | Bacteria | 6947 |
| 232 | Ga0157371_10025849 | 3300013102 | Bacteria | 4273 |
| 233 | Ga0157371_10115285 | 3300013102 | Bacteria | 1908 |
| 234 | Ga0157371_10163806 | 3300013102 | Bacteria | 1588 |
| 235 | Ga0157371_10227328 | 3300013102 | Bacteria | 1340 |
| 236 | Ga0157370_10000070 | 3300013104 | Bacteria | 112014 |
| 237 | Ga0157370_10011932 | 3300013104 | Bacteria | 9060 |
| 238 | Ga0157370_10039117 | 3300013104 | Bacteria | 4584 |
| 239 | Ga0157370_10052578 | 3300013104 | Bacteria | 3889 |
| 240 | Ga0157370_10072242 | 3300013104 | Bacteria | 3256 |
| 241 | Ga0157370_10105658 | 3300013104 | Bacteria | 2635 |
| 242 | Ga0157370_10141128 | 3300013104 | Bacteria | 2245 |
| 243 | Ga0157370_10386291 | 3300013104 | Bacteria | 1289 |
| 244 | Ga0157369_10039350 | 3300013105 | Bacteria | 5168 |
| 245 | Ga0157369_10052988 | 3300013105 | Bacteria | 4387 |
| 246 | Ga0157369_10086792 | 3300013105 | Bacteria | 3341 |
| 247 | Ga0157369_10094667 | 3300013105 | Bacteria | 3188 |
| 248 | Ga0157369_10095256 | 3300013105 | Bacteria | 3177 |
| 249 | Ga0157369_10133358 | 3300013105 | Bacteria | 2631 |
| 250 | Ga0157369_10138981 | 3300013105 | Bacteria | 2571 |
| 251 | Ga0163162_10048268 | 3300013306 | Bacteria | 4265 |
| 252 | Ga0163162_10770004 | 3300013306 | Bacteria | 1081 |
| 253 | Ga0163162_11101635 | 3300013306 | Bacteria | 900 |
| 254 | Ga0157372_10109402 | 3300013307 | Bacteria | 3165 |
| 255 | Ga0157372_10131463 | 3300013307 | Bacteria | 2880 |
| 256 | Ga0157375_10086735 | 3300013308 | Bacteria | 3182 |
| 257 | Ga0157375_10090932 | 3300013308 | Bacteria | 3112 |
| 258 | Ga0157375_10249140 | 3300013308 | Bacteria | 1937 |
| 259 | Ga0157375_10382958 | 3300013308 | Bacteria | 1573 |
| 260 | Ga0157375_10911217 | 3300013308 | Bacteria | 1023 |
| 261 | Ga0157380_10410785 | 3300014326 | Bacteria | 1287 |
| 262 | Ga0182008_10000662 | 3300014497 | Bacteria | 24971 |
| 263 | Ga0182008_10003064 | 3300014497 | Bacteria | 10267 |
| 264 | Ga0182008_10005030 | 3300014497 | Bacteria | 7604 |
| 265 | Ga0182008_10013293 | 3300014497 | Bacteria | 4328 |
| 266 | Ga0182008_10013647 | 3300014497 | Bacteria | 4269 |
| 267 | Ga0182008_10024543 | 3300014497 | Bacteria | 3068 |
| 268 | Ga0182008_10025165 | 3300014497 | Bacteria | 3025 |
| 269 | Ga0182008_10026256 | 3300014497 | Bacteria | 2954 |
| 270 | Ga0182008_10052314 | 3300014497 | Bacteria | 2025 |
| 271 | Ga0182008_10097056 | 3300014497 | Bacteria | 1455 |
| 272 | Ga0182008_10153588 | 3300014497 | Bacteria | 1155 |
| 273 | Ga0157376_10340397 | 3300014969 | Bacteria | 1432 |
| 274 | Ga0182006_1006448 | 3300015261 | Bacteria | 5451 |
| 275 | Ga0182006_1010871 | 3300015261 | Bacteria | 4027 |
| 276 | Ga0182006_1014777 | 3300015261 | Bacteria | 3358 |
| 277 | Ga0182006_1016147 | 3300015261 | Bacteria | 3189 |
| 278 | Ga0182006_1020055 | 3300015261 | Bacteria | 2805 |
| 279 | Ga0182006_1020526 | 3300015261 | Bacteria | 2767 |
| 280 | Ga0182006_1023930 | 3300015261 | Bacteria | 2525 |
| 281 | Ga0182006_1028676 | 3300015261 | Bacteria | 2262 |
| 282 | Ga0182006_1044379 | 3300015261 | Bacteria | 1734 |
| 283 | Ga0182006_1050795 | 3300015261 | Bacteria | 1597 |
| 284 | Ga0182006_1068441 | 3300015261 | Bacteria | 1322 |
| 285 | Ga0182006_1148228 | 3300015261 | Bacteria | 797 |
| 286 | Ga0182007_10001352 | 3300015262 | Bacteria | 13221 |
| 287 | Ga0182007_10001934 | 3300015262 | Bacteria | 10718 |
| 288 | Ga0182007_10006630 | 3300015262 | Bacteria | 4956 |
| 289 | Ga0182007_10017947 | 3300015262 | Bacteria | 2575 |
| 290 | Ga0182007_10019671 | 3300015262 | Bacteria | 2424 |
| 291 | Ga0182007_10025132 | 3300015262 | Bacteria | 2077 |
| 292 | Ga0182007_10026086 | 3300015262 | Bacteria | 2029 |
| 293 | Ga0182005_1000183 | 3300015265 | Bacteria | 42914 |
| 294 | Ga0182005_1007397 | 3300015265 | Bacteria | 3296 |
| 295 | Ga0182005_1010616 | 3300015265 | Bacteria | 2644 |
| 296 | Ga0182005_1021610 | 3300015265 | Bacteria | 1765 |
| 297 | Ga0182005_1035003 | 3300015265 | Bacteria | 1366 |
| 298 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 299 | Ga0183361_10004 | 3300016635 | Bacteria | 484183 |
| 300 | Ga0163161_10046855 | 3300017792 | Bacteria | 3120 |
| 301 | Ga0163161_10101646 | 3300017792 | Bacteria | 2140 |
| 302 | Ga0163161_10124933 | 3300017792 | Bacteria | 1936 |
| 303 | Ga0163161_10167083 | 3300017792 | Bacteria | 1680 |
| 304 | Ga0163161_10173430 | 3300017792 | Bacteria | 1650 |
| 305 | Ga0163161_10181486 | 3300017792 | Bacteria | 1614 |
| 306 | Ga0163161_10215667 | 3300017792 | Bacteria | 1484 |
| 307 | Ga0163161_10239651 | 3300017792 | Bacteria | 1410 |
| 308 | Ga0163161_10258045 | 3300017792 | Bacteria | 1360 |
| 309 | Ga0163161_10279826 | 3300017792 | Bacteria | 1308 |
| 310 | Ga0163161_10287576 | 3300017792 | Bacteria | 1291 |
| 311 | Ga0163161_10325029 | 3300017792 | Bacteria | 1217 |
| 312 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 313 | Ga0209435_100046 | 3300025206 | Bacteria | 95081 |
| 314 | Ga0209435_100377 | 3300025206 | Bacteria | 9928 |
| 315 | Ga0209435_100768 | 3300025206 | Bacteria | 5258 |
| 316 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 317 | Ga0209760_101344 | 3300025207 | Bacteria | 2647 |
| 318 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 319 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 320 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 321 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 322 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 323 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 324 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 325 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 326 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 327 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 328 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 329 | Ga0209147_100157 | 3300025229 | Bacteria | 92005 |
| 330 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 331 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 332 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 333 | Ga0209563_100268 | 3300025230 | Bacteria | 22421 |
| 334 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 335 | Ga0207427_100149 | 3300025231 | Bacteria | 78920 |
| 336 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 337 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 338 | Ga0209437_100207 | 3300025233 | Bacteria | 112147 |
| 339 | Ga0209437_100939 | 3300025233 | Bacteria | 10959 |
| 340 | Ga0209258_100851 | 3300025242 | Bacteria | 16447 |
| 341 | Ga0209258_100913 | 3300025242 | Bacteria | 14949 |
| 342 | Ga0209258_101397 | 3300025242 | Bacteria | 8633 |
| 343 | Ga0209646_1000141 | 3300025246 | Bacteria | 107030 |
| 344 | Ga0209646_1000149 | 3300025246 | Bacteria | 100004 |
| 345 | Ga0209646_1000156 | 3300025246 | Bacteria | 95083 |
| 346 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 347 | Ga0209646_1000233 | 3300025246 | Bacteria | 57776 |
| 348 | Ga0209646_1000524 | 3300025246 | Bacteria | 16813 |
| 349 | Ga0209026_1000066 | 3300025250 | Bacteria | 207691 |
| 350 | Ga0209026_1000776 | 3300025250 | Bacteria | 17734 |
| 351 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 352 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 353 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 354 | Ga0209148_1012493 | 3300025254 | Bacteria | 1550 |
| 355 | Ga0209148_1015404 | 3300025254 | Bacteria | 1336 |
| 356 | Ga0209759_1000072 | 3300025256 | Bacteria | 178206 |
| 357 | Ga0209759_1000182 | 3300025256 | Bacteria | 102836 |
| 358 | Ga0209759_1001083 | 3300025256 | Bacteria | 17734 |
| 359 | Ga0209759_1001715 | 3300025256 | Bacteria | 11322 |
| 360 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 361 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 362 | Ga0209565_1001951 | 3300025263 | Bacteria | 8088 |
| 363 | Ga0209455_1001032 | 3300025272 | Bacteria | 13865 |
| 364 | Ga0209455_1002502 | 3300025272 | Bacteria | 7057 |
| 365 | Ga0209673_1011314 | 3300025273 | Bacteria | 3686 |
| 366 | Ga0209130_1010307 | 3300025284 | Bacteria | 2586 |
| 367 | Ga0209130_1032862 | 3300025284 | Bacteria | 1054 |
| 368 | Ga0209675_1000078 | 3300025291 | Bacteria | 156111 |
| 369 | Ga0209675_1000573 | 3300025291 | Bacteria | 26547 |
| 370 | Ga0209675_1001701 | 3300025291 | Bacteria | 12170 |
| 371 | Ga0209675_1003212 | 3300025291 | Bacteria | 7917 |
| 372 | Ga0209675_1004183 | 3300025291 | Bacteria | 6528 |
| 373 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 374 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 375 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 376 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 377 | Ga0209676_1007094 | 3300025292 | Bacteria | 5363 |
| 378 | Ga0209676_1026401 | 3300025292 | Bacteria | 1845 |
| 379 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 380 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 381 | Ga0209025_1003638 | 3300025294 | Bacteria | 14313 |
| 382 | Ga0209025_1034026 | 3300025294 | Bacteria | 2339 |
| 383 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 384 | Ga0209564_1020032 | 3300025295 | Bacteria | 2471 |
| 385 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 386 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 387 | Ga0209050_1000228 | 3300025298 | Bacteria | 123537 |
| 388 | Ga0209050_1000332 | 3300025298 | Bacteria | 94224 |
| 389 | Ga0209050_1001473 | 3300025298 | Bacteria | 25146 |
| 390 | Ga0209050_1011157 | 3300025298 | Bacteria | 4303 |
| 391 | Ga0209050_1022072 | 3300025298 | Bacteria | 2294 |
| 392 | Ga0209050_1035225 | 3300025298 | Bacteria | 1483 |
| 393 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 394 | Ga0209256_1000699 | 3300025299 | Bacteria | 44604 |
| 395 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 396 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 397 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 398 | Ga0209051_1000367 | 3300025303 | Bacteria | 65677 |
| 399 | Ga0209051_1001294 | 3300025303 | Bacteria | 22056 |
| 400 | Ga0209051_1007252 | 3300025303 | Bacteria | 6093 |
| 401 | Ga0209051_1009205 | 3300025303 | Bacteria | 5115 |
| 402 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 403 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 404 | Ga0209257_1000262 | 3300025304 | Bacteria | 121021 |
| 405 | Ga0209257_1022106 | 3300025304 | Bacteria | 2281 |
| 406 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 407 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 408 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 409 | Ga0207696_1001215 | 3300025711 | Bacteria | 14643 |
| 410 | Ga0207696_1003799 | 3300025711 | Bacteria | 6726 |
| 411 | Ga0207696_1005266 | 3300025711 | Bacteria | 5393 |
| 412 | Ga0207696_1024464 | 3300025711 | Bacteria | 1893 |
| 413 | Ga0207696_1041534 | 3300025711 | Bacteria | 1343 |
| 414 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 415 | Ga0207655_1000083 | 3300025728 | Bacteria | 213295 |
| 416 | Ga0207655_1000703 | 3300025728 | Bacteria | 38823 |
| 417 | Ga0207655_1002748 | 3300025728 | Bacteria | 13718 |
| 418 | Ga0207655_1005392 | 3300025728 | Bacteria | 8711 |
| 419 | Ga0207655_1005543 | 3300025728 | Bacteria | 8557 |
| 420 | Ga0207655_1005590 | 3300025728 | Bacteria | 8511 |
| 421 | Ga0207655_1007307 | 3300025728 | Bacteria | 7180 |
| 422 | Ga0207655_1012751 | 3300025728 | Bacteria | 4878 |
| 423 | Ga0207655_1012880 | 3300025728 | Bacteria | 4844 |
| 424 | Ga0207655_1013705 | 3300025728 | Bacteria | 4633 |
| 425 | Ga0207655_1015570 | 3300025728 | Bacteria | 4215 |
| 426 | Ga0207655_1020094 | 3300025728 | Bacteria | 3455 |
| 427 | Ga0207655_1041823 | 3300025728 | Bacteria | 1959 |
| 428 | Ga0207655_1142231 | 3300025728 | Bacteria | 769 |
| 429 | Ga0207713_1000032 | 3300025735 | Bacteria | 276465 |
| 430 | Ga0207713_1000079 | 3300025735 | Bacteria | 172274 |
| 431 | Ga0207713_1000659 | 3300025735 | Bacteria | 32880 |
| 432 | Ga0207713_1000750 | 3300025735 | Bacteria | 30221 |
| 433 | Ga0207713_1000837 | 3300025735 | Bacteria | 28361 |
| 434 | Ga0207713_1001056 | 3300025735 | Bacteria | 23875 |
| 435 | Ga0207713_1002266 | 3300025735 | Bacteria | 14188 |
| 436 | Ga0207713_1002477 | 3300025735 | Bacteria | 13429 |
| 437 | Ga0207713_1006015 | 3300025735 | Bacteria | 7480 |
| 438 | Ga0207713_1007842 | 3300025735 | Bacteria | 6225 |
| 439 | Ga0207713_1007888 | 3300025735 | Bacteria | 6204 |
| 440 | Ga0207713_1008313 | 3300025735 | Bacteria | 5993 |
| 441 | Ga0207713_1011258 | 3300025735 | Bacteria | 4878 |
| 442 | Ga0207713_1021313 | 3300025735 | Bacteria | 3109 |
| 443 | Ga0207713_1022601 | 3300025735 | Bacteria | 2980 |
| 444 | Ga0207688_10362594 | 3300025901 | Bacteria | 894 |
| 445 | Ga0207645_10307425 | 3300025907 | Bacteria | 1056 |
| 446 | Ga0207695_10000748 | 3300025913 | Bacteria | 62583 |
| 447 | Ga0207695_10000979 | 3300025913 | Bacteria | 50790 |
| 448 | Ga0207695_10085612 | 3300025913 | Bacteria | 3180 |
| 449 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 450 | Ga0207671_10027798 | 3300025914 | Bacteria | 4228 |
| 451 | Ga0207671_10312044 | 3300025914 | Bacteria | 1243 |
| 452 | Ga0207657_10210920 | 3300025919 | Bacteria | 1559 |
| 453 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 454 | Ga0207649_10194479 | 3300025920 | Bacteria | 1429 |
| 455 | Ga0207681_10000381 | 3300025923 | Bacteria | 31124 |
| 456 | Ga0207681_10000482 | 3300025923 | Bacteria | 27925 |
| 457 | Ga0207681_10009066 | 3300025923 | Bacteria | 6077 |
| 458 | Ga0207694_10000069 | 3300025924 | Bacteria | 124500 |
| 459 | Ga0207694_10033085 | 3300025924 | Bacteria | 3960 |
| 460 | Ga0207694_10340000 | 3300025924 | Bacteria | 1241 |
| 461 | Ga0207650_10000338 | 3300025925 | Bacteria | 45436 |
| 462 | Ga0207650_10000564 | 3300025925 | Bacteria | 30060 |
| 463 | Ga0207650_10176277 | 3300025925 | Bacteria | 1702 |
| 464 | Ga0207659_10173289 | 3300025926 | Bacteria | 1703 |
| 465 | Ga0207664_10665713 | 3300025929 | Bacteria | 936 |
| 466 | Ga0207644_10289078 | 3300025931 | Bacteria | 1318 |
| 467 | Ga0207706_10001424 | 3300025933 | Bacteria | 23939 |
| 468 | Ga0207706_10042839 | 3300025933 | Bacteria | 4011 |
| 469 | Ga0207686_10000663 | 3300025934 | Bacteria | 21277 |
| 470 | Ga0207686_10241547 | 3300025934 | Bacteria | 1315 |
| 471 | Ga0207686_10271493 | 3300025934 | Bacteria | 1248 |
| 472 | Ga0207709_10000248 | 3300025935 | Bacteria | 66465 |
| 473 | Ga0207709_10003176 | 3300025935 | Bacteria | 9870 |
| 474 | Ga0207709_10181605 | 3300025935 | Bacteria | 1486 |
| 475 | Ga0207709_10203623 | 3300025935 | Bacteria | 1415 |
| 476 | Ga0207669_10759510 | 3300025937 | Bacteria | 801 |
| 477 | Ga0207665_10052433 | 3300025939 | Bacteria | 2748 |
| 478 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 479 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 480 | Ga0207667_10030089 | 3300025949 | Bacteria | 5877 |
| 481 | Ga0207667_10223683 | 3300025949 | Bacteria | 1928 |
| 482 | Ga0207667_10398203 | 3300025949 | Bacteria | 1402 |
| 483 | Ga0207651_10280762 | 3300025960 | Bacteria | 1376 |
| 484 | Ga0207640_10015014 | 3300025981 | Bacteria | 4473 |
| 485 | Ga0207677_10102893 | 3300026023 | Bacteria | 2107 |
| 486 | Ga0207639_10000286 | 3300026041 | Bacteria | 36062 |
| 487 | Ga0207702_10027104 | 3300026078 | Bacteria | 4758 |
| 488 | Ga0207702_10333543 | 3300026078 | Bacteria | 1447 |
| 489 | Ga0207648_10239465 | 3300026089 | Bacteria | 1615 |
| 490 | Ga0207674_10246713 | 3300026116 | Bacteria | 1733 |
| 491 | Ga0207675_101211330 | 3300026118 | Bacteria | 775 |
| 492 | Ga0207683_10472243 | 3300026121 | Bacteria | 1157 |
| 493 | Ga0207698_10000966 | 3300026142 | Bacteria | 16711 |
| 494 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 495 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 496 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 497 | Ga0209281_1005170 | 3300027111 | Bacteria | 3685 |
| 498 | Ga0209281_1007590 | 3300027111 | Bacteria | 2710 |
| 499 | Ga0209371_1000871 | 3300027312 | Bacteria | 24307 |
| 500 | Ga0209282_1000058 | 3300027666 | Bacteria | 99152 |
| 501 | Ga0207428_10007071 | 3300027907 | Bacteria | 10273 |
| 502 | Ga0207428_10072024 | 3300027907 | Bacteria | 2714 |
| 503 | Ga0207428_10076055 | 3300027907 | Bacteria | 2630 |
| 504 | Ga0207428_10085395 | 3300027907 | Bacteria | 2458 |
| 505 | Ga0207428_10093304 | 3300027907 | Bacteria | 2335 |
| 506 | Ga0268266_10004944 | 3300028379 | Bacteria | 12615 |
| 507 | Ga0268266_10040199 | 3300028379 | Bacteria | 3985 |
| 508 | Ga0268266_10290161 | 3300028379 | Bacteria | 1523 |
| 509 | Ga0268266_10622091 | 3300028379 | Bacteria | 1038 |
| 510 | Ga0268266_10834620 | 3300028379 | Bacteria | 890 |
| 511 | Ga0307517_10186905 | 3300028786 | Bacteria | 1324 |
| 512 | Ga0307515_10000215 | 3300028794 | Bacteria | 142594 |
| 513 | Ga0268256_1000771 | 3300030500 | Bacteria | 23304 |
| 514 | Ga0307511_10003163 | 3300030521 | Bacteria | 16949 |
| 515 | Ga0307511_10046070 | 3300030521 | Bacteria | 3593 |
| 516 | Ga0307511_10105971 | 3300030521 | Bacteria | 1817 |
| 517 | Ga0316178_1051183 | 3300030735 | Bacteria | 40899 |
| 518 | Ga0316183_1079327 | 3300030742 | Bacteria | 2695 |
| 519 | Ga0316181_1054368 | 3300030744 | Bacteria | 10190 |
| 520 | Ga0265332_10002934 | 3300031238 | Bacteria | 8389 |
| 521 | Ga0265329_10028102 | 3300031242 | Bacteria | 1845 |
| 522 | Ga0265340_10001308 | 3300031247 | Bacteria | 14259 |
| 523 | Ga0265331_10011421 | 3300031250 | Bacteria | 4864 |
| 524 | Ga0265327_10036761 | 3300031251 | Bacteria | 2688 |
| 525 | Ga0265327_10058111 | 3300031251 | Bacteria | 1987 |
| 526 | Ga0265316_10053295 | 3300031344 | Bacteria | 3170 |
| 527 | Ga0265316_10199969 | 3300031344 | Bacteria | 1482 |
| 528 | Ga0307513_10146120 | 3300031456 | Bacteria | 2282 |
| 529 | Ga0307509_10141275 | 3300031507 | Bacteria | 2342 |
| 530 | Ga0307509_10373778 | 3300031507 | Bacteria | 1141 |
| 531 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 532 | Ga0307408_100018437 | 3300031548 | Bacteria | 4685 |
| 533 | Ga0307408_100030557 | 3300031548 | Bacteria | 3741 |
| 534 | Ga0307408_100135174 | 3300031548 | Bacteria | 1928 |
| 535 | Ga0307408_100368944 | 3300031548 | Bacteria | 1223 |
| 536 | Ga0307408_100839944 | 3300031548 | Bacteria | 836 |
| 537 | Ga0265314_10038167 | 3300031711 | Bacteria | 3474 |
| 538 | Ga0265342_10002113 | 3300031712 | Bacteria | 17530 |
| 539 | Ga0307516_10329423 | 3300031730 | Bacteria | 1196 |
| 540 | Ga0307405_10021286 | 3300031731 | Bacteria | 3641 |
| 541 | Ga0307405_10030612 | 3300031731 | Bacteria | 3157 |
| 542 | Ga0307405_10118288 | 3300031731 | Bacteria | 1808 |
| 543 | Ga0307405_10219610 | 3300031731 | Bacteria | 1393 |
| 544 | Ga0307405_10445495 | 3300031731 | Bacteria | 1025 |
| 545 | Ga0307413_10467860 | 3300031824 | Bacteria | 1004 |
| 546 | Ga0307406_10031651 | 3300031901 | Bacteria | 3222 |
| 547 | Ga0307406_10064864 | 3300031901 | Bacteria | 2371 |
| 548 | Ga0307406_10422248 | 3300031901 | Bacteria | 1063 |
| 549 | Ga0307412_10000401 | 3300031911 | Bacteria | 26384 |
| 550 | Ga0307412_10014881 | 3300031911 | Bacteria | 4598 |
| 551 | Ga0307412_10027454 | 3300031911 | Bacteria | 3549 |
| 552 | Ga0307412_10114444 | 3300031911 | Bacteria | 1931 |
| 553 | Ga0307412_10128873 | 3300031911 | Bacteria | 1834 |
| 554 | Ga0307412_10143622 | 3300031911 | Bacteria | 1751 |
| 555 | Ga0307412_10229525 | 3300031911 | Bacteria | 1428 |
| 556 | Ga0307409_100114929 | 3300031995 | Bacteria | 2265 |
| 557 | Ga0307416_100168469 | 3300032002 | Bacteria | 2035 |
| 558 | Ga0307416_100235127 | 3300032002 | Bacteria | 1770 |
| 559 | Ga0307416_100313562 | 3300032002 | Bacteria | 1566 |
| 560 | Ga0307416_101373701 | 3300032002 | Bacteria | 812 |
| 561 | Ga0307414_10018847 | 3300032004 | Bacteria | 4261 |
| 562 | Ga0307414_10351963 | 3300032004 | Bacteria | 1264 |
| 563 | Ga0307414_10529026 | 3300032004 | Bacteria | 1047 |
| 564 | Ga0307414_11003013 | 3300032004 | Bacteria | 768 |
| 565 | Ga0307411_10021537 | 3300032005 | Bacteria | 3774 |
| 566 | Ga0307411_10044282 | 3300032005 | Bacteria | 2853 |
| 567 | Ga0307411_10069287 | 3300032005 | Bacteria | 2381 |
| 568 | Ga0307510_10081644 | 3300033180 | Bacteria | 3132 |
| 569 | Ga0395899_0000478 | 3300037312 | Bacteria | 44762 |
| 570 | Ga0395899_0002559 | 3300037312 | Bacteria | 14713 |
| 571 | Ga0395899_0003641 | 3300037312 | Bacteria | 12200 |
| 572 | Ga0395899_0010527 | 3300037312 | Bacteria | 7084 |
| 573 | Ga0395899_0021543 | 3300037312 | Bacteria | 4887 |
| 574 | Ga0395900_0000689 | 3300037418 | Bacteria | 45109 |
| 575 | Ga0395900_0009793 | 3300037418 | Bacteria | 9820 |
| 576 | Ga0395900_0054673 | 3300037418 | Bacteria | 4111 |
| 577 | Ga0395900_0067915 | 3300037418 | Bacteria | 3662 |
| 578 | Ga0395898_0006853 | 3300037466 | Bacteria | 12116 |
| 579 | Ga0395898_0012935 | 3300037466 | Bacteria | 8609 |
| 580 | Ga0395898_0542779 | 3300037466 | Bacteria | 1104 |
| 581 | Ga0395905_0001455 | 3300037471 | Bacteria | 28407 |
| 582 | Ga0395905_0006806 | 3300037471 | Bacteria | 11449 |
| 583 | Ga0395905_0040143 | 3300037471 | Bacteria | 4390 |
| 584 | Ga0395905_0131624 | 3300037471 | Bacteria | 2353 |
| 585 | Ga0395901_0000448 | 3300038443 | Bacteria | 47911 |
| 586 | Ga0395901_0013926 | 3300038443 | Bacteria | 8184 |
| 587 | Ga0395901_0021143 | 3300038443 | Bacteria | 6666 |
| 588 | Ga0395901_0707761 | 3300038443 | Bacteria | 1004 |
| 589 | Ga0237819_00552 | 3300038705 | Bacteria | 12558 |
| 590 | Ga0436361_0383577 | 3300039447 | Bacteria | 3194 |
| 591 | Ga0439436_0002185 | 3300041404 | Bacteria | 5852 |
| 592 | Ga0439436_0014730 | 3300041404 | Bacteria | 2355 |
| 593 | Ga0439436_0031731 | 3300041404 | Bacteria | 1533 |
| 594 | Ga0439438_003027 | 3300041405 | Bacteria | 6923 |
| 595 | Ga0439438_008131 | 3300041405 | Bacteria | 3515 |
| 596 | Ga0439438_009379 | 3300041405 | Bacteria | 3171 |
| 597 | Ga0439438_029762 | 3300041405 | Bacteria | 1460 |
| 598 | Ga0439438_056012 | 3300041405 | Bacteria | 993 |
| 599 | Ga0439447_002518 | 3300041407 | Bacteria | 6665 |
| 600 | Ga0439447_003011 | 3300041407 | Bacteria | 6030 |
| 601 | Ga0439447_005933 | 3300041407 | Bacteria | 4012 |
| 602 | Ga0439447_008182 | 3300041407 | Bacteria | 3257 |
| 603 | Ga0439447_041380 | 3300041407 | Bacteria | 1121 |
| 604 | Ga0439447_048871 | 3300041407 | Bacteria | 1014 |
| 605 | Ga0439453_0033084 | 3300041408 | Bacteria | 987 |
| 606 | Ga0439461_0060740 | 3300041410 | Bacteria | 858 |
| 607 | Ga0439466_0002249 | 3300041411 | Bacteria | 7564 |
| 608 | Ga0439466_0002406 | 3300041411 | Bacteria | 7338 |
| 609 | Ga0439466_0002488 | 3300041411 | Bacteria | 7216 |
| 610 | Ga0439466_0005445 | 3300041411 | Bacteria | 4865 |
| 611 | Ga0439466_0007824 | 3300041411 | Bacteria | 4036 |
| 612 | Ga0439466_0011931 | 3300041411 | Bacteria | 3209 |
| 613 | Ga0439466_0022629 | 3300041411 | Bacteria | 2216 |
| 614 | Ga0439466_0072787 | 3300041411 | Bacteria | 1092 |
| 615 | Ga0439465_0002411 | 3300041413 | Bacteria | 6124 |
| 616 | Ga0439431_0000362 | 3300041997 | Bacteria | 9558 |
| 617 | Ga0439433_0000386 | 3300041999 | Bacteria | 7896 |
| 618 | Ga0439442_003449 | 3300042002 | Bacteria | 3128 |
| 619 | Ga0439445_0000121 | 3300042004 | Bacteria | 13329 |
| 620 | Ga0439448_0000259 | 3300042005 | Bacteria | 11457 |
| 621 | Ga0439432_000513 | 3300042006 | Bacteria | 14429 |
| 622 | Ga0439432_001999 | 3300042006 | Bacteria | 7720 |
| 623 | Ga0439432_012071 | 3300042006 | Bacteria | 2964 |
| 624 | Ga0439432_015834 | 3300042006 | Bacteria | 2540 |
| 625 | Ga0439432_032113 | 3300042006 | Bacteria | 1695 |
| 626 | Ga0439432_059886 | 3300042006 | Bacteria | 1175 |
| 627 | Ga0439449_0001222 | 3300042007 | Bacteria | 10081 |
| 628 | Ga0439449_0052621 | 3300042007 | Bacteria | 1505 |
| 629 | Ga0439450_003664 | 3300042008 | Bacteria | 2561 |
| 630 | Ga0439451_000646 | 3300042009 | Bacteria | 6609 |
| 631 | Ga0439451_003347 | 3300042009 | Bacteria | 3247 |
| 632 | Ga0439451_004400 | 3300042009 | Bacteria | 2862 |
| 633 | Ga0439451_008272 | 3300042009 | Bacteria | 2109 |
| 634 | Ga0439451_048696 | 3300042009 | Bacteria | 848 |
| 635 | Ga0439451_051306 | 3300042009 | Bacteria | 826 |
| 636 | Ga0439452_002368 | 3300042010 | Bacteria | 7001 |
| 637 | Ga0439452_002759 | 3300042010 | Bacteria | 6347 |
| 638 | Ga0439452_008262 | 3300042010 | Bacteria | 3144 |
| 639 | Ga0439452_008471 | 3300042010 | Bacteria | 3093 |
| 640 | Ga0439452_022738 | 3300042010 | Bacteria | 1619 |
| 641 | Ga0439452_048695 | 3300042010 | Bacteria | 976 |
| 642 | Ga0439455_0023343 | 3300042012 | Bacteria | 1488 |
| 643 | Ga0439456_001671 | 3300042013 | Bacteria | 4478 |
| 644 | Ga0439456_004150 | 3300042013 | Bacteria | 2935 |
| 645 | Ga0439456_042724 | 3300042013 | Bacteria | 984 |
| 646 | Ga0439462_0011605 | 3300042015 | Bacteria | 2245 |
| 647 | Ga0439463_001315 | 3300042016 | Bacteria | 6617 |
| 648 | Ga0439463_001732 | 3300042016 | Bacteria | 5691 |
| 649 | Ga0439463_003054 | 3300042016 | Bacteria | 4251 |
| 650 | Ga0439463_029998 | 3300042016 | Bacteria | 1370 |
| 651 | Ga0450911_001308 | 3300042115 | Bacteria | 5904 |
| 652 | Ga0450911_007537 | 3300042115 | Bacteria | 1573 |
| 653 | Ga0450919_001489 | 3300042121 | Bacteria | 3058 |
| 654 | Ga0450919_003601 | 3300042121 | Bacteria | 1922 |
| 655 | Ga0450920_001631 | 3300042122 | Bacteria | 3745 |
| 656 | Ga0450923_015979 | 3300042125 | Bacteria | 1409 |
| 657 | Ga0450890_003335 | 3300042127 | Bacteria | 2141 |
| 658 | Ga0450900_001223 | 3300042136 | Bacteria | 2437 |
| 659 | Ga0450902_004412 | 3300042137 | Bacteria | 2093 |
| 660 | Ga0450902_016447 | 3300042137 | Bacteria | 1206 |
| 661 | Ga0450903_001035 | 3300042138 | Bacteria | 5309 |
| 662 | Ga0450903_009052 | 3300042138 | Bacteria | 1625 |
| 663 | Ga0450903_015548 | 3300042138 | Bacteria | 1198 |
| 664 | Ga0450905_001395 | 3300042142 | Bacteria | 3075 |
| 665 | Ga0450906_001441 | 3300042145 | Bacteria | 5178 |
| 666 | Ga0450906_004512 | 3300042145 | Bacteria | 2914 |
| 667 | Ga0450907_001403 | 3300042146 | Bacteria | 5255 |
| 668 | Ga0450907_001502 | 3300042146 | Bacteria | 4994 |
| 669 | Ga0450907_001564 | 3300042146 | Bacteria | 4871 |
| 670 | Ga0450910_001446 | 3300042147 | Bacteria | 2990 |
| 671 | Ga0439446_0017528 | 3300042156 | Bacteria | 2002 |
| 672 | Ga0439446_0021589 | 3300042156 | Bacteria | 1821 |
| 673 | Ga0450908_011990 | 3300042184 | Bacteria | 1578 |
| 674 | Ga0450908_022912 | 3300042184 | Bacteria | 1094 |
| 675 | Ga0450908_042764 | 3300042184 | Bacteria | 785 |
| 676 | Ga0450909_002330 | 3300042185 | Bacteria | 2692 |
| 677 | Ga0450909_007436 | 3300042185 | Bacteria | 1586 |
| 678 | Ga0439434_0034102 | 3300042435 | Bacteria | 1553 |
| 679 | Ga0439434_0104232 | 3300042435 | Bacteria | 915 |
| 680 | Ga0439464_0002118 | 3300042439 | Bacteria | 4838 |
| 681 | Ga0439460_0000913 | 3300042461 | Bacteria | 6754 |
| 682 | Ga0439460_0027876 | 3300042461 | Bacteria | 1589 |
| 683 | Ga0450918_000196 | 3300042531 | Bacteria | 13608 |
| 684 | Ga0450918_004059 | 3300042531 | Bacteria | 2689 |
| 685 | Ga0450901_000243 | 3300042533 | Bacteria | 6617 |
| 686 | Ga0439440_0011461 | 3300042993 | Bacteria | 1869 |
| 687 | Ga0466969_0002577 | 3300044656 | Bacteria | 9685 |
| 688 | Ga0466972_0003793 | 3300044658 | Bacteria | 7513 |
| 689 | Ga0466972_0029120 | 3300044658 | Bacteria | 2720 |
| 690 | Ga0466972_0184092 | 3300044658 | Bacteria | 979 |
| 691 | Ga0466965_0004441 | 3300044683 | Bacteria | 6237 |
| 692 | Ga0466965_0015148 | 3300044683 | Bacteria | 3661 |
| 693 | Ga0466965_0038432 | 3300044683 | Bacteria | 2351 |
| 694 | Ga0466965_0161174 | 3300044683 | Bacteria | 1176 |
| 695 | Ga0466966_0052393 | 3300044684 | Bacteria | 2592 |
| 696 | Ga0466966_0080819 | 3300044684 | Bacteria | 2024 |
| 697 | Ga0466961_0017656 | 3300044693 | Bacteria | 4583 |
| 698 | Ga0466964_0001947 | 3300044706 | Bacteria | 7239 |
| 699 | Ga0466964_0017499 | 3300044706 | Bacteria | 2743 |
| 700 | Ga0466964_0026220 | 3300044706 | Bacteria | 2280 |
| 701 | Ga0466964_0214650 | 3300044706 | Bacteria | 931 |
| 702 | Ga0466968_0007003 | 3300044735 | Bacteria | 4274 |
| 703 | Ga0466968_0007529 | 3300044735 | Bacteria | 4144 |
| 704 | Ga0466968_0008302 | 3300044735 | Bacteria | 3973 |
| 705 | Ga0466957_0020683 | 3300044842 | Bacteria | 3873 |
| 706 | Ga0466960_0127563 | 3300044901 | Bacteria | 1339 |
| 707 | Ga0466960_0140472 | 3300044901 | Bacteria | 1282 |
| 708 | Ga0466960_0325598 | 3300044901 | Bacteria | 871 |
| 709 | Ga0466959_0014864 | 3300045049 | Bacteria | 5667 |
| 710 | Ga0466959_0045215 | 3300045049 | Bacteria | 3243 |
| 711 | Ga0466959_0365778 | 3300045049 | Bacteria | 982 |
| 712 | Ga0466958_0077912 | 3300045836 | Bacteria | 2036 |
| 713 | Ga0466967_0010798 | 3300045976 | Bacteria | 6872 |
| 714 | Ga0495617_008515 | 3300046452 | Bacteria | 3534 |
| 715 | Ga0495617_011744 | 3300046452 | Bacteria | 2986 |
| 716 | Ga0495617_015578 | 3300046452 | Bacteria | 2574 |
| 717 | Ga0495627_000083 | 3300046453 | Bacteria | 113227 |
| 718 | Ga0495627_003909 | 3300046453 | Bacteria | 6377 |
| 719 | Ga0495627_005462 | 3300046453 | Bacteria | 5119 |
| 720 | Ga0495627_006280 | 3300046453 | Bacteria | 4668 |
| 721 | Ga0495627_008624 | 3300046453 | Bacteria | 3803 |
| 722 | Ga0495627_009171 | 3300046453 | Bacteria | 3650 |
| 723 | Ga0495627_024339 | 3300046453 | Bacteria | 1974 |
| 724 | Ga0495627_041276 | 3300046453 | Bacteria | 1417 |
| 725 | Ga0495592_0064774 | 3300046454 | Bacteria | 2677 |
| 726 | Ga0495603_0004335 | 3300046455 | Bacteria | 8462 |
| 727 | Ga0495603_0080815 | 3300046455 | Bacteria | 1905 |
| 728 | Ga0495603_0102798 | 3300046455 | Bacteria | 1668 |
| 729 | Ga0495590_0012084 | 3300046457 | Bacteria | 3212 |
| 730 | Ga0495590_0014464 | 3300046457 | Bacteria | 2877 |
| 731 | Ga0495590_0025283 | 3300046457 | Bacteria | 2088 |
| 732 | Ga0495590_0073097 | 3300046457 | Bacteria | 1205 |
| 733 | Ga0495590_0074436 | 3300046457 | Bacteria | 1194 |
| 734 | Ga0495590_0138886 | 3300046457 | Bacteria | 876 |
| 735 | Ga0495591_000002 | 3300046458 | Bacteria | 455013 |
| 736 | Ga0495591_000113 | 3300046458 | Bacteria | 93452 |
| 737 | Ga0495591_003516 | 3300046458 | Bacteria | 8047 |
| 738 | Ga0495591_003651 | 3300046458 | Bacteria | 7833 |
| 739 | Ga0495591_004074 | 3300046458 | Bacteria | 7281 |
| 740 | Ga0495591_008694 | 3300046458 | Bacteria | 4130 |
| 741 | Ga0495591_009701 | 3300046458 | Bacteria | 3799 |
| 742 | Ga0495591_009752 | 3300046458 | Bacteria | 3784 |
| 743 | Ga0495591_013527 | 3300046458 | Bacteria | 2976 |
| 744 | Ga0495591_014025 | 3300046458 | Bacteria | 2900 |
| 745 | Ga0495591_015116 | 3300046458 | Bacteria | 2738 |
| 746 | Ga0495591_022913 | 3300046458 | Bacteria | 2010 |
| 747 | Ga0495591_034834 | 3300046458 | Bacteria | 1478 |
| 748 | Ga0495591_036110 | 3300046458 | Bacteria | 1441 |
| 749 | Ga0495591_044438 | 3300046458 | Bacteria | 1244 |
| 750 | Ga0495591_051672 | 3300046458 | Bacteria | 1120 |
| 751 | Ga0495591_073907 | 3300046458 | Bacteria | 880 |
| 752 | Ga0495638_0031008 | 3300046460 | Bacteria | 3437 |
| 753 | Ga0495638_0103993 | 3300046460 | Bacteria | 1694 |
| 754 | Ga0495638_0192496 | 3300046460 | Bacteria | 1156 |
| 755 | Ga0495638_0207299 | 3300046460 | Bacteria | 1103 |
| 756 | Ga0495638_0238693 | 3300046460 | Bacteria | 1007 |
| 757 | Ga0495651_0017632 | 3300046462 | Bacteria | 5525 |
| 758 | Ga0495651_0126203 | 3300046462 | Bacteria | 1873 |
| 759 | Ga0495651_0154753 | 3300046462 | Bacteria | 1649 |
| 760 | Ga0495651_0187053 | 3300046462 | Bacteria | 1461 |
| 761 | Ga0495653_0013706 | 3300046463 | Bacteria | 6606 |
| 762 | Ga0495653_0019246 | 3300046463 | Bacteria | 5536 |
| 763 | Ga0495653_0026743 | 3300046463 | Bacteria | 4624 |
| 764 | Ga0495653_0107228 | 3300046463 | Bacteria | 2013 |
| 765 | Ga0495653_0409177 | 3300046463 | Bacteria | 860 |
| 766 | Ga0495650_0000623 | 3300046471 | Bacteria | 47691 |
| 767 | Ga0495650_0002491 | 3300046471 | Bacteria | 14791 |
| 768 | Ga0495650_0003593 | 3300046471 | Bacteria | 11187 |
| 769 | Ga0495650_0067092 | 3300046471 | Bacteria | 1418 |
| 770 | Ga0495650_0073259 | 3300046471 | Bacteria | 1338 |
| 771 | Ga0495650_0089405 | 3300046471 | Bacteria | 1174 |
| 772 | Ga0495580_0002103 | 3300046472 | Bacteria | 17475 |
| 773 | Ga0495605_0000048 | 3300046474 | Bacteria | 170182 |
| 774 | Ga0495605_0000100 | 3300046474 | Bacteria | 109002 |
| 775 | Ga0495605_0000122 | 3300046474 | Bacteria | 101994 |
| 776 | Ga0495605_0000157 | 3300046474 | Bacteria | 86897 |
| 777 | Ga0495605_0000339 | 3300046474 | Bacteria | 46440 |
| 778 | Ga0495605_0001304 | 3300046474 | Bacteria | 16517 |
| 779 | Ga0495605_0003104 | 3300046474 | Bacteria | 10020 |
| 780 | Ga0495605_0007095 | 3300046474 | Bacteria | 6382 |
| 781 | Ga0495605_0008405 | 3300046474 | Bacteria | 5836 |
| 782 | Ga0495605_0009534 | 3300046474 | Bacteria | 5450 |
| 783 | Ga0495605_0024062 | 3300046474 | Bacteria | 3191 |
| 784 | Ga0495605_0040719 | 3300046474 | Bacteria | 2318 |
| 785 | Ga0495605_0041933 | 3300046474 | Bacteria | 2277 |
| 786 | Ga0495605_0060194 | 3300046474 | Bacteria | 1820 |
| 787 | Ga0495605_0062160 | 3300046474 | Bacteria | 1784 |
| 788 | Ga0495605_0072134 | 3300046474 | Bacteria | 1629 |
| 789 | Ga0495605_0131142 | 3300046474 | Bacteria | 1130 |
| 790 | Ga0495639_0003059 | 3300046475 | Bacteria | 7279 |
| 791 | Ga0495639_0003490 | 3300046475 | Bacteria | 6800 |
| 792 | Ga0495639_0143286 | 3300046475 | Bacteria | 1150 |
| 793 | Ga0495584_0002441 | 3300046491 | Bacteria | 10538 |
| 794 | Ga0495584_0007556 | 3300046491 | Bacteria | 5665 |
| 795 | Ga0495584_0008229 | 3300046491 | Bacteria | 5406 |
| 796 | Ga0495584_0017198 | 3300046491 | Bacteria | 3684 |
| 797 | Ga0495584_0022541 | 3300046491 | Bacteria | 3194 |
| 798 | Ga0495584_0026803 | 3300046491 | Bacteria | 2920 |
| 799 | Ga0495584_0073146 | 3300046491 | Bacteria | 1723 |
| 800 | Ga0495584_0106135 | 3300046491 | Bacteria | 1420 |
| 801 | Ga0495584_0124228 | 3300046491 | Bacteria | 1307 |
| 802 | Ga0495584_0166746 | 3300046491 | Bacteria | 1119 |
| 803 | Ga0495585_0010646 | 3300046492 | Bacteria | 5464 |
| 804 | Ga0495585_0025718 | 3300046492 | Bacteria | 3367 |
| 805 | Ga0495585_0036941 | 3300046492 | Bacteria | 2752 |
| 806 | Ga0495585_0058636 | 3300046492 | Bacteria | 2123 |
| 807 | Ga0495585_0116298 | 3300046492 | Bacteria | 1418 |
| 808 | Ga0495594_0026034 | 3300046499 | Bacteria | 3145 |
| 809 | Ga0495594_0028474 | 3300046499 | Bacteria | 3015 |
| 810 | Ga0495596_0000060 | 3300046500 | Bacteria | 79429 |
| 811 | Ga0495596_0008186 | 3300046500 | Bacteria | 4666 |
| 812 | Ga0495596_0088404 | 3300046500 | Bacteria | 1202 |
| 813 | Ga0495607_0000025 | 3300046501 | Bacteria | 159379 |
| 814 | Ga0495607_0000700 | 3300046501 | Bacteria | 32278 |
| 815 | Ga0495607_0004307 | 3300046501 | Bacteria | 10503 |
| 816 | Ga0495607_0009429 | 3300046501 | Bacteria | 6608 |
| 817 | Ga0495607_0010126 | 3300046501 | Bacteria | 6345 |
| 818 | Ga0495607_0013887 | 3300046501 | Bacteria | 5262 |
| 819 | Ga0495607_0020703 | 3300046501 | Bacteria | 4151 |
| 820 | Ga0495607_0023824 | 3300046501 | Bacteria | 3825 |
| 821 | Ga0495607_0027473 | 3300046501 | Bacteria | 3517 |
| 822 | Ga0495607_0027597 | 3300046501 | Bacteria | 3507 |
| 823 | Ga0495607_0032656 | 3300046501 | Bacteria | 3174 |
| 824 | Ga0495607_0036551 | 3300046501 | Bacteria | 2957 |
| 825 | Ga0495607_0047097 | 3300046501 | Bacteria | 2527 |
| 826 | Ga0495607_0052257 | 3300046501 | Bacteria | 2367 |
| 827 | Ga0495607_0071229 | 3300046501 | Bacteria | 1938 |
| 828 | Ga0495607_0087140 | 3300046501 | Bacteria | 1700 |
| 829 | Ga0495607_0105796 | 3300046501 | Bacteria | 1499 |
| 830 | Ga0495607_0113072 | 3300046501 | Bacteria | 1436 |
| 831 | Ga0495607_0124743 | 3300046501 | Bacteria | 1347 |
| 832 | Ga0495607_0229300 | 3300046501 | Bacteria | 904 |
| 833 | Ga0495583_0000096 | 3300046506 | Bacteria | 151090 |
| 834 | Ga0495583_0000174 | 3300046506 | Bacteria | 109079 |
| 835 | Ga0495583_0002655 | 3300046506 | Bacteria | 14891 |
| 836 | Ga0495583_0005999 | 3300046506 | Bacteria | 8060 |
| 837 | Ga0495583_0006439 | 3300046506 | Bacteria | 7678 |
| 838 | Ga0495583_0007722 | 3300046506 | Bacteria | 6698 |
| 839 | Ga0495583_0007740 | 3300046506 | Bacteria | 6687 |
| 840 | Ga0495583_0017638 | 3300046506 | Bacteria | 3783 |
| 841 | Ga0495583_0021365 | 3300046506 | Bacteria | 3331 |
| 842 | Ga0495583_0056286 | 3300046506 | Bacteria | 1774 |
| 843 | Ga0495606_0002388 | 3300046507 | Bacteria | 22020 |
| 844 | Ga0495606_0007622 | 3300046507 | Bacteria | 9623 |
| 845 | Ga0495606_0008130 | 3300046507 | Bacteria | 9189 |
| 846 | Ga0495606_0011278 | 3300046507 | Bacteria | 7308 |
| 847 | Ga0495606_0013494 | 3300046507 | Bacteria | 6445 |
| 848 | Ga0495606_0014237 | 3300046507 | Bacteria | 6221 |
| 849 | Ga0495606_0025647 | 3300046507 | Bacteria | 4216 |
| 850 | Ga0495606_0035068 | 3300046507 | Bacteria | 3434 |
| 851 | Ga0495606_0062812 | 3300046507 | Bacteria | 2369 |
| 852 | Ga0495606_0067153 | 3300046507 | Bacteria | 2271 |
| 853 | Ga0495606_0154542 | 3300046507 | Bacteria | 1343 |
| 854 | Ga0495606_0157725 | 3300046507 | Bacteria | 1326 |
| 855 | Ga0495606_0339071 | 3300046507 | Bacteria | 801 |
| 856 | Ga0495606_0345354 | 3300046507 | Bacteria | 791 |
| 857 | Ga0495608_0008033 | 3300046511 | Bacteria | 7416 |
| 858 | Ga0495610_0000793 | 3300046512 | Bacteria | 29614 |
| 859 | Ga0495610_0011986 | 3300046512 | Bacteria | 5252 |
| 860 | Ga0495610_0019717 | 3300046512 | Bacteria | 3763 |
| 861 | Ga0495610_0021338 | 3300046512 | Bacteria | 3564 |
| 862 | Ga0495610_0023286 | 3300046512 | Bacteria | 3371 |
| 863 | Ga0495610_0025576 | 3300046512 | Bacteria | 3164 |
| 864 | Ga0495610_0027599 | 3300046512 | Bacteria | 3014 |
| 865 | Ga0495610_0036476 | 3300046512 | Bacteria | 2512 |
| 866 | Ga0495610_0063291 | 3300046512 | Bacteria | 1752 |
| 867 | Ga0495610_0065205 | 3300046512 | Bacteria | 1719 |
| 868 | Ga0495610_0085897 | 3300046512 | Bacteria | 1434 |
| 869 | Ga0495610_0115229 | 3300046512 | Bacteria | 1185 |
| 870 | Ga0495610_0115843 | 3300046512 | Bacteria | 1181 |
| 871 | Ga0495610_0127871 | 3300046512 | Bacteria | 1106 |
| 872 | Ga0495616_0011878 | 3300046513 | Bacteria | 4963 |
| 873 | Ga0495616_0015111 | 3300046513 | Bacteria | 4296 |
| 874 | Ga0495616_0025697 | 3300046513 | Bacteria | 3143 |
| 875 | Ga0495616_0026041 | 3300046513 | Bacteria | 3117 |
| 876 | Ga0495616_0028635 | 3300046513 | Bacteria | 2948 |
| 877 | Ga0495616_0058116 | 3300046513 | Bacteria | 1905 |
| 878 | Ga0495616_0082227 | 3300046513 | Bacteria | 1538 |
| 879 | Ga0495616_0095331 | 3300046513 | Bacteria | 1402 |
| 880 | Ga0495618_0014135 | 3300046514 | Bacteria | 4860 |
| 881 | Ga0495620_0000085 | 3300046515 | Bacteria | 77879 |
| 882 | Ga0495620_0000306 | 3300046515 | Bacteria | 34954 |
| 883 | Ga0495620_0006325 | 3300046515 | Bacteria | 6518 |
| 884 | Ga0495620_0010688 | 3300046515 | Bacteria | 4830 |
| 885 | Ga0495620_0012319 | 3300046515 | Bacteria | 4425 |
| 886 | Ga0495620_0015484 | 3300046515 | Bacteria | 3848 |
| 887 | Ga0495620_0018041 | 3300046515 | Bacteria | 3502 |
| 888 | Ga0495620_0019621 | 3300046515 | Bacteria | 3320 |
| 889 | Ga0495620_0027695 | 3300046515 | Bacteria | 2648 |
| 890 | Ga0495628_0000076 | 3300046516 | Bacteria | 78344 |
| 891 | Ga0495628_0011291 | 3300046516 | Bacteria | 7555 |
| 892 | Ga0495628_0145649 | 3300046516 | Bacteria | 1806 |
| 893 | Ga0495631_0002255 | 3300046518 | Bacteria | 11055 |
| 894 | Ga0495631_0018449 | 3300046518 | Bacteria | 3283 |
| 895 | Ga0495631_0018531 | 3300046518 | Bacteria | 3275 |
| 896 | Ga0495631_0033479 | 3300046518 | Bacteria | 2308 |
| 897 | Ga0495631_0084394 | 3300046518 | Bacteria | 1368 |
| 898 | Ga0495631_0123550 | 3300046518 | Bacteria | 1113 |
| 899 | Ga0495632_0000843 | 3300046519 | Bacteria | 27042 |
| 900 | Ga0495632_0007773 | 3300046519 | Bacteria | 6685 |
| 901 | Ga0495632_0015914 | 3300046519 | Bacteria | 4199 |
| 902 | Ga0495632_0017927 | 3300046519 | Bacteria | 3894 |
| 903 | Ga0495632_0020548 | 3300046519 | Bacteria | 3571 |
| 904 | Ga0495632_0023533 | 3300046519 | Bacteria | 3289 |
| 905 | Ga0495632_0025244 | 3300046519 | Bacteria | 3145 |
| 906 | Ga0495632_0028338 | 3300046519 | Bacteria | 2923 |
| 907 | Ga0495632_0052463 | 3300046519 | Bacteria | 2005 |
| 908 | Ga0495632_0095995 | 3300046519 | Bacteria | 1400 |
| 909 | Ga0495632_0102171 | 3300046519 | Bacteria | 1350 |
| 910 | Ga0495632_0109272 | 3300046519 | Bacteria | 1299 |
| 911 | Ga0495632_0139413 | 3300046519 | Bacteria | 1125 |
| 912 | Ga0495637_0000301 | 3300046520 | Bacteria | 38275 |
| 913 | Ga0495637_0000948 | 3300046520 | Bacteria | 18540 |
| 914 | Ga0495637_0007787 | 3300046520 | Bacteria | 5292 |
| 915 | Ga0495637_0009362 | 3300046520 | Bacteria | 4778 |
| 916 | Ga0495637_0010322 | 3300046520 | Bacteria | 4523 |
| 917 | Ga0495637_0015564 | 3300046520 | Bacteria | 3568 |
| 918 | Ga0495637_0019071 | 3300046520 | Bacteria | 3175 |
| 919 | Ga0495637_0020136 | 3300046520 | Bacteria | 3073 |
| 920 | Ga0495637_0033696 | 3300046520 | Bacteria | 2247 |
| 921 | Ga0495637_0035009 | 3300046520 | Bacteria | 2195 |
| 922 | Ga0495637_0046098 | 3300046520 | Bacteria | 1845 |
| 923 | Ga0495637_0050312 | 3300046520 | Bacteria | 1748 |
| 924 | Ga0495637_0056721 | 3300046520 | Bacteria | 1620 |
| 925 | Ga0495637_0062852 | 3300046520 | Bacteria | 1518 |
| 926 | Ga0495637_0129753 | 3300046520 | Bacteria | 963 |
| 927 | Ga0495643_0000017 | 3300046522 | Bacteria | 313381 |
| 928 | Ga0495643_0009169 | 3300046522 | Bacteria | 6178 |
| 929 | Ga0495643_0024262 | 3300046522 | Bacteria | 3441 |
| 930 | Ga0495643_0032085 | 3300046522 | Bacteria | 2918 |
| 931 | Ga0495643_0092113 | 3300046522 | Bacteria | 1562 |
| 932 | Ga0495643_0142913 | 3300046522 | Bacteria | 1191 |
| 933 | Ga0495643_0163289 | 3300046522 | Bacteria | 1094 |
| 934 | Ga0495643_0210030 | 3300046522 | Bacteria | 929 |
| 935 | Ga0495643_0293515 | 3300046522 | Bacteria | 743 |
| 936 | Ga0495644_0008107 | 3300046523 | Bacteria | 4040 |
| 937 | Ga0495644_0010436 | 3300046523 | Bacteria | 3580 |
| 938 | Ga0495644_0015458 | 3300046523 | Bacteria | 2922 |
| 939 | Ga0495644_0018365 | 3300046523 | Bacteria | 2671 |
| 940 | Ga0495648_0005408 | 3300046524 | Bacteria | 10618 |
| 941 | Ga0495648_0006603 | 3300046524 | Bacteria | 9421 |
| 942 | Ga0495648_0017221 | 3300046524 | Bacteria | 5174 |
| 943 | Ga0495648_0018140 | 3300046524 | Bacteria | 5000 |
| 944 | Ga0495648_0031268 | 3300046524 | Bacteria | 3507 |
| 945 | Ga0495648_0039184 | 3300046524 | Bacteria | 3018 |
| 946 | Ga0495648_0040940 | 3300046524 | Bacteria | 2932 |
| 947 | Ga0495648_0042386 | 3300046524 | Bacteria | 2863 |
| 948 | Ga0495648_0094394 | 3300046524 | Bacteria | 1666 |
| 949 | Ga0495648_0103956 | 3300046524 | Bacteria | 1560 |
| 950 | Ga0495648_0131601 | 3300046524 | Bacteria | 1329 |
| 951 | Ga0495648_0167299 | 3300046524 | Bacteria | 1130 |
| 952 | Ga0495648_0187893 | 3300046524 | Bacteria | 1044 |
| 953 | Ga0495666_0003913 | 3300046526 | Bacteria | 7526 |
| 954 | Ga0495666_0067328 | 3300046526 | Bacteria | 1706 |
| 955 | Ga0495642_0003183 | 3300046528 | Bacteria | 6510 |
| 956 | Ga0495642_0003695 | 3300046528 | Bacteria | 6007 |
| 957 | Ga0495642_0048265 | 3300046528 | Bacteria | 1745 |
| 958 | Ga0495652_0024033 | 3300046529 | Bacteria | 5398 |
| 959 | Ga0495652_0048460 | 3300046529 | Bacteria | 3640 |
| 960 | Ga0495652_0083701 | 3300046529 | Bacteria | 2625 |
| 961 | Ga0495654_0000446 | 3300046530 | Bacteria | 35044 |
| 962 | Ga0495654_0008111 | 3300046530 | Bacteria | 5821 |
| 963 | Ga0495654_0011590 | 3300046530 | Bacteria | 4766 |
| 964 | Ga0495654_0011680 | 3300046530 | Bacteria | 4744 |
| 965 | Ga0495654_0013053 | 3300046530 | Bacteria | 4451 |
| 966 | Ga0495654_0014627 | 3300046530 | Bacteria | 4173 |
| 967 | Ga0495654_0017413 | 3300046530 | Bacteria | 3780 |
| 968 | Ga0495654_0022733 | 3300046530 | Bacteria | 3252 |
| 969 | Ga0495654_0022931 | 3300046530 | Bacteria | 3236 |
| 970 | Ga0495654_0028942 | 3300046530 | Bacteria | 2829 |
| 971 | Ga0495654_0031638 | 3300046530 | Bacteria | 2685 |
| 972 | Ga0495654_0056740 | 3300046530 | Bacteria | 1892 |
| 973 | Ga0495654_0080553 | 3300046530 | Bacteria | 1527 |
| 974 | Ga0495654_0081388 | 3300046530 | Bacteria | 1517 |
| 975 | Ga0495654_0094659 | 3300046530 | Bacteria | 1381 |
| 976 | Ga0495654_0118859 | 3300046530 | Bacteria | 1198 |
| 977 | Ga0495654_0126113 | 3300046530 | Bacteria | 1153 |
| 978 | Ga0495654_0143185 | 3300046530 | Bacteria | 1063 |
| 979 | Ga0495587_0014770 | 3300046536 | Bacteria | 4890 |
| 980 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 981 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 982 | Ga0495609_0000088 | 3300046538 | Bacteria | 109269 |
| 983 | Ga0495609_0000132 | 3300046538 | Bacteria | 80926 |
| 984 | Ga0495609_0000649 | 3300046538 | Bacteria | 27069 |
| 985 | Ga0495609_0007369 | 3300046538 | Bacteria | 5500 |
| 986 | Ga0495609_0015268 | 3300046538 | Bacteria | 3596 |
| 987 | Ga0495609_0028323 | 3300046538 | Bacteria | 2556 |
| 988 | Ga0495609_0033448 | 3300046538 | Bacteria | 2334 |
| 989 | Ga0495609_0087541 | 3300046538 | Bacteria | 1356 |
| 990 | Ga0495609_0090652 | 3300046538 | Bacteria | 1330 |
| 991 | Ga0495597_0000011 | 3300046542 | Bacteria | 221377 |
| 992 | Ga0495597_0000185 | 3300046542 | Bacteria | 56031 |
| 993 | Ga0495597_0001086 | 3300046542 | Bacteria | 20631 |
| 994 | Ga0495597_0015149 | 3300046542 | Bacteria | 3654 |
| 995 | Ga0495597_0016172 | 3300046542 | Bacteria | 3527 |
| 996 | Ga0495597_0021177 | 3300046542 | Bacteria | 3023 |
| 997 | Ga0495597_0028158 | 3300046542 | Bacteria | 2572 |
| 998 | Ga0495597_0090729 | 3300046542 | Bacteria | 1297 |
| 999 | Ga0495597_0120057 | 3300046542 | Bacteria | 1096 |
| 1000 | Ga0495597_0135545 | 3300046542 | Bacteria | 1018 |
| 1001 | Ga0495597_0151658 | 3300046542 | Bacteria | 950 |
| 1002 | Ga0495645_0055410 | 3300046543 | Bacteria | 2879 |
| 1003 | Ga0495622_0011715 | 3300046557 | Bacteria | 4054 |
| 1004 | Ga0495622_0016547 | 3300046557 | Bacteria | 3435 |
| 1005 | Ga0495622_0020286 | 3300046557 | Bacteria | 3094 |
| 1006 | Ga0495622_0084911 | 3300046557 | Bacteria | 1456 |
| 1007 | Ga0495622_0101775 | 3300046557 | Bacteria | 1316 |
| 1008 | Ga0495633_0000034 | 3300046558 | Bacteria | 185552 |
| 1009 | Ga0495633_0009015 | 3300046558 | Bacteria | 5549 |
| 1010 | Ga0495633_0014506 | 3300046558 | Bacteria | 4117 |
| 1011 | Ga0495656_0003752 | 3300046615 | Bacteria | 5158 |
| 1012 | Ga0495656_0082991 | 3300046615 | Bacteria | 1450 |
| 1013 | Ga0495656_0114758 | 3300046615 | Bacteria | 1264 |
| 1014 | Ga0495668_0006815 | 3300046616 | Bacteria | 7416 |
| 1015 | Ga0495668_0016904 | 3300046616 | Bacteria | 4236 |
| 1016 | Ga0495668_0026872 | 3300046616 | Bacteria | 3263 |
| 1017 | Ga0495668_0086948 | 3300046616 | Bacteria | 1714 |
| 1018 | Ga0495668_0198571 | 3300046616 | Bacteria | 1098 |
| 1019 | Ga0495634_0016357 | 3300046642 | Bacteria | 5305 |
| 1020 | Ga0495634_0052805 | 3300046642 | Bacteria | 2724 |
| 1021 | Ga0495634_0126500 | 3300046642 | Bacteria | 1633 |
| 1022 | Ga0495611_0001661 | 3300046648 | Bacteria | 10790 |
| 1023 | Ga0495611_0004094 | 3300046648 | Bacteria | 6345 |
| 1024 | Ga0495611_0004457 | 3300046648 | Bacteria | 6060 |
| 1025 | Ga0495611_0082749 | 3300046648 | Bacteria | 1477 |
| 1026 | Ga0495611_0168905 | 3300046648 | Bacteria | 1022 |
| 1027 | Ga0495625_0000061 | 3300046660 | Bacteria | 179140 |
| 1028 | Ga0495625_0001913 | 3300046660 | Bacteria | 23538 |
| 1029 | Ga0495625_0012656 | 3300046660 | Bacteria | 6828 |
| 1030 | Ga0495625_0014555 | 3300046660 | Bacteria | 6271 |
| 1031 | Ga0495625_0038915 | 3300046660 | Bacteria | 3476 |
| 1032 | Ga0495625_0045837 | 3300046660 | Bacteria | 3159 |
| 1033 | Ga0495625_0201382 | 3300046660 | Bacteria | 1314 |
| 1034 | Ga0495625_0209300 | 3300046660 | Bacteria | 1283 |
| 1035 | Ga0495625_0230565 | 3300046660 | Bacteria | 1209 |
| 1036 | Ga0495635_0041374 | 3300046663 | Bacteria | 3183 |
| 1037 | Ga0495635_0155319 | 3300046663 | Bacteria | 1557 |
| 1038 | Ga0495659_0002669 | 3300046664 | Bacteria | 5744 |
| 1039 | Ga0495659_0077951 | 3300046664 | Bacteria | 1252 |
| 1040 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 1041 | Ga0495661_0000036 | 3300046665 | Bacteria | 164694 |
| 1042 | Ga0495661_0000060 | 3300046665 | Bacteria | 131162 |
| 1043 | Ga0495661_0000187 | 3300046665 | Bacteria | 71327 |
| 1044 | Ga0495661_0001218 | 3300046665 | Bacteria | 22323 |
| 1045 | Ga0495661_0002367 | 3300046665 | Bacteria | 14543 |
| 1046 | Ga0495661_0009192 | 3300046665 | Bacteria | 6790 |
| 1047 | Ga0495661_0048174 | 3300046665 | Bacteria | 2590 |
| 1048 | Ga0495661_0097426 | 3300046665 | Bacteria | 1661 |
| 1049 | Ga0495661_0140827 | 3300046665 | Bacteria | 1312 |
| 1050 | Ga0495661_0162307 | 3300046665 | Bacteria | 1198 |
| 1051 | Ga0495588_0158347 | 3300046674 | Bacteria | 1197 |
| 1052 | Ga0495588_0274324 | 3300046674 | Bacteria | 888 |
| 1053 | Ga0495657_0100484 | 3300046675 | Bacteria | 1844 |
| 1054 | Ga0495657_0220054 | 3300046675 | Bacteria | 1151 |
| 1055 | Ga0495599_0034503 | 3300046678 | Bacteria | 3178 |
| 1056 | Ga0495623_0006955 | 3300046679 | Bacteria | 7353 |
| 1057 | Ga0495623_0039096 | 3300046679 | Bacteria | 3032 |
| 1058 | Ga0495646_0003698 | 3300046680 | Bacteria | 9547 |
| 1059 | Ga0495669_0008374 | 3300046684 | Bacteria | 4346 |
| 1060 | Ga0495613_0122405 | 3300046689 | Bacteria | 1867 |
| 1061 | Ga0495613_0415467 | 3300046689 | Bacteria | 916 |
| 1062 | Ga0495624_0011454 | 3300046690 | Bacteria | 6094 |
| 1063 | Ga0495624_0020811 | 3300046690 | Bacteria | 4359 |
| 1064 | Ga0495624_0030721 | 3300046690 | Bacteria | 3497 |
| 1065 | Ga0495670_0024067 | 3300046691 | Bacteria | 3007 |
| 1066 | Ga0495670_0025848 | 3300046691 | Bacteria | 2905 |
| 1067 | Ga0495670_0032353 | 3300046691 | Bacteria | 2601 |
| 1068 | Ga0495670_0038481 | 3300046691 | Bacteria | 2384 |
| 1069 | Ga0495670_0056069 | 3300046691 | Bacteria | 1976 |
| 1070 | Ga0495670_0078241 | 3300046691 | Bacteria | 1682 |
| 1071 | Ga0495670_0244214 | 3300046691 | Bacteria | 956 |
| 1072 | Ga0495670_0369036 | 3300046691 | Bacteria | 773 |
| 1073 | Ga0495671_0000662 | 3300046692 | Bacteria | 24991 |
| 1074 | Ga0495671_0001738 | 3300046692 | Bacteria | 14119 |
| 1075 | Ga0495671_0001929 | 3300046692 | Bacteria | 13311 |
| 1076 | Ga0495671_0004125 | 3300046692 | Bacteria | 8757 |
| 1077 | Ga0495671_0023909 | 3300046692 | Bacteria | 3189 |
| 1078 | Ga0495671_0028439 | 3300046692 | Bacteria | 2879 |
| 1079 | Ga0495671_0028502 | 3300046692 | Bacteria | 2875 |
| 1080 | Ga0495671_0035860 | 3300046692 | Bacteria | 2516 |
| 1081 | Ga0495671_0054514 | 3300046692 | Bacteria | 1982 |
| 1082 | Ga0495671_0059564 | 3300046692 | Bacteria | 1886 |
| 1083 | Ga0495671_0060744 | 3300046692 | Bacteria | 1865 |
| 1084 | Ga0495671_0078233 | 3300046692 | Bacteria | 1621 |
| 1085 | Ga0495671_0086076 | 3300046692 | Bacteria | 1539 |
| 1086 | Ga0495671_0100340 | 3300046692 | Bacteria | 1415 |
| 1087 | Ga0495671_0125138 | 3300046692 | Bacteria | 1253 |
| 1088 | Ga0495671_0144353 | 3300046692 | Bacteria | 1159 |
| 1089 | Ga0495649_0007545 | 3300046694 | Bacteria | 6620 |
| 1090 | Ga0495649_0013292 | 3300046694 | Bacteria | 4753 |
| 1091 | Ga0495649_0015889 | 3300046694 | Bacteria | 4276 |
| 1092 | Ga0495649_0023844 | 3300046694 | Bacteria | 3416 |
| 1093 | Ga0495649_0030657 | 3300046694 | Bacteria | 2969 |
| 1094 | Ga0495649_0056291 | 3300046694 | Bacteria | 2123 |
| 1095 | Ga0495649_0064754 | 3300046694 | Bacteria | 1962 |
| 1096 | Ga0495649_0072808 | 3300046694 | Bacteria | 1841 |
| 1097 | Ga0495649_0078469 | 3300046694 | Bacteria | 1766 |
| 1098 | Ga0495649_0080867 | 3300046694 | Bacteria | 1737 |
| 1099 | Ga0495649_0096429 | 3300046694 | Bacteria | 1574 |
| 1100 | Ga0495649_0104176 | 3300046694 | Bacteria | 1506 |
| 1101 | Ga0495589_0003318 | 3300046794 | Bacteria | 8734 |
| 1102 | Ga0495589_0010874 | 3300046794 | Bacteria | 4728 |
| 1103 | Ga0495589_0021478 | 3300046794 | Bacteria | 3298 |
| 1104 | Ga0495589_0022326 | 3300046794 | Bacteria | 3229 |
| 1105 | Ga0495589_0082550 | 3300046794 | Bacteria | 1562 |
| 1106 | Ga0495589_0231540 | 3300046794 | Bacteria | 866 |
| 1107 | Ga0495600_0003938 | 3300046809 | Bacteria | 8822 |
| 1108 | Ga0495600_0179248 | 3300046809 | Bacteria | 1365 |
| 1109 | Ga0495600_0185820 | 3300046809 | Bacteria | 1338 |
| 1110 | Ga0495600_0204923 | 3300046809 | Bacteria | 1265 |
| 1111 | Ga0495660_0003401 | 3300046810 | Bacteria | 9847 |
| 1112 | Ga0495660_0003415 | 3300046810 | Bacteria | 9832 |
| 1113 | Ga0495660_0011226 | 3300046810 | Bacteria | 5201 |
| 1114 | Ga0495660_0026559 | 3300046810 | Bacteria | 3281 |
| 1115 | Ga0495660_0028351 | 3300046810 | Bacteria | 3164 |
| 1116 | Ga0495660_0028386 | 3300046810 | Bacteria | 3161 |
| 1117 | Ga0495660_0038247 | 3300046810 | Bacteria | 2668 |
| 1118 | Ga0495660_0050839 | 3300046810 | Bacteria | 2256 |
| 1119 | Ga0495660_0053651 | 3300046810 | Bacteria | 2187 |
| 1120 | Ga0495660_0065478 | 3300046810 | Bacteria | 1939 |
| 1121 | Ga0495660_0089028 | 3300046810 | Bacteria | 1607 |
| 1122 | Ga0495660_0097599 | 3300046810 | Bacteria | 1517 |
| 1123 | Ga0495660_0160907 | 3300046810 | Bacteria | 1101 |
| 1124 | Ga0495660_0176078 | 3300046810 | Bacteria | 1038 |
| 1125 | Ga0495660_0210676 | 3300046810 | Bacteria | 922 |
| 1126 | Ga0495604_0000948 | 3300047317 | Bacteria | 24198 |
| 1127 | Ga0495604_0050468 | 3300047317 | Bacteria | 3230 |
| 1128 | Ga0495604_0094930 | 3300047317 | Bacteria | 2204 |
| 1129 | Ga0495604_0182182 | 3300047317 | Bacteria | 1468 |
| 1130 | Ga0495604_0218715 | 3300047317 | Bacteria | 1312 |
| 1131 | Ga0495636_0011170 | 3300047318 | Bacteria | 3552 |
| 1132 | Ga0495674_0093556 | 3300047319 | Bacteria | 2565 |
| 1133 | Ga0495672_0006253 | 3300047320 | Bacteria | 9279 |
| 1134 | Ga0495672_0007817 | 3300047320 | Bacteria | 7988 |
| 1135 | Ga0495672_0008177 | 3300047320 | Bacteria | 7759 |
| 1136 | Ga0495672_0010931 | 3300047320 | Bacteria | 6438 |
| 1137 | Ga0495672_0013983 | 3300047320 | Bacteria | 5516 |
| 1138 | Ga0495672_0017033 | 3300047320 | Bacteria | 4868 |
| 1139 | Ga0495672_0017358 | 3300047320 | Bacteria | 4815 |
| 1140 | Ga0495672_0018955 | 3300047320 | Bacteria | 4552 |
| 1141 | Ga0495672_0025697 | 3300047320 | Bacteria | 3764 |
| 1142 | Ga0495672_0032878 | 3300047320 | Bacteria | 3219 |
| 1143 | Ga0495672_0036278 | 3300047320 | Bacteria | 3028 |
| 1144 | Ga0495672_0037415 | 3300047320 | Bacteria | 2969 |
| 1145 | Ga0495672_0040141 | 3300047320 | Bacteria | 2840 |
| 1146 | Ga0495672_0042164 | 3300047320 | Bacteria | 2754 |
| 1147 | Ga0495672_0072442 | 3300047320 | Bacteria | 1946 |
| 1148 | Ga0495672_0088004 | 3300047320 | Bacteria | 1713 |
| 1149 | Ga0495672_0100895 | 3300047320 | Bacteria | 1565 |
| 1150 | Ga0495672_0108685 | 3300047320 | Bacteria | 1492 |
| 1151 | Ga0495672_0165702 | 3300047320 | Bacteria | 1131 |
| 1152 | Ga0495672_0242159 | 3300047320 | Bacteria | 880 |
| 1153 | Ga0495676_0000011 | 3300047321 | Bacteria | 242612 |
| 1154 | Ga0495676_0020361 | 3300047321 | Bacteria | 5820 |
| 1155 | Ga0495676_0173689 | 3300047321 | Bacteria | 1514 |
| 1156 | Ga0495680_0055612 | 3300047322 | Bacteria | 3068 |
| 1157 | Ga0495680_0342418 | 3300047322 | Bacteria | 1042 |
| 1158 | Ga0495683_0000028 | 3300047323 | Bacteria | 153672 |
| 1159 | Ga0495683_0000034 | 3300047323 | Bacteria | 148959 |
| 1160 | Ga0495683_0000070 | 3300047323 | Bacteria | 108186 |
| 1161 | Ga0495683_0017499 | 3300047323 | Bacteria | 3714 |
| 1162 | Ga0495683_0022075 | 3300047323 | Bacteria | 3274 |
| 1163 | Ga0495683_0057785 | 3300047323 | Bacteria | 1927 |
| 1164 | Ga0495687_006777 | 3300047443 | Bacteria | 6928 |
| 1165 | Ga0495687_008366 | 3300047443 | Bacteria | 5927 |
| 1166 | Ga0495687_008443 | 3300047443 | Bacteria | 5897 |
| 1167 | Ga0495675_0039511 | 3300047444 | Bacteria | 3004 |
| 1168 | Ga0495677_0019091 | 3300047445 | Bacteria | 2486 |
| 1169 | Ga0495677_0093214 | 3300047445 | Bacteria | 1136 |
| 1170 | Ga0495679_000028 | 3300047446 | Bacteria | 192300 |
| 1171 | Ga0495679_000370 | 3300047446 | Bacteria | 34815 |
| 1172 | Ga0495679_004083 | 3300047446 | Bacteria | 6837 |
| 1173 | Ga0495679_013446 | 3300047446 | Bacteria | 3073 |
| 1174 | Ga0495679_031520 | 3300047446 | Bacteria | 1709 |
| 1175 | Ga0495679_054703 | 3300047446 | Bacteria | 1187 |
| 1176 | Ga0495679_059342 | 3300047446 | Bacteria | 1125 |
| 1177 | Ga0495673_0002589 | 3300047469 | Bacteria | 12590 |
| 1178 | Ga0495673_0004790 | 3300047469 | Bacteria | 8369 |
| 1179 | Ga0495673_0005801 | 3300047469 | Bacteria | 7392 |
| 1180 | Ga0495673_0015551 | 3300047469 | Bacteria | 3917 |
| 1181 | Ga0495673_0015946 | 3300047469 | Bacteria | 3855 |
| 1182 | Ga0495673_0016029 | 3300047469 | Bacteria | 3844 |
| 1183 | Ga0495673_0017738 | 3300047469 | Bacteria | 3604 |
| 1184 | Ga0495673_0018232 | 3300047469 | Bacteria | 3545 |
| 1185 | Ga0495673_0023496 | 3300047469 | Bacteria | 2997 |
| 1186 | Ga0495673_0025842 | 3300047469 | Bacteria | 2814 |
| 1187 | Ga0495673_0029397 | 3300047469 | Bacteria | 2593 |
| 1188 | Ga0495673_0035779 | 3300047469 | Bacteria | 2284 |
| 1189 | Ga0495673_0040254 | 3300047469 | Bacteria | 2113 |
| 1190 | Ga0495673_0049794 | 3300047469 | Bacteria | 1842 |
| 1191 | Ga0495673_0050604 | 3300047469 | Bacteria | 1822 |
| 1192 | Ga0495673_0057994 | 3300047469 | Bacteria | 1670 |
| 1193 | Ga0495673_0064001 | 3300047469 | Bacteria | 1566 |
| 1194 | Ga0495673_0076174 | 3300047469 | Bacteria | 1399 |
| 1195 | Ga0495673_0088590 | 3300047469 | Bacteria | 1268 |
| 1196 | Ga0495673_0115752 | 3300047469 | Bacteria | 1066 |
| 1197 | Ga0495673_0125643 | 3300047469 | Bacteria | 1012 |
| 1198 | Ga0495673_0141971 | 3300047469 | Bacteria | 935 |
| 1199 | Ga0495673_0174170 | 3300047469 | Bacteria | 818 |
| 1200 | Ga0495681_0008476 | 3300047470 | Bacteria | 6447 |
| 1201 | Ga0495681_0019090 | 3300047470 | Bacteria | 3754 |
| 1202 | Ga0495681_0021856 | 3300047470 | Bacteria | 3437 |
| 1203 | Ga0495681_0022771 | 3300047470 | Bacteria | 3343 |
| 1204 | Ga0495681_0024639 | 3300047470 | Bacteria | 3163 |
| 1205 | Ga0495681_0027271 | 3300047470 | Bacteria | 2957 |
| 1206 | Ga0495681_0031133 | 3300047470 | Bacteria | 2706 |
| 1207 | Ga0495681_0041865 | 3300047470 | Bacteria | 2221 |
| 1208 | Ga0495681_0045559 | 3300047470 | Bacteria | 2098 |
| 1209 | Ga0495681_0059234 | 3300047470 | Bacteria | 1771 |
| 1210 | Ga0495681_0062733 | 3300047470 | Bacteria | 1708 |
| 1211 | Ga0495681_0071169 | 3300047470 | Bacteria | 1575 |
| 1212 | Ga0495681_0110542 | 3300047470 | Bacteria | 1190 |
| 1213 | Ga0495681_0151488 | 3300047470 | Bacteria | 972 |
| 1214 | Ga0495684_0095672 | 3300047471 | Bacteria | 2248 |
| 1215 | Ga0495686_0104090 | 3300047472 | Bacteria | 1709 |
| 1216 | Ga0495686_0113864 | 3300047472 | Bacteria | 1619 |
| 1217 | Ga0495686_0142235 | 3300047472 | Bacteria | 1415 |
| 1218 | Ga0495686_0148283 | 3300047472 | Bacteria | 1379 |
| 1219 | Ga0495593_0078652 | 3300047673 | Bacteria | 1708 |
| 1220 | Ga0495593_0127608 | 3300047673 | Bacteria | 1292 |
| 1221 | Ga0495593_0135498 | 3300047673 | Bacteria | 1248 |
| 1222 | Ga0495602_0009002 | 3300048088 | Bacteria | 10403 |
| 1223 | Ga0495602_0376219 | 3300048088 | Bacteria | 1018 |
| 1224 | Ga0495626_0000024 | 3300048091 | Bacteria | 214179 |
| 1225 | Ga0495626_0006473 | 3300048091 | Bacteria | 6665 |
| 1226 | Ga0495626_0007135 | 3300048091 | Bacteria | 6253 |
| 1227 | Ga0495626_0016350 | 3300048091 | Bacteria | 3770 |
| 1228 | Ga0495626_0022425 | 3300048091 | Bacteria | 3118 |
| 1229 | Ga0495626_0044773 | 3300048091 | Bacteria | 2068 |
| 1230 | Ga0495626_0052961 | 3300048091 | Bacteria | 1869 |
| 1231 | Ga0495626_0070204 | 3300048091 | Bacteria | 1576 |
| 1232 | Ga0495626_0076772 | 3300048091 | Bacteria | 1490 |
| 1233 | Ga0496100_0039148 | 3300048903 | Bacteria | 3009 |
| 1234 | Ga0496101_0009650 | 3300048904 | Bacteria | 6349 |
| 1235 | Ga0496102_0004242 | 3300048905 | Bacteria | 12120 |
| 1236 | Ga0496102_0004534 | 3300048905 | Bacteria | 11740 |
| 1237 | Ga0496103_0013210 | 3300048906 | Bacteria | 4896 |
| 1238 | Ga0496104_0137938 | 3300048907 | Bacteria | 2343 |
| 1239 | Ga0496105_0002236 | 3300048908 | Bacteria | 14021 |
| 1240 | Ga0496106_0011540 | 3300048909 | Bacteria | 6531 |
| 1241 | Ga0496107_0315144 | 3300048910 | Bacteria | 1164 |
| 1242 | Ga0496110_0038468 | 3300048913 | Bacteria | 4163 |
| 1243 | Ga0496110_0195940 | 3300048913 | Bacteria | 1835 |
| 1244 | Ga0496111_0187292 | 3300048914 | Bacteria | 1538 |
| 1245 | Ga0496112_0441141 | 3300048915 | Bacteria | 1240 |
| 1246 | Ga0496112_0569987 | 3300048915 | Bacteria | 1065 |
| 1247 | Ga0496114_0002270 | 3300048917 | Bacteria | 14636 |
| 1248 | Ga0496114_0102391 | 3300048917 | Bacteria | 2446 |
| 1249 | Ga0496116_0001954 | 3300048919 | Bacteria | 22220 |
| 1250 | Ga0496116_0006985 | 3300048919 | Bacteria | 10115 |
| 1251 | Ga0496116_0020749 | 3300048919 | Bacteria | 4978 |
| 1252 | Ga0496116_0022501 | 3300048919 | Bacteria | 4722 |
| 1253 | Ga0496116_0029771 | 3300048919 | Bacteria | 3930 |
| 1254 | Ga0496116_0041683 | 3300048919 | Bacteria | 3147 |
| 1255 | Ga0496116_0065419 | 3300048919 | Bacteria | 2332 |
| 1256 | Ga0496116_0117438 | 3300048919 | Bacteria | 1548 |
| 1257 | Ga0496116_0135888 | 3300048919 | Bacteria | 1392 |
| 1258 | Ga0496116_0138478 | 3300048919 | Bacteria | 1373 |
| 1259 | Ga0496117_0004774 | 3300048920 | Bacteria | 14697 |
| 1260 | Ga0496117_0012455 | 3300048920 | Bacteria | 7491 |
| 1261 | Ga0496117_0029302 | 3300048920 | Bacteria | 4247 |
| 1262 | Ga0496117_0087048 | 3300048920 | Bacteria | 2026 |
| 1263 | Ga0496117_0124601 | 3300048920 | Bacteria | 1575 |
| 1264 | Ga0496117_0147306 | 3300048920 | Bacteria | 1399 |
| 1265 | Ga0496117_0159215 | 3300048920 | Bacteria | 1325 |
| 1266 | Ga0496118_0014455 | 3300048921 | Bacteria | 7390 |
| 1267 | Ga0496118_0073811 | 3300048921 | Bacteria | 2441 |
| 1268 | Ga0496118_0095396 | 3300048921 | Bacteria | 2030 |
| 1269 | Ga0496118_0110003 | 3300048921 | Bacteria | 1832 |
| 1270 | Ga0496118_0141186 | 3300048921 | Bacteria | 1526 |
| 1271 | Ga0496118_0182613 | 3300048921 | Bacteria | 1265 |
| 1272 | Ga0496118_0206247 | 3300048921 | Bacteria | 1158 |
| 1273 | Ga0496119_0052709 | 3300048922 | Bacteria | 2490 |
| 1274 | Ga0496119_0191494 | 3300048922 | Bacteria | 1065 |
| 1275 | Ga0496120_0005221 | 3300048923 | Bacteria | 10458 |
| 1276 | Ga0496120_0015311 | 3300048923 | Bacteria | 5065 |
| 1277 | Ga0496121_0001365 | 3300048924 | Bacteria | 41600 |
| 1278 | Ga0496121_0013843 | 3300048924 | Bacteria | 8630 |
| 1279 | Ga0496121_0015990 | 3300048924 | Bacteria | 7781 |
| 1280 | Ga0496121_0016038 | 3300048924 | Bacteria | 7766 |
| 1281 | Ga0496121_0017647 | 3300048924 | Bacteria | 7270 |
| 1282 | Ga0496121_0043798 | 3300048924 | Bacteria | 3870 |
| 1283 | Ga0496121_0086255 | 3300048924 | Bacteria | 2467 |
| 1284 | Ga0496121_0096435 | 3300048924 | Bacteria | 2295 |
| 1285 | Ga0496121_0155626 | 3300048924 | Bacteria | 1677 |
| 1286 | Ga0496121_0221953 | 3300048924 | Bacteria | 1330 |
| 1287 | Ga0496121_0300223 | 3300048924 | Bacteria | 1090 |
| 1288 | Ga0496121_0484260 | 3300048924 | Bacteria | 789 |
| 1289 | Ga0496122_0000449 | 3300048925 | Bacteria | 85961 |
| 1290 | Ga0496122_0000616 | 3300048925 | Bacteria | 73030 |
| 1291 | Ga0496122_0000669 | 3300048925 | Bacteria | 68904 |
| 1292 | Ga0496122_0001392 | 3300048925 | Bacteria | 39241 |
| 1293 | Ga0496122_0003626 | 3300048925 | Bacteria | 20083 |
| 1294 | Ga0496122_0011766 | 3300048925 | Bacteria | 8813 |
| 1295 | Ga0496122_0020263 | 3300048925 | Bacteria | 6021 |
| 1296 | Ga0496122_0038861 | 3300048925 | Bacteria | 3803 |
| 1297 | Ga0496122_0071453 | 3300048925 | Bacteria | 2473 |
| 1298 | Ga0496122_0123299 | 3300048925 | Bacteria | 1665 |
| 1299 | Ga0496122_0127065 | 3300048925 | Bacteria | 1629 |
| 1300 | Ga0496123_0000263 | 3300048926 | Bacteria | 105886 |
| 1301 | Ga0496123_0000632 | 3300048926 | Bacteria | 58881 |
| 1302 | Ga0496123_0000977 | 3300048926 | Bacteria | 44079 |
| 1303 | Ga0496123_0001569 | 3300048926 | Bacteria | 31270 |
| 1304 | Ga0496123_0008524 | 3300048926 | Bacteria | 9401 |
| 1305 | Ga0496123_0065943 | 3300048926 | Bacteria | 2297 |
| 1306 | Ga0496123_0067508 | 3300048926 | Bacteria | 2258 |
| 1307 | Ga0496123_0071585 | 3300048926 | Bacteria | 2161 |
| 1308 | Ga0496123_0090133 | 3300048926 | Bacteria | 1824 |
| 1309 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 1310 | Ga0496124_0007897 | 3300048927 | Bacteria | 11206 |
| 1311 | Ga0496124_0015211 | 3300048927 | Bacteria | 7386 |
| 1312 | Ga0496124_0015525 | 3300048927 | Bacteria | 7292 |
| 1313 | Ga0496124_0050107 | 3300048927 | Bacteria | 3559 |
| 1314 | Ga0496124_0081214 | 3300048927 | Bacteria | 2665 |
| 1315 | Ga0496124_0087475 | 3300048927 | Bacteria | 2548 |
| 1316 | Ga0496124_0174404 | 3300048927 | Bacteria | 1661 |
| 1317 | Ga0496124_0381807 | 3300048927 | Bacteria | 985 |
| 1318 | Ga0496125_0000168 | 3300048928 | Bacteria | 146364 |
| 1319 | Ga0496125_0000319 | 3300048928 | Bacteria | 93727 |
| 1320 | Ga0496125_0000947 | 3300048928 | Bacteria | 45544 |
| 1321 | Ga0496125_0003314 | 3300048928 | Bacteria | 19714 |
| 1322 | Ga0496125_0005089 | 3300048928 | Bacteria | 14806 |
| 1323 | Ga0496125_0005136 | 3300048928 | Bacteria | 14724 |
| 1324 | Ga0496125_0026564 | 3300048928 | Bacteria | 5271 |
| 1325 | Ga0496125_0037898 | 3300048928 | Bacteria | 4184 |
| 1326 | Ga0496125_0046824 | 3300048928 | Bacteria | 3624 |
| 1327 | Ga0496125_0057758 | 3300048928 | Bacteria | 3139 |
| 1328 | Ga0496125_0062306 | 3300048928 | Bacteria | 2984 |
| 1329 | Ga0496125_0211080 | 3300048928 | Bacteria | 1261 |
| 1330 | Ga0496126_0023661 | 3300048929 | Bacteria | 5949 |
| 1331 | Ga0496126_0024217 | 3300048929 | Bacteria | 5864 |
| 1332 | Ga0496126_0086476 | 3300048929 | Bacteria | 2763 |
| 1333 | Ga0496126_0101023 | 3300048929 | Bacteria | 2523 |
| 1334 | Ga0496126_0150981 | 3300048929 | Bacteria | 1991 |
| 1335 | Ga0496126_0226004 | 3300048929 | Bacteria | 1570 |
| 1336 | Ga0496126_0248988 | 3300048929 | Bacteria | 1481 |
| 1337 | Ga0496126_0360461 | 3300048929 | Bacteria | 1187 |
| 1338 | Ga0495678_000049 | 3300049459 | Bacteria | 163929 |
| 1339 | Ga0495678_000160 | 3300049459 | Bacteria | 80551 |
| 1340 | Ga0495678_009421 | 3300049459 | Bacteria | 4833 |
| 1341 | Ga0495678_013793 | 3300049459 | Bacteria | 3782 |
| 1342 | Ga0495678_018525 | 3300049459 | Bacteria | 3128 |
| 1343 | Ga0495678_018970 | 3300049459 | Bacteria | 3079 |
| 1344 | Ga0495678_020127 | 3300049459 | Bacteria | 2961 |
| 1345 | Ga0495678_021976 | 3300049459 | Bacteria | 2798 |
| 1346 | Ga0495678_025529 | 3300049459 | Bacteria | 2535 |
| 1347 | Ga0495678_026414 | 3300049459 | Bacteria | 2479 |
| 1348 | Ga0495678_053864 | 3300049459 | Bacteria | 1542 |
| 1349 | Ga0495678_060446 | 3300049459 | Bacteria | 1425 |
| 1350 | Ga0495678_102818 | 3300049459 | Bacteria | 987 |
| 1351 | Ga0495682_0000090 | 3300049460 | Bacteria | 79463 |
| 1352 | Ga0495682_0001506 | 3300049460 | Bacteria | 12391 |
| 1353 | Ga0495682_0028204 | 3300049460 | Bacteria | 2081 |
| 1354 | Ga0495682_0040104 | 3300049460 | Bacteria | 1717 |
| 1355 | Ga0495682_0087915 | 3300049460 | Bacteria | 1116 |
| 1356 | Ga0501238_007309 | 3300049671 | Bacteria | 1433 |
| 1357 | Ga0501241_022199 | 3300049758 | Bacteria | 1172 |
| 1358 | nmdc:mga00v17_11469_c1 | 3300050491 | Bacteria | 4870 |
| 1359 | nmdc:mga00v17_188609_c1 | 3300050491 | Bacteria | 1331 |
| 1360 | nmdc:mga00v17_50346_c1 | 3300050491 | Bacteria | 2177 |
| 1361 | nmdc:mga0yw44_249364_c1 | 3300050492 | Bacteria | 1181 |
| 1362 | nmdc:mga0k408_184357_c1 | 3300050493 | Bacteria | 1245 |
| 1363 | nmdc:mga0k408_198142_c1 | 3300050493 | Bacteria | 1198 |
| 1364 | nmdc:mga0k408_2992_c1 | 3300050493 | Bacteria | 8961 |
| 1365 | nmdc:mga06z11_105374_c1 | 3300050494 | Bacteria | 1553 |
| 1366 | nmdc:mga08x19_251483_c1 | 3300050514 | Bacteria | 1220 |
| 1367 | nmdc:mga08x19_355381_c1 | 3300050514 | Bacteria | 1023 |
| 1368 | Ga0495601_0019812 | 3300053077 | Bacteria | 4107 |
| 1369 | Ga0500646_0000914 | 3300053090 | Bacteria | 8136 |
| 1370 | Ga0500583_0006260 | 3300053092 | Bacteria | 4078 |
| 1371 | Ga0500583_0179503 | 3300053092 | Bacteria | 1054 |
| 1372 | Ga0500641_0022457 | 3300053096 | Bacteria | 2417 |
| 1373 | Ga0500650_0065649 | 3300053098 | Bacteria | 1695 |
| 1374 | Ga0500594_0011721 | 3300053118 | Bacteria | 2051 |
| 1375 | Ga0500595_001205 | 3300053119 | Bacteria | 14280 |
| 1376 | Ga0500618_023789 | 3300053125 | Bacteria | 1480 |
| 1377 | Ga0500618_025568 | 3300053125 | Bacteria | 1414 |
| 1378 | Ga0500655_004044 | 3300053133 | Bacteria | 2642 |
| 1379 | Ga0500559_0000578 | 3300053136 | Bacteria | 25123 |
| 1380 | Ga0500573_0034392 | 3300053140 | Bacteria | 2924 |
| 1381 | Ga0500586_056689 | 3300053145 | Bacteria | 1359 |
| 1382 | Ga0500604_0003723 | 3300053151 | Bacteria | 4077 |
| 1383 | Ga0500619_003230 | 3300053154 | Bacteria | 3298 |
| 1384 | 2511249605 | 2511231003 | Bacteria | 5606035 |
| 1385 | 2511254814 | 2511231004 | Bacteria | 6669789 |
| 1386 | 2511266028 | 2511231006 | Bacteria | 6794709 |
| 1387 | 2511273340 | 2511231007 | Bacteria | 6306603 |
| 1388 | 2511275051 | 2511231008 | Bacteria | 6624100 |
| 1389 | 2511288501 | 2511231010 | Bacteria | 6373152 |
| 1390 | 2511297998 | 2511231011 | Bacteria | 6149768 |
| 1391 | 2511303991 | 2511231012 | Bacteria | 6738011 |
| 1392 | 2511311963 | 2511231014 | Bacteria | 6462302 |
| 1393 | 2511320679 | 2511231015 | Bacteria | 6598026 |
| 1394 | 2511327969 | 2511231016 | Bacteria | 6704427 |
| 1395 | 2511329712 | 2511231017 | Bacteria | 6503007 |
| 1396 | 2511335884 | 2511231018 | Bacteria | 6436256 |
| 1397 | 2511344754 | 2511231019 | Bacteria | 6520662 |
| 1398 | 2511349517 | 2511231020 | Bacteria | 6115223 |
| 1399 | 2511360140 | 2511231021 | Bacteria | 7302637 |
| 1400 | 2511365982 | 2511231022 | Bacteria | 6719296 |
| 1401 | 2511368993 | 2511231023 | Bacteria | 6808468 |
| 1402 | 2511384059 | 2511231026 | Bacteria | 5225445 |
| 1403 | 2511412133 | 2511231031 | Bacteria | 6558529 |
| 1404 | 2511827682 | 2511231156 | Bacteria | 6845832 |
| 1405 | 2512037785 | 2511231221 | Bacteria | 6846400 |
| 1406 | 2512326631 | 2512047018 | Bacteria | 6663241 |
| 1407 | 2514045004 | 2513237165 | Bacteria | 6771773 |
| 1408 | 2514045247 | 2513237165 | Bacteria | 6771773 |
| 1409 | 2514045305 | 2513237165 | Bacteria | 6771773 |
| 1410 | 2521560192 | 2521172590 | Bacteria | 5047645 |
| 1411 | 2550695313 | 2548876994 | Bacteria | 4904866 |
| 1412 | 2550695898 | 2548876994 | Bacteria | 4904866 |
| 1413 | 2553004989 | 2551306416 | Bacteria | 6152985 |
| 1414 | 2574431087 | 2574179768 | Bacteria | 4907129 |
| 1415 | 2583795681 | 2582580891 | Bacteria | 6800976 |
| 1416 | 2597860925 | 2597489887 | Bacteria | 6666321 |
| 1417 | 2597866672 | 2597489888 | Bacteria | 6179543 |
| 1418 | 2597872530 | 2597489889 | Bacteria | 6297495 |
| 1419 | 2599327552 | 2599185155 | Bacteria | 5827168 |
| 1420 | 2599400495 | 2599185167 | Bacteria | 6353609 |
| 1421 | 2599449819 | 2599185179 | Bacteria | 6611171 |
| 1422 | 2599485840 | 2599185185 | Bacteria | 6652270 |
| 1423 | 2599500304 | 2599185188 | Bacteria | 6164180 |
| 1424 | 2599505792 | 2599185189 | Bacteria | 5862825 |
| 1425 | 2599511893 | 2599185190 | Bacteria | 6285678 |
| 1426 | 2599516877 | 2599185191 | Bacteria | 6297582 |
| 1427 | 2599614472 | 2599185212 | Bacteria | 6765997 |
| 1428 | 2599768102 | 2599185248 | Bacteria | 6696816 |
| 1429 | 2599804620 | 2599185257 | Bacteria | 6492581 |
| 1430 | 2599879080 | 2599185288 | Bacteria | 6666191 |
| 1431 | 2599885538 | 2599185289 | Bacteria | 6778765 |
| 1432 | 2599892745 | 2599185290 | Bacteria | 6289611 |
| 1433 | 2599897252 | 2599185291 | Bacteria | 6775623 |
| 1434 | 2599902896 | 2599185292 | Bacteria | 6290804 |
| 1435 | 2599930673 | 2599185300 | Bacteria | 6062622 |
| 1436 | 2599942311 | 2599185302 | Bacteria | 5954930 |
| 1437 | 2599951494 | 2599185303 | Bacteria | 6512725 |
| 1438 | 2599954276 | 2599185304 | Bacteria | 5951361 |
| 1439 | 2599961961 | 2599185305 | Bacteria | 6748700 |
| 1440 | 2599965984 | 2599185306 | Bacteria | 6637356 |
| 1441 | 2599972351 | 2599185307 | Bacteria | 6194719 |
| 1442 | 2599977966 | 2599185308 | Bacteria | 6621546 |
| 1443 | 2599982881 | 2599185309 | Bacteria | 5969593 |
| 1444 | 2599988369 | 2599185310 | Bacteria | 6014457 |
| 1445 | 2599994030 | 2599185311 | Bacteria | 6354990 |
| 1446 | 2599999164 | 2599185312 | Bacteria | 5912071 |
| 1447 | 2600004265 | 2599185313 | Bacteria | 6658188 |
| 1448 | 2600012133 | 2599185314 | Bacteria | 6621749 |
| 1449 | 2600020445 | 2599185315 | Bacteria | 6771107 |
| 1450 | 2600026302 | 2599185316 | Bacteria | 6320029 |
| 1451 | 2600032047 | 2599185317 | Bacteria | 6435722 |
| 1452 | 2600036015 | 2599185318 | Bacteria | 6961590 |
| 1453 | 2600044580 | 2599185319 | Bacteria | 6637840 |
| 1454 | 2600046695 | 2599185320 | Bacteria | 5963263 |
| 1455 | 2600054877 | 2599185321 | Bacteria | 6764560 |
| 1456 | 2600061090 | 2599185322 | Bacteria | 6763055 |
| 1457 | 2600068003 | 2599185323 | Bacteria | 6688755 |
| 1458 | 2600071912 | 2599185324 | Bacteria | 6590677 |
| 1459 | 2600076500 | 2599185325 | Bacteria | 6324919 |
| 1460 | 2600358950 | 2600254930 | Bacteria | 6431253 |
| 1461 | 2600363506 | 2600254931 | Bacteria | 6734225 |
| 1462 | 2600444136 | 2600254954 | Bacteria | 5100516 |
| 1463 | 2601627449 | 2600255283 | Bacteria | 6061572 |
| 1464 | 2601693403 | 2600255296 | Bacteria | 5784754 |
| 1465 | 2601798521 | 2600255318 | Bacteria | 6383414 |
| 1466 | 2602008386 | 2600255389 | Bacteria | 5275336 |
| 1467 | 2606077415 | 2603880185 | Bacteria | 6379190 |
| 1468 | 2606129339 | 2603880199 | Bacteria | 6377649 |
| 1469 | 2621296804 | 2619619299 | Bacteria | 6649820 |
| 1470 | 2624483451 | 2623620443 | Bacteria | 6427864 |
| 1471 | 2624494976 | 2623620446 | Bacteria | 6500345 |
| 1472 | 2643843003 | 2643221565 | Bacteria | 6216018 |
| 1473 | 2643861719 | 2643221569 | Bacteria | 6064337 |
| 1474 | 2643872308 | 2643221571 | Bacteria | 6228673 |
| 1475 | 2643955591 | 2643221589 | Bacteria | 6250934 |
| 1476 | 2644020385 | 2643221602 | Bacteria | 6249926 |
| 1477 | 2644028505 | 2643221603 | Bacteria | 6147767 |
| 1478 | 2644184440 | 2643221633 | Bacteria | 6733554 |
| 1479 | 2644246219 | 2643221644 | Bacteria | 6865017 |
| 1480 | 2644283185 | 2643221650 | Bacteria | 7029547 |
| 1481 | 2644624726 | 2643221713 | Bacteria | 6554480 |
| 1482 | 2652546691 | 2651869719 | Bacteria | 6047974 |
| 1483 | 2671089598 | 2667528170 | Bacteria | 6786960 |
| 1484 | 2671128545 | 2667528176 | Bacteria | 6724917 |
| 1485 | 2671771627 | 2671180172 | Bacteria | 6495783 |
| 1486 | 2677897174 | 2675903420 | Bacteria | 6247433 |
| 1487 | 2678266191 | 2675903515 | Bacteria | 6580491 |
| 1488 | 2715749791 | 2713897148 | Bacteria | 5883533 |
| 1489 | 2715754809 | 2713897149 | Bacteria | 6506249 |
| 1490 | 2718636656 | 2718217725 | Bacteria | 5758958 |
| 1491 | 2723251408 | 2721755607 | Bacteria | 5841722 |
| 1492 | 2723876522 | 2721755763 | Bacteria | 4464185 |
| 1493 | 2738671624 | 2738541265 | Bacteria | 6594665 |
| 1494 | 2738690393 | 2738541271 | Bacteria | 5657310 |
| 1495 | 2738750018 | 2738541282 | Bacteria | 6593925 |
| 1496 | 2738807296 | 2738541294 | Bacteria | 6925949 |
| 1497 | 2738859058 | 2738541303 | Bacteria | 6591772 |
| 1498 | 2738894656 | 2738541309 | Bacteria | 6926455 |
| 1499 | 2739199100 | 2738543004 | Bacteria | 6381073 |
| 1500 | 2739252448 | 2738543013 | Bacteria | 5618633 |
| 1501 | 2739259039 | 2738543015 | Bacteria | 6750701 |
| 1502 | 2739266167 | 2738543016 | Bacteria | 5657564 |
| 1503 | 2739289968 | 2738543020 | Bacteria | 5718238 |
| 1504 | 2739295280 | 2738543021 | Bacteria | 5718241 |
| 1505 | 2739312464 | 2738543025 | Bacteria | 6600348 |
| 1506 | 2743740465 | 2740892503 | Bacteria | 6855563 |
| 1507 | 2745007423 | 2744054620 | Bacteria | 6551379 |
| 1508 | 2765571360 | 2765235838 | Bacteria | 5445269 |
| 1509 | 2774118335 | 2773857670 | Bacteria | 6407454 |
| 1510 | 2774135524 | 2773857673 | Bacteria | 6513460 |
| 1511 | 2784261773 | 2784132063 | Bacteria | 6262788 |
| 1512 | 2784313616 | 2784132072 | Bacteria | 6596533 |
| 1513 | 2794593797 | 2791355520 | Bacteria | 5948615 |
| 1514 | 2807408848 | 2806310737 | Bacteria | 5751088 |
| 1515 | 2807457179 | 2806310745 | Bacteria | 5742165 |
| 1516 | 2808855656 | 2808606361 | Bacteria | 6136259 |
| 1517 | 2808926782 | 2808606376 | Bacteria | 6248667 |
| 1518 | 2808928401 | 2808606377 | Bacteria | 6646337 |
| 1519 | 2808935507 | 2808606378 | Bacteria | 6177535 |
| 1520 | 2808948943 | 2808606380 | Bacteria | 6248705 |
| 1521 | 2808950416 | 2808606381 | Bacteria | 6646461 |
| 1522 | 2808959798 | 2808606382 | Bacteria | 6841132 |
| 1523 | 2808964115 | 2808606383 | Bacteria | 6138645 |
| 1524 | 2808976190 | 2808606385 | Bacteria | 6711065 |
| 1525 | 2808982470 | 2808606386 | Bacteria | 4471946 |
| 1526 | 2808994346 | 2808606388 | Bacteria | 6706662 |
| 1527 | 2808999049 | 2808606389 | Bacteria | 6138126 |
| 1528 | 2809033228 | 2808606395 | Bacteria | 6020352 |
| 1529 | 2809129703 | 2808606415 | Bacteria | 4576710 |
| 1530 | 2809149242 | 2808606419 | Bacteria | 4576925 |
| 1531 | 2809217227 | 2808606445 | Bacteria | 6057339 |
| 1532 | 2817494083 | 2816332298 | Bacteria | 6852809 |
| 1533 | 2819543929 | 2818991436 | Bacteria | 5376622 |
| 1534 | 2819592889 | 2818991445 | Bacteria | 4955017 |
| 1535 | 2819592919 | 2818991445 | Bacteria | 4955017 |
| 1536 | 2819616549 | 2818991449 | Bacteria | 5518009 |
| 1537 | 2819655175 | 2818991456 | Bacteria | 6123676 |
| 1538 | 2823425757 | 2823421272 | Bacteria | 5372474 |
| 1539 | 2825655053 | 2825651385 | Bacteria | 6715909 |
| 1540 | 2826581861 | 2826581358 | Bacteria | 5963467 |
| 1541 | 2834030994 | 2834028612 | Bacteria | 6354979 |
| 1542 | 2839099201 | 2839094727 | Bacteria | 5534556 |
| 1543 | 2842735689 | 2842733646 | Bacteria | 5716726 |
| 1544 | 2842749122 | 2842747753 | Bacteria | 5578255 |
| 1545 | 2842805863 | 2842805378 | Bacteria | 5385175 |
| 1546 | 2842816885 | 2842815866 | Bacteria | 5947510 |
| 1547 | 2842831245 | 2842826826 | Bacteria | 5974129 |
| 1548 | 2842833498 | 2842832357 | Bacteria | 5959113 |
| 1549 | 2842837941 | 2842837860 | Bacteria | 6066181 |
| 1550 | 2842845728 | 2842843487 | Bacteria | 6004777 |
| 1551 | 2842854151 | 2842849001 | Bacteria | 5924277 |
| 1552 | 2842855665 | 2842854478 | Bacteria | 6143501 |
| 1553 | 2844667141 | 2844665904 | Bacteria | 6817974 |
| 1554 | 2852616393 | 2852612431 | Bacteria | 6885235 |
| 1555 | 2852619383 | 2852618963 | Bacteria | 4577824 |
| 1556 | 2852659721 | 2852657418 | Bacteria | 6472974 |
| 1557 | 2852671361 | 2852667396 | Bacteria | 6885555 |
| 1558 | 2855732747 | 2855730933 | Bacteria | 7047938 |
| 1559 | 2855771499 | 2855767633 | Bacteria | 7049357 |
| 1560 | 2857553213 | 2857547612 | Bacteria | 6179999 |
| 1561 | 2857577578 | 2857576091 | Bacteria | 5465855 |
| 1562 | 2860341759 | 2860339153 | Bacteria | 6846989 |
| 1563 | 2860873068 | 2860867994 | Bacteria | 5645326 |
| 1564 | 2878035392 | 2878029506 | Bacteria | 6418441 |
| 1565 | 2880236039 | 2880230671 | Bacteria | 6140320 |
| 1566 | 2881415543 | 2881412998 | Bacteria | 6492157 |
| 1567 | 2884813274 | 2884811622 | Bacteria | 5552861 |
| 1568 | 2884838572 | 2884836552 | Bacteria | 5219991 |
| 1569 | 2884854863 | 2884852848 | Bacteria | 5221161 |
| 1570 | 2885195978 | 2885192300 | Bacteria | 5882526 |
| 1571 | 2891634427 | 2891633521 | Bacteria | 4602265 |
| 1572 | 2896156468 | 2896154374 | Bacteria | 5221518 |
| 1573 | 2897806768 | 2897803580 | Bacteria | 7000062 |
| 1574 | 2904435818 | 2904434214 | Bacteria | 6230908 |
| 1575 | 2904440767 | 2904439833 | Bacteria | 5931679 |
| 1576 | 2904480751 | 2904479285 | Bacteria | 5073931 |
| 1577 | 2904518915 | 2904518522 | Bacteria | 6068986 |
| 1578 | 2904535366 | 2904530477 | Bacteria | 5876334 |
| 1579 | 2904551402 | 2904550169 | Bacteria | 6221258 |
| 1580 | 2904588486 | 2904584206 | Bacteria | 6028872 |
| 1581 | 2904594626 | 2904589729 | Bacteria | 6113573 |
| 1582 | 2904605858 | 2904601388 | Bacteria | 5884906 |
| 1583 | 2908452628 | 2908446538 | Bacteria | 6829095 |
| 1584 | 2913042572 | 2913036834 | Bacteria | 6704877 |
| 1585 | 2919048933 | 2919046199 | Bacteria | 5567169 |
| 1586 | 2919065477 | 2919063839 | Bacteria | 6302690 |
| 1587 | 2919084835 | 2919079590 | Bacteria | 5946433 |
| 1588 | 2919389152 | 2919385768 | Bacteria | 5897293 |
| 1589 | 2919485699 | 2919481497 | Bacteria | 6907839 |
| 1590 | 2919488128 | 2919487758 | Bacteria | 5929766 |
| 1591 | 2919502515 | 2919501602 | Bacteria | 5286340 |
| 1592 | 2919700532 | 2919697872 | Bacteria | 6553725 |
| 1593 | 2923159558 | 2923153595 | Bacteria | 6870622 |
| 1594 | 2923513938 | 2923510766 | Bacteria | 5926163 |
| 1595 | 2923589041 | 2923586266 | Bacteria | 6565975 |
| 1596 | 2926064188 | 2926063275 | Bacteria | 5285848 |
| 1597 | 2928134200 | 2928130867 | Bacteria | 5467269 |
| 1598 | 2929149961 | 2929144301 | Bacteria | 6622272 |
| 1599 | 2929195192 | 2929189879 | Bacteria | 5930554 |
| 1600 | 2931372598 | 2931369376 | Bacteria | 6847892 |
| 1601 | 2931396457 | 2931390751 | Bacteria | 6273349 |
| 1602 | 2931398122 | 2931396565 | Bacteria | 7251677 |
| 1603 | 2939640764 | 2939636861 | Bacteria | 6297853 |
| 1604 | 2941482521 | |||
| 1605 | 2945930873 | 2945928738 | Bacteria | 6053221 |
| 1606 | 2945966903 | 2945961074 | Bacteria | 7342064 |
| 1607 | 2946013238 | 2946006987 | Bacteria | 6705746 |
| 1608 | 2946027945 | 2946027586 | Bacteria | 6049274 |
| 1609 | 2947234470 | 2947233263 | Bacteria | 6439278 |
| 1610 | 2969310216 | 2969304461 | Bacteria | 6601805 |
| 1611 | 2974294041 | 2974289157 | Bacteria | 6080362 |
| 1612 | 2984286556 | 2984286254 | Bacteria | 6702062 |
| 1613 | 2988731498 | 2988728565 | Bacteria | 6124362 |
| 1614 | 2998145438 | 2998139840 | Bacteria | 6073514 |
| 1615 | 2998344656 | 2998344455 | Bacteria | 4222996 |
| 1616 | 3007399357 | 3007395558 | Bacteria | 6755444 |
| 1617 | 3007425770 | 3007419365 | Bacteria | 7026924 |
| 1618 | 3007517224 | 3007511990 | Bacteria | 6481491 |
| 1619 | 3007618865 | 3007614139 | Bacteria | 6053559 |
| 1620 | 3007721799 | 3007718800 | Bacteria | 5971527 |
| 1621 | 3007859231 | 3007855910 | Bacteria | 5637581 |
| 1622 | 3007865065 | 3007861166 | Bacteria | 6045338 |
| 1623 | 3007866742 | 3007866637 | Bacteria | 5899198 |
| 1624 | 3007872938 | 3007872151 | Bacteria | 5268868 |
| 1625 | 639787418 | 639633007 | Bacteria | 4376040 |
| 1626 | 8015693656 | 8015687852 | Bacteria | 6613826 |
| 1627 | 8019777639 | 8019775933 | Bacteria | 6858656 |
| 1628 | 8029995466 | 8029995093 | Bacteria | 5990776 |
| 1629 | 8034965083 | 8034962539 | Bacteria | 4884839 |
| 1630 | 8054007067 | 8054002106 | Bacteria | 7987183 |
| 1631 | 8054285680 | 8054285046 | Bacteria | 6919322 |
| 1632 | 8054349543 | 8054347763 | Bacteria | 5901107 |
| 1633 | 8054508978 | 8054503363 | Bacteria | 6101651 |
| 1634 | 8054931855 | 8054929484 | Bacteria | 5599761 |
| 1635 | 8055776903 | 8055770955 | Bacteria | 6827675 |
| 1636 | 8055823949 | 8055817908 | Bacteria | 6609162 |
| 1637 | 8056131647 | 8056125926 | Bacteria | 6228218 |
| 1638 | 8056137353 | 8056131705 | Bacteria | 6107031 |
| 1639 | 8056140402 | 8056137416 | Bacteria | 6147080 |
| 1640 | 8056148814 | 8056143049 | Bacteria | 6307666 |
| 1641 | 8056151450 | 8056148874 | Bacteria | 6479865 |
| 1642 | 8056159743 | 8056155041 | Bacteria | 6486948 |
| 1643 | 8056163670 | 8056161164 | Bacteria | 6106669 |
| 1644 | 8056171269 | 8056166840 | Bacteria | 5820959 |
| 1645 | 8056182039 | 8056177738 | Bacteria | 6748268 |
| 1646 | 8056570507 | 8056569372 | Bacteria | 5997322 |
| 1647 | Ga0055538_1000229 | |||
| 1648 | MRS2a_Contig_718 | |||
| 1649 | SwRhRL2b_contig_3259057 | |||
| 1650 | JGI24741J21665_1006777 | |||
| 1651 | JGI25155J39150_1000370 | |||
| 1652 | JGI25155J39150_1000428 | |||
| 1653 | JGI25155J39150_1000795 | |||
| 1654 | JGI25155J39150_1001260 | |||
| 1655 | JGI25156J39149_1000117 | |||
| 1656 | JGI25156J39149_1000989 | |||
| 1657 | JGI25156J39149_1002357 | |||
| 1658 | JGI25162J39368_1000001 | |||
| 1659 | JGI25162J39368_1000378 | |||
| 1660 | JGI25162J39368_1004300 | |||
| 1661 | JGI25162J39368_1004556 | |||
| 1662 | JGI25154J39366_1000107 | |||
| 1663 | JGI25154J39366_1000249 | |||
| 1664 | JGI25154J39366_1000826 | |||
| 1665 | JGI25154J39366_1004380 | |||
| 1666 | JGI25157J39369_1000966 | |||
| 1667 | JGI25157J39369_1001016 | |||
| 1668 | JGI25163J39215_1001139 | |||
| 1669 | JGI25164J39214_1000273 | |||
| 1670 | JGI25151J46595_10001598 | |||
| 1671 | JGI25151J46595_10001939 | |||
| 1672 | JGI25165J46597_1000001 | |||
| 1673 | JGI25165J46597_1000498 | |||
| 1674 | rootH2_10020080 | |||
| 1675 | rootL2_10082487 | |||
| 1676 | Ga0055538_1000001 | |||
| 1677 | Ga0055538_1000032 | |||
| 1678 | Ga0055539_1000001 | |||
| 1679 | Ga0055539_1000043 | |||
| 1680 | Ga0055539_1000269 | |||
| 1681 | Ga0055533_1000003 | |||
| 1682 | Ga0055533_1000052 | |||
| 1683 | Ga0055533_1000258 | |||
| 1684 | Ga0055532_1000044 | |||
| 1685 | Ga0055532_1000047 | |||
| 1686 | Ga0055532_1000647 | |||
| 1687 | Ga0055525_1000003 | |||
| 1688 | Ga0055525_1000062 | |||
| 1689 | Ga0055525_1000359 | |||
| 1690 | Ga0055535_1002174 | |||
| 1691 | Ga0055535_1006556 | |||
| 1692 | Ga0055529_1008064 | |||
| 1693 | Ga0055526_1002434 | |||
| 1694 | Ga0055524_1000061 | |||
| 1695 | Ga0055536_1000081 | |||
| 1696 | Ga0055536_1000201 | |||
| 1697 | Ga0055536_1000704 | |||
| 1698 | Ga0055536_1011459 | |||
| 1699 | Ga0055534_1000104 | |||
| 1700 | Ga0055534_1000470 | |||
| 1701 | Ga0055530_10000324 | |||
| 1702 | Ga0055530_10000800 | |||
| 1703 | Ga0055530_10001011 | |||
| 1704 | Ga0055530_10001044 | |||
| 1705 | Ga0055530_10003143 | |||
| 1706 | Ga0055540_1000026 | |||
| 1707 | Ga0055540_1000745 | |||
| 1708 | Ga0055540_1003757 | |||
| 1709 | Ga0055540_1003950 | |||
| 1710 | Ga0055531_10000404 | |||
| 1711 | Ga0055531_10001242 | |||
| 1712 | Ga0055531_10006377 | |||
| 1713 | Ga0055541_1000001 | |||
| 1714 | Ga0055541_1000030 | |||
| 1715 | Ga0055541_1000168 | |||
| 1716 | Ga0065714_10000115 | |||
| 1717 | Ga0065714_10007511 | |||
| 1718 | Ga0065714_10009964 | |||
| 1719 | Ga0065714_10015263 | |||
| 1720 | Ga0065714_10016786 | |||
| 1721 | Ga0065714_10018929 | |||
| 1722 | Ga0065714_10040903 | |||
| 1723 | Ga0065714_10065087 | |||
| 1724 | Ga0065714_10065569 | |||
| 1725 | Ga0065714_10072683 | |||
| 1726 | Ga0065714_10078533 | |||
| 1727 | Ga0065714_10092492 | |||
| 1728 | Ga0065714_10129168 | |||
| 1729 | Ga0065714_10135547 | |||
| 1730 | Ga0065704_10008310 | |||
| 1731 | Ga0065704_10024159 | |||
| 1732 | Ga0065704_10073325 | |||
| 1733 | Ga0065704_10076165 | |||
| 1734 | Ga0065704_10080568 | |||
| 1735 | Ga0065712_10067900 | |||
| 1736 | Ga0065712_10068537 | |||
| 1737 | Ga0065715_10117248 | |||
| 1738 | Ga0070670_100001343 | |||
| 1739 | Ga0070670_100005930 | |||
| 1740 | Ga0070670_100024674 | |||
| 1741 | Ga0070666_10044566 | |||
| 1742 | Ga0070660_100439878 | |||
| 1743 | Ga0070660_100663137 | |||
| 1744 | Ga0070661_100000126 | |||
| 1745 | Ga0070661_100568593 | |||
| 1746 | Ga0070669_100000764 | |||
| 1747 | Ga0070669_100002215 | |||
| 1748 | Ga0070669_100010461 | |||
| 1749 | Ga0070673_100336409 | |||
| 1750 | Ga0070667_100025826 | |||
| 1751 | Ga0070714_100523115 | |||
| 1752 | Ga0070663_100590763 | |||
| 1753 | Ga0070662_100000426 | |||
| 1754 | Ga0070662_100025623 | |||
| 1755 | Ga0068853_100002460 | |||
| 1756 | Ga0068853_100167212 | |||
| 1757 | Ga0068853_100247147 | |||
| 1758 | Ga0070665_100045202 | |||
| 1759 | Ga0070665_100055165 | |||
| 1760 | Ga0070665_100244070 | |||
| 1761 | Ga0070665_100289486 | |||
| 1762 | Ga0070665_100719054 | |||
| 1763 | Ga0070665_101406873 | |||
| 1764 | Ga0068855_100000083 | |||
| 1765 | Ga0068855_100075954 | |||
| 1766 | Ga0068855_100156925 | |||
| 1767 | Ga0068855_100230745 | |||
| 1768 | Ga0070664_100002791 | |||
| 1769 | Ga0070664_100385963 | |||
| 1770 | Ga0068854_100009626 | |||
| 1771 | Ga0068854_100042852 | |||
| 1772 | Ga0068856_100045478 | |||
| 1773 | Ga0068856_100062089 | |||
| 1774 | Ga0068852_100010440 | |||
| 1775 | Ga0068851_10000007 | |||
| 1776 | Ga0075365_10085235 | |||
| 1777 | Ga0075365_10145557 | |||
| 1778 | Ga0075364_10129569 | |||
| 1779 | Ga0075364_10373248 | |||
| 1780 | Ga0075432_10011631 | |||
| 1781 | Ga0075432_10028200 | |||
| 1782 | Ga0075432_10032413 | |||
| 1783 | Ga0075432_10074428 | |||
| 1784 | Ga0070716_100037343 | |||
| 1785 | Ga0075362_10034210 | |||
| 1786 | Ga0075362_10037732 | |||
| 1787 | Ga0075362_10108739 | |||
| 1788 | Ga0075366_10005256 | |||
| 1789 | Ga0075366_10024685 | |||
| 1790 | Ga0075370_10004516 | |||
| 1791 | Ga0075436_100042606 | |||
| 1792 | Ga0075436_100176405 | |||
| 1793 | Ga0075436_100235249 | |||
| 1794 | Ga0075436_100269535 | |||
| 1795 | Ga0075436_100494052 | |||
| 1796 | Ga0075436_100536753 | |||
| 1797 | Ga0079104_1000093 | |||
| 1798 | Ga0079104_1000518 | |||
| 1799 | Ga0079104_1000754 | |||
| 1800 | Ga0079104_1001469 | |||
| 1801 | Ga0079104_1010922 | |||
| 1802 | Ga0099826_10000039 | |||
| 1803 | Ga0099826_10004941 | |||
| 1804 | Ga0105251_10000009 | |||
| 1805 | Ga0105251_10000133 | |||
| 1806 | Ga0105251_10004529 | |||
| 1807 | Ga0105251_10006398 | |||
| 1808 | Ga0105251_10008326 | |||
| 1809 | Ga0105251_10009680 | |||
| 1810 | Ga0105251_10014310 | |||
| 1811 | Ga0105251_10016733 | |||
| 1812 | Ga0105251_10017668 | |||
| 1813 | Ga0105251_10034134 | |||
| 1814 | Ga0105251_10037689 | |||
| 1815 | Ga0105251_10044660 | |||
| 1816 | Ga0105251_10162951 | |||
| 1817 | Ga0105251_10175120 | |||
| 1818 | Ga0105244_10000008 | |||
| 1819 | Ga0105244_10001453 | |||
| 1820 | Ga0105244_10003377 | |||
| 1821 | Ga0105244_10008099 | |||
| 1822 | Ga0105244_10034271 | |||
| 1823 | Ga0105244_10061120 | |||
| 1824 | Ga0105244_10067665 | |||
| 1825 | Ga0105244_10076791 | |||
| 1826 | Ga0105244_10097516 | |||
| 1827 | Ga0105244_10098580 | |||
| 1828 | Ga0105244_10276542 | |||
| 1829 | Ga0105250_10000605 | |||
| 1830 | Ga0105250_10002587 | |||
| 1831 | Ga0105250_10003447 | |||
| 1832 | Ga0105250_10003816 | |||
| 1833 | Ga0105250_10004205 | |||
| 1834 | Ga0105250_10011988 | |||
| 1835 | Ga0105250_10030034 | |||
| 1836 | Ga0105250_10032680 | |||
| 1837 | Ga0105250_10057968 | |||
| 1838 | Ga0105250_10101348 | |||
| 1839 | Ga0105240_10003351 | |||
| 1840 | Ga0105240_10028663 | |||
| 1841 | Ga0105240_10118802 | |||
| 1842 | Ga0105243_10007062 | |||
| 1843 | Ga0105243_10007538 | |||
| 1844 | Ga0105243_10013877 | |||
| 1845 | Ga0105243_10053584 | |||
| 1846 | Ga0105243_10170509 | |||
| 1847 | Ga0105242_10004917 | |||
| 1848 | Ga0105242_10033598 | |||
| 1849 | Ga0105242_10164967 | |||
| 1850 | Ga0105242_10440437 | |||
| 1851 | Ga0105237_10005994 | |||
| 1852 | Ga0105237_10093575 | |||
| 1853 | Ga0105237_10149362 | |||
| 1854 | Ga0105237_10268524 | |||
| 1855 | Ga0105237_10340359 | |||
| 1856 | Ga0105238_10000037 | |||
| 1857 | Ga0105238_10080399 | |||
| 1858 | Ga0105239_10013749 | |||
| 1859 | Ga0105239_10092298 | |||
| 1860 | Ga0105246_10000162 | |||
| 1861 | Ga0105246_10000432 | |||
| 1862 | Ga0105246_10019035 | |||
| 1863 | Ga0105246_10025124 | |||
| 1864 | Ga0105246_10111801 | |||
| 1865 | Ga0105246_10169006 | |||
| 1866 | Ga0157345_1000059 | |||
| 1867 | Ga0157373_10003992 | |||
| 1868 | Ga0157373_10007482 | |||
| 1869 | Ga0157373_10011402 | |||
| 1870 | Ga0157373_10043148 | |||
| 1871 | Ga0157373_10043917 | |||
| 1872 | Ga0157373_10085841 | |||
| 1873 | Ga0157373_10129501 | |||
| 1874 | Ga0157373_10152386 | |||
| 1875 | Ga0157373_10178942 | |||
| 1876 | Ga0157371_10000039 | |||
| 1877 | Ga0157371_10011165 | |||
| 1878 | Ga0157371_10025849 | |||
| 1879 | Ga0157371_10115285 | |||
| 1880 | Ga0157371_10163806 | |||
| 1881 | Ga0157371_10227328 | |||
| 1882 | Ga0157370_10000070 | |||
| 1883 | Ga0157370_10011932 | |||
| 1884 | Ga0157370_10039117 | |||
| 1885 | Ga0157370_10052578 | |||
| 1886 | Ga0157370_10072242 | |||
| 1887 | Ga0157370_10105658 | |||
| 1888 | Ga0157370_10141128 | |||
| 1889 | Ga0157370_10386291 | |||
| 1890 | Ga0157369_10039350 | |||
| 1891 | Ga0157369_10052988 | |||
| 1892 | Ga0157369_10086792 | |||
| 1893 | Ga0157369_10094667 | |||
| 1894 | Ga0157369_10095256 | |||
| 1895 | Ga0157369_10133358 | |||
| 1896 | Ga0157369_10138981 | |||
| 1897 | Ga0163162_10048268 | |||
| 1898 | Ga0163162_10770004 | |||
| 1899 | Ga0163162_11101635 | |||
| 1900 | Ga0157372_10109402 | |||
| 1901 | Ga0157372_10131463 | |||
| 1902 | Ga0157375_10086735 | |||
| 1903 | Ga0157375_10090932 | |||
| 1904 | Ga0157375_10249140 | |||
| 1905 | Ga0157375_10382958 | |||
| 1906 | Ga0157375_10911217 | |||
| 1907 | Ga0157380_10410785 | |||
| 1908 | Ga0182008_10000662 | |||
| 1909 | Ga0182008_10003064 | |||
| 1910 | Ga0182008_10005030 | |||
| 1911 | Ga0182008_10013293 | |||
| 1912 | Ga0182008_10013647 | |||
| 1913 | Ga0182008_10024543 | |||
| 1914 | Ga0182008_10025165 | |||
| 1915 | Ga0182008_10026256 | |||
| 1916 | Ga0182008_10052314 | |||
| 1917 | Ga0182008_10097056 | |||
| 1918 | Ga0182008_10153588 | |||
| 1919 | Ga0157376_10340397 | |||
| 1920 | Ga0182006_1006448 | |||
| 1921 | Ga0182006_1010871 | |||
| 1922 | Ga0182006_1014777 | |||
| 1923 | Ga0182006_1016147 | |||
| 1924 | Ga0182006_1020055 | |||
| 1925 | Ga0182006_1020526 | |||
| 1926 | Ga0182006_1023930 | |||
| 1927 | Ga0182006_1028676 | |||
| 1928 | Ga0182006_1044379 | |||
| 1929 | Ga0182006_1050795 | |||
| 1930 | Ga0182006_1068441 | |||
| 1931 | Ga0182006_1148228 | |||
| 1932 | Ga0182007_10001352 | |||
| 1933 | Ga0182007_10001934 | |||
| 1934 | Ga0182007_10006630 | |||
| 1935 | Ga0182007_10017947 | |||
| 1936 | Ga0182007_10019671 | |||
| 1937 | Ga0182007_10025132 | |||
| 1938 | Ga0182007_10026086 | |||
| 1939 | Ga0182005_1000183 | |||
| 1940 | Ga0182005_1007397 | |||
| 1941 | Ga0182005_1010616 | |||
| 1942 | Ga0182005_1021610 | |||
| 1943 | Ga0182005_1035003 | |||
| 1944 | Ga0183362_10001 | |||
| 1945 | Ga0183361_10004 | |||
| 1946 | Ga0163161_10046855 | |||
| 1947 | Ga0163161_10101646 | |||
| 1948 | Ga0163161_10124933 | |||
| 1949 | Ga0163161_10167083 | |||
| 1950 | Ga0163161_10173430 | |||
| 1951 | Ga0163161_10181486 | |||
| 1952 | Ga0163161_10215667 | |||
| 1953 | Ga0163161_10239651 | |||
| 1954 | Ga0163161_10258045 | |||
| 1955 | Ga0163161_10279826 | |||
| 1956 | Ga0163161_10287576 | |||
| 1957 | Ga0163161_10325029 | |||
| 1958 | Ga0209435_100004 | |||
| 1959 | Ga0209435_100046 | |||
| 1960 | Ga0209435_100377 | |||
| 1961 | Ga0209435_100768 | |||
| 1962 | Ga0209760_100027 | |||
| 1963 | Ga0209760_101344 | |||
| 1964 | Ga0209784_100004 | |||
| 1965 | Ga0209784_100007 | |||
| 1966 | Ga0209784_100009 | |||
| 1967 | Ga0209566_100004 | |||
| 1968 | Ga0209566_100007 | |||
| 1969 | Ga0209566_100009 | |||
| 1970 | Ga0209674_100006 | |||
| 1971 | Ga0209674_100018 | |||
| 1972 | Ga0209674_100021 | |||
| 1973 | Ga0209147_100009 | |||
| 1974 | Ga0209147_100011 | |||
| 1975 | Ga0209147_100157 | |||
| 1976 | Ga0209563_100009 | |||
| 1977 | Ga0209563_100018 | |||
| 1978 | Ga0209563_100020 | |||
| 1979 | Ga0209563_100268 | |||
| 1980 | Ga0207427_100006 | |||
| 1981 | Ga0207427_100149 | |||
| 1982 | Ga0209437_100004 | |||
| 1983 | Ga0209437_100013 | |||
| 1984 | Ga0209437_100207 | |||
| 1985 | Ga0209437_100939 | |||
| 1986 | Ga0209258_100851 | |||
| 1987 | Ga0209258_100913 | |||
| 1988 | Ga0209258_101397 | |||
| 1989 | Ga0209646_1000141 | |||
| 1990 | Ga0209646_1000149 | |||
| 1991 | Ga0209646_1000156 | |||
| 1992 | Ga0209646_1000184 | |||
| 1993 | Ga0209646_1000233 | |||
| 1994 | Ga0209646_1000524 | |||
| 1995 | Ga0209026_1000066 | |||
| 1996 | Ga0209026_1000776 | |||
| 1997 | Ga0209677_100005 | |||
| 1998 | Ga0209677_100010 | |||
| 1999 | Ga0209677_100012 | |||
| 2000 | Ga0209148_1012493 | |||
| 2001 | Ga0209148_1015404 | |||
| 2002 | Ga0209759_1000072 | |||
| 2003 | Ga0209759_1000182 | |||
| 2004 | Ga0209759_1001083 | |||
| 2005 | Ga0209759_1001715 | |||
| 2006 | Ga0209233_1000005 | |||
| 2007 | Ga0209233_1000022 | |||
| 2008 | Ga0209565_1001951 | |||
| 2009 | Ga0209455_1001032 | |||
| 2010 | Ga0209455_1002502 | |||
| 2011 | Ga0209673_1011314 | |||
| 2012 | Ga0209130_1010307 | |||
| 2013 | Ga0209130_1032862 | |||
| 2014 | Ga0209675_1000078 | |||
| 2015 | Ga0209675_1000573 | |||
| 2016 | Ga0209675_1001701 | |||
| 2017 | Ga0209675_1003212 | |||
| 2018 | Ga0209675_1004183 | |||
| 2019 | Ga0209676_1000015 | |||
| 2020 | Ga0209676_1000030 | |||
| 2021 | Ga0209676_1000041 | |||
| 2022 | Ga0209676_1000121 | |||
| 2023 | Ga0209676_1007094 | |||
| 2024 | Ga0209676_1026401 | |||
| 2025 | Ga0209025_1000019 | |||
| 2026 | Ga0209025_1000051 | |||
| 2027 | Ga0209025_1003638 | |||
| 2028 | Ga0209025_1034026 | |||
| 2029 | Ga0209564_1000133 | |||
| 2030 | Ga0209564_1020032 | |||
| 2031 | Ga0209050_1000024 | |||
| 2032 | Ga0209050_1000030 | |||
| 2033 | Ga0209050_1000228 | |||
| 2034 | Ga0209050_1000332 | |||
| 2035 | Ga0209050_1001473 | |||
| 2036 | Ga0209050_1011157 | |||
| 2037 | Ga0209050_1022072 | |||
| 2038 | Ga0209050_1035225 | |||
| 2039 | Ga0209256_1000030 | |||
| 2040 | Ga0209256_1000699 | |||
| 2041 | Ga0209051_1000004 | |||
| 2042 | Ga0209051_1000012 | |||
| 2043 | Ga0209051_1000023 | |||
| 2044 | Ga0209051_1000367 | |||
| 2045 | Ga0209051_1001294 | |||
| 2046 | Ga0209051_1007252 | |||
| 2047 | Ga0209051_1009205 | |||
| 2048 | Ga0209257_1000012 | |||
| 2049 | Ga0209257_1000063 | |||
| 2050 | Ga0209257_1000262 | |||
| 2051 | Ga0209257_1022106 | |||
| 2052 | Ga0207656_10000006 | |||
| 2053 | Ga0207696_1000020 | |||
| 2054 | Ga0207696_1000031 | |||
| 2055 | Ga0207696_1001215 | |||
| 2056 | Ga0207696_1003799 | |||
| 2057 | Ga0207696_1005266 | |||
| 2058 | Ga0207696_1024464 | |||
| 2059 | Ga0207696_1041534 | |||
| 2060 | Ga0207655_1000033 | |||
| 2061 | Ga0207655_1000083 | |||
| 2062 | Ga0207655_1000703 | |||
| 2063 | Ga0207655_1002748 | |||
| 2064 | Ga0207655_1005392 | |||
| 2065 | Ga0207655_1005543 | |||
| 2066 | Ga0207655_1005590 | |||
| 2067 | Ga0207655_1007307 | |||
| 2068 | Ga0207655_1012751 | |||
| 2069 | Ga0207655_1012880 | |||
| 2070 | Ga0207655_1013705 | |||
| 2071 | Ga0207655_1015570 | |||
| 2072 | Ga0207655_1020094 | |||
| 2073 | Ga0207655_1041823 | |||
| 2074 | Ga0207655_1142231 | |||
| 2075 | Ga0207713_1000032 | |||
| 2076 | Ga0207713_1000079 | |||
| 2077 | Ga0207713_1000659 | |||
| 2078 | Ga0207713_1000750 | |||
| 2079 | Ga0207713_1000837 | |||
| 2080 | Ga0207713_1001056 | |||
| 2081 | Ga0207713_1002266 | |||
| 2082 | Ga0207713_1002477 | |||
| 2083 | Ga0207713_1006015 | |||
| 2084 | Ga0207713_1007842 | |||
| 2085 | Ga0207713_1007888 | |||
| 2086 | Ga0207713_1008313 | |||
| 2087 | Ga0207713_1011258 | |||
| 2088 | Ga0207713_1021313 | |||
| 2089 | Ga0207713_1022601 | |||
| 2090 | Ga0207688_10362594 | |||
| 2091 | Ga0207645_10307425 | |||
| 2092 | Ga0207695_10000748 | |||
| 2093 | Ga0207695_10000979 | |||
| 2094 | Ga0207695_10085612 | |||
| 2095 | Ga0207671_10000131 | |||
| 2096 | Ga0207671_10027798 | |||
| 2097 | Ga0207671_10312044 | |||
| 2098 | Ga0207657_10210920 | |||
| 2099 | Ga0207649_10000012 | |||
| 2100 | Ga0207649_10194479 | |||
| 2101 | Ga0207681_10000381 | |||
| 2102 | Ga0207681_10000482 | |||
| 2103 | Ga0207681_10009066 | |||
| 2104 | Ga0207694_10000069 | |||
| 2105 | Ga0207694_10033085 | |||
| 2106 | Ga0207694_10340000 | |||
| 2107 | Ga0207650_10000338 | |||
| 2108 | Ga0207650_10000564 | |||
| 2109 | Ga0207650_10176277 | |||
| 2110 | Ga0207659_10173289 | |||
| 2111 | Ga0207664_10665713 | |||
| 2112 | Ga0207644_10289078 | |||
| 2113 | Ga0207706_10001424 | |||
| 2114 | Ga0207706_10042839 | |||
| 2115 | Ga0207686_10000663 | |||
| 2116 | Ga0207686_10241547 | |||
| 2117 | Ga0207686_10271493 | |||
| 2118 | Ga0207709_10000248 | |||
| 2119 | Ga0207709_10003176 | |||
| 2120 | Ga0207709_10181605 | |||
| 2121 | Ga0207709_10203623 | |||
| 2122 | Ga0207669_10759510 | |||
| 2123 | Ga0207665_10052433 | |||
| 2124 | Ga0207679_10000015 | |||
| 2125 | Ga0207667_10000043 | |||
| 2126 | Ga0207667_10030089 | |||
| 2127 | Ga0207667_10223683 | |||
| 2128 | Ga0207667_10398203 | |||
| 2129 | Ga0207651_10280762 | |||
| 2130 | Ga0207640_10015014 | |||
| 2131 | Ga0207677_10102893 | |||
| 2132 | Ga0207639_10000286 | |||
| 2133 | Ga0207702_10027104 | |||
| 2134 | Ga0207702_10333543 | |||
| 2135 | Ga0207648_10239465 | |||
| 2136 | Ga0207674_10246713 | |||
| 2137 | Ga0207675_101211330 | |||
| 2138 | Ga0207683_10472243 | |||
| 2139 | Ga0207698_10000966 | |||
| 2140 | Ga0209281_1000016 | |||
| 2141 | Ga0209281_1000019 | |||
| 2142 | Ga0209281_1000084 | |||
| 2143 | Ga0209281_1005170 | |||
| 2144 | Ga0209281_1007590 | |||
| 2145 | Ga0209371_1000871 | |||
| 2146 | Ga0209282_1000058 | |||
| 2147 | Ga0207428_10007071 | |||
| 2148 | Ga0207428_10072024 | |||
| 2149 | Ga0207428_10076055 | |||
| 2150 | Ga0207428_10085395 | |||
| 2151 | Ga0207428_10093304 | |||
| 2152 | Ga0268266_10004944 | |||
| 2153 | Ga0268266_10040199 | |||
| 2154 | Ga0268266_10290161 | |||
| 2155 | Ga0268266_10622091 | |||
| 2156 | Ga0268266_10834620 | |||
| 2157 | Ga0307517_10186905 | |||
| 2158 | Ga0307515_10000215 | |||
| 2159 | Ga0268256_1000771 | |||
| 2160 | Ga0307511_10003163 | |||
| 2161 | Ga0307511_10046070 | |||
| 2162 | Ga0307511_10105971 | |||
| 2163 | Ga0316178_1051183 | |||
| 2164 | Ga0316183_1079327 | |||
| 2165 | Ga0316181_1054368 | |||
| 2166 | Ga0265332_10002934 | |||
| 2167 | Ga0265329_10028102 | |||
| 2168 | Ga0265340_10001308 | |||
| 2169 | Ga0265331_10011421 | |||
| 2170 | Ga0265327_10036761 | |||
| 2171 | Ga0265327_10058111 | |||
| 2172 | Ga0265316_10053295 | |||
| 2173 | Ga0265316_10199969 | |||
| 2174 | Ga0307513_10146120 | |||
| 2175 | Ga0307509_10141275 | |||
| 2176 | Ga0307509_10373778 | |||
| 2177 | Ga0307408_100000002 | |||
| 2178 | Ga0307408_100018437 | |||
| 2179 | Ga0307408_100030557 | |||
| 2180 | Ga0307408_100135174 | |||
| 2181 | Ga0307408_100368944 | |||
| 2182 | Ga0307408_100839944 | |||
| 2183 | Ga0265314_10038167 | |||
| 2184 | Ga0265342_10002113 | |||
| 2185 | Ga0307516_10329423 | |||
| 2186 | Ga0307405_10021286 | |||
| 2187 | Ga0307405_10030612 | |||
| 2188 | Ga0307405_10118288 | |||
| 2189 | Ga0307405_10219610 | |||
| 2190 | Ga0307405_10445495 | |||
| 2191 | Ga0307413_10467860 | |||
| 2192 | Ga0307406_10031651 | |||
| 2193 | Ga0307406_10064864 | |||
| 2194 | Ga0307406_10422248 | |||
| 2195 | Ga0307412_10000401 | |||
| 2196 | Ga0307412_10014881 | |||
| 2197 | Ga0307412_10027454 | |||
| 2198 | Ga0307412_10114444 | |||
| 2199 | Ga0307412_10128873 | |||
| 2200 | Ga0307412_10143622 | |||
| 2201 | Ga0307412_10229525 | |||
| 2202 | Ga0307409_100114929 | |||
| 2203 | Ga0307416_100168469 | |||
| 2204 | Ga0307416_100235127 | |||
| 2205 | Ga0307416_100313562 | |||
| 2206 | Ga0307416_101373701 | |||
| 2207 | Ga0307414_10018847 | |||
| 2208 | Ga0307414_10351963 | |||
| 2209 | Ga0307414_10529026 | |||
| 2210 | Ga0307414_11003013 | |||
| 2211 | Ga0307411_10021537 | |||
| 2212 | Ga0307411_10044282 | |||
| 2213 | Ga0307411_10069287 | |||
| 2214 | Ga0307510_10081644 | |||
| 2215 | Ga0395899_0000478 | |||
| 2216 | Ga0395899_0002559 | |||
| 2217 | Ga0395899_0003641 | |||
| 2218 | Ga0395899_0010527 | |||
| 2219 | Ga0395899_0021543 | |||
| 2220 | Ga0395900_0000689 | |||
| 2221 | Ga0395900_0009793 | |||
| 2222 | Ga0395900_0054673 | |||
| 2223 | Ga0395900_0067915 | |||
| 2224 | Ga0395898_0006853 | |||
| 2225 | Ga0395898_0012935 | |||
| 2226 | Ga0395898_0542779 | |||
| 2227 | Ga0395905_0001455 | |||
| 2228 | Ga0395905_0006806 | |||
| 2229 | Ga0395905_0040143 | |||
| 2230 | Ga0395905_0131624 | |||
| 2231 | Ga0395901_0000448 | |||
| 2232 | Ga0395901_0013926 | |||
| 2233 | Ga0395901_0021143 | |||
| 2234 | Ga0395901_0707761 | |||
| 2235 | Ga0237819_00552 | |||
| 2236 | Ga0436361_0383577 | |||
| 2237 | Ga0439436_0002185 | |||
| 2238 | Ga0439436_0014730 | |||
| 2239 | Ga0439436_0031731 | |||
| 2240 | Ga0439438_003027 | |||
| 2241 | Ga0439438_008131 | |||
| 2242 | Ga0439438_009379 | |||
| 2243 | Ga0439438_029762 | |||
| 2244 | Ga0439438_056012 | |||
| 2245 | Ga0439447_002518 | |||
| 2246 | Ga0439447_003011 | |||
| 2247 | Ga0439447_005933 | |||
| 2248 | Ga0439447_008182 | |||
| 2249 | Ga0439447_041380 | |||
| 2250 | Ga0439447_048871 | |||
| 2251 | Ga0439453_0033084 | |||
| 2252 | Ga0439461_0060740 | |||
| 2253 | Ga0439466_0002249 | |||
| 2254 | Ga0439466_0002406 | |||
| 2255 | Ga0439466_0002488 | |||
| 2256 | Ga0439466_0005445 | |||
| 2257 | Ga0439466_0007824 | |||
| 2258 | Ga0439466_0011931 | |||
| 2259 | Ga0439466_0022629 | |||
| 2260 | Ga0439466_0072787 | |||
| 2261 | Ga0439465_0002411 | |||
| 2262 | Ga0439431_0000362 | |||
| 2263 | Ga0439433_0000386 | |||
| 2264 | Ga0439442_003449 | |||
| 2265 | Ga0439445_0000121 | |||
| 2266 | Ga0439448_0000259 | |||
| 2267 | Ga0439432_000513 | |||
| 2268 | Ga0439432_001999 | |||
| 2269 | Ga0439432_012071 | |||
| 2270 | Ga0439432_015834 | |||
| 2271 | Ga0439432_032113 | |||
| 2272 | Ga0439432_059886 | |||
| 2273 | Ga0439449_0001222 | |||
| 2274 | Ga0439449_0052621 | |||
| 2275 | Ga0439450_003664 | |||
| 2276 | Ga0439451_000646 | |||
| 2277 | Ga0439451_003347 | |||
| 2278 | Ga0439451_004400 | |||
| 2279 | Ga0439451_008272 | |||
| 2280 | Ga0439451_048696 | |||
| 2281 | Ga0439451_051306 | |||
| 2282 | Ga0439452_002368 | |||
| 2283 | Ga0439452_002759 | |||
| 2284 | Ga0439452_008262 | |||
| 2285 | Ga0439452_008471 | |||
| 2286 | Ga0439452_022738 | |||
| 2287 | Ga0439452_048695 | |||
| 2288 | Ga0439455_0023343 | |||
| 2289 | Ga0439456_001671 | |||
| 2290 | Ga0439456_004150 | |||
| 2291 | Ga0439456_042724 | |||
| 2292 | Ga0439462_0011605 | |||
| 2293 | Ga0439463_001315 | |||
| 2294 | Ga0439463_001732 | |||
| 2295 | Ga0439463_003054 | |||
| 2296 | Ga0439463_029998 | |||
| 2297 | Ga0450911_001308 | |||
| 2298 | Ga0450911_007537 | |||
| 2299 | Ga0450919_001489 | |||
| 2300 | Ga0450919_003601 | |||
| 2301 | Ga0450920_001631 | |||
| 2302 | Ga0450923_015979 | |||
| 2303 | Ga0450890_003335 | |||
| 2304 | Ga0450900_001223 | |||
| 2305 | Ga0450902_004412 | |||
| 2306 | Ga0450902_016447 | |||
| 2307 | Ga0450903_001035 | |||
| 2308 | Ga0450903_009052 | |||
| 2309 | Ga0450903_015548 | |||
| 2310 | Ga0450905_001395 | |||
| 2311 | Ga0450906_001441 | |||
| 2312 | Ga0450906_004512 | |||
| 2313 | Ga0450907_001403 | |||
| 2314 | Ga0450907_001502 | |||
| 2315 | Ga0450907_001564 | |||
| 2316 | Ga0450910_001446 | |||
| 2317 | Ga0439446_0017528 | |||
| 2318 | Ga0439446_0021589 | |||
| 2319 | Ga0450908_011990 | |||
| 2320 | Ga0450908_022912 | |||
| 2321 | Ga0450908_042764 | |||
| 2322 | Ga0450909_002330 | |||
| 2323 | Ga0450909_007436 | |||
| 2324 | Ga0439434_0034102 | |||
| 2325 | Ga0439434_0104232 | |||
| 2326 | Ga0439464_0002118 | |||
| 2327 | Ga0439460_0000913 | |||
| 2328 | Ga0439460_0027876 | |||
| 2329 | Ga0450918_000196 | |||
| 2330 | Ga0450918_004059 | |||
| 2331 | Ga0450901_000243 | |||
| 2332 | Ga0439440_0011461 | |||
| 2333 | Ga0466969_0002577 | |||
| 2334 | Ga0466972_0003793 | |||
| 2335 | Ga0466972_0029120 | |||
| 2336 | Ga0466972_0184092 | |||
| 2337 | Ga0466965_0004441 | |||
| 2338 | Ga0466965_0015148 | |||
| 2339 | Ga0466965_0038432 | |||
| 2340 | Ga0466965_0161174 | |||
| 2341 | Ga0466966_0052393 | |||
| 2342 | Ga0466966_0080819 | |||
| 2343 | Ga0466961_0017656 | |||
| 2344 | Ga0466964_0001947 | |||
| 2345 | Ga0466964_0017499 | |||
| 2346 | Ga0466964_0026220 | |||
| 2347 | Ga0466964_0214650 | |||
| 2348 | Ga0466968_0007003 | |||
| 2349 | Ga0466968_0007529 | |||
| 2350 | Ga0466968_0008302 | |||
| 2351 | Ga0466957_0020683 | |||
| 2352 | Ga0466960_0127563 | |||
| 2353 | Ga0466960_0140472 | |||
| 2354 | Ga0466960_0325598 | |||
| 2355 | Ga0466959_0014864 | |||
| 2356 | Ga0466959_0045215 | |||
| 2357 | Ga0466959_0365778 | |||
| 2358 | Ga0466958_0077912 | |||
| 2359 | Ga0466967_0010798 | |||
| 2360 | Ga0495617_008515 | |||
| 2361 | Ga0495617_011744 | |||
| 2362 | Ga0495617_015578 | |||
| 2363 | Ga0495627_000083 | |||
| 2364 | Ga0495627_003909 | |||
| 2365 | Ga0495627_005462 | |||
| 2366 | Ga0495627_006280 | |||
| 2367 | Ga0495627_008624 | |||
| 2368 | Ga0495627_009171 | |||
| 2369 | Ga0495627_024339 | |||
| 2370 | Ga0495627_041276 | |||
| 2371 | Ga0495592_0064774 | |||
| 2372 | Ga0495603_0004335 | |||
| 2373 | Ga0495603_0080815 | |||
| 2374 | Ga0495603_0102798 | |||
| 2375 | Ga0495590_0012084 | |||
| 2376 | Ga0495590_0014464 | |||
| 2377 | Ga0495590_0025283 | |||
| 2378 | Ga0495590_0073097 | |||
| 2379 | Ga0495590_0074436 | |||
| 2380 | Ga0495590_0138886 | |||
| 2381 | Ga0495591_000002 | |||
| 2382 | Ga0495591_000113 | |||
| 2383 | Ga0495591_003516 | |||
| 2384 | Ga0495591_003651 | |||
| 2385 | Ga0495591_004074 | |||
| 2386 | Ga0495591_008694 | |||
| 2387 | Ga0495591_009701 | |||
| 2388 | Ga0495591_009752 | |||
| 2389 | Ga0495591_013527 | |||
| 2390 | Ga0495591_014025 | |||
| 2391 | Ga0495591_015116 | |||
| 2392 | Ga0495591_022913 | |||
| 2393 | Ga0495591_034834 | |||
| 2394 | Ga0495591_036110 | |||
| 2395 | Ga0495591_044438 | |||
| 2396 | Ga0495591_051672 | |||
| 2397 | Ga0495591_073907 | |||
| 2398 | Ga0495638_0031008 | |||
| 2399 | Ga0495638_0103993 | |||
| 2400 | Ga0495638_0192496 | |||
| 2401 | Ga0495638_0207299 | |||
| 2402 | Ga0495638_0238693 | |||
| 2403 | Ga0495651_0017632 | |||
| 2404 | Ga0495651_0126203 | |||
| 2405 | Ga0495651_0154753 | |||
| 2406 | Ga0495651_0187053 | |||
| 2407 | Ga0495653_0013706 | |||
| 2408 | Ga0495653_0019246 | |||
| 2409 | Ga0495653_0026743 | |||
| 2410 | Ga0495653_0107228 | |||
| 2411 | Ga0495653_0409177 | |||
| 2412 | Ga0495650_0000623 | |||
| 2413 | Ga0495650_0002491 | |||
| 2414 | Ga0495650_0003593 | |||
| 2415 | Ga0495650_0067092 | |||
| 2416 | Ga0495650_0073259 | |||
| 2417 | Ga0495650_0089405 | |||
| 2418 | Ga0495580_0002103 | |||
| 2419 | Ga0495605_0000048 | |||
| 2420 | Ga0495605_0000100 | |||
| 2421 | Ga0495605_0000122 | |||
| 2422 | Ga0495605_0000157 | |||
| 2423 | Ga0495605_0000339 | |||
| 2424 | Ga0495605_0001304 | |||
| 2425 | Ga0495605_0003104 | |||
| 2426 | Ga0495605_0007095 | |||
| 2427 | Ga0495605_0008405 | |||
| 2428 | Ga0495605_0009534 | |||
| 2429 | Ga0495605_0024062 | |||
| 2430 | Ga0495605_0040719 | |||
| 2431 | Ga0495605_0041933 | |||
| 2432 | Ga0495605_0060194 | |||
| 2433 | Ga0495605_0062160 | |||
| 2434 | Ga0495605_0072134 | |||
| 2435 | Ga0495605_0131142 | |||
| 2436 | Ga0495639_0003059 | |||
| 2437 | Ga0495639_0003490 | |||
| 2438 | Ga0495639_0143286 | |||
| 2439 | Ga0495584_0002441 | |||
| 2440 | Ga0495584_0007556 | |||
| 2441 | Ga0495584_0008229 | |||
| 2442 | Ga0495584_0017198 | |||
| 2443 | Ga0495584_0022541 | |||
| 2444 | Ga0495584_0026803 | |||
| 2445 | Ga0495584_0073146 | |||
| 2446 | Ga0495584_0106135 | |||
| 2447 | Ga0495584_0124228 | |||
| 2448 | Ga0495584_0166746 | |||
| 2449 | Ga0495585_0010646 | |||
| 2450 | Ga0495585_0025718 | |||
| 2451 | Ga0495585_0036941 | |||
| 2452 | Ga0495585_0058636 | |||
| 2453 | Ga0495585_0116298 | |||
| 2454 | Ga0495594_0026034 | |||
| 2455 | Ga0495594_0028474 | |||
| 2456 | Ga0495596_0000060 | |||
| 2457 | Ga0495596_0008186 | |||
| 2458 | Ga0495596_0088404 | |||
| 2459 | Ga0495607_0000025 | |||
| 2460 | Ga0495607_0000700 | |||
| 2461 | Ga0495607_0004307 | |||
| 2462 | Ga0495607_0009429 | |||
| 2463 | Ga0495607_0010126 | |||
| 2464 | Ga0495607_0013887 | |||
| 2465 | Ga0495607_0020703 | |||
| 2466 | Ga0495607_0023824 | |||
| 2467 | Ga0495607_0027473 | |||
| 2468 | Ga0495607_0027597 | |||
| 2469 | Ga0495607_0032656 | |||
| 2470 | Ga0495607_0036551 | |||
| 2471 | Ga0495607_0047097 | |||
| 2472 | Ga0495607_0052257 | |||
| 2473 | Ga0495607_0071229 | |||
| 2474 | Ga0495607_0087140 | |||
| 2475 | Ga0495607_0105796 | |||
| 2476 | Ga0495607_0113072 | |||
| 2477 | Ga0495607_0124743 | |||
| 2478 | Ga0495607_0229300 | |||
| 2479 | Ga0495583_0000096 | |||
| 2480 | Ga0495583_0000174 | |||
| 2481 | Ga0495583_0002655 | |||
| 2482 | Ga0495583_0005999 | |||
| 2483 | Ga0495583_0006439 | |||
| 2484 | Ga0495583_0007722 | |||
| 2485 | Ga0495583_0007740 | |||
| 2486 | Ga0495583_0017638 | |||
| 2487 | Ga0495583_0021365 | |||
| 2488 | Ga0495583_0056286 | |||
| 2489 | Ga0495606_0002388 | |||
| 2490 | Ga0495606_0007622 | |||
| 2491 | Ga0495606_0008130 | |||
| 2492 | Ga0495606_0011278 | |||
| 2493 | Ga0495606_0013494 | |||
| 2494 | Ga0495606_0014237 | |||
| 2495 | Ga0495606_0025647 | |||
| 2496 | Ga0495606_0035068 | |||
| 2497 | Ga0495606_0062812 | |||
| 2498 | Ga0495606_0067153 | |||
| 2499 | Ga0495606_0154542 | |||
| 2500 | Ga0495606_0157725 | |||
| 2501 | Ga0495606_0339071 | |||
| 2502 | Ga0495606_0345354 | |||
| 2503 | Ga0495608_0008033 | |||
| 2504 | Ga0495610_0000793 | |||
| 2505 | Ga0495610_0011986 | |||
| 2506 | Ga0495610_0019717 | |||
| 2507 | Ga0495610_0021338 | |||
| 2508 | Ga0495610_0023286 | |||
| 2509 | Ga0495610_0025576 | |||
| 2510 | Ga0495610_0027599 | |||
| 2511 | Ga0495610_0036476 | |||
| 2512 | Ga0495610_0063291 | |||
| 2513 | Ga0495610_0065205 | |||
| 2514 | Ga0495610_0085897 | |||
| 2515 | Ga0495610_0115229 | |||
| 2516 | Ga0495610_0115843 | |||
| 2517 | Ga0495610_0127871 | |||
| 2518 | Ga0495616_0011878 | |||
| 2519 | Ga0495616_0015111 | |||
| 2520 | Ga0495616_0025697 | |||
| 2521 | Ga0495616_0026041 | |||
| 2522 | Ga0495616_0028635 | |||
| 2523 | Ga0495616_0058116 | |||
| 2524 | Ga0495616_0082227 | |||
| 2525 | Ga0495616_0095331 | |||
| 2526 | Ga0495618_0014135 | |||
| 2527 | Ga0495620_0000085 | |||
| 2528 | Ga0495620_0000306 | |||
| 2529 | Ga0495620_0006325 | |||
| 2530 | Ga0495620_0010688 | |||
| 2531 | Ga0495620_0012319 | |||
| 2532 | Ga0495620_0015484 | |||
| 2533 | Ga0495620_0018041 | |||
| 2534 | Ga0495620_0019621 | |||
| 2535 | Ga0495620_0027695 | |||
| 2536 | Ga0495628_0000076 | |||
| 2537 | Ga0495628_0011291 | |||
| 2538 | Ga0495628_0145649 | |||
| 2539 | Ga0495631_0002255 | |||
| 2540 | Ga0495631_0018449 | |||
| 2541 | Ga0495631_0018531 | |||
| 2542 | Ga0495631_0033479 | |||
| 2543 | Ga0495631_0084394 | |||
| 2544 | Ga0495631_0123550 | |||
| 2545 | Ga0495632_0000843 | |||
| 2546 | Ga0495632_0007773 | |||
| 2547 | Ga0495632_0015914 | |||
| 2548 | Ga0495632_0017927 | |||
| 2549 | Ga0495632_0020548 | |||
| 2550 | Ga0495632_0023533 | |||
| 2551 | Ga0495632_0025244 | |||
| 2552 | Ga0495632_0028338 | |||
| 2553 | Ga0495632_0052463 | |||
| 2554 | Ga0495632_0095995 | |||
| 2555 | Ga0495632_0102171 | |||
| 2556 | Ga0495632_0109272 | |||
| 2557 | Ga0495632_0139413 | |||
| 2558 | Ga0495637_0000301 | |||
| 2559 | Ga0495637_0000948 | |||
| 2560 | Ga0495637_0007787 | |||
| 2561 | Ga0495637_0009362 | |||
| 2562 | Ga0495637_0010322 | |||
| 2563 | Ga0495637_0015564 | |||
| 2564 | Ga0495637_0019071 | |||
| 2565 | Ga0495637_0020136 | |||
| 2566 | Ga0495637_0033696 | |||
| 2567 | Ga0495637_0035009 | |||
| 2568 | Ga0495637_0046098 | |||
| 2569 | Ga0495637_0050312 | |||
| 2570 | Ga0495637_0056721 | |||
| 2571 | Ga0495637_0062852 | |||
| 2572 | Ga0495637_0129753 | |||
| 2573 | Ga0495643_0000017 | |||
| 2574 | Ga0495643_0009169 | |||
| 2575 | Ga0495643_0024262 | |||
| 2576 | Ga0495643_0032085 | |||
| 2577 | Ga0495643_0092113 | |||
| 2578 | Ga0495643_0142913 | |||
| 2579 | Ga0495643_0163289 | |||
| 2580 | Ga0495643_0210030 | |||
| 2581 | Ga0495643_0293515 | |||
| 2582 | Ga0495644_0008107 | |||
| 2583 | Ga0495644_0010436 | |||
| 2584 | Ga0495644_0015458 | |||
| 2585 | Ga0495644_0018365 | |||
| 2586 | Ga0495648_0005408 | |||
| 2587 | Ga0495648_0006603 | |||
| 2588 | Ga0495648_0017221 | |||
| 2589 | Ga0495648_0018140 | |||
| 2590 | Ga0495648_0031268 | |||
| 2591 | Ga0495648_0039184 | |||
| 2592 | Ga0495648_0040940 | |||
| 2593 | Ga0495648_0042386 | |||
| 2594 | Ga0495648_0094394 | |||
| 2595 | Ga0495648_0103956 | |||
| 2596 | Ga0495648_0131601 | |||
| 2597 | Ga0495648_0167299 | |||
| 2598 | Ga0495648_0187893 | |||
| 2599 | Ga0495666_0003913 | |||
| 2600 | Ga0495666_0067328 | |||
| 2601 | Ga0495642_0003183 | |||
| 2602 | Ga0495642_0003695 | |||
| 2603 | Ga0495642_0048265 | |||
| 2604 | Ga0495652_0024033 | |||
| 2605 | Ga0495652_0048460 | |||
| 2606 | Ga0495652_0083701 | |||
| 2607 | Ga0495654_0000446 | |||
| 2608 | Ga0495654_0008111 | |||
| 2609 | Ga0495654_0011590 | |||
| 2610 | Ga0495654_0011680 | |||
| 2611 | Ga0495654_0013053 | |||
| 2612 | Ga0495654_0014627 | |||
| 2613 | Ga0495654_0017413 | |||
| 2614 | Ga0495654_0022733 | |||
| 2615 | Ga0495654_0022931 | |||
| 2616 | Ga0495654_0028942 | |||
| 2617 | Ga0495654_0031638 | |||
| 2618 | Ga0495654_0056740 | |||
| 2619 | Ga0495654_0080553 | |||
| 2620 | Ga0495654_0081388 | |||
| 2621 | Ga0495654_0094659 | |||
| 2622 | Ga0495654_0118859 | |||
| 2623 | Ga0495654_0126113 | |||
| 2624 | Ga0495654_0143185 | |||
| 2625 | Ga0495587_0014770 | |||
| 2626 | Ga0495609_0000012 | |||
| 2627 | Ga0495609_0000023 | |||
| 2628 | Ga0495609_0000088 | |||
| 2629 | Ga0495609_0000132 | |||
| 2630 | Ga0495609_0000649 | |||
| 2631 | Ga0495609_0007369 | |||
| 2632 | Ga0495609_0015268 | |||
| 2633 | Ga0495609_0028323 | |||
| 2634 | Ga0495609_0033448 | |||
| 2635 | Ga0495609_0087541 | |||
| 2636 | Ga0495609_0090652 | |||
| 2637 | Ga0495597_0000011 | |||
| 2638 | Ga0495597_0000185 | |||
| 2639 | Ga0495597_0001086 | |||
| 2640 | Ga0495597_0015149 | |||
| 2641 | Ga0495597_0016172 | |||
| 2642 | Ga0495597_0021177 | |||
| 2643 | Ga0495597_0028158 | |||
| 2644 | Ga0495597_0090729 | |||
| 2645 | Ga0495597_0120057 | |||
| 2646 | Ga0495597_0135545 | |||
| 2647 | Ga0495597_0151658 | |||
| 2648 | Ga0495645_0055410 | |||
| 2649 | Ga0495622_0011715 | |||
| 2650 | Ga0495622_0016547 | |||
| 2651 | Ga0495622_0020286 | |||
| 2652 | Ga0495622_0084911 | |||
| 2653 | Ga0495622_0101775 | |||
| 2654 | Ga0495633_0000034 | |||
| 2655 | Ga0495633_0009015 | |||
| 2656 | Ga0495633_0014506 | |||
| 2657 | Ga0495656_0003752 | |||
| 2658 | Ga0495656_0082991 | |||
| 2659 | Ga0495656_0114758 | |||
| 2660 | Ga0495668_0006815 | |||
| 2661 | Ga0495668_0016904 | |||
| 2662 | Ga0495668_0026872 | |||
| 2663 | Ga0495668_0086948 | |||
| 2664 | Ga0495668_0198571 | |||
| 2665 | Ga0495634_0016357 | |||
| 2666 | Ga0495634_0052805 | |||
| 2667 | Ga0495634_0126500 | |||
| 2668 | Ga0495611_0001661 | |||
| 2669 | Ga0495611_0004094 | |||
| 2670 | Ga0495611_0004457 | |||
| 2671 | Ga0495611_0082749 | |||
| 2672 | Ga0495611_0168905 | |||
| 2673 | Ga0495625_0000061 | |||
| 2674 | Ga0495625_0001913 | |||
| 2675 | Ga0495625_0012656 | |||
| 2676 | Ga0495625_0014555 | |||
| 2677 | Ga0495625_0038915 | |||
| 2678 | Ga0495625_0045837 | |||
| 2679 | Ga0495625_0201382 | |||
| 2680 | Ga0495625_0209300 | |||
| 2681 | Ga0495625_0230565 | |||
| 2682 | Ga0495635_0041374 | |||
| 2683 | Ga0495635_0155319 | |||
| 2684 | Ga0495659_0002669 | |||
| 2685 | Ga0495659_0077951 | |||
| 2686 | Ga0495661_0000004 | |||
| 2687 | Ga0495661_0000036 | |||
| 2688 | Ga0495661_0000060 | |||
| 2689 | Ga0495661_0000187 | |||
| 2690 | Ga0495661_0001218 | |||
| 2691 | Ga0495661_0002367 | |||
| 2692 | Ga0495661_0009192 | |||
| 2693 | Ga0495661_0048174 | |||
| 2694 | Ga0495661_0097426 | |||
| 2695 | Ga0495661_0140827 | |||
| 2696 | Ga0495661_0162307 | |||
| 2697 | Ga0495588_0158347 | |||
| 2698 | Ga0495588_0274324 | |||
| 2699 | Ga0495657_0100484 | |||
| 2700 | Ga0495657_0220054 | |||
| 2701 | Ga0495599_0034503 | |||
| 2702 | Ga0495623_0006955 | |||
| 2703 | Ga0495623_0039096 | |||
| 2704 | Ga0495646_0003698 | |||
| 2705 | Ga0495669_0008374 | |||
| 2706 | Ga0495613_0122405 | |||
| 2707 | Ga0495613_0415467 | |||
| 2708 | Ga0495624_0011454 | |||
| 2709 | Ga0495624_0020811 | |||
| 2710 | Ga0495624_0030721 | |||
| 2711 | Ga0495670_0024067 | |||
| 2712 | Ga0495670_0025848 | |||
| 2713 | Ga0495670_0032353 | |||
| 2714 | Ga0495670_0038481 | |||
| 2715 | Ga0495670_0056069 | |||
| 2716 | Ga0495670_0078241 | |||
| 2717 | Ga0495670_0244214 | |||
| 2718 | Ga0495670_0369036 | |||
| 2719 | Ga0495671_0000662 | |||
| 2720 | Ga0495671_0001738 | |||
| 2721 | Ga0495671_0001929 | |||
| 2722 | Ga0495671_0004125 | |||
| 2723 | Ga0495671_0023909 | |||
| 2724 | Ga0495671_0028439 | |||
| 2725 | Ga0495671_0028502 | |||
| 2726 | Ga0495671_0035860 | |||
| 2727 | Ga0495671_0054514 | |||
| 2728 | Ga0495671_0059564 | |||
| 2729 | Ga0495671_0060744 | |||
| 2730 | Ga0495671_0078233 | |||
| 2731 | Ga0495671_0086076 | |||
| 2732 | Ga0495671_0100340 | |||
| 2733 | Ga0495671_0125138 | |||
| 2734 | Ga0495671_0144353 | |||
| 2735 | Ga0495649_0007545 | |||
| 2736 | Ga0495649_0013292 | |||
| 2737 | Ga0495649_0015889 | |||
| 2738 | Ga0495649_0023844 | |||
| 2739 | Ga0495649_0030657 | |||
| 2740 | Ga0495649_0056291 | |||
| 2741 | Ga0495649_0064754 | |||
| 2742 | Ga0495649_0072808 | |||
| 2743 | Ga0495649_0078469 | |||
| 2744 | Ga0495649_0080867 | |||
| 2745 | Ga0495649_0096429 | |||
| 2746 | Ga0495649_0104176 | |||
| 2747 | Ga0495589_0003318 | |||
| 2748 | Ga0495589_0010874 | |||
| 2749 | Ga0495589_0021478 | |||
| 2750 | Ga0495589_0022326 | |||
| 2751 | Ga0495589_0082550 | |||
| 2752 | Ga0495589_0231540 | |||
| 2753 | Ga0495600_0003938 | |||
| 2754 | Ga0495600_0179248 | |||
| 2755 | Ga0495600_0185820 | |||
| 2756 | Ga0495600_0204923 | |||
| 2757 | Ga0495660_0003401 | |||
| 2758 | Ga0495660_0003415 | |||
| 2759 | Ga0495660_0011226 | |||
| 2760 | Ga0495660_0026559 | |||
| 2761 | Ga0495660_0028351 | |||
| 2762 | Ga0495660_0028386 | |||
| 2763 | Ga0495660_0038247 | |||
| 2764 | Ga0495660_0050839 | |||
| 2765 | Ga0495660_0053651 | |||
| 2766 | Ga0495660_0065478 | |||
| 2767 | Ga0495660_0089028 | |||
| 2768 | Ga0495660_0097599 | |||
| 2769 | Ga0495660_0160907 | |||
| 2770 | Ga0495660_0176078 | |||
| 2771 | Ga0495660_0210676 | |||
| 2772 | Ga0495604_0000948 | |||
| 2773 | Ga0495604_0050468 | |||
| 2774 | Ga0495604_0094930 | |||
| 2775 | Ga0495604_0182182 | |||
| 2776 | Ga0495604_0218715 | |||
| 2777 | Ga0495636_0011170 | |||
| 2778 | Ga0495674_0093556 | |||
| 2779 | Ga0495672_0006253 | |||
| 2780 | Ga0495672_0007817 | |||
| 2781 | Ga0495672_0008177 | |||
| 2782 | Ga0495672_0010931 | |||
| 2783 | Ga0495672_0013983 | |||
| 2784 | Ga0495672_0017033 | |||
| 2785 | Ga0495672_0017358 | |||
| 2786 | Ga0495672_0018955 | |||
| 2787 | Ga0495672_0025697 | |||
| 2788 | Ga0495672_0032878 | |||
| 2789 | Ga0495672_0036278 | |||
| 2790 | Ga0495672_0037415 | |||
| 2791 | Ga0495672_0040141 | |||
| 2792 | Ga0495672_0042164 | |||
| 2793 | Ga0495672_0072442 | |||
| 2794 | Ga0495672_0088004 | |||
| 2795 | Ga0495672_0100895 | |||
| 2796 | Ga0495672_0108685 | |||
| 2797 | Ga0495672_0165702 | |||
| 2798 | Ga0495672_0242159 | |||
| 2799 | Ga0495676_0000011 | |||
| 2800 | Ga0495676_0020361 | |||
| 2801 | Ga0495676_0173689 | |||
| 2802 | Ga0495680_0055612 | |||
| 2803 | Ga0495680_0342418 | |||
| 2804 | Ga0495683_0000028 | |||
| 2805 | Ga0495683_0000034 | |||
| 2806 | Ga0495683_0000070 | |||
| 2807 | Ga0495683_0017499 | |||
| 2808 | Ga0495683_0022075 | |||
| 2809 | Ga0495683_0057785 | |||
| 2810 | Ga0495687_006777 | |||
| 2811 | Ga0495687_008366 | |||
| 2812 | Ga0495687_008443 | |||
| 2813 | Ga0495675_0039511 | |||
| 2814 | Ga0495677_0019091 | |||
| 2815 | Ga0495677_0093214 | |||
| 2816 | Ga0495679_000028 | |||
| 2817 | Ga0495679_000370 | |||
| 2818 | Ga0495679_004083 | |||
| 2819 | Ga0495679_013446 | |||
| 2820 | Ga0495679_031520 | |||
| 2821 | Ga0495679_054703 | |||
| 2822 | Ga0495679_059342 | |||
| 2823 | Ga0495673_0002589 | |||
| 2824 | Ga0495673_0004790 | |||
| 2825 | Ga0495673_0005801 | |||
| 2826 | Ga0495673_0015551 | |||
| 2827 | Ga0495673_0015946 | |||
| 2828 | Ga0495673_0016029 | |||
| 2829 | Ga0495673_0017738 | |||
| 2830 | Ga0495673_0018232 | |||
| 2831 | Ga0495673_0023496 | |||
| 2832 | Ga0495673_0025842 | |||
| 2833 | Ga0495673_0029397 | |||
| 2834 | Ga0495673_0035779 | |||
| 2835 | Ga0495673_0040254 | |||
| 2836 | Ga0495673_0049794 | |||
| 2837 | Ga0495673_0050604 | |||
| 2838 | Ga0495673_0057994 | |||
| 2839 | Ga0495673_0064001 | |||
| 2840 | Ga0495673_0076174 | |||
| 2841 | Ga0495673_0088590 | |||
| 2842 | Ga0495673_0115752 | |||
| 2843 | Ga0495673_0125643 | |||
| 2844 | Ga0495673_0141971 | |||
| 2845 | Ga0495673_0174170 | |||
| 2846 | Ga0495681_0008476 | |||
| 2847 | Ga0495681_0019090 | |||
| 2848 | Ga0495681_0021856 | |||
| 2849 | Ga0495681_0022771 | |||
| 2850 | Ga0495681_0024639 | |||
| 2851 | Ga0495681_0027271 | |||
| 2852 | Ga0495681_0031133 | |||
| 2853 | Ga0495681_0041865 | |||
| 2854 | Ga0495681_0045559 | |||
| 2855 | Ga0495681_0059234 | |||
| 2856 | Ga0495681_0062733 | |||
| 2857 | Ga0495681_0071169 | |||
| 2858 | Ga0495681_0110542 | |||
| 2859 | Ga0495681_0151488 | |||
| 2860 | Ga0495684_0095672 | |||
| 2861 | Ga0495686_0104090 | |||
| 2862 | Ga0495686_0113864 | |||
| 2863 | Ga0495686_0142235 | |||
| 2864 | Ga0495686_0148283 | |||
| 2865 | Ga0495593_0078652 | |||
| 2866 | Ga0495593_0127608 | |||
| 2867 | Ga0495593_0135498 | |||
| 2868 | Ga0495602_0009002 | |||
| 2869 | Ga0495602_0376219 | |||
| 2870 | Ga0495626_0000024 | |||
| 2871 | Ga0495626_0006473 | |||
| 2872 | Ga0495626_0007135 | |||
| 2873 | Ga0495626_0016350 | |||
| 2874 | Ga0495626_0022425 | |||
| 2875 | Ga0495626_0044773 | |||
| 2876 | Ga0495626_0052961 | |||
| 2877 | Ga0495626_0070204 | |||
| 2878 | Ga0495626_0076772 | |||
| 2879 | Ga0496100_0039148 | |||
| 2880 | Ga0496101_0009650 | |||
| 2881 | Ga0496102_0004242 | |||
| 2882 | Ga0496102_0004534 | |||
| 2883 | Ga0496103_0013210 | |||
| 2884 | Ga0496104_0137938 | |||
| 2885 | Ga0496105_0002236 | |||
| 2886 | Ga0496106_0011540 | |||
| 2887 | Ga0496107_0315144 | |||
| 2888 | Ga0496110_0038468 | |||
| 2889 | Ga0496110_0195940 | |||
| 2890 | Ga0496111_0187292 | |||
| 2891 | Ga0496112_0441141 | |||
| 2892 | Ga0496112_0569987 | |||
| 2893 | Ga0496114_0002270 | |||
| 2894 | Ga0496114_0102391 | |||
| 2895 | Ga0496116_0001954 | |||
| 2896 | Ga0496116_0006985 | |||
| 2897 | Ga0496116_0020749 | |||
| 2898 | Ga0496116_0022501 | |||
| 2899 | Ga0496116_0029771 | |||
| 2900 | Ga0496116_0041683 | |||
| 2901 | Ga0496116_0065419 | |||
| 2902 | Ga0496116_0117438 | |||
| 2903 | Ga0496116_0135888 | |||
| 2904 | Ga0496116_0138478 | |||
| 2905 | Ga0496117_0004774 | |||
| 2906 | Ga0496117_0012455 | |||
| 2907 | Ga0496117_0029302 | |||
| 2908 | Ga0496117_0087048 | |||
| 2909 | Ga0496117_0124601 | |||
| 2910 | Ga0496117_0147306 | |||
| 2911 | Ga0496117_0159215 | |||
| 2912 | Ga0496118_0014455 | |||
| 2913 | Ga0496118_0073811 | |||
| 2914 | Ga0496118_0095396 | |||
| 2915 | Ga0496118_0110003 | |||
| 2916 | Ga0496118_0141186 | |||
| 2917 | Ga0496118_0182613 | |||
| 2918 | Ga0496118_0206247 | |||
| 2919 | Ga0496119_0052709 | |||
| 2920 | Ga0496119_0191494 | |||
| 2921 | Ga0496120_0005221 | |||
| 2922 | Ga0496120_0015311 | |||
| 2923 | Ga0496121_0001365 | |||
| 2924 | Ga0496121_0013843 | |||
| 2925 | Ga0496121_0015990 | |||
| 2926 | Ga0496121_0016038 | |||
| 2927 | Ga0496121_0017647 | |||
| 2928 | Ga0496121_0043798 | |||
| 2929 | Ga0496121_0086255 | |||
| 2930 | Ga0496121_0096435 | |||
| 2931 | Ga0496121_0155626 | |||
| 2932 | Ga0496121_0221953 | |||
| 2933 | Ga0496121_0300223 | |||
| 2934 | Ga0496121_0484260 | |||
| 2935 | Ga0496122_0000449 | |||
| 2936 | Ga0496122_0000616 | |||
| 2937 | Ga0496122_0000669 | |||
| 2938 | Ga0496122_0001392 | |||
| 2939 | Ga0496122_0003626 | |||
| 2940 | Ga0496122_0011766 | |||
| 2941 | Ga0496122_0020263 | |||
| 2942 | Ga0496122_0038861 | |||
| 2943 | Ga0496122_0071453 | |||
| 2944 | Ga0496122_0123299 | |||
| 2945 | Ga0496122_0127065 | |||
| 2946 | Ga0496123_0000263 | |||
| 2947 | Ga0496123_0000632 | |||
| 2948 | Ga0496123_0000977 | |||
| 2949 | Ga0496123_0001569 | |||
| 2950 | Ga0496123_0008524 | |||
| 2951 | Ga0496123_0065943 | |||
| 2952 | Ga0496123_0067508 | |||
| 2953 | Ga0496123_0071585 | |||
| 2954 | Ga0496123_0090133 | |||
| 2955 | Ga0496124_0000073 | |||
| 2956 | Ga0496124_0007897 | |||
| 2957 | Ga0496124_0015211 | |||
| 2958 | Ga0496124_0015525 | |||
| 2959 | Ga0496124_0050107 | |||
| 2960 | Ga0496124_0081214 | |||
| 2961 | Ga0496124_0087475 | |||
| 2962 | Ga0496124_0174404 | |||
| 2963 | Ga0496124_0381807 | |||
| 2964 | Ga0496125_0000168 | |||
| 2965 | Ga0496125_0000319 | |||
| 2966 | Ga0496125_0000947 | |||
| 2967 | Ga0496125_0003314 | |||
| 2968 | Ga0496125_0005089 | |||
| 2969 | Ga0496125_0005136 | |||
| 2970 | Ga0496125_0026564 | |||
| 2971 | Ga0496125_0037898 | |||
| 2972 | Ga0496125_0046824 | |||
| 2973 | Ga0496125_0057758 | |||
| 2974 | Ga0496125_0062306 | |||
| 2975 | Ga0496125_0211080 | |||
| 2976 | Ga0496126_0023661 | |||
| 2977 | Ga0496126_0024217 | |||
| 2978 | Ga0496126_0086476 | |||
| 2979 | Ga0496126_0101023 | |||
| 2980 | Ga0496126_0150981 | |||
| 2981 | Ga0496126_0226004 | |||
| 2982 | Ga0496126_0248988 | |||
| 2983 | Ga0496126_0360461 | |||
| 2984 | Ga0495678_000049 | |||
| 2985 | Ga0495678_000160 | |||
| 2986 | Ga0495678_009421 | |||
| 2987 | Ga0495678_013793 | |||
| 2988 | Ga0495678_018525 | |||
| 2989 | Ga0495678_018970 | |||
| 2990 | Ga0495678_020127 | |||
| 2991 | Ga0495678_021976 | |||
| 2992 | Ga0495678_025529 | |||
| 2993 | Ga0495678_026414 | |||
| 2994 | Ga0495678_053864 | |||
| 2995 | Ga0495678_060446 | |||
| 2996 | Ga0495678_102818 | |||
| 2997 | Ga0495682_0000090 | |||
| 2998 | Ga0495682_0001506 | |||
| 2999 | Ga0495682_0028204 | |||
| 3000 | Ga0495682_0040104 | |||
| 3001 | Ga0495682_0087915 | |||
| 3002 | Ga0501238_007309 | |||
| 3003 | Ga0501241_022199 | |||
| 3004 | nmdc:mga00v17_11469_c1 | |||
| 3005 | nmdc:mga00v17_188609_c1 | |||
| 3006 | nmdc:mga00v17_50346_c1 | |||
| 3007 | nmdc:mga0yw44_249364_c1 | |||
| 3008 | nmdc:mga0k408_184357_c1 | |||
| 3009 | nmdc:mga0k408_198142_c1 | |||
| 3010 | nmdc:mga0k408_2992_c1 | |||
| 3011 | nmdc:mga06z11_105374_c1 | |||
| 3012 | nmdc:mga08x19_251483_c1 | |||
| 3013 | nmdc:mga08x19_355381_c1 | |||
| 3014 | Ga0495601_0019812 | |||
| 3015 | Ga0500646_0000914 | |||
| 3016 | Ga0500583_0006260 | |||
| 3017 | Ga0500583_0179503 | |||
| 3018 | Ga0500641_0022457 | |||
| 3019 | Ga0500650_0065649 | |||
| 3020 | Ga0500594_0011721 | |||
| 3021 | Ga0500595_001205 | |||
| 3022 | Ga0500618_023789 | |||
| 3023 | Ga0500618_025568 | |||
| 3024 | Ga0500655_004044 | |||
| 3025 | Ga0500559_0000578 | |||
| 3026 | Ga0500573_0034392 | |||
| 3027 | Ga0500586_056689 | |||
| 3028 | Ga0500604_0003723 | |||
| 3029 | Ga0500619_003230 | |||
| 3030 | 2511249605 | |||
| 3031 | 2511254814 | |||
| 3032 | 2511266028 | |||
| 3033 | 2511273340 | |||
| 3034 | 2511275051 | |||
| 3035 | 2511288501 | |||
| 3036 | 2511297998 | |||
| 3037 | 2511303991 | |||
| 3038 | 2511311963 | |||
| 3039 | 2511320679 | |||
| 3040 | 2511327969 | |||
| 3041 | 2511329712 | |||
| 3042 | 2511335884 | |||
| 3043 | 2511344754 | |||
| 3044 | 2511349517 | |||
| 3045 | 2511360140 | |||
| 3046 | 2511365982 | |||
| 3047 | 2511368993 | |||
| 3048 | 2511384059 | |||
| 3049 | 2511412133 | |||
| 3050 | 2511827682 | |||
| 3051 | 2512037785 | |||
| 3052 | 2512326631 | |||
| 3053 | 2514045004 | |||
| 3054 | 2514045247 | |||
| 3055 | 2514045305 | |||
| 3056 | 2521560192 | |||
| 3057 | 2550695313 | |||
| 3058 | 2550695898 | |||
| 3059 | 2553004989 | |||
| 3060 | 2574431087 | |||
| 3061 | 2583795681 | |||
| 3062 | 2597860925 | |||
| 3063 | 2597866672 | |||
| 3064 | 2597872530 | |||
| 3065 | 2599327552 | |||
| 3066 | 2599400495 | |||
| 3067 | 2599449819 | |||
| 3068 | 2599485840 | |||
| 3069 | 2599500304 | |||
| 3070 | 2599505792 | |||
| 3071 | 2599511893 | |||
| 3072 | 2599516877 | |||
| 3073 | 2599614472 | |||
| 3074 | 2599768102 | |||
| 3075 | 2599804620 | |||
| 3076 | 2599879080 | |||
| 3077 | 2599885538 | |||
| 3078 | 2599892745 | |||
| 3079 | 2599897252 | |||
| 3080 | 2599902896 | |||
| 3081 | 2599930673 | |||
| 3082 | 2599942311 | |||
| 3083 | 2599951494 | |||
| 3084 | 2599954276 | |||
| 3085 | 2599961961 | |||
| 3086 | 2599965984 | |||
| 3087 | 2599972351 | |||
| 3088 | 2599977966 | |||
| 3089 | 2599982881 | |||
| 3090 | 2599988369 | |||
| 3091 | 2599994030 | |||
| 3092 | 2599999164 | |||
| 3093 | 2600004265 | |||
| 3094 | 2600012133 | |||
| 3095 | 2600020445 | |||
| 3096 | 2600026302 | |||
| 3097 | 2600032047 | |||
| 3098 | 2600036015 | |||
| 3099 | 2600044580 | |||
| 3100 | 2600046695 | |||
| 3101 | 2600054877 | |||
| 3102 | 2600061090 | |||
| 3103 | 2600068003 | |||
| 3104 | 2600071912 | |||
| 3105 | 2600076500 | |||
| 3106 | 2600358950 | |||
| 3107 | 2600363506 | |||
| 3108 | 2600444136 | |||
| 3109 | 2601627449 | |||
| 3110 | 2601693403 | |||
| 3111 | 2601798521 | |||
| 3112 | 2602008386 | |||
| 3113 | 2606077415 | |||
| 3114 | 2606129339 | |||
| 3115 | 2621296804 | |||
| 3116 | 2624483451 | |||
| 3117 | 2624494976 | |||
| 3118 | 2643843003 | |||
| 3119 | 2643861719 | |||
| 3120 | 2643872308 | |||
| 3121 | 2643955591 | |||
| 3122 | 2644020385 | |||
| 3123 | 2644028505 | |||
| 3124 | 2644184440 | |||
| 3125 | 2644246219 | |||
| 3126 | 2644283185 | |||
| 3127 | 2644624726 | |||
| 3128 | 2652546691 | |||
| 3129 | 2671089598 | |||
| 3130 | 2671128545 | |||
| 3131 | 2671771627 | |||
| 3132 | 2677897174 | |||
| 3133 | 2678266191 | |||
| 3134 | 2715749791 | |||
| 3135 | 2715754809 | |||
| 3136 | 2718636656 | |||
| 3137 | 2723251408 | |||
| 3138 | 2723876522 | |||
| 3139 | 2738671624 | |||
| 3140 | 2738690393 | |||
| 3141 | 2738750018 | |||
| 3142 | 2738807296 | |||
| 3143 | 2738859058 | |||
| 3144 | 2738894656 | |||
| 3145 | 2739199100 | |||
| 3146 | 2739252448 | |||
| 3147 | 2739259039 | |||
| 3148 | 2739266167 | |||
| 3149 | 2739289968 | |||
| 3150 | 2739295280 | |||
| 3151 | 2739312464 | |||
| 3152 | 2743740465 | |||
| 3153 | 2745007423 | |||
| 3154 | 2765571360 | |||
| 3155 | 2774118335 | |||
| 3156 | 2774135524 | |||
| 3157 | 2784261773 | |||
| 3158 | 2784313616 | |||
| 3159 | 2794593797 | |||
| 3160 | 2807408848 | |||
| 3161 | 2807457179 | |||
| 3162 | 2808855656 | |||
| 3163 | 2808926782 | |||
| 3164 | 2808928401 | |||
| 3165 | 2808935507 | |||
| 3166 | 2808948943 | |||
| 3167 | 2808950416 | |||
| 3168 | 2808959798 | |||
| 3169 | 2808964115 | |||
| 3170 | 2808976190 | |||
| 3171 | 2808982470 | |||
| 3172 | 2808994346 | |||
| 3173 | 2808999049 | |||
| 3174 | 2809033228 | |||
| 3175 | 2809129703 | |||
| 3176 | 2809149242 | |||
| 3177 | 2809217227 | |||
| 3178 | 2817494083 | |||
| 3179 | 2819543929 | |||
| 3180 | 2819592889 | |||
| 3181 | 2819592919 | |||
| 3182 | 2819616549 | |||
| 3183 | 2819655175 | |||
| 3184 | 2823425757 | |||
| 3185 | 2825655053 | |||
| 3186 | 2826581861 | |||
| 3187 | 2834030994 | |||
| 3188 | 2839099201 | |||
| 3189 | 2842735689 | |||
| 3190 | 2842749122 | |||
| 3191 | 2842805863 | |||
| 3192 | 2842816885 | |||
| 3193 | 2842831245 | |||
| 3194 | 2842833498 | |||
| 3195 | 2842837941 | |||
| 3196 | 2842845728 | |||
| 3197 | 2842854151 | |||
| 3198 | 2842855665 | |||
| 3199 | 2844667141 | |||
| 3200 | 2852616393 | |||
| 3201 | 2852619383 | |||
| 3202 | 2852659721 | |||
| 3203 | 2852671361 | |||
| 3204 | 2855732747 | |||
| 3205 | 2855771499 | |||
| 3206 | 2857553213 | |||
| 3207 | 2857577578 | |||
| 3208 | 2860341759 | |||
| 3209 | 2860873068 | |||
| 3210 | 2878035392 | |||
| 3211 | 2880236039 | |||
| 3212 | 2881415543 | |||
| 3213 | 2884813274 | |||
| 3214 | 2884838572 | |||
| 3215 | 2884854863 | |||
| 3216 | 2885195978 | |||
| 3217 | 2891634427 | |||
| 3218 | 2896156468 | |||
| 3219 | 2897806768 | |||
| 3220 | 2904435818 | |||
| 3221 | 2904440767 | |||
| 3222 | 2904480751 | |||
| 3223 | 2904518915 | |||
| 3224 | 2904535366 | |||
| 3225 | 2904551402 | |||
| 3226 | 2904588486 | |||
| 3227 | 2904594626 | |||
| 3228 | 2904605858 | |||
| 3229 | 2908452628 | |||
| 3230 | 2913042572 | |||
| 3231 | 2919048933 | |||
| 3232 | 2919065477 | |||
| 3233 | 2919084835 | |||
| 3234 | 2919389152 | |||
| 3235 | 2919485699 | |||
| 3236 | 2919488128 | |||
| 3237 | 2919502515 | |||
| 3238 | 2919700532 | |||
| 3239 | 2923159558 | |||
| 3240 | 2923513938 | |||
| 3241 | 2923589041 | |||
| 3242 | 2926064188 | |||
| 3243 | 2928134200 | |||
| 3244 | 2929149961 | |||
| 3245 | 2929195192 | |||
| 3246 | 2931372598 | |||
| 3247 | 2931396457 | |||
| 3248 | 2931398122 | |||
| 3249 | 2939640764 | |||
| 3250 | 2941482521 | |||
| 3251 | 2945930873 | |||
| 3252 | 2945966903 | |||
| 3253 | 2946013238 | |||
| 3254 | 2946027945 | |||
| 3255 | 2947234470 | |||
| 3256 | 2969310216 | |||
| 3257 | 2974294041 | |||
| 3258 | 2984286556 | |||
| 3259 | 2988731498 | |||
| 3260 | 2998145438 | |||
| 3261 | 2998344656 | |||
| 3262 | 3007399357 | |||
| 3263 | 3007425770 | |||
| 3264 | 3007517224 | |||
| 3265 | 3007618865 | |||
| 3266 | 3007721799 | |||
| 3267 | 3007859231 | |||
| 3268 | 3007865065 | |||
| 3269 | 3007866742 | |||
| 3270 | 3007872938 | |||
| 3271 | 639787418 | |||
| 3272 | 8015693656 | |||
| 3273 | 8019777639 | |||
| 3274 | 8029995466 | |||
| 3275 | 8034965083 | |||
| 3276 | 8054007067 | |||
| 3277 | 8054285680 | |||
| 3278 | 8054349543 | |||
| 3279 | 8054508978 | |||
| 3280 | 8054931855 | |||
| 3281 | 8055776903 | |||
| 3282 | 8055823949 | |||
| 3283 | 8056131647 | |||
| 3284 | 8056137353 | |||
| 3285 | 8056140402 | |||
| 3286 | 8056148814 | |||
| 3287 | 8056151450 | |||
| 3288 | 8056159743 | |||
| 3289 | 8056163670 | |||
| 3290 | 8056171269 | |||
| 3291 | 8056182039 | |||
| 3292 | 8056570507 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
56
235
0.93
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8402 | 4 | 216 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8332 | 4 | 216 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7206 | 16 | 206 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7106 | 14 | 215 |
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.6899 | 20 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52094_1_222_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8469 | 15 | 215 | 1.10.3720.10 |
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8428 | 4 | 215 | 1.10.3720.10 |
| af_P0AE34_6_232_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8308 | 17 | 215 | 1.10.3720.10 |
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8288 | 4 | 215 | 1.10.3720.10 |
| af_P45767_178_390_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8198 | 85 | 215 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A430DZQ7-F1-model_v4 | ABC transporter permease subunit | 0.8848 | 1 | 218 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A3S4MXR4-F1-model_v4 | AcnD | 0.8834 | 1 | 215 |
GO:0016829
GO:0022857 GO:0043190 |
| AF-A0A1Y0L479-F1-model_v4 | ABC transporter | 0.8833 | 1 | 218 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A502SB01-F1-model_v4 | Amino acid ABC transporter permease | 0.8832 | 1 | 217 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A7Z2NYA0-F1-model_v4 | ABC transporter permease subunit | 0.8822 | 1 | 218 |
GO:0006865
GO:0022857 GO:0043190 |