F495183

General Info

Members Datasets Scaffolds Average Seq Length
1646 630 3292 218

Family's Representative Sequence

Representative Sequence 3300003751|Ga0055538_1000229|Ga0055538_100022917
Length 244
Sequence MEATAGAGGQPGSTRQGTHDIMAYQFDFLSTFDYSDVIVKGVLTTIELIAIGGVLGVAVGIFGAWARSQGPGWLKPIVSGYVEIIRNTPFLVQLFFIFFGLPSLDIHISEIAAAILAMVINLGAYSTEIIRAGVQAIPRGQIEAAQSLSMSRMQIFRHIILRPALQKIWPALSSQVVIVMLGSAVCSQIAVEELSFAANFIQGRNFRAFEAYIVATLIYLVLAVLLRQVLRLIGHYFITARRTA

Samples

Sample ID Description Type Environment
1 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
87 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
206 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
209 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
210 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
211 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
212 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
215 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
216 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
217 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
218 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
219 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
220 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
221 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
222 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
245 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
318 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
351 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
352 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
356 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
360 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
369 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
372 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
373 2511231004 Pseudomonas sp. GM102 Isolate Nodule
374 2511231006 Pseudomonas sp. GM17 Isolate Nodule
375 2511231007 Pseudomonas sp. GM18 Isolate Nodule
376 2511231008 Pseudomonas sp. GM21 Isolate Nodule
377 2511231010 Pseudomonas sp. GM25 Isolate Nodule
378 2511231011 Pseudomonas sp. GM30 Isolate Nodule
379 2511231012 Pseudomonas sp. GM33 Isolate Nodule
380 2511231014 Pseudomonas sp. GM48 Isolate Nodule
381 2511231015 Pseudomonas sp. GM49 Isolate Nodule
382 2511231016 Pseudomonas sp. GM50 Isolate Nodule
383 2511231017 Pseudomonas sp. GM55 Isolate Nodule
384 2511231018 Pseudomonas sp. GM60 Isolate Nodule
385 2511231019 Pseudomonas sp. GM67 Isolate Nodule
386 2511231020 Pseudomonas sp. GM74 Isolate Nodule
387 2511231021 Pseudomonas sp. GM78 Isolate Nodule
388 2511231022 Pseudomonas sp. GM79 Isolate Nodule
389 2511231023 Pseudomonas sp. GM80 Isolate Nodule
390 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
391 2511231031 Pseudomonas sp. GM16 Isolate Nodule
392 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
393 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
394 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
395 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
396 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
397 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
398 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
399 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
400 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
401 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
402 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
403 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
404 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
405 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
406 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
407 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
408 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
409 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
410 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
411 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
412 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
413 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
414 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
415 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
416 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
417 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
418 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
419 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
420 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
421 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
422 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
423 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
424 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
425 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
426 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
427 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
428 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
429 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
430 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
431 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
432 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
433 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
434 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
435 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
436 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
437 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
438 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
439 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
440 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
441 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
442 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
443 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
444 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
445 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
446 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
447 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
448 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
449 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
450 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
451 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
452 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
453 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
454 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
455 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
456 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
457 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
458 2643221569 Achromobacter sp. Root565 Isolate Unclassified
459 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
460 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
461 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
462 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
463 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
464 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
465 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
466 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
467 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
468 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
469 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
470 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
471 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
472 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
473 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
474 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
475 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
476 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
477 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
478 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
479 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
480 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
481 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
482 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
483 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
484 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
485 2738543013 Variovorax sp. BT01 Isolate Unclassified
486 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
487 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
488 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
489 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
490 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
491 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
492 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
493 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
494 2773857670 Pseudomonas sp. 478 Isolate Unclassified
495 2773857673 Pseudomonas sp. 443 Isolate Unclassified
496 2784132063 Pseudomonas sp. 424 Isolate Unclassified
497 2784132072 Pseudomonas sp. 460 Isolate Unclassified
498 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
499 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
500 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
501 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
502 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
503 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
504 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
505 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
506 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
507 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
508 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
509 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
510 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
511 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
512 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
513 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
514 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
515 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
516 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
517 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
518 2818991436 Collimonas arenae 515 Isolate Unclassified
519 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
520 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
521 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
522 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
523 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
524 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
525 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
526 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
527 2842733646 Variovorax sp. R-72446 Isolate Unclassified
528 2842747753 Variovorax sp. R-72060 Isolate Unclassified
529 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
530 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
531 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
532 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
533 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
534 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
535 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
536 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
537 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
538 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
539 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
540 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
541 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
542 2855730933 Achromobacter sp. HZ28 Isolate Nodule
543 2855767633 Achromobacter sp. HZ34 Isolate Nodule
544 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
545 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
546 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
547 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
548 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
549 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
550 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
551 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
552 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
553 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
554 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
555 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
556 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
557 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
558 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
559 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
560 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
561 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
562 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
563 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
564 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
565 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
566 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
567 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
568 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
569 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
570 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
571 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
572 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
573 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
574 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
575 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
576 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
577 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
578 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
579 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
580 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
581 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
582 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
583 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
584 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
585 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
586 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
587 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
588 2941479691
589 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
590 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
591 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
592 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
593 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
594 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
595 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
596 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
597 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
598 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
599 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
600 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
601 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
602 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
603 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
604 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
605 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
606 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
607 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
608 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
609 639633007 Azoarcus olearius BH72 Isolate Unclassified
610 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
611 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
612 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
613 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
614 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
615 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
616 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
617 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
618 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
619 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
620 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
621 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
622 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
623 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
624 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
625 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
626 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
627 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
628 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
629 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
630 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.02
Metatranscriptomes 0
Isolates 15.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.84
Nodule 2.49
Rhizoplane 4.25
Rhizosphere 69.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000229 3300003751 Bacteria 31274
2 MRS2a_Contig_718 2124908027 Bacteria 55855
3 SwRhRL2b_contig_3259057 2162886007 Bacteria 954
4 JGI24741J21665_1006777 3300001915 Bacteria 2272
5 JGI25155J39150_1000370 3300002704 Bacteria 13442
6 JGI25155J39150_1000428 3300002704 Bacteria 11253
7 JGI25155J39150_1000795 3300002704 Bacteria 5027
8 JGI25155J39150_1001260 3300002704 Bacteria 2038
9 JGI25156J39149_1000117 3300002705 Bacteria 57700
10 JGI25156J39149_1000989 3300002705 Bacteria 13442
11 JGI25156J39149_1002357 3300002705 Bacteria 6870
12 JGI25162J39368_1000001 3300002737 Bacteria 740113
13 JGI25162J39368_1000378 3300002737 Bacteria 37854
14 JGI25162J39368_1004300 3300002737 Bacteria 3396
15 JGI25162J39368_1004556 3300002737 Bacteria 3157
16 JGI25154J39366_1000107 3300002738 Bacteria 73482
17 JGI25154J39366_1000249 3300002738 Bacteria 34973
18 JGI25154J39366_1000826 3300002738 Bacteria 13442
19 JGI25154J39366_1004380 3300002738 Bacteria 2555
20 JGI25157J39369_1000966 3300002741 Bacteria 13433
21 JGI25157J39369_1001016 3300002741 Bacteria 13010
22 JGI25163J39215_1001139 3300002771 Bacteria 5240
23 JGI25164J39214_1000273 3300002772 Bacteria 37854
24 JGI25151J46595_10001598 3300003187 Bacteria 15033
25 JGI25151J46595_10001939 3300003187 Bacteria 13112
26 JGI25165J46597_1000001 3300003214 Bacteria 1111887
27 JGI25165J46597_1000498 3300003214 Bacteria 37854
28 rootH2_10020080 3300003320 Bacteria 1260
29 rootL2_10082487 3300003322 Bacteria 5783
30 Ga0055538_1000001 3300003751 Bacteria 1111887
31 Ga0055538_1000032 3300003751 Bacteria 199718
32 Ga0055539_1000001 3300003752 Bacteria 1111887
33 Ga0055539_1000043 3300003752 Bacteria 199718
34 Ga0055539_1000269 3300003752 Bacteria 31274
35 Ga0055533_1000003 3300003756 Bacteria 1111887
36 Ga0055533_1000052 3300003756 Bacteria 199718
37 Ga0055533_1000258 3300003756 Bacteria 31274
38 Ga0055532_1000044 3300003758 Bacteria 191110
39 Ga0055532_1000047 3300003758 Bacteria 179201
40 Ga0055532_1000647 3300003758 Bacteria 13442
41 Ga0055525_1000003 3300003759 Bacteria 962094
42 Ga0055525_1000062 3300003759 Bacteria 199718
43 Ga0055525_1000359 3300003759 Bacteria 31274
44 Ga0055535_1002174 3300003761 Bacteria 7556
45 Ga0055535_1006556 3300003761 Bacteria 2336
46 Ga0055529_1008064 3300003763 Bacteria 1409
47 Ga0055526_1002434 3300003771 Bacteria 12611
48 Ga0055524_1000061 3300003775 Bacteria 135241
49 Ga0055536_1000081 3300003781 Bacteria 81966
50 Ga0055536_1000201 3300003781 Bacteria 48808
51 Ga0055536_1000704 3300003781 Bacteria 22401
52 Ga0055536_1011459 3300003781 Bacteria 3399
53 Ga0055534_1000104 3300003784 Bacteria 64767
54 Ga0055534_1000470 3300003784 Bacteria 22861
55 Ga0055530_10000324 3300003791 Bacteria 43140
56 Ga0055530_10000800 3300003791 Bacteria 26158
57 Ga0055530_10001011 3300003791 Bacteria 22475
58 Ga0055530_10001044 3300003791 Bacteria 22066
59 Ga0055530_10003143 3300003791 Bacteria 9737
60 Ga0055540_1000026 3300003792 Bacteria 189071
61 Ga0055540_1000745 3300003792 Bacteria 22100
62 Ga0055540_1003757 3300003792 Bacteria 7161
63 Ga0055540_1003950 3300003792 Bacteria 6924
64 Ga0055531_10000404 3300003794 Bacteria 41520
65 Ga0055531_10001242 3300003794 Bacteria 19363
66 Ga0055531_10006377 3300003794 Bacteria 6709
67 Ga0055541_1000001 3300003841 Bacteria 1111887
68 Ga0055541_1000030 3300003841 Bacteria 199616
69 Ga0055541_1000168 3300003841 Bacteria 31274
70 Ga0065714_10000115 3300005288 Bacteria 10449
71 Ga0065714_10007511 3300005288 Bacteria 3527
72 Ga0065714_10009964 3300005288 Bacteria 3262
73 Ga0065714_10015263 3300005288 Bacteria 1723
74 Ga0065714_10016786 3300005288 Bacteria 1373
75 Ga0065714_10018929 3300005288 Bacteria 1393
76 Ga0065714_10040903 3300005288 Bacteria 1013
77 Ga0065714_10065087 3300005288 Bacteria 13133
78 Ga0065714_10065569 3300005288 Bacteria 9352
79 Ga0065714_10072683 3300005288 Bacteria 3320
80 Ga0065714_10078533 3300005288 Bacteria 2591
81 Ga0065714_10092492 3300005288 Bacteria 1876
82 Ga0065714_10129168 3300005288 Bacteria 1267
83 Ga0065714_10135547 3300005288 Bacteria 1213
84 Ga0065704_10008310 3300005289 Bacteria 4618
85 Ga0065704_10024159 3300005289 Bacteria 1633
86 Ga0065704_10073325 3300005289 Bacteria 7307
87 Ga0065704_10076165 3300005289 Bacteria 5230
88 Ga0065704_10080568 3300005289 Bacteria 3921
89 Ga0065712_10067900 3300005290 Bacteria 22102
90 Ga0065712_10068537 3300005290 Bacteria 10000
91 Ga0065715_10117248 3300005293 Bacteria 2348
92 Ga0070670_100001343 3300005331 Bacteria 19676
93 Ga0070670_100005930 3300005331 Bacteria 10333
94 Ga0070670_100024674 3300005331 Bacteria 5171
95 Ga0070666_10044566 3300005335 Bacteria 2972
96 Ga0070660_100439878 3300005339 Bacteria 1081
97 Ga0070660_100663137 3300005339 Bacteria 874
98 Ga0070661_100000126 3300005344 Bacteria 63357
99 Ga0070661_100568593 3300005344 Bacteria 914
100 Ga0070669_100000764 3300005353 Bacteria 23404
101 Ga0070669_100002215 3300005353 Bacteria 14088
102 Ga0070669_100010461 3300005353 Bacteria 6588
103 Ga0070673_100336409 3300005364 Bacteria 1337
104 Ga0070667_100025826 3300005367 Bacteria 4885
105 Ga0070714_100523115 3300005435 Bacteria 1133
106 Ga0070663_100590763 3300005455 Bacteria 933
107 Ga0070662_100000426 3300005457 Bacteria 24961
108 Ga0070662_100025623 3300005457 Bacteria 4074
109 Ga0068853_100002460 3300005539 Bacteria 13865
110 Ga0068853_100167212 3300005539 Bacteria 1988
111 Ga0068853_100247147 3300005539 Bacteria 1636
112 Ga0070665_100045202 3300005548 Bacteria 4422
113 Ga0070665_100055165 3300005548 Bacteria 3985
114 Ga0070665_100244070 3300005548 Bacteria 1796
115 Ga0070665_100289486 3300005548 Bacteria 1640
116 Ga0070665_100719054 3300005548 Bacteria 1012
117 Ga0070665_101406873 3300005548 Bacteria 706
118 Ga0068855_100000083 3300005563 Bacteria 114159
119 Ga0068855_100075954 3300005563 Bacteria 3900
120 Ga0068855_100156925 3300005563 Bacteria 2585
121 Ga0068855_100230745 3300005563 Bacteria 2073
122 Ga0070664_100002791 3300005564 Bacteria 14105
123 Ga0070664_100385963 3300005564 Bacteria 1279
124 Ga0068854_100009626 3300005578 Bacteria 6240
125 Ga0068854_100042852 3300005578 Bacteria 3205
126 Ga0068856_100045478 3300005614 Bacteria 4323
127 Ga0068856_100062089 3300005614 Bacteria 3691
128 Ga0068852_100010440 3300005616 Bacteria 6942
129 Ga0068851_10000007 3300005834 Bacteria 244101
130 Ga0075365_10085235 3300006038 Bacteria 2146
131 Ga0075365_10145557 3300006038 Bacteria 1646
132 Ga0075364_10129569 3300006051 Bacteria 1692
133 Ga0075364_10373248 3300006051 Bacteria 973
134 Ga0075432_10011631 3300006058 Bacteria 2990
135 Ga0075432_10028200 3300006058 Bacteria 1936
136 Ga0075432_10032413 3300006058 Bacteria 1810
137 Ga0075432_10074428 3300006058 Bacteria 1223
138 Ga0070716_100037343 3300006173 Bacteria 2684
139 Ga0075362_10034210 3300006177 Bacteria 2214
140 Ga0075362_10037732 3300006177 Bacteria 2120
141 Ga0075362_10108739 3300006177 Bacteria 1303
142 Ga0075366_10005256 3300006195 Bacteria 7011
143 Ga0075366_10024685 3300006195 Bacteria 3506
144 Ga0075370_10004516 3300006353 Bacteria 6774
145 Ga0075436_100042606 3300006914 Bacteria 3131
146 Ga0075436_100176405 3300006914 Bacteria 1509
147 Ga0075436_100235249 3300006914 Bacteria 1302
148 Ga0075436_100269535 3300006914 Bacteria 1216
149 Ga0075436_100494052 3300006914 Bacteria 895
150 Ga0075436_100536753 3300006914 Bacteria 858
151 Ga0079104_1000093 3300006946 Bacteria 130633
152 Ga0079104_1000518 3300006946 Bacteria 41295
153 Ga0079104_1000754 3300006946 Bacteria 27883
154 Ga0079104_1001469 3300006946 Bacteria 15717
155 Ga0079104_1010922 3300006946 Bacteria 2953
156 Ga0099826_10000039 3300006948 Bacteria 99286
157 Ga0099826_10004941 3300006948 Bacteria 9450
158 Ga0105251_10000009 3300009011 Bacteria 192384
159 Ga0105251_10000133 3300009011 Bacteria 74942
160 Ga0105251_10004529 3300009011 Bacteria 9422
161 Ga0105251_10006398 3300009011 Bacteria 7511
162 Ga0105251_10008326 3300009011 Bacteria 6260
163 Ga0105251_10009680 3300009011 Bacteria 5664
164 Ga0105251_10014310 3300009011 Bacteria 4394
165 Ga0105251_10016733 3300009011 Bacteria 3952
166 Ga0105251_10017668 3300009011 Bacteria 3816
167 Ga0105251_10034134 3300009011 Bacteria 2520
168 Ga0105251_10037689 3300009011 Bacteria 2370
169 Ga0105251_10044660 3300009011 Bacteria 2139
170 Ga0105251_10162951 3300009011 Bacteria 1005
171 Ga0105251_10175120 3300009011 Bacteria 967
172 Ga0105244_10000008 3300009036 Bacteria 302297
173 Ga0105244_10001453 3300009036 Bacteria 19179
174 Ga0105244_10003377 3300009036 Bacteria 11430
175 Ga0105244_10008099 3300009036 Bacteria 6601
176 Ga0105244_10034271 3300009036 Bacteria 2674
177 Ga0105244_10061120 3300009036 Bacteria 1897
178 Ga0105244_10067665 3300009036 Bacteria 1786
179 Ga0105244_10076791 3300009036 Bacteria 1658
180 Ga0105244_10097516 3300009036 Bacteria 1440
181 Ga0105244_10098580 3300009036 Bacteria 1431
182 Ga0105244_10276542 3300009036 Bacteria 779
183 Ga0105250_10000605 3300009092 Bacteria 23408
184 Ga0105250_10002587 3300009092 Bacteria 9012
185 Ga0105250_10003447 3300009092 Bacteria 7496
186 Ga0105250_10003816 3300009092 Bacteria 7075
187 Ga0105250_10004205 3300009092 Bacteria 6671
188 Ga0105250_10011988 3300009092 Bacteria 3589
189 Ga0105250_10030034 3300009092 Bacteria 2186
190 Ga0105250_10032680 3300009092 Bacteria 2089
191 Ga0105250_10057968 3300009092 Bacteria 1554
192 Ga0105250_10101348 3300009092 Bacteria 1175
193 Ga0105240_10003351 3300009093 Bacteria 24930
194 Ga0105240_10028663 3300009093 Bacteria 7266
195 Ga0105240_10118802 3300009093 Bacteria 3186
196 Ga0105243_10007062 3300009148 Bacteria 8635
197 Ga0105243_10007538 3300009148 Bacteria 8366
198 Ga0105243_10013877 3300009148 Bacteria 6099
199 Ga0105243_10053584 3300009148 Bacteria 3200
200 Ga0105243_10170509 3300009148 Bacteria 1884
201 Ga0105242_10004917 3300009176 Bacteria 10346
202 Ga0105242_10033598 3300009176 Bacteria 4109
203 Ga0105242_10164967 3300009176 Bacteria 1942
204 Ga0105242_10440437 3300009176 Bacteria 1226
205 Ga0105237_10005994 3300009545 Bacteria 13608
206 Ga0105237_10093575 3300009545 Bacteria 2995
207 Ga0105237_10149362 3300009545 Bacteria 2333
208 Ga0105237_10268524 3300009545 Bacteria 1709
209 Ga0105237_10340359 3300009545 Bacteria 1505
210 Ga0105238_10000037 3300009551 Bacteria 163954
211 Ga0105238_10080399 3300009551 Bacteria 3249
212 Ga0105239_10013749 3300010375 Bacteria 8985
213 Ga0105239_10092298 3300010375 Bacteria 3342
214 Ga0105246_10000162 3300011119 Bacteria 32137
215 Ga0105246_10000432 3300011119 Bacteria 22385
216 Ga0105246_10019035 3300011119 Bacteria 4380
217 Ga0105246_10025124 3300011119 Bacteria 3881
218 Ga0105246_10111801 3300011119 Bacteria 2008
219 Ga0105246_10169006 3300011119 Bacteria 1673
220 Ga0157345_1000059 3300012498 Bacteria 23613
221 Ga0157373_10003992 3300013100 Bacteria 11124
222 Ga0157373_10007482 3300013100 Bacteria 8124
223 Ga0157373_10011402 3300013100 Bacteria 6538
224 Ga0157373_10043148 3300013100 Bacteria 3222
225 Ga0157373_10043917 3300013100 Bacteria 3191
226 Ga0157373_10085841 3300013100 Bacteria 2218
227 Ga0157373_10129501 3300013100 Bacteria 1774
228 Ga0157373_10152386 3300013100 Bacteria 1626
229 Ga0157373_10178942 3300013100 Bacteria 1493
230 Ga0157371_10000039 3300013102 Bacteria 207724
231 Ga0157371_10011165 3300013102 Bacteria 6947
232 Ga0157371_10025849 3300013102 Bacteria 4273
233 Ga0157371_10115285 3300013102 Bacteria 1908
234 Ga0157371_10163806 3300013102 Bacteria 1588
235 Ga0157371_10227328 3300013102 Bacteria 1340
236 Ga0157370_10000070 3300013104 Bacteria 112014
237 Ga0157370_10011932 3300013104 Bacteria 9060
238 Ga0157370_10039117 3300013104 Bacteria 4584
239 Ga0157370_10052578 3300013104 Bacteria 3889
240 Ga0157370_10072242 3300013104 Bacteria 3256
241 Ga0157370_10105658 3300013104 Bacteria 2635
242 Ga0157370_10141128 3300013104 Bacteria 2245
243 Ga0157370_10386291 3300013104 Bacteria 1289
244 Ga0157369_10039350 3300013105 Bacteria 5168
245 Ga0157369_10052988 3300013105 Bacteria 4387
246 Ga0157369_10086792 3300013105 Bacteria 3341
247 Ga0157369_10094667 3300013105 Bacteria 3188
248 Ga0157369_10095256 3300013105 Bacteria 3177
249 Ga0157369_10133358 3300013105 Bacteria 2631
250 Ga0157369_10138981 3300013105 Bacteria 2571
251 Ga0163162_10048268 3300013306 Bacteria 4265
252 Ga0163162_10770004 3300013306 Bacteria 1081
253 Ga0163162_11101635 3300013306 Bacteria 900
254 Ga0157372_10109402 3300013307 Bacteria 3165
255 Ga0157372_10131463 3300013307 Bacteria 2880
256 Ga0157375_10086735 3300013308 Bacteria 3182
257 Ga0157375_10090932 3300013308 Bacteria 3112
258 Ga0157375_10249140 3300013308 Bacteria 1937
259 Ga0157375_10382958 3300013308 Bacteria 1573
260 Ga0157375_10911217 3300013308 Bacteria 1023
261 Ga0157380_10410785 3300014326 Bacteria 1287
262 Ga0182008_10000662 3300014497 Bacteria 24971
263 Ga0182008_10003064 3300014497 Bacteria 10267
264 Ga0182008_10005030 3300014497 Bacteria 7604
265 Ga0182008_10013293 3300014497 Bacteria 4328
266 Ga0182008_10013647 3300014497 Bacteria 4269
267 Ga0182008_10024543 3300014497 Bacteria 3068
268 Ga0182008_10025165 3300014497 Bacteria 3025
269 Ga0182008_10026256 3300014497 Bacteria 2954
270 Ga0182008_10052314 3300014497 Bacteria 2025
271 Ga0182008_10097056 3300014497 Bacteria 1455
272 Ga0182008_10153588 3300014497 Bacteria 1155
273 Ga0157376_10340397 3300014969 Bacteria 1432
274 Ga0182006_1006448 3300015261 Bacteria 5451
275 Ga0182006_1010871 3300015261 Bacteria 4027
276 Ga0182006_1014777 3300015261 Bacteria 3358
277 Ga0182006_1016147 3300015261 Bacteria 3189
278 Ga0182006_1020055 3300015261 Bacteria 2805
279 Ga0182006_1020526 3300015261 Bacteria 2767
280 Ga0182006_1023930 3300015261 Bacteria 2525
281 Ga0182006_1028676 3300015261 Bacteria 2262
282 Ga0182006_1044379 3300015261 Bacteria 1734
283 Ga0182006_1050795 3300015261 Bacteria 1597
284 Ga0182006_1068441 3300015261 Bacteria 1322
285 Ga0182006_1148228 3300015261 Bacteria 797
286 Ga0182007_10001352 3300015262 Bacteria 13221
287 Ga0182007_10001934 3300015262 Bacteria 10718
288 Ga0182007_10006630 3300015262 Bacteria 4956
289 Ga0182007_10017947 3300015262 Bacteria 2575
290 Ga0182007_10019671 3300015262 Bacteria 2424
291 Ga0182007_10025132 3300015262 Bacteria 2077
292 Ga0182007_10026086 3300015262 Bacteria 2029
293 Ga0182005_1000183 3300015265 Bacteria 42914
294 Ga0182005_1007397 3300015265 Bacteria 3296
295 Ga0182005_1010616 3300015265 Bacteria 2644
296 Ga0182005_1021610 3300015265 Bacteria 1765
297 Ga0182005_1035003 3300015265 Bacteria 1366
298 Ga0183362_10001 3300015683 Bacteria 2046624
299 Ga0183361_10004 3300016635 Bacteria 484183
300 Ga0163161_10046855 3300017792 Bacteria 3120
301 Ga0163161_10101646 3300017792 Bacteria 2140
302 Ga0163161_10124933 3300017792 Bacteria 1936
303 Ga0163161_10167083 3300017792 Bacteria 1680
304 Ga0163161_10173430 3300017792 Bacteria 1650
305 Ga0163161_10181486 3300017792 Bacteria 1614
306 Ga0163161_10215667 3300017792 Bacteria 1484
307 Ga0163161_10239651 3300017792 Bacteria 1410
308 Ga0163161_10258045 3300017792 Bacteria 1360
309 Ga0163161_10279826 3300017792 Bacteria 1308
310 Ga0163161_10287576 3300017792 Bacteria 1291
311 Ga0163161_10325029 3300017792 Bacteria 1217
312 Ga0209435_100004 3300025206 Bacteria 633417
313 Ga0209435_100046 3300025206 Bacteria 95081
314 Ga0209435_100377 3300025206 Bacteria 9928
315 Ga0209435_100768 3300025206 Bacteria 5258
316 Ga0209760_100027 3300025207 Bacteria 153290
317 Ga0209760_101344 3300025207 Bacteria 2647
318 Ga0209784_100004 3300025224 Bacteria 1378156
319 Ga0209784_100007 3300025224 Bacteria 747715
320 Ga0209784_100009 3300025224 Bacteria 688031
321 Ga0209566_100004 3300025225 Bacteria 1531866
322 Ga0209566_100007 3300025225 Bacteria 688031
323 Ga0209566_100009 3300025225 Bacteria 554018
324 Ga0209674_100006 3300025226 Bacteria 1531866
325 Ga0209674_100018 3300025226 Bacteria 688031
326 Ga0209674_100021 3300025226 Bacteria 629811
327 Ga0209147_100009 3300025229 Bacteria 747409
328 Ga0209147_100011 3300025229 Bacteria 702140
329 Ga0209147_100157 3300025229 Bacteria 92005
330 Ga0209563_100009 3300025230 Bacteria 1378156
331 Ga0209563_100018 3300025230 Bacteria 747850
332 Ga0209563_100020 3300025230 Bacteria 688031
333 Ga0209563_100268 3300025230 Bacteria 22421
334 Ga0207427_100006 3300025231 Bacteria 785415
335 Ga0207427_100149 3300025231 Bacteria 78920
336 Ga0209437_100004 3300025233 Bacteria 1378156
337 Ga0209437_100013 3300025233 Bacteria 785457
338 Ga0209437_100207 3300025233 Bacteria 112147
339 Ga0209437_100939 3300025233 Bacteria 10959
340 Ga0209258_100851 3300025242 Bacteria 16447
341 Ga0209258_100913 3300025242 Bacteria 14949
342 Ga0209258_101397 3300025242 Bacteria 8633
343 Ga0209646_1000141 3300025246 Bacteria 107030
344 Ga0209646_1000149 3300025246 Bacteria 100004
345 Ga0209646_1000156 3300025246 Bacteria 95083
346 Ga0209646_1000184 3300025246 Bacteria 78423
347 Ga0209646_1000233 3300025246 Bacteria 57776
348 Ga0209646_1000524 3300025246 Bacteria 16813
349 Ga0209026_1000066 3300025250 Bacteria 207691
350 Ga0209026_1000776 3300025250 Bacteria 17734
351 Ga0209677_100005 3300025253 Bacteria 1378156
352 Ga0209677_100010 3300025253 Bacteria 688031
353 Ga0209677_100012 3300025253 Bacteria 554018
354 Ga0209148_1012493 3300025254 Bacteria 1550
355 Ga0209148_1015404 3300025254 Bacteria 1336
356 Ga0209759_1000072 3300025256 Bacteria 178206
357 Ga0209759_1000182 3300025256 Bacteria 102836
358 Ga0209759_1001083 3300025256 Bacteria 17734
359 Ga0209759_1001715 3300025256 Bacteria 11322
360 Ga0209233_1000005 3300025261 Bacteria 1531866
361 Ga0209233_1000022 3300025261 Bacteria 785415
362 Ga0209565_1001951 3300025263 Bacteria 8088
363 Ga0209455_1001032 3300025272 Bacteria 13865
364 Ga0209455_1002502 3300025272 Bacteria 7057
365 Ga0209673_1011314 3300025273 Bacteria 3686
366 Ga0209130_1010307 3300025284 Bacteria 2586
367 Ga0209130_1032862 3300025284 Bacteria 1054
368 Ga0209675_1000078 3300025291 Bacteria 156111
369 Ga0209675_1000573 3300025291 Bacteria 26547
370 Ga0209675_1001701 3300025291 Bacteria 12170
371 Ga0209675_1003212 3300025291 Bacteria 7917
372 Ga0209675_1004183 3300025291 Bacteria 6528
373 Ga0209676_1000015 3300025292 Bacteria 784458
374 Ga0209676_1000030 3300025292 Bacteria 506421
375 Ga0209676_1000041 3300025292 Bacteria 424583
376 Ga0209676_1000121 3300025292 Bacteria 198920
377 Ga0209676_1007094 3300025292 Bacteria 5363
378 Ga0209676_1026401 3300025292 Bacteria 1845
379 Ga0209025_1000019 3300025294 Bacteria 631548
380 Ga0209025_1000051 3300025294 Bacteria 330080
381 Ga0209025_1003638 3300025294 Bacteria 14313
382 Ga0209025_1034026 3300025294 Bacteria 2339
383 Ga0209564_1000133 3300025295 Bacteria 189140
384 Ga0209564_1020032 3300025295 Bacteria 2471
385 Ga0209050_1000024 3300025298 Bacteria 533389
386 Ga0209050_1000030 3300025298 Bacteria 463381
387 Ga0209050_1000228 3300025298 Bacteria 123537
388 Ga0209050_1000332 3300025298 Bacteria 94224
389 Ga0209050_1001473 3300025298 Bacteria 25146
390 Ga0209050_1011157 3300025298 Bacteria 4303
391 Ga0209050_1022072 3300025298 Bacteria 2294
392 Ga0209050_1035225 3300025298 Bacteria 1483
393 Ga0209256_1000030 3300025299 Bacteria 414828
394 Ga0209256_1000699 3300025299 Bacteria 44604
395 Ga0209051_1000004 3300025303 Bacteria 1155596
396 Ga0209051_1000012 3300025303 Bacteria 595474
397 Ga0209051_1000023 3300025303 Bacteria 437371
398 Ga0209051_1000367 3300025303 Bacteria 65677
399 Ga0209051_1001294 3300025303 Bacteria 22056
400 Ga0209051_1007252 3300025303 Bacteria 6093
401 Ga0209051_1009205 3300025303 Bacteria 5115
402 Ga0209257_1000012 3300025304 Bacteria 1111138
403 Ga0209257_1000063 3300025304 Bacteria 359089
404 Ga0209257_1000262 3300025304 Bacteria 121021
405 Ga0209257_1022106 3300025304 Bacteria 2281
406 Ga0207656_10000006 3300025321 Bacteria 395044
407 Ga0207696_1000020 3300025711 Bacteria 434998
408 Ga0207696_1000031 3300025711 Bacteria 384169
409 Ga0207696_1001215 3300025711 Bacteria 14643
410 Ga0207696_1003799 3300025711 Bacteria 6726
411 Ga0207696_1005266 3300025711 Bacteria 5393
412 Ga0207696_1024464 3300025711 Bacteria 1893
413 Ga0207696_1041534 3300025711 Bacteria 1343
414 Ga0207655_1000033 3300025728 Bacteria 377066
415 Ga0207655_1000083 3300025728 Bacteria 213295
416 Ga0207655_1000703 3300025728 Bacteria 38823
417 Ga0207655_1002748 3300025728 Bacteria 13718
418 Ga0207655_1005392 3300025728 Bacteria 8711
419 Ga0207655_1005543 3300025728 Bacteria 8557
420 Ga0207655_1005590 3300025728 Bacteria 8511
421 Ga0207655_1007307 3300025728 Bacteria 7180
422 Ga0207655_1012751 3300025728 Bacteria 4878
423 Ga0207655_1012880 3300025728 Bacteria 4844
424 Ga0207655_1013705 3300025728 Bacteria 4633
425 Ga0207655_1015570 3300025728 Bacteria 4215
426 Ga0207655_1020094 3300025728 Bacteria 3455
427 Ga0207655_1041823 3300025728 Bacteria 1959
428 Ga0207655_1142231 3300025728 Bacteria 769
429 Ga0207713_1000032 3300025735 Bacteria 276465
430 Ga0207713_1000079 3300025735 Bacteria 172274
431 Ga0207713_1000659 3300025735 Bacteria 32880
432 Ga0207713_1000750 3300025735 Bacteria 30221
433 Ga0207713_1000837 3300025735 Bacteria 28361
434 Ga0207713_1001056 3300025735 Bacteria 23875
435 Ga0207713_1002266 3300025735 Bacteria 14188
436 Ga0207713_1002477 3300025735 Bacteria 13429
437 Ga0207713_1006015 3300025735 Bacteria 7480
438 Ga0207713_1007842 3300025735 Bacteria 6225
439 Ga0207713_1007888 3300025735 Bacteria 6204
440 Ga0207713_1008313 3300025735 Bacteria 5993
441 Ga0207713_1011258 3300025735 Bacteria 4878
442 Ga0207713_1021313 3300025735 Bacteria 3109
443 Ga0207713_1022601 3300025735 Bacteria 2980
444 Ga0207688_10362594 3300025901 Bacteria 894
445 Ga0207645_10307425 3300025907 Bacteria 1056
446 Ga0207695_10000748 3300025913 Bacteria 62583
447 Ga0207695_10000979 3300025913 Bacteria 50790
448 Ga0207695_10085612 3300025913 Bacteria 3180
449 Ga0207671_10000131 3300025914 Bacteria 116866
450 Ga0207671_10027798 3300025914 Bacteria 4228
451 Ga0207671_10312044 3300025914 Bacteria 1243
452 Ga0207657_10210920 3300025919 Bacteria 1559
453 Ga0207649_10000012 3300025920 Bacteria 265674
454 Ga0207649_10194479 3300025920 Bacteria 1429
455 Ga0207681_10000381 3300025923 Bacteria 31124
456 Ga0207681_10000482 3300025923 Bacteria 27925
457 Ga0207681_10009066 3300025923 Bacteria 6077
458 Ga0207694_10000069 3300025924 Bacteria 124500
459 Ga0207694_10033085 3300025924 Bacteria 3960
460 Ga0207694_10340000 3300025924 Bacteria 1241
461 Ga0207650_10000338 3300025925 Bacteria 45436
462 Ga0207650_10000564 3300025925 Bacteria 30060
463 Ga0207650_10176277 3300025925 Bacteria 1702
464 Ga0207659_10173289 3300025926 Bacteria 1703
465 Ga0207664_10665713 3300025929 Bacteria 936
466 Ga0207644_10289078 3300025931 Bacteria 1318
467 Ga0207706_10001424 3300025933 Bacteria 23939
468 Ga0207706_10042839 3300025933 Bacteria 4011
469 Ga0207686_10000663 3300025934 Bacteria 21277
470 Ga0207686_10241547 3300025934 Bacteria 1315
471 Ga0207686_10271493 3300025934 Bacteria 1248
472 Ga0207709_10000248 3300025935 Bacteria 66465
473 Ga0207709_10003176 3300025935 Bacteria 9870
474 Ga0207709_10181605 3300025935 Bacteria 1486
475 Ga0207709_10203623 3300025935 Bacteria 1415
476 Ga0207669_10759510 3300025937 Bacteria 801
477 Ga0207665_10052433 3300025939 Bacteria 2748
478 Ga0207679_10000015 3300025945 Bacteria 265674
479 Ga0207667_10000043 3300025949 Bacteria 261426
480 Ga0207667_10030089 3300025949 Bacteria 5877
481 Ga0207667_10223683 3300025949 Bacteria 1928
482 Ga0207667_10398203 3300025949 Bacteria 1402
483 Ga0207651_10280762 3300025960 Bacteria 1376
484 Ga0207640_10015014 3300025981 Bacteria 4473
485 Ga0207677_10102893 3300026023 Bacteria 2107
486 Ga0207639_10000286 3300026041 Bacteria 36062
487 Ga0207702_10027104 3300026078 Bacteria 4758
488 Ga0207702_10333543 3300026078 Bacteria 1447
489 Ga0207648_10239465 3300026089 Bacteria 1615
490 Ga0207674_10246713 3300026116 Bacteria 1733
491 Ga0207675_101211330 3300026118 Bacteria 775
492 Ga0207683_10472243 3300026121 Bacteria 1157
493 Ga0207698_10000966 3300026142 Bacteria 16711
494 Ga0209281_1000016 3300027111 Bacteria 588107
495 Ga0209281_1000019 3300027111 Bacteria 576164
496 Ga0209281_1000084 3300027111 Bacteria 254215
497 Ga0209281_1005170 3300027111 Bacteria 3685
498 Ga0209281_1007590 3300027111 Bacteria 2710
499 Ga0209371_1000871 3300027312 Bacteria 24307
500 Ga0209282_1000058 3300027666 Bacteria 99152
501 Ga0207428_10007071 3300027907 Bacteria 10273
502 Ga0207428_10072024 3300027907 Bacteria 2714
503 Ga0207428_10076055 3300027907 Bacteria 2630
504 Ga0207428_10085395 3300027907 Bacteria 2458
505 Ga0207428_10093304 3300027907 Bacteria 2335
506 Ga0268266_10004944 3300028379 Bacteria 12615
507 Ga0268266_10040199 3300028379 Bacteria 3985
508 Ga0268266_10290161 3300028379 Bacteria 1523
509 Ga0268266_10622091 3300028379 Bacteria 1038
510 Ga0268266_10834620 3300028379 Bacteria 890
511 Ga0307517_10186905 3300028786 Bacteria 1324
512 Ga0307515_10000215 3300028794 Bacteria 142594
513 Ga0268256_1000771 3300030500 Bacteria 23304
514 Ga0307511_10003163 3300030521 Bacteria 16949
515 Ga0307511_10046070 3300030521 Bacteria 3593
516 Ga0307511_10105971 3300030521 Bacteria 1817
517 Ga0316178_1051183 3300030735 Bacteria 40899
518 Ga0316183_1079327 3300030742 Bacteria 2695
519 Ga0316181_1054368 3300030744 Bacteria 10190
520 Ga0265332_10002934 3300031238 Bacteria 8389
521 Ga0265329_10028102 3300031242 Bacteria 1845
522 Ga0265340_10001308 3300031247 Bacteria 14259
523 Ga0265331_10011421 3300031250 Bacteria 4864
524 Ga0265327_10036761 3300031251 Bacteria 2688
525 Ga0265327_10058111 3300031251 Bacteria 1987
526 Ga0265316_10053295 3300031344 Bacteria 3170
527 Ga0265316_10199969 3300031344 Bacteria 1482
528 Ga0307513_10146120 3300031456 Bacteria 2282
529 Ga0307509_10141275 3300031507 Bacteria 2342
530 Ga0307509_10373778 3300031507 Bacteria 1141
531 Ga0307408_100000002 3300031548 Bacteria 827227
532 Ga0307408_100018437 3300031548 Bacteria 4685
533 Ga0307408_100030557 3300031548 Bacteria 3741
534 Ga0307408_100135174 3300031548 Bacteria 1928
535 Ga0307408_100368944 3300031548 Bacteria 1223
536 Ga0307408_100839944 3300031548 Bacteria 836
537 Ga0265314_10038167 3300031711 Bacteria 3474
538 Ga0265342_10002113 3300031712 Bacteria 17530
539 Ga0307516_10329423 3300031730 Bacteria 1196
540 Ga0307405_10021286 3300031731 Bacteria 3641
541 Ga0307405_10030612 3300031731 Bacteria 3157
542 Ga0307405_10118288 3300031731 Bacteria 1808
543 Ga0307405_10219610 3300031731 Bacteria 1393
544 Ga0307405_10445495 3300031731 Bacteria 1025
545 Ga0307413_10467860 3300031824 Bacteria 1004
546 Ga0307406_10031651 3300031901 Bacteria 3222
547 Ga0307406_10064864 3300031901 Bacteria 2371
548 Ga0307406_10422248 3300031901 Bacteria 1063
549 Ga0307412_10000401 3300031911 Bacteria 26384
550 Ga0307412_10014881 3300031911 Bacteria 4598
551 Ga0307412_10027454 3300031911 Bacteria 3549
552 Ga0307412_10114444 3300031911 Bacteria 1931
553 Ga0307412_10128873 3300031911 Bacteria 1834
554 Ga0307412_10143622 3300031911 Bacteria 1751
555 Ga0307412_10229525 3300031911 Bacteria 1428
556 Ga0307409_100114929 3300031995 Bacteria 2265
557 Ga0307416_100168469 3300032002 Bacteria 2035
558 Ga0307416_100235127 3300032002 Bacteria 1770
559 Ga0307416_100313562 3300032002 Bacteria 1566
560 Ga0307416_101373701 3300032002 Bacteria 812
561 Ga0307414_10018847 3300032004 Bacteria 4261
562 Ga0307414_10351963 3300032004 Bacteria 1264
563 Ga0307414_10529026 3300032004 Bacteria 1047
564 Ga0307414_11003013 3300032004 Bacteria 768
565 Ga0307411_10021537 3300032005 Bacteria 3774
566 Ga0307411_10044282 3300032005 Bacteria 2853
567 Ga0307411_10069287 3300032005 Bacteria 2381
568 Ga0307510_10081644 3300033180 Bacteria 3132
569 Ga0395899_0000478 3300037312 Bacteria 44762
570 Ga0395899_0002559 3300037312 Bacteria 14713
571 Ga0395899_0003641 3300037312 Bacteria 12200
572 Ga0395899_0010527 3300037312 Bacteria 7084
573 Ga0395899_0021543 3300037312 Bacteria 4887
574 Ga0395900_0000689 3300037418 Bacteria 45109
575 Ga0395900_0009793 3300037418 Bacteria 9820
576 Ga0395900_0054673 3300037418 Bacteria 4111
577 Ga0395900_0067915 3300037418 Bacteria 3662
578 Ga0395898_0006853 3300037466 Bacteria 12116
579 Ga0395898_0012935 3300037466 Bacteria 8609
580 Ga0395898_0542779 3300037466 Bacteria 1104
581 Ga0395905_0001455 3300037471 Bacteria 28407
582 Ga0395905_0006806 3300037471 Bacteria 11449
583 Ga0395905_0040143 3300037471 Bacteria 4390
584 Ga0395905_0131624 3300037471 Bacteria 2353
585 Ga0395901_0000448 3300038443 Bacteria 47911
586 Ga0395901_0013926 3300038443 Bacteria 8184
587 Ga0395901_0021143 3300038443 Bacteria 6666
588 Ga0395901_0707761 3300038443 Bacteria 1004
589 Ga0237819_00552 3300038705 Bacteria 12558
590 Ga0436361_0383577 3300039447 Bacteria 3194
591 Ga0439436_0002185 3300041404 Bacteria 5852
592 Ga0439436_0014730 3300041404 Bacteria 2355
593 Ga0439436_0031731 3300041404 Bacteria 1533
594 Ga0439438_003027 3300041405 Bacteria 6923
595 Ga0439438_008131 3300041405 Bacteria 3515
596 Ga0439438_009379 3300041405 Bacteria 3171
597 Ga0439438_029762 3300041405 Bacteria 1460
598 Ga0439438_056012 3300041405 Bacteria 993
599 Ga0439447_002518 3300041407 Bacteria 6665
600 Ga0439447_003011 3300041407 Bacteria 6030
601 Ga0439447_005933 3300041407 Bacteria 4012
602 Ga0439447_008182 3300041407 Bacteria 3257
603 Ga0439447_041380 3300041407 Bacteria 1121
604 Ga0439447_048871 3300041407 Bacteria 1014
605 Ga0439453_0033084 3300041408 Bacteria 987
606 Ga0439461_0060740 3300041410 Bacteria 858
607 Ga0439466_0002249 3300041411 Bacteria 7564
608 Ga0439466_0002406 3300041411 Bacteria 7338
609 Ga0439466_0002488 3300041411 Bacteria 7216
610 Ga0439466_0005445 3300041411 Bacteria 4865
611 Ga0439466_0007824 3300041411 Bacteria 4036
612 Ga0439466_0011931 3300041411 Bacteria 3209
613 Ga0439466_0022629 3300041411 Bacteria 2216
614 Ga0439466_0072787 3300041411 Bacteria 1092
615 Ga0439465_0002411 3300041413 Bacteria 6124
616 Ga0439431_0000362 3300041997 Bacteria 9558
617 Ga0439433_0000386 3300041999 Bacteria 7896
618 Ga0439442_003449 3300042002 Bacteria 3128
619 Ga0439445_0000121 3300042004 Bacteria 13329
620 Ga0439448_0000259 3300042005 Bacteria 11457
621 Ga0439432_000513 3300042006 Bacteria 14429
622 Ga0439432_001999 3300042006 Bacteria 7720
623 Ga0439432_012071 3300042006 Bacteria 2964
624 Ga0439432_015834 3300042006 Bacteria 2540
625 Ga0439432_032113 3300042006 Bacteria 1695
626 Ga0439432_059886 3300042006 Bacteria 1175
627 Ga0439449_0001222 3300042007 Bacteria 10081
628 Ga0439449_0052621 3300042007 Bacteria 1505
629 Ga0439450_003664 3300042008 Bacteria 2561
630 Ga0439451_000646 3300042009 Bacteria 6609
631 Ga0439451_003347 3300042009 Bacteria 3247
632 Ga0439451_004400 3300042009 Bacteria 2862
633 Ga0439451_008272 3300042009 Bacteria 2109
634 Ga0439451_048696 3300042009 Bacteria 848
635 Ga0439451_051306 3300042009 Bacteria 826
636 Ga0439452_002368 3300042010 Bacteria 7001
637 Ga0439452_002759 3300042010 Bacteria 6347
638 Ga0439452_008262 3300042010 Bacteria 3144
639 Ga0439452_008471 3300042010 Bacteria 3093
640 Ga0439452_022738 3300042010 Bacteria 1619
641 Ga0439452_048695 3300042010 Bacteria 976
642 Ga0439455_0023343 3300042012 Bacteria 1488
643 Ga0439456_001671 3300042013 Bacteria 4478
644 Ga0439456_004150 3300042013 Bacteria 2935
645 Ga0439456_042724 3300042013 Bacteria 984
646 Ga0439462_0011605 3300042015 Bacteria 2245
647 Ga0439463_001315 3300042016 Bacteria 6617
648 Ga0439463_001732 3300042016 Bacteria 5691
649 Ga0439463_003054 3300042016 Bacteria 4251
650 Ga0439463_029998 3300042016 Bacteria 1370
651 Ga0450911_001308 3300042115 Bacteria 5904
652 Ga0450911_007537 3300042115 Bacteria 1573
653 Ga0450919_001489 3300042121 Bacteria 3058
654 Ga0450919_003601 3300042121 Bacteria 1922
655 Ga0450920_001631 3300042122 Bacteria 3745
656 Ga0450923_015979 3300042125 Bacteria 1409
657 Ga0450890_003335 3300042127 Bacteria 2141
658 Ga0450900_001223 3300042136 Bacteria 2437
659 Ga0450902_004412 3300042137 Bacteria 2093
660 Ga0450902_016447 3300042137 Bacteria 1206
661 Ga0450903_001035 3300042138 Bacteria 5309
662 Ga0450903_009052 3300042138 Bacteria 1625
663 Ga0450903_015548 3300042138 Bacteria 1198
664 Ga0450905_001395 3300042142 Bacteria 3075
665 Ga0450906_001441 3300042145 Bacteria 5178
666 Ga0450906_004512 3300042145 Bacteria 2914
667 Ga0450907_001403 3300042146 Bacteria 5255
668 Ga0450907_001502 3300042146 Bacteria 4994
669 Ga0450907_001564 3300042146 Bacteria 4871
670 Ga0450910_001446 3300042147 Bacteria 2990
671 Ga0439446_0017528 3300042156 Bacteria 2002
672 Ga0439446_0021589 3300042156 Bacteria 1821
673 Ga0450908_011990 3300042184 Bacteria 1578
674 Ga0450908_022912 3300042184 Bacteria 1094
675 Ga0450908_042764 3300042184 Bacteria 785
676 Ga0450909_002330 3300042185 Bacteria 2692
677 Ga0450909_007436 3300042185 Bacteria 1586
678 Ga0439434_0034102 3300042435 Bacteria 1553
679 Ga0439434_0104232 3300042435 Bacteria 915
680 Ga0439464_0002118 3300042439 Bacteria 4838
681 Ga0439460_0000913 3300042461 Bacteria 6754
682 Ga0439460_0027876 3300042461 Bacteria 1589
683 Ga0450918_000196 3300042531 Bacteria 13608
684 Ga0450918_004059 3300042531 Bacteria 2689
685 Ga0450901_000243 3300042533 Bacteria 6617
686 Ga0439440_0011461 3300042993 Bacteria 1869
687 Ga0466969_0002577 3300044656 Bacteria 9685
688 Ga0466972_0003793 3300044658 Bacteria 7513
689 Ga0466972_0029120 3300044658 Bacteria 2720
690 Ga0466972_0184092 3300044658 Bacteria 979
691 Ga0466965_0004441 3300044683 Bacteria 6237
692 Ga0466965_0015148 3300044683 Bacteria 3661
693 Ga0466965_0038432 3300044683 Bacteria 2351
694 Ga0466965_0161174 3300044683 Bacteria 1176
695 Ga0466966_0052393 3300044684 Bacteria 2592
696 Ga0466966_0080819 3300044684 Bacteria 2024
697 Ga0466961_0017656 3300044693 Bacteria 4583
698 Ga0466964_0001947 3300044706 Bacteria 7239
699 Ga0466964_0017499 3300044706 Bacteria 2743
700 Ga0466964_0026220 3300044706 Bacteria 2280
701 Ga0466964_0214650 3300044706 Bacteria 931
702 Ga0466968_0007003 3300044735 Bacteria 4274
703 Ga0466968_0007529 3300044735 Bacteria 4144
704 Ga0466968_0008302 3300044735 Bacteria 3973
705 Ga0466957_0020683 3300044842 Bacteria 3873
706 Ga0466960_0127563 3300044901 Bacteria 1339
707 Ga0466960_0140472 3300044901 Bacteria 1282
708 Ga0466960_0325598 3300044901 Bacteria 871
709 Ga0466959_0014864 3300045049 Bacteria 5667
710 Ga0466959_0045215 3300045049 Bacteria 3243
711 Ga0466959_0365778 3300045049 Bacteria 982
712 Ga0466958_0077912 3300045836 Bacteria 2036
713 Ga0466967_0010798 3300045976 Bacteria 6872
714 Ga0495617_008515 3300046452 Bacteria 3534
715 Ga0495617_011744 3300046452 Bacteria 2986
716 Ga0495617_015578 3300046452 Bacteria 2574
717 Ga0495627_000083 3300046453 Bacteria 113227
718 Ga0495627_003909 3300046453 Bacteria 6377
719 Ga0495627_005462 3300046453 Bacteria 5119
720 Ga0495627_006280 3300046453 Bacteria 4668
721 Ga0495627_008624 3300046453 Bacteria 3803
722 Ga0495627_009171 3300046453 Bacteria 3650
723 Ga0495627_024339 3300046453 Bacteria 1974
724 Ga0495627_041276 3300046453 Bacteria 1417
725 Ga0495592_0064774 3300046454 Bacteria 2677
726 Ga0495603_0004335 3300046455 Bacteria 8462
727 Ga0495603_0080815 3300046455 Bacteria 1905
728 Ga0495603_0102798 3300046455 Bacteria 1668
729 Ga0495590_0012084 3300046457 Bacteria 3212
730 Ga0495590_0014464 3300046457 Bacteria 2877
731 Ga0495590_0025283 3300046457 Bacteria 2088
732 Ga0495590_0073097 3300046457 Bacteria 1205
733 Ga0495590_0074436 3300046457 Bacteria 1194
734 Ga0495590_0138886 3300046457 Bacteria 876
735 Ga0495591_000002 3300046458 Bacteria 455013
736 Ga0495591_000113 3300046458 Bacteria 93452
737 Ga0495591_003516 3300046458 Bacteria 8047
738 Ga0495591_003651 3300046458 Bacteria 7833
739 Ga0495591_004074 3300046458 Bacteria 7281
740 Ga0495591_008694 3300046458 Bacteria 4130
741 Ga0495591_009701 3300046458 Bacteria 3799
742 Ga0495591_009752 3300046458 Bacteria 3784
743 Ga0495591_013527 3300046458 Bacteria 2976
744 Ga0495591_014025 3300046458 Bacteria 2900
745 Ga0495591_015116 3300046458 Bacteria 2738
746 Ga0495591_022913 3300046458 Bacteria 2010
747 Ga0495591_034834 3300046458 Bacteria 1478
748 Ga0495591_036110 3300046458 Bacteria 1441
749 Ga0495591_044438 3300046458 Bacteria 1244
750 Ga0495591_051672 3300046458 Bacteria 1120
751 Ga0495591_073907 3300046458 Bacteria 880
752 Ga0495638_0031008 3300046460 Bacteria 3437
753 Ga0495638_0103993 3300046460 Bacteria 1694
754 Ga0495638_0192496 3300046460 Bacteria 1156
755 Ga0495638_0207299 3300046460 Bacteria 1103
756 Ga0495638_0238693 3300046460 Bacteria 1007
757 Ga0495651_0017632 3300046462 Bacteria 5525
758 Ga0495651_0126203 3300046462 Bacteria 1873
759 Ga0495651_0154753 3300046462 Bacteria 1649
760 Ga0495651_0187053 3300046462 Bacteria 1461
761 Ga0495653_0013706 3300046463 Bacteria 6606
762 Ga0495653_0019246 3300046463 Bacteria 5536
763 Ga0495653_0026743 3300046463 Bacteria 4624
764 Ga0495653_0107228 3300046463 Bacteria 2013
765 Ga0495653_0409177 3300046463 Bacteria 860
766 Ga0495650_0000623 3300046471 Bacteria 47691
767 Ga0495650_0002491 3300046471 Bacteria 14791
768 Ga0495650_0003593 3300046471 Bacteria 11187
769 Ga0495650_0067092 3300046471 Bacteria 1418
770 Ga0495650_0073259 3300046471 Bacteria 1338
771 Ga0495650_0089405 3300046471 Bacteria 1174
772 Ga0495580_0002103 3300046472 Bacteria 17475
773 Ga0495605_0000048 3300046474 Bacteria 170182
774 Ga0495605_0000100 3300046474 Bacteria 109002
775 Ga0495605_0000122 3300046474 Bacteria 101994
776 Ga0495605_0000157 3300046474 Bacteria 86897
777 Ga0495605_0000339 3300046474 Bacteria 46440
778 Ga0495605_0001304 3300046474 Bacteria 16517
779 Ga0495605_0003104 3300046474 Bacteria 10020
780 Ga0495605_0007095 3300046474 Bacteria 6382
781 Ga0495605_0008405 3300046474 Bacteria 5836
782 Ga0495605_0009534 3300046474 Bacteria 5450
783 Ga0495605_0024062 3300046474 Bacteria 3191
784 Ga0495605_0040719 3300046474 Bacteria 2318
785 Ga0495605_0041933 3300046474 Bacteria 2277
786 Ga0495605_0060194 3300046474 Bacteria 1820
787 Ga0495605_0062160 3300046474 Bacteria 1784
788 Ga0495605_0072134 3300046474 Bacteria 1629
789 Ga0495605_0131142 3300046474 Bacteria 1130
790 Ga0495639_0003059 3300046475 Bacteria 7279
791 Ga0495639_0003490 3300046475 Bacteria 6800
792 Ga0495639_0143286 3300046475 Bacteria 1150
793 Ga0495584_0002441 3300046491 Bacteria 10538
794 Ga0495584_0007556 3300046491 Bacteria 5665
795 Ga0495584_0008229 3300046491 Bacteria 5406
796 Ga0495584_0017198 3300046491 Bacteria 3684
797 Ga0495584_0022541 3300046491 Bacteria 3194
798 Ga0495584_0026803 3300046491 Bacteria 2920
799 Ga0495584_0073146 3300046491 Bacteria 1723
800 Ga0495584_0106135 3300046491 Bacteria 1420
801 Ga0495584_0124228 3300046491 Bacteria 1307
802 Ga0495584_0166746 3300046491 Bacteria 1119
803 Ga0495585_0010646 3300046492 Bacteria 5464
804 Ga0495585_0025718 3300046492 Bacteria 3367
805 Ga0495585_0036941 3300046492 Bacteria 2752
806 Ga0495585_0058636 3300046492 Bacteria 2123
807 Ga0495585_0116298 3300046492 Bacteria 1418
808 Ga0495594_0026034 3300046499 Bacteria 3145
809 Ga0495594_0028474 3300046499 Bacteria 3015
810 Ga0495596_0000060 3300046500 Bacteria 79429
811 Ga0495596_0008186 3300046500 Bacteria 4666
812 Ga0495596_0088404 3300046500 Bacteria 1202
813 Ga0495607_0000025 3300046501 Bacteria 159379
814 Ga0495607_0000700 3300046501 Bacteria 32278
815 Ga0495607_0004307 3300046501 Bacteria 10503
816 Ga0495607_0009429 3300046501 Bacteria 6608
817 Ga0495607_0010126 3300046501 Bacteria 6345
818 Ga0495607_0013887 3300046501 Bacteria 5262
819 Ga0495607_0020703 3300046501 Bacteria 4151
820 Ga0495607_0023824 3300046501 Bacteria 3825
821 Ga0495607_0027473 3300046501 Bacteria 3517
822 Ga0495607_0027597 3300046501 Bacteria 3507
823 Ga0495607_0032656 3300046501 Bacteria 3174
824 Ga0495607_0036551 3300046501 Bacteria 2957
825 Ga0495607_0047097 3300046501 Bacteria 2527
826 Ga0495607_0052257 3300046501 Bacteria 2367
827 Ga0495607_0071229 3300046501 Bacteria 1938
828 Ga0495607_0087140 3300046501 Bacteria 1700
829 Ga0495607_0105796 3300046501 Bacteria 1499
830 Ga0495607_0113072 3300046501 Bacteria 1436
831 Ga0495607_0124743 3300046501 Bacteria 1347
832 Ga0495607_0229300 3300046501 Bacteria 904
833 Ga0495583_0000096 3300046506 Bacteria 151090
834 Ga0495583_0000174 3300046506 Bacteria 109079
835 Ga0495583_0002655 3300046506 Bacteria 14891
836 Ga0495583_0005999 3300046506 Bacteria 8060
837 Ga0495583_0006439 3300046506 Bacteria 7678
838 Ga0495583_0007722 3300046506 Bacteria 6698
839 Ga0495583_0007740 3300046506 Bacteria 6687
840 Ga0495583_0017638 3300046506 Bacteria 3783
841 Ga0495583_0021365 3300046506 Bacteria 3331
842 Ga0495583_0056286 3300046506 Bacteria 1774
843 Ga0495606_0002388 3300046507 Bacteria 22020
844 Ga0495606_0007622 3300046507 Bacteria 9623
845 Ga0495606_0008130 3300046507 Bacteria 9189
846 Ga0495606_0011278 3300046507 Bacteria 7308
847 Ga0495606_0013494 3300046507 Bacteria 6445
848 Ga0495606_0014237 3300046507 Bacteria 6221
849 Ga0495606_0025647 3300046507 Bacteria 4216
850 Ga0495606_0035068 3300046507 Bacteria 3434
851 Ga0495606_0062812 3300046507 Bacteria 2369
852 Ga0495606_0067153 3300046507 Bacteria 2271
853 Ga0495606_0154542 3300046507 Bacteria 1343
854 Ga0495606_0157725 3300046507 Bacteria 1326
855 Ga0495606_0339071 3300046507 Bacteria 801
856 Ga0495606_0345354 3300046507 Bacteria 791
857 Ga0495608_0008033 3300046511 Bacteria 7416
858 Ga0495610_0000793 3300046512 Bacteria 29614
859 Ga0495610_0011986 3300046512 Bacteria 5252
860 Ga0495610_0019717 3300046512 Bacteria 3763
861 Ga0495610_0021338 3300046512 Bacteria 3564
862 Ga0495610_0023286 3300046512 Bacteria 3371
863 Ga0495610_0025576 3300046512 Bacteria 3164
864 Ga0495610_0027599 3300046512 Bacteria 3014
865 Ga0495610_0036476 3300046512 Bacteria 2512
866 Ga0495610_0063291 3300046512 Bacteria 1752
867 Ga0495610_0065205 3300046512 Bacteria 1719
868 Ga0495610_0085897 3300046512 Bacteria 1434
869 Ga0495610_0115229 3300046512 Bacteria 1185
870 Ga0495610_0115843 3300046512 Bacteria 1181
871 Ga0495610_0127871 3300046512 Bacteria 1106
872 Ga0495616_0011878 3300046513 Bacteria 4963
873 Ga0495616_0015111 3300046513 Bacteria 4296
874 Ga0495616_0025697 3300046513 Bacteria 3143
875 Ga0495616_0026041 3300046513 Bacteria 3117
876 Ga0495616_0028635 3300046513 Bacteria 2948
877 Ga0495616_0058116 3300046513 Bacteria 1905
878 Ga0495616_0082227 3300046513 Bacteria 1538
879 Ga0495616_0095331 3300046513 Bacteria 1402
880 Ga0495618_0014135 3300046514 Bacteria 4860
881 Ga0495620_0000085 3300046515 Bacteria 77879
882 Ga0495620_0000306 3300046515 Bacteria 34954
883 Ga0495620_0006325 3300046515 Bacteria 6518
884 Ga0495620_0010688 3300046515 Bacteria 4830
885 Ga0495620_0012319 3300046515 Bacteria 4425
886 Ga0495620_0015484 3300046515 Bacteria 3848
887 Ga0495620_0018041 3300046515 Bacteria 3502
888 Ga0495620_0019621 3300046515 Bacteria 3320
889 Ga0495620_0027695 3300046515 Bacteria 2648
890 Ga0495628_0000076 3300046516 Bacteria 78344
891 Ga0495628_0011291 3300046516 Bacteria 7555
892 Ga0495628_0145649 3300046516 Bacteria 1806
893 Ga0495631_0002255 3300046518 Bacteria 11055
894 Ga0495631_0018449 3300046518 Bacteria 3283
895 Ga0495631_0018531 3300046518 Bacteria 3275
896 Ga0495631_0033479 3300046518 Bacteria 2308
897 Ga0495631_0084394 3300046518 Bacteria 1368
898 Ga0495631_0123550 3300046518 Bacteria 1113
899 Ga0495632_0000843 3300046519 Bacteria 27042
900 Ga0495632_0007773 3300046519 Bacteria 6685
901 Ga0495632_0015914 3300046519 Bacteria 4199
902 Ga0495632_0017927 3300046519 Bacteria 3894
903 Ga0495632_0020548 3300046519 Bacteria 3571
904 Ga0495632_0023533 3300046519 Bacteria 3289
905 Ga0495632_0025244 3300046519 Bacteria 3145
906 Ga0495632_0028338 3300046519 Bacteria 2923
907 Ga0495632_0052463 3300046519 Bacteria 2005
908 Ga0495632_0095995 3300046519 Bacteria 1400
909 Ga0495632_0102171 3300046519 Bacteria 1350
910 Ga0495632_0109272 3300046519 Bacteria 1299
911 Ga0495632_0139413 3300046519 Bacteria 1125
912 Ga0495637_0000301 3300046520 Bacteria 38275
913 Ga0495637_0000948 3300046520 Bacteria 18540
914 Ga0495637_0007787 3300046520 Bacteria 5292
915 Ga0495637_0009362 3300046520 Bacteria 4778
916 Ga0495637_0010322 3300046520 Bacteria 4523
917 Ga0495637_0015564 3300046520 Bacteria 3568
918 Ga0495637_0019071 3300046520 Bacteria 3175
919 Ga0495637_0020136 3300046520 Bacteria 3073
920 Ga0495637_0033696 3300046520 Bacteria 2247
921 Ga0495637_0035009 3300046520 Bacteria 2195
922 Ga0495637_0046098 3300046520 Bacteria 1845
923 Ga0495637_0050312 3300046520 Bacteria 1748
924 Ga0495637_0056721 3300046520 Bacteria 1620
925 Ga0495637_0062852 3300046520 Bacteria 1518
926 Ga0495637_0129753 3300046520 Bacteria 963
927 Ga0495643_0000017 3300046522 Bacteria 313381
928 Ga0495643_0009169 3300046522 Bacteria 6178
929 Ga0495643_0024262 3300046522 Bacteria 3441
930 Ga0495643_0032085 3300046522 Bacteria 2918
931 Ga0495643_0092113 3300046522 Bacteria 1562
932 Ga0495643_0142913 3300046522 Bacteria 1191
933 Ga0495643_0163289 3300046522 Bacteria 1094
934 Ga0495643_0210030 3300046522 Bacteria 929
935 Ga0495643_0293515 3300046522 Bacteria 743
936 Ga0495644_0008107 3300046523 Bacteria 4040
937 Ga0495644_0010436 3300046523 Bacteria 3580
938 Ga0495644_0015458 3300046523 Bacteria 2922
939 Ga0495644_0018365 3300046523 Bacteria 2671
940 Ga0495648_0005408 3300046524 Bacteria 10618
941 Ga0495648_0006603 3300046524 Bacteria 9421
942 Ga0495648_0017221 3300046524 Bacteria 5174
943 Ga0495648_0018140 3300046524 Bacteria 5000
944 Ga0495648_0031268 3300046524 Bacteria 3507
945 Ga0495648_0039184 3300046524 Bacteria 3018
946 Ga0495648_0040940 3300046524 Bacteria 2932
947 Ga0495648_0042386 3300046524 Bacteria 2863
948 Ga0495648_0094394 3300046524 Bacteria 1666
949 Ga0495648_0103956 3300046524 Bacteria 1560
950 Ga0495648_0131601 3300046524 Bacteria 1329
951 Ga0495648_0167299 3300046524 Bacteria 1130
952 Ga0495648_0187893 3300046524 Bacteria 1044
953 Ga0495666_0003913 3300046526 Bacteria 7526
954 Ga0495666_0067328 3300046526 Bacteria 1706
955 Ga0495642_0003183 3300046528 Bacteria 6510
956 Ga0495642_0003695 3300046528 Bacteria 6007
957 Ga0495642_0048265 3300046528 Bacteria 1745
958 Ga0495652_0024033 3300046529 Bacteria 5398
959 Ga0495652_0048460 3300046529 Bacteria 3640
960 Ga0495652_0083701 3300046529 Bacteria 2625
961 Ga0495654_0000446 3300046530 Bacteria 35044
962 Ga0495654_0008111 3300046530 Bacteria 5821
963 Ga0495654_0011590 3300046530 Bacteria 4766
964 Ga0495654_0011680 3300046530 Bacteria 4744
965 Ga0495654_0013053 3300046530 Bacteria 4451
966 Ga0495654_0014627 3300046530 Bacteria 4173
967 Ga0495654_0017413 3300046530 Bacteria 3780
968 Ga0495654_0022733 3300046530 Bacteria 3252
969 Ga0495654_0022931 3300046530 Bacteria 3236
970 Ga0495654_0028942 3300046530 Bacteria 2829
971 Ga0495654_0031638 3300046530 Bacteria 2685
972 Ga0495654_0056740 3300046530 Bacteria 1892
973 Ga0495654_0080553 3300046530 Bacteria 1527
974 Ga0495654_0081388 3300046530 Bacteria 1517
975 Ga0495654_0094659 3300046530 Bacteria 1381
976 Ga0495654_0118859 3300046530 Bacteria 1198
977 Ga0495654_0126113 3300046530 Bacteria 1153
978 Ga0495654_0143185 3300046530 Bacteria 1063
979 Ga0495587_0014770 3300046536 Bacteria 4890
980 Ga0495609_0000012 3300046538 Bacteria 333994
981 Ga0495609_0000023 3300046538 Bacteria 269702
982 Ga0495609_0000088 3300046538 Bacteria 109269
983 Ga0495609_0000132 3300046538 Bacteria 80926
984 Ga0495609_0000649 3300046538 Bacteria 27069
985 Ga0495609_0007369 3300046538 Bacteria 5500
986 Ga0495609_0015268 3300046538 Bacteria 3596
987 Ga0495609_0028323 3300046538 Bacteria 2556
988 Ga0495609_0033448 3300046538 Bacteria 2334
989 Ga0495609_0087541 3300046538 Bacteria 1356
990 Ga0495609_0090652 3300046538 Bacteria 1330
991 Ga0495597_0000011 3300046542 Bacteria 221377
992 Ga0495597_0000185 3300046542 Bacteria 56031
993 Ga0495597_0001086 3300046542 Bacteria 20631
994 Ga0495597_0015149 3300046542 Bacteria 3654
995 Ga0495597_0016172 3300046542 Bacteria 3527
996 Ga0495597_0021177 3300046542 Bacteria 3023
997 Ga0495597_0028158 3300046542 Bacteria 2572
998 Ga0495597_0090729 3300046542 Bacteria 1297
999 Ga0495597_0120057 3300046542 Bacteria 1096
1000 Ga0495597_0135545 3300046542 Bacteria 1018
1001 Ga0495597_0151658 3300046542 Bacteria 950
1002 Ga0495645_0055410 3300046543 Bacteria 2879
1003 Ga0495622_0011715 3300046557 Bacteria 4054
1004 Ga0495622_0016547 3300046557 Bacteria 3435
1005 Ga0495622_0020286 3300046557 Bacteria 3094
1006 Ga0495622_0084911 3300046557 Bacteria 1456
1007 Ga0495622_0101775 3300046557 Bacteria 1316
1008 Ga0495633_0000034 3300046558 Bacteria 185552
1009 Ga0495633_0009015 3300046558 Bacteria 5549
1010 Ga0495633_0014506 3300046558 Bacteria 4117
1011 Ga0495656_0003752 3300046615 Bacteria 5158
1012 Ga0495656_0082991 3300046615 Bacteria 1450
1013 Ga0495656_0114758 3300046615 Bacteria 1264
1014 Ga0495668_0006815 3300046616 Bacteria 7416
1015 Ga0495668_0016904 3300046616 Bacteria 4236
1016 Ga0495668_0026872 3300046616 Bacteria 3263
1017 Ga0495668_0086948 3300046616 Bacteria 1714
1018 Ga0495668_0198571 3300046616 Bacteria 1098
1019 Ga0495634_0016357 3300046642 Bacteria 5305
1020 Ga0495634_0052805 3300046642 Bacteria 2724
1021 Ga0495634_0126500 3300046642 Bacteria 1633
1022 Ga0495611_0001661 3300046648 Bacteria 10790
1023 Ga0495611_0004094 3300046648 Bacteria 6345
1024 Ga0495611_0004457 3300046648 Bacteria 6060
1025 Ga0495611_0082749 3300046648 Bacteria 1477
1026 Ga0495611_0168905 3300046648 Bacteria 1022
1027 Ga0495625_0000061 3300046660 Bacteria 179140
1028 Ga0495625_0001913 3300046660 Bacteria 23538
1029 Ga0495625_0012656 3300046660 Bacteria 6828
1030 Ga0495625_0014555 3300046660 Bacteria 6271
1031 Ga0495625_0038915 3300046660 Bacteria 3476
1032 Ga0495625_0045837 3300046660 Bacteria 3159
1033 Ga0495625_0201382 3300046660 Bacteria 1314
1034 Ga0495625_0209300 3300046660 Bacteria 1283
1035 Ga0495625_0230565 3300046660 Bacteria 1209
1036 Ga0495635_0041374 3300046663 Bacteria 3183
1037 Ga0495635_0155319 3300046663 Bacteria 1557
1038 Ga0495659_0002669 3300046664 Bacteria 5744
1039 Ga0495659_0077951 3300046664 Bacteria 1252
1040 Ga0495661_0000004 3300046665 Bacteria 555340
1041 Ga0495661_0000036 3300046665 Bacteria 164694
1042 Ga0495661_0000060 3300046665 Bacteria 131162
1043 Ga0495661_0000187 3300046665 Bacteria 71327
1044 Ga0495661_0001218 3300046665 Bacteria 22323
1045 Ga0495661_0002367 3300046665 Bacteria 14543
1046 Ga0495661_0009192 3300046665 Bacteria 6790
1047 Ga0495661_0048174 3300046665 Bacteria 2590
1048 Ga0495661_0097426 3300046665 Bacteria 1661
1049 Ga0495661_0140827 3300046665 Bacteria 1312
1050 Ga0495661_0162307 3300046665 Bacteria 1198
1051 Ga0495588_0158347 3300046674 Bacteria 1197
1052 Ga0495588_0274324 3300046674 Bacteria 888
1053 Ga0495657_0100484 3300046675 Bacteria 1844
1054 Ga0495657_0220054 3300046675 Bacteria 1151
1055 Ga0495599_0034503 3300046678 Bacteria 3178
1056 Ga0495623_0006955 3300046679 Bacteria 7353
1057 Ga0495623_0039096 3300046679 Bacteria 3032
1058 Ga0495646_0003698 3300046680 Bacteria 9547
1059 Ga0495669_0008374 3300046684 Bacteria 4346
1060 Ga0495613_0122405 3300046689 Bacteria 1867
1061 Ga0495613_0415467 3300046689 Bacteria 916
1062 Ga0495624_0011454 3300046690 Bacteria 6094
1063 Ga0495624_0020811 3300046690 Bacteria 4359
1064 Ga0495624_0030721 3300046690 Bacteria 3497
1065 Ga0495670_0024067 3300046691 Bacteria 3007
1066 Ga0495670_0025848 3300046691 Bacteria 2905
1067 Ga0495670_0032353 3300046691 Bacteria 2601
1068 Ga0495670_0038481 3300046691 Bacteria 2384
1069 Ga0495670_0056069 3300046691 Bacteria 1976
1070 Ga0495670_0078241 3300046691 Bacteria 1682
1071 Ga0495670_0244214 3300046691 Bacteria 956
1072 Ga0495670_0369036 3300046691 Bacteria 773
1073 Ga0495671_0000662 3300046692 Bacteria 24991
1074 Ga0495671_0001738 3300046692 Bacteria 14119
1075 Ga0495671_0001929 3300046692 Bacteria 13311
1076 Ga0495671_0004125 3300046692 Bacteria 8757
1077 Ga0495671_0023909 3300046692 Bacteria 3189
1078 Ga0495671_0028439 3300046692 Bacteria 2879
1079 Ga0495671_0028502 3300046692 Bacteria 2875
1080 Ga0495671_0035860 3300046692 Bacteria 2516
1081 Ga0495671_0054514 3300046692 Bacteria 1982
1082 Ga0495671_0059564 3300046692 Bacteria 1886
1083 Ga0495671_0060744 3300046692 Bacteria 1865
1084 Ga0495671_0078233 3300046692 Bacteria 1621
1085 Ga0495671_0086076 3300046692 Bacteria 1539
1086 Ga0495671_0100340 3300046692 Bacteria 1415
1087 Ga0495671_0125138 3300046692 Bacteria 1253
1088 Ga0495671_0144353 3300046692 Bacteria 1159
1089 Ga0495649_0007545 3300046694 Bacteria 6620
1090 Ga0495649_0013292 3300046694 Bacteria 4753
1091 Ga0495649_0015889 3300046694 Bacteria 4276
1092 Ga0495649_0023844 3300046694 Bacteria 3416
1093 Ga0495649_0030657 3300046694 Bacteria 2969
1094 Ga0495649_0056291 3300046694 Bacteria 2123
1095 Ga0495649_0064754 3300046694 Bacteria 1962
1096 Ga0495649_0072808 3300046694 Bacteria 1841
1097 Ga0495649_0078469 3300046694 Bacteria 1766
1098 Ga0495649_0080867 3300046694 Bacteria 1737
1099 Ga0495649_0096429 3300046694 Bacteria 1574
1100 Ga0495649_0104176 3300046694 Bacteria 1506
1101 Ga0495589_0003318 3300046794 Bacteria 8734
1102 Ga0495589_0010874 3300046794 Bacteria 4728
1103 Ga0495589_0021478 3300046794 Bacteria 3298
1104 Ga0495589_0022326 3300046794 Bacteria 3229
1105 Ga0495589_0082550 3300046794 Bacteria 1562
1106 Ga0495589_0231540 3300046794 Bacteria 866
1107 Ga0495600_0003938 3300046809 Bacteria 8822
1108 Ga0495600_0179248 3300046809 Bacteria 1365
1109 Ga0495600_0185820 3300046809 Bacteria 1338
1110 Ga0495600_0204923 3300046809 Bacteria 1265
1111 Ga0495660_0003401 3300046810 Bacteria 9847
1112 Ga0495660_0003415 3300046810 Bacteria 9832
1113 Ga0495660_0011226 3300046810 Bacteria 5201
1114 Ga0495660_0026559 3300046810 Bacteria 3281
1115 Ga0495660_0028351 3300046810 Bacteria 3164
1116 Ga0495660_0028386 3300046810 Bacteria 3161
1117 Ga0495660_0038247 3300046810 Bacteria 2668
1118 Ga0495660_0050839 3300046810 Bacteria 2256
1119 Ga0495660_0053651 3300046810 Bacteria 2187
1120 Ga0495660_0065478 3300046810 Bacteria 1939
1121 Ga0495660_0089028 3300046810 Bacteria 1607
1122 Ga0495660_0097599 3300046810 Bacteria 1517
1123 Ga0495660_0160907 3300046810 Bacteria 1101
1124 Ga0495660_0176078 3300046810 Bacteria 1038
1125 Ga0495660_0210676 3300046810 Bacteria 922
1126 Ga0495604_0000948 3300047317 Bacteria 24198
1127 Ga0495604_0050468 3300047317 Bacteria 3230
1128 Ga0495604_0094930 3300047317 Bacteria 2204
1129 Ga0495604_0182182 3300047317 Bacteria 1468
1130 Ga0495604_0218715 3300047317 Bacteria 1312
1131 Ga0495636_0011170 3300047318 Bacteria 3552
1132 Ga0495674_0093556 3300047319 Bacteria 2565
1133 Ga0495672_0006253 3300047320 Bacteria 9279
1134 Ga0495672_0007817 3300047320 Bacteria 7988
1135 Ga0495672_0008177 3300047320 Bacteria 7759
1136 Ga0495672_0010931 3300047320 Bacteria 6438
1137 Ga0495672_0013983 3300047320 Bacteria 5516
1138 Ga0495672_0017033 3300047320 Bacteria 4868
1139 Ga0495672_0017358 3300047320 Bacteria 4815
1140 Ga0495672_0018955 3300047320 Bacteria 4552
1141 Ga0495672_0025697 3300047320 Bacteria 3764
1142 Ga0495672_0032878 3300047320 Bacteria 3219
1143 Ga0495672_0036278 3300047320 Bacteria 3028
1144 Ga0495672_0037415 3300047320 Bacteria 2969
1145 Ga0495672_0040141 3300047320 Bacteria 2840
1146 Ga0495672_0042164 3300047320 Bacteria 2754
1147 Ga0495672_0072442 3300047320 Bacteria 1946
1148 Ga0495672_0088004 3300047320 Bacteria 1713
1149 Ga0495672_0100895 3300047320 Bacteria 1565
1150 Ga0495672_0108685 3300047320 Bacteria 1492
1151 Ga0495672_0165702 3300047320 Bacteria 1131
1152 Ga0495672_0242159 3300047320 Bacteria 880
1153 Ga0495676_0000011 3300047321 Bacteria 242612
1154 Ga0495676_0020361 3300047321 Bacteria 5820
1155 Ga0495676_0173689 3300047321 Bacteria 1514
1156 Ga0495680_0055612 3300047322 Bacteria 3068
1157 Ga0495680_0342418 3300047322 Bacteria 1042
1158 Ga0495683_0000028 3300047323 Bacteria 153672
1159 Ga0495683_0000034 3300047323 Bacteria 148959
1160 Ga0495683_0000070 3300047323 Bacteria 108186
1161 Ga0495683_0017499 3300047323 Bacteria 3714
1162 Ga0495683_0022075 3300047323 Bacteria 3274
1163 Ga0495683_0057785 3300047323 Bacteria 1927
1164 Ga0495687_006777 3300047443 Bacteria 6928
1165 Ga0495687_008366 3300047443 Bacteria 5927
1166 Ga0495687_008443 3300047443 Bacteria 5897
1167 Ga0495675_0039511 3300047444 Bacteria 3004
1168 Ga0495677_0019091 3300047445 Bacteria 2486
1169 Ga0495677_0093214 3300047445 Bacteria 1136
1170 Ga0495679_000028 3300047446 Bacteria 192300
1171 Ga0495679_000370 3300047446 Bacteria 34815
1172 Ga0495679_004083 3300047446 Bacteria 6837
1173 Ga0495679_013446 3300047446 Bacteria 3073
1174 Ga0495679_031520 3300047446 Bacteria 1709
1175 Ga0495679_054703 3300047446 Bacteria 1187
1176 Ga0495679_059342 3300047446 Bacteria 1125
1177 Ga0495673_0002589 3300047469 Bacteria 12590
1178 Ga0495673_0004790 3300047469 Bacteria 8369
1179 Ga0495673_0005801 3300047469 Bacteria 7392
1180 Ga0495673_0015551 3300047469 Bacteria 3917
1181 Ga0495673_0015946 3300047469 Bacteria 3855
1182 Ga0495673_0016029 3300047469 Bacteria 3844
1183 Ga0495673_0017738 3300047469 Bacteria 3604
1184 Ga0495673_0018232 3300047469 Bacteria 3545
1185 Ga0495673_0023496 3300047469 Bacteria 2997
1186 Ga0495673_0025842 3300047469 Bacteria 2814
1187 Ga0495673_0029397 3300047469 Bacteria 2593
1188 Ga0495673_0035779 3300047469 Bacteria 2284
1189 Ga0495673_0040254 3300047469 Bacteria 2113
1190 Ga0495673_0049794 3300047469 Bacteria 1842
1191 Ga0495673_0050604 3300047469 Bacteria 1822
1192 Ga0495673_0057994 3300047469 Bacteria 1670
1193 Ga0495673_0064001 3300047469 Bacteria 1566
1194 Ga0495673_0076174 3300047469 Bacteria 1399
1195 Ga0495673_0088590 3300047469 Bacteria 1268
1196 Ga0495673_0115752 3300047469 Bacteria 1066
1197 Ga0495673_0125643 3300047469 Bacteria 1012
1198 Ga0495673_0141971 3300047469 Bacteria 935
1199 Ga0495673_0174170 3300047469 Bacteria 818
1200 Ga0495681_0008476 3300047470 Bacteria 6447
1201 Ga0495681_0019090 3300047470 Bacteria 3754
1202 Ga0495681_0021856 3300047470 Bacteria 3437
1203 Ga0495681_0022771 3300047470 Bacteria 3343
1204 Ga0495681_0024639 3300047470 Bacteria 3163
1205 Ga0495681_0027271 3300047470 Bacteria 2957
1206 Ga0495681_0031133 3300047470 Bacteria 2706
1207 Ga0495681_0041865 3300047470 Bacteria 2221
1208 Ga0495681_0045559 3300047470 Bacteria 2098
1209 Ga0495681_0059234 3300047470 Bacteria 1771
1210 Ga0495681_0062733 3300047470 Bacteria 1708
1211 Ga0495681_0071169 3300047470 Bacteria 1575
1212 Ga0495681_0110542 3300047470 Bacteria 1190
1213 Ga0495681_0151488 3300047470 Bacteria 972
1214 Ga0495684_0095672 3300047471 Bacteria 2248
1215 Ga0495686_0104090 3300047472 Bacteria 1709
1216 Ga0495686_0113864 3300047472 Bacteria 1619
1217 Ga0495686_0142235 3300047472 Bacteria 1415
1218 Ga0495686_0148283 3300047472 Bacteria 1379
1219 Ga0495593_0078652 3300047673 Bacteria 1708
1220 Ga0495593_0127608 3300047673 Bacteria 1292
1221 Ga0495593_0135498 3300047673 Bacteria 1248
1222 Ga0495602_0009002 3300048088 Bacteria 10403
1223 Ga0495602_0376219 3300048088 Bacteria 1018
1224 Ga0495626_0000024 3300048091 Bacteria 214179
1225 Ga0495626_0006473 3300048091 Bacteria 6665
1226 Ga0495626_0007135 3300048091 Bacteria 6253
1227 Ga0495626_0016350 3300048091 Bacteria 3770
1228 Ga0495626_0022425 3300048091 Bacteria 3118
1229 Ga0495626_0044773 3300048091 Bacteria 2068
1230 Ga0495626_0052961 3300048091 Bacteria 1869
1231 Ga0495626_0070204 3300048091 Bacteria 1576
1232 Ga0495626_0076772 3300048091 Bacteria 1490
1233 Ga0496100_0039148 3300048903 Bacteria 3009
1234 Ga0496101_0009650 3300048904 Bacteria 6349
1235 Ga0496102_0004242 3300048905 Bacteria 12120
1236 Ga0496102_0004534 3300048905 Bacteria 11740
1237 Ga0496103_0013210 3300048906 Bacteria 4896
1238 Ga0496104_0137938 3300048907 Bacteria 2343
1239 Ga0496105_0002236 3300048908 Bacteria 14021
1240 Ga0496106_0011540 3300048909 Bacteria 6531
1241 Ga0496107_0315144 3300048910 Bacteria 1164
1242 Ga0496110_0038468 3300048913 Bacteria 4163
1243 Ga0496110_0195940 3300048913 Bacteria 1835
1244 Ga0496111_0187292 3300048914 Bacteria 1538
1245 Ga0496112_0441141 3300048915 Bacteria 1240
1246 Ga0496112_0569987 3300048915 Bacteria 1065
1247 Ga0496114_0002270 3300048917 Bacteria 14636
1248 Ga0496114_0102391 3300048917 Bacteria 2446
1249 Ga0496116_0001954 3300048919 Bacteria 22220
1250 Ga0496116_0006985 3300048919 Bacteria 10115
1251 Ga0496116_0020749 3300048919 Bacteria 4978
1252 Ga0496116_0022501 3300048919 Bacteria 4722
1253 Ga0496116_0029771 3300048919 Bacteria 3930
1254 Ga0496116_0041683 3300048919 Bacteria 3147
1255 Ga0496116_0065419 3300048919 Bacteria 2332
1256 Ga0496116_0117438 3300048919 Bacteria 1548
1257 Ga0496116_0135888 3300048919 Bacteria 1392
1258 Ga0496116_0138478 3300048919 Bacteria 1373
1259 Ga0496117_0004774 3300048920 Bacteria 14697
1260 Ga0496117_0012455 3300048920 Bacteria 7491
1261 Ga0496117_0029302 3300048920 Bacteria 4247
1262 Ga0496117_0087048 3300048920 Bacteria 2026
1263 Ga0496117_0124601 3300048920 Bacteria 1575
1264 Ga0496117_0147306 3300048920 Bacteria 1399
1265 Ga0496117_0159215 3300048920 Bacteria 1325
1266 Ga0496118_0014455 3300048921 Bacteria 7390
1267 Ga0496118_0073811 3300048921 Bacteria 2441
1268 Ga0496118_0095396 3300048921 Bacteria 2030
1269 Ga0496118_0110003 3300048921 Bacteria 1832
1270 Ga0496118_0141186 3300048921 Bacteria 1526
1271 Ga0496118_0182613 3300048921 Bacteria 1265
1272 Ga0496118_0206247 3300048921 Bacteria 1158
1273 Ga0496119_0052709 3300048922 Bacteria 2490
1274 Ga0496119_0191494 3300048922 Bacteria 1065
1275 Ga0496120_0005221 3300048923 Bacteria 10458
1276 Ga0496120_0015311 3300048923 Bacteria 5065
1277 Ga0496121_0001365 3300048924 Bacteria 41600
1278 Ga0496121_0013843 3300048924 Bacteria 8630
1279 Ga0496121_0015990 3300048924 Bacteria 7781
1280 Ga0496121_0016038 3300048924 Bacteria 7766
1281 Ga0496121_0017647 3300048924 Bacteria 7270
1282 Ga0496121_0043798 3300048924 Bacteria 3870
1283 Ga0496121_0086255 3300048924 Bacteria 2467
1284 Ga0496121_0096435 3300048924 Bacteria 2295
1285 Ga0496121_0155626 3300048924 Bacteria 1677
1286 Ga0496121_0221953 3300048924 Bacteria 1330
1287 Ga0496121_0300223 3300048924 Bacteria 1090
1288 Ga0496121_0484260 3300048924 Bacteria 789
1289 Ga0496122_0000449 3300048925 Bacteria 85961
1290 Ga0496122_0000616 3300048925 Bacteria 73030
1291 Ga0496122_0000669 3300048925 Bacteria 68904
1292 Ga0496122_0001392 3300048925 Bacteria 39241
1293 Ga0496122_0003626 3300048925 Bacteria 20083
1294 Ga0496122_0011766 3300048925 Bacteria 8813
1295 Ga0496122_0020263 3300048925 Bacteria 6021
1296 Ga0496122_0038861 3300048925 Bacteria 3803
1297 Ga0496122_0071453 3300048925 Bacteria 2473
1298 Ga0496122_0123299 3300048925 Bacteria 1665
1299 Ga0496122_0127065 3300048925 Bacteria 1629
1300 Ga0496123_0000263 3300048926 Bacteria 105886
1301 Ga0496123_0000632 3300048926 Bacteria 58881
1302 Ga0496123_0000977 3300048926 Bacteria 44079
1303 Ga0496123_0001569 3300048926 Bacteria 31270
1304 Ga0496123_0008524 3300048926 Bacteria 9401
1305 Ga0496123_0065943 3300048926 Bacteria 2297
1306 Ga0496123_0067508 3300048926 Bacteria 2258
1307 Ga0496123_0071585 3300048926 Bacteria 2161
1308 Ga0496123_0090133 3300048926 Bacteria 1824
1309 Ga0496124_0000073 3300048927 Bacteria 219306
1310 Ga0496124_0007897 3300048927 Bacteria 11206
1311 Ga0496124_0015211 3300048927 Bacteria 7386
1312 Ga0496124_0015525 3300048927 Bacteria 7292
1313 Ga0496124_0050107 3300048927 Bacteria 3559
1314 Ga0496124_0081214 3300048927 Bacteria 2665
1315 Ga0496124_0087475 3300048927 Bacteria 2548
1316 Ga0496124_0174404 3300048927 Bacteria 1661
1317 Ga0496124_0381807 3300048927 Bacteria 985
1318 Ga0496125_0000168 3300048928 Bacteria 146364
1319 Ga0496125_0000319 3300048928 Bacteria 93727
1320 Ga0496125_0000947 3300048928 Bacteria 45544
1321 Ga0496125_0003314 3300048928 Bacteria 19714
1322 Ga0496125_0005089 3300048928 Bacteria 14806
1323 Ga0496125_0005136 3300048928 Bacteria 14724
1324 Ga0496125_0026564 3300048928 Bacteria 5271
1325 Ga0496125_0037898 3300048928 Bacteria 4184
1326 Ga0496125_0046824 3300048928 Bacteria 3624
1327 Ga0496125_0057758 3300048928 Bacteria 3139
1328 Ga0496125_0062306 3300048928 Bacteria 2984
1329 Ga0496125_0211080 3300048928 Bacteria 1261
1330 Ga0496126_0023661 3300048929 Bacteria 5949
1331 Ga0496126_0024217 3300048929 Bacteria 5864
1332 Ga0496126_0086476 3300048929 Bacteria 2763
1333 Ga0496126_0101023 3300048929 Bacteria 2523
1334 Ga0496126_0150981 3300048929 Bacteria 1991
1335 Ga0496126_0226004 3300048929 Bacteria 1570
1336 Ga0496126_0248988 3300048929 Bacteria 1481
1337 Ga0496126_0360461 3300048929 Bacteria 1187
1338 Ga0495678_000049 3300049459 Bacteria 163929
1339 Ga0495678_000160 3300049459 Bacteria 80551
1340 Ga0495678_009421 3300049459 Bacteria 4833
1341 Ga0495678_013793 3300049459 Bacteria 3782
1342 Ga0495678_018525 3300049459 Bacteria 3128
1343 Ga0495678_018970 3300049459 Bacteria 3079
1344 Ga0495678_020127 3300049459 Bacteria 2961
1345 Ga0495678_021976 3300049459 Bacteria 2798
1346 Ga0495678_025529 3300049459 Bacteria 2535
1347 Ga0495678_026414 3300049459 Bacteria 2479
1348 Ga0495678_053864 3300049459 Bacteria 1542
1349 Ga0495678_060446 3300049459 Bacteria 1425
1350 Ga0495678_102818 3300049459 Bacteria 987
1351 Ga0495682_0000090 3300049460 Bacteria 79463
1352 Ga0495682_0001506 3300049460 Bacteria 12391
1353 Ga0495682_0028204 3300049460 Bacteria 2081
1354 Ga0495682_0040104 3300049460 Bacteria 1717
1355 Ga0495682_0087915 3300049460 Bacteria 1116
1356 Ga0501238_007309 3300049671 Bacteria 1433
1357 Ga0501241_022199 3300049758 Bacteria 1172
1358 nmdc:mga00v17_11469_c1 3300050491 Bacteria 4870
1359 nmdc:mga00v17_188609_c1 3300050491 Bacteria 1331
1360 nmdc:mga00v17_50346_c1 3300050491 Bacteria 2177
1361 nmdc:mga0yw44_249364_c1 3300050492 Bacteria 1181
1362 nmdc:mga0k408_184357_c1 3300050493 Bacteria 1245
1363 nmdc:mga0k408_198142_c1 3300050493 Bacteria 1198
1364 nmdc:mga0k408_2992_c1 3300050493 Bacteria 8961
1365 nmdc:mga06z11_105374_c1 3300050494 Bacteria 1553
1366 nmdc:mga08x19_251483_c1 3300050514 Bacteria 1220
1367 nmdc:mga08x19_355381_c1 3300050514 Bacteria 1023
1368 Ga0495601_0019812 3300053077 Bacteria 4107
1369 Ga0500646_0000914 3300053090 Bacteria 8136
1370 Ga0500583_0006260 3300053092 Bacteria 4078
1371 Ga0500583_0179503 3300053092 Bacteria 1054
1372 Ga0500641_0022457 3300053096 Bacteria 2417
1373 Ga0500650_0065649 3300053098 Bacteria 1695
1374 Ga0500594_0011721 3300053118 Bacteria 2051
1375 Ga0500595_001205 3300053119 Bacteria 14280
1376 Ga0500618_023789 3300053125 Bacteria 1480
1377 Ga0500618_025568 3300053125 Bacteria 1414
1378 Ga0500655_004044 3300053133 Bacteria 2642
1379 Ga0500559_0000578 3300053136 Bacteria 25123
1380 Ga0500573_0034392 3300053140 Bacteria 2924
1381 Ga0500586_056689 3300053145 Bacteria 1359
1382 Ga0500604_0003723 3300053151 Bacteria 4077
1383 Ga0500619_003230 3300053154 Bacteria 3298
1384 2511249605 2511231003 Bacteria 5606035
1385 2511254814 2511231004 Bacteria 6669789
1386 2511266028 2511231006 Bacteria 6794709
1387 2511273340 2511231007 Bacteria 6306603
1388 2511275051 2511231008 Bacteria 6624100
1389 2511288501 2511231010 Bacteria 6373152
1390 2511297998 2511231011 Bacteria 6149768
1391 2511303991 2511231012 Bacteria 6738011
1392 2511311963 2511231014 Bacteria 6462302
1393 2511320679 2511231015 Bacteria 6598026
1394 2511327969 2511231016 Bacteria 6704427
1395 2511329712 2511231017 Bacteria 6503007
1396 2511335884 2511231018 Bacteria 6436256
1397 2511344754 2511231019 Bacteria 6520662
1398 2511349517 2511231020 Bacteria 6115223
1399 2511360140 2511231021 Bacteria 7302637
1400 2511365982 2511231022 Bacteria 6719296
1401 2511368993 2511231023 Bacteria 6808468
1402 2511384059 2511231026 Bacteria 5225445
1403 2511412133 2511231031 Bacteria 6558529
1404 2511827682 2511231156 Bacteria 6845832
1405 2512037785 2511231221 Bacteria 6846400
1406 2512326631 2512047018 Bacteria 6663241
1407 2514045004 2513237165 Bacteria 6771773
1408 2514045247 2513237165 Bacteria 6771773
1409 2514045305 2513237165 Bacteria 6771773
1410 2521560192 2521172590 Bacteria 5047645
1411 2550695313 2548876994 Bacteria 4904866
1412 2550695898 2548876994 Bacteria 4904866
1413 2553004989 2551306416 Bacteria 6152985
1414 2574431087 2574179768 Bacteria 4907129
1415 2583795681 2582580891 Bacteria 6800976
1416 2597860925 2597489887 Bacteria 6666321
1417 2597866672 2597489888 Bacteria 6179543
1418 2597872530 2597489889 Bacteria 6297495
1419 2599327552 2599185155 Bacteria 5827168
1420 2599400495 2599185167 Bacteria 6353609
1421 2599449819 2599185179 Bacteria 6611171
1422 2599485840 2599185185 Bacteria 6652270
1423 2599500304 2599185188 Bacteria 6164180
1424 2599505792 2599185189 Bacteria 5862825
1425 2599511893 2599185190 Bacteria 6285678
1426 2599516877 2599185191 Bacteria 6297582
1427 2599614472 2599185212 Bacteria 6765997
1428 2599768102 2599185248 Bacteria 6696816
1429 2599804620 2599185257 Bacteria 6492581
1430 2599879080 2599185288 Bacteria 6666191
1431 2599885538 2599185289 Bacteria 6778765
1432 2599892745 2599185290 Bacteria 6289611
1433 2599897252 2599185291 Bacteria 6775623
1434 2599902896 2599185292 Bacteria 6290804
1435 2599930673 2599185300 Bacteria 6062622
1436 2599942311 2599185302 Bacteria 5954930
1437 2599951494 2599185303 Bacteria 6512725
1438 2599954276 2599185304 Bacteria 5951361
1439 2599961961 2599185305 Bacteria 6748700
1440 2599965984 2599185306 Bacteria 6637356
1441 2599972351 2599185307 Bacteria 6194719
1442 2599977966 2599185308 Bacteria 6621546
1443 2599982881 2599185309 Bacteria 5969593
1444 2599988369 2599185310 Bacteria 6014457
1445 2599994030 2599185311 Bacteria 6354990
1446 2599999164 2599185312 Bacteria 5912071
1447 2600004265 2599185313 Bacteria 6658188
1448 2600012133 2599185314 Bacteria 6621749
1449 2600020445 2599185315 Bacteria 6771107
1450 2600026302 2599185316 Bacteria 6320029
1451 2600032047 2599185317 Bacteria 6435722
1452 2600036015 2599185318 Bacteria 6961590
1453 2600044580 2599185319 Bacteria 6637840
1454 2600046695 2599185320 Bacteria 5963263
1455 2600054877 2599185321 Bacteria 6764560
1456 2600061090 2599185322 Bacteria 6763055
1457 2600068003 2599185323 Bacteria 6688755
1458 2600071912 2599185324 Bacteria 6590677
1459 2600076500 2599185325 Bacteria 6324919
1460 2600358950 2600254930 Bacteria 6431253
1461 2600363506 2600254931 Bacteria 6734225
1462 2600444136 2600254954 Bacteria 5100516
1463 2601627449 2600255283 Bacteria 6061572
1464 2601693403 2600255296 Bacteria 5784754
1465 2601798521 2600255318 Bacteria 6383414
1466 2602008386 2600255389 Bacteria 5275336
1467 2606077415 2603880185 Bacteria 6379190
1468 2606129339 2603880199 Bacteria 6377649
1469 2621296804 2619619299 Bacteria 6649820
1470 2624483451 2623620443 Bacteria 6427864
1471 2624494976 2623620446 Bacteria 6500345
1472 2643843003 2643221565 Bacteria 6216018
1473 2643861719 2643221569 Bacteria 6064337
1474 2643872308 2643221571 Bacteria 6228673
1475 2643955591 2643221589 Bacteria 6250934
1476 2644020385 2643221602 Bacteria 6249926
1477 2644028505 2643221603 Bacteria 6147767
1478 2644184440 2643221633 Bacteria 6733554
1479 2644246219 2643221644 Bacteria 6865017
1480 2644283185 2643221650 Bacteria 7029547
1481 2644624726 2643221713 Bacteria 6554480
1482 2652546691 2651869719 Bacteria 6047974
1483 2671089598 2667528170 Bacteria 6786960
1484 2671128545 2667528176 Bacteria 6724917
1485 2671771627 2671180172 Bacteria 6495783
1486 2677897174 2675903420 Bacteria 6247433
1487 2678266191 2675903515 Bacteria 6580491
1488 2715749791 2713897148 Bacteria 5883533
1489 2715754809 2713897149 Bacteria 6506249
1490 2718636656 2718217725 Bacteria 5758958
1491 2723251408 2721755607 Bacteria 5841722
1492 2723876522 2721755763 Bacteria 4464185
1493 2738671624 2738541265 Bacteria 6594665
1494 2738690393 2738541271 Bacteria 5657310
1495 2738750018 2738541282 Bacteria 6593925
1496 2738807296 2738541294 Bacteria 6925949
1497 2738859058 2738541303 Bacteria 6591772
1498 2738894656 2738541309 Bacteria 6926455
1499 2739199100 2738543004 Bacteria 6381073
1500 2739252448 2738543013 Bacteria 5618633
1501 2739259039 2738543015 Bacteria 6750701
1502 2739266167 2738543016 Bacteria 5657564
1503 2739289968 2738543020 Bacteria 5718238
1504 2739295280 2738543021 Bacteria 5718241
1505 2739312464 2738543025 Bacteria 6600348
1506 2743740465 2740892503 Bacteria 6855563
1507 2745007423 2744054620 Bacteria 6551379
1508 2765571360 2765235838 Bacteria 5445269
1509 2774118335 2773857670 Bacteria 6407454
1510 2774135524 2773857673 Bacteria 6513460
1511 2784261773 2784132063 Bacteria 6262788
1512 2784313616 2784132072 Bacteria 6596533
1513 2794593797 2791355520 Bacteria 5948615
1514 2807408848 2806310737 Bacteria 5751088
1515 2807457179 2806310745 Bacteria 5742165
1516 2808855656 2808606361 Bacteria 6136259
1517 2808926782 2808606376 Bacteria 6248667
1518 2808928401 2808606377 Bacteria 6646337
1519 2808935507 2808606378 Bacteria 6177535
1520 2808948943 2808606380 Bacteria 6248705
1521 2808950416 2808606381 Bacteria 6646461
1522 2808959798 2808606382 Bacteria 6841132
1523 2808964115 2808606383 Bacteria 6138645
1524 2808976190 2808606385 Bacteria 6711065
1525 2808982470 2808606386 Bacteria 4471946
1526 2808994346 2808606388 Bacteria 6706662
1527 2808999049 2808606389 Bacteria 6138126
1528 2809033228 2808606395 Bacteria 6020352
1529 2809129703 2808606415 Bacteria 4576710
1530 2809149242 2808606419 Bacteria 4576925
1531 2809217227 2808606445 Bacteria 6057339
1532 2817494083 2816332298 Bacteria 6852809
1533 2819543929 2818991436 Bacteria 5376622
1534 2819592889 2818991445 Bacteria 4955017
1535 2819592919 2818991445 Bacteria 4955017
1536 2819616549 2818991449 Bacteria 5518009
1537 2819655175 2818991456 Bacteria 6123676
1538 2823425757 2823421272 Bacteria 5372474
1539 2825655053 2825651385 Bacteria 6715909
1540 2826581861 2826581358 Bacteria 5963467
1541 2834030994 2834028612 Bacteria 6354979
1542 2839099201 2839094727 Bacteria 5534556
1543 2842735689 2842733646 Bacteria 5716726
1544 2842749122 2842747753 Bacteria 5578255
1545 2842805863 2842805378 Bacteria 5385175
1546 2842816885 2842815866 Bacteria 5947510
1547 2842831245 2842826826 Bacteria 5974129
1548 2842833498 2842832357 Bacteria 5959113
1549 2842837941 2842837860 Bacteria 6066181
1550 2842845728 2842843487 Bacteria 6004777
1551 2842854151 2842849001 Bacteria 5924277
1552 2842855665 2842854478 Bacteria 6143501
1553 2844667141 2844665904 Bacteria 6817974
1554 2852616393 2852612431 Bacteria 6885235
1555 2852619383 2852618963 Bacteria 4577824
1556 2852659721 2852657418 Bacteria 6472974
1557 2852671361 2852667396 Bacteria 6885555
1558 2855732747 2855730933 Bacteria 7047938
1559 2855771499 2855767633 Bacteria 7049357
1560 2857553213 2857547612 Bacteria 6179999
1561 2857577578 2857576091 Bacteria 5465855
1562 2860341759 2860339153 Bacteria 6846989
1563 2860873068 2860867994 Bacteria 5645326
1564 2878035392 2878029506 Bacteria 6418441
1565 2880236039 2880230671 Bacteria 6140320
1566 2881415543 2881412998 Bacteria 6492157
1567 2884813274 2884811622 Bacteria 5552861
1568 2884838572 2884836552 Bacteria 5219991
1569 2884854863 2884852848 Bacteria 5221161
1570 2885195978 2885192300 Bacteria 5882526
1571 2891634427 2891633521 Bacteria 4602265
1572 2896156468 2896154374 Bacteria 5221518
1573 2897806768 2897803580 Bacteria 7000062
1574 2904435818 2904434214 Bacteria 6230908
1575 2904440767 2904439833 Bacteria 5931679
1576 2904480751 2904479285 Bacteria 5073931
1577 2904518915 2904518522 Bacteria 6068986
1578 2904535366 2904530477 Bacteria 5876334
1579 2904551402 2904550169 Bacteria 6221258
1580 2904588486 2904584206 Bacteria 6028872
1581 2904594626 2904589729 Bacteria 6113573
1582 2904605858 2904601388 Bacteria 5884906
1583 2908452628 2908446538 Bacteria 6829095
1584 2913042572 2913036834 Bacteria 6704877
1585 2919048933 2919046199 Bacteria 5567169
1586 2919065477 2919063839 Bacteria 6302690
1587 2919084835 2919079590 Bacteria 5946433
1588 2919389152 2919385768 Bacteria 5897293
1589 2919485699 2919481497 Bacteria 6907839
1590 2919488128 2919487758 Bacteria 5929766
1591 2919502515 2919501602 Bacteria 5286340
1592 2919700532 2919697872 Bacteria 6553725
1593 2923159558 2923153595 Bacteria 6870622
1594 2923513938 2923510766 Bacteria 5926163
1595 2923589041 2923586266 Bacteria 6565975
1596 2926064188 2926063275 Bacteria 5285848
1597 2928134200 2928130867 Bacteria 5467269
1598 2929149961 2929144301 Bacteria 6622272
1599 2929195192 2929189879 Bacteria 5930554
1600 2931372598 2931369376 Bacteria 6847892
1601 2931396457 2931390751 Bacteria 6273349
1602 2931398122 2931396565 Bacteria 7251677
1603 2939640764 2939636861 Bacteria 6297853
1604 2941482521
1605 2945930873 2945928738 Bacteria 6053221
1606 2945966903 2945961074 Bacteria 7342064
1607 2946013238 2946006987 Bacteria 6705746
1608 2946027945 2946027586 Bacteria 6049274
1609 2947234470 2947233263 Bacteria 6439278
1610 2969310216 2969304461 Bacteria 6601805
1611 2974294041 2974289157 Bacteria 6080362
1612 2984286556 2984286254 Bacteria 6702062
1613 2988731498 2988728565 Bacteria 6124362
1614 2998145438 2998139840 Bacteria 6073514
1615 2998344656 2998344455 Bacteria 4222996
1616 3007399357 3007395558 Bacteria 6755444
1617 3007425770 3007419365 Bacteria 7026924
1618 3007517224 3007511990 Bacteria 6481491
1619 3007618865 3007614139 Bacteria 6053559
1620 3007721799 3007718800 Bacteria 5971527
1621 3007859231 3007855910 Bacteria 5637581
1622 3007865065 3007861166 Bacteria 6045338
1623 3007866742 3007866637 Bacteria 5899198
1624 3007872938 3007872151 Bacteria 5268868
1625 639787418 639633007 Bacteria 4376040
1626 8015693656 8015687852 Bacteria 6613826
1627 8019777639 8019775933 Bacteria 6858656
1628 8029995466 8029995093 Bacteria 5990776
1629 8034965083 8034962539 Bacteria 4884839
1630 8054007067 8054002106 Bacteria 7987183
1631 8054285680 8054285046 Bacteria 6919322
1632 8054349543 8054347763 Bacteria 5901107
1633 8054508978 8054503363 Bacteria 6101651
1634 8054931855 8054929484 Bacteria 5599761
1635 8055776903 8055770955 Bacteria 6827675
1636 8055823949 8055817908 Bacteria 6609162
1637 8056131647 8056125926 Bacteria 6228218
1638 8056137353 8056131705 Bacteria 6107031
1639 8056140402 8056137416 Bacteria 6147080
1640 8056148814 8056143049 Bacteria 6307666
1641 8056151450 8056148874 Bacteria 6479865
1642 8056159743 8056155041 Bacteria 6486948
1643 8056163670 8056161164 Bacteria 6106669
1644 8056171269 8056166840 Bacteria 5820959
1645 8056182039 8056177738 Bacteria 6748268
1646 8056570507 8056569372 Bacteria 5997322
1647 Ga0055538_1000229
1648 MRS2a_Contig_718
1649 SwRhRL2b_contig_3259057
1650 JGI24741J21665_1006777
1651 JGI25155J39150_1000370
1652 JGI25155J39150_1000428
1653 JGI25155J39150_1000795
1654 JGI25155J39150_1001260
1655 JGI25156J39149_1000117
1656 JGI25156J39149_1000989
1657 JGI25156J39149_1002357
1658 JGI25162J39368_1000001
1659 JGI25162J39368_1000378
1660 JGI25162J39368_1004300
1661 JGI25162J39368_1004556
1662 JGI25154J39366_1000107
1663 JGI25154J39366_1000249
1664 JGI25154J39366_1000826
1665 JGI25154J39366_1004380
1666 JGI25157J39369_1000966
1667 JGI25157J39369_1001016
1668 JGI25163J39215_1001139
1669 JGI25164J39214_1000273
1670 JGI25151J46595_10001598
1671 JGI25151J46595_10001939
1672 JGI25165J46597_1000001
1673 JGI25165J46597_1000498
1674 rootH2_10020080
1675 rootL2_10082487
1676 Ga0055538_1000001
1677 Ga0055538_1000032
1678 Ga0055539_1000001
1679 Ga0055539_1000043
1680 Ga0055539_1000269
1681 Ga0055533_1000003
1682 Ga0055533_1000052
1683 Ga0055533_1000258
1684 Ga0055532_1000044
1685 Ga0055532_1000047
1686 Ga0055532_1000647
1687 Ga0055525_1000003
1688 Ga0055525_1000062
1689 Ga0055525_1000359
1690 Ga0055535_1002174
1691 Ga0055535_1006556
1692 Ga0055529_1008064
1693 Ga0055526_1002434
1694 Ga0055524_1000061
1695 Ga0055536_1000081
1696 Ga0055536_1000201
1697 Ga0055536_1000704
1698 Ga0055536_1011459
1699 Ga0055534_1000104
1700 Ga0055534_1000470
1701 Ga0055530_10000324
1702 Ga0055530_10000800
1703 Ga0055530_10001011
1704 Ga0055530_10001044
1705 Ga0055530_10003143
1706 Ga0055540_1000026
1707 Ga0055540_1000745
1708 Ga0055540_1003757
1709 Ga0055540_1003950
1710 Ga0055531_10000404
1711 Ga0055531_10001242
1712 Ga0055531_10006377
1713 Ga0055541_1000001
1714 Ga0055541_1000030
1715 Ga0055541_1000168
1716 Ga0065714_10000115
1717 Ga0065714_10007511
1718 Ga0065714_10009964
1719 Ga0065714_10015263
1720 Ga0065714_10016786
1721 Ga0065714_10018929
1722 Ga0065714_10040903
1723 Ga0065714_10065087
1724 Ga0065714_10065569
1725 Ga0065714_10072683
1726 Ga0065714_10078533
1727 Ga0065714_10092492
1728 Ga0065714_10129168
1729 Ga0065714_10135547
1730 Ga0065704_10008310
1731 Ga0065704_10024159
1732 Ga0065704_10073325
1733 Ga0065704_10076165
1734 Ga0065704_10080568
1735 Ga0065712_10067900
1736 Ga0065712_10068537
1737 Ga0065715_10117248
1738 Ga0070670_100001343
1739 Ga0070670_100005930
1740 Ga0070670_100024674
1741 Ga0070666_10044566
1742 Ga0070660_100439878
1743 Ga0070660_100663137
1744 Ga0070661_100000126
1745 Ga0070661_100568593
1746 Ga0070669_100000764
1747 Ga0070669_100002215
1748 Ga0070669_100010461
1749 Ga0070673_100336409
1750 Ga0070667_100025826
1751 Ga0070714_100523115
1752 Ga0070663_100590763
1753 Ga0070662_100000426
1754 Ga0070662_100025623
1755 Ga0068853_100002460
1756 Ga0068853_100167212
1757 Ga0068853_100247147
1758 Ga0070665_100045202
1759 Ga0070665_100055165
1760 Ga0070665_100244070
1761 Ga0070665_100289486
1762 Ga0070665_100719054
1763 Ga0070665_101406873
1764 Ga0068855_100000083
1765 Ga0068855_100075954
1766 Ga0068855_100156925
1767 Ga0068855_100230745
1768 Ga0070664_100002791
1769 Ga0070664_100385963
1770 Ga0068854_100009626
1771 Ga0068854_100042852
1772 Ga0068856_100045478
1773 Ga0068856_100062089
1774 Ga0068852_100010440
1775 Ga0068851_10000007
1776 Ga0075365_10085235
1777 Ga0075365_10145557
1778 Ga0075364_10129569
1779 Ga0075364_10373248
1780 Ga0075432_10011631
1781 Ga0075432_10028200
1782 Ga0075432_10032413
1783 Ga0075432_10074428
1784 Ga0070716_100037343
1785 Ga0075362_10034210
1786 Ga0075362_10037732
1787 Ga0075362_10108739
1788 Ga0075366_10005256
1789 Ga0075366_10024685
1790 Ga0075370_10004516
1791 Ga0075436_100042606
1792 Ga0075436_100176405
1793 Ga0075436_100235249
1794 Ga0075436_100269535
1795 Ga0075436_100494052
1796 Ga0075436_100536753
1797 Ga0079104_1000093
1798 Ga0079104_1000518
1799 Ga0079104_1000754
1800 Ga0079104_1001469
1801 Ga0079104_1010922
1802 Ga0099826_10000039
1803 Ga0099826_10004941
1804 Ga0105251_10000009
1805 Ga0105251_10000133
1806 Ga0105251_10004529
1807 Ga0105251_10006398
1808 Ga0105251_10008326
1809 Ga0105251_10009680
1810 Ga0105251_10014310
1811 Ga0105251_10016733
1812 Ga0105251_10017668
1813 Ga0105251_10034134
1814 Ga0105251_10037689
1815 Ga0105251_10044660
1816 Ga0105251_10162951
1817 Ga0105251_10175120
1818 Ga0105244_10000008
1819 Ga0105244_10001453
1820 Ga0105244_10003377
1821 Ga0105244_10008099
1822 Ga0105244_10034271
1823 Ga0105244_10061120
1824 Ga0105244_10067665
1825 Ga0105244_10076791
1826 Ga0105244_10097516
1827 Ga0105244_10098580
1828 Ga0105244_10276542
1829 Ga0105250_10000605
1830 Ga0105250_10002587
1831 Ga0105250_10003447
1832 Ga0105250_10003816
1833 Ga0105250_10004205
1834 Ga0105250_10011988
1835 Ga0105250_10030034
1836 Ga0105250_10032680
1837 Ga0105250_10057968
1838 Ga0105250_10101348
1839 Ga0105240_10003351
1840 Ga0105240_10028663
1841 Ga0105240_10118802
1842 Ga0105243_10007062
1843 Ga0105243_10007538
1844 Ga0105243_10013877
1845 Ga0105243_10053584
1846 Ga0105243_10170509
1847 Ga0105242_10004917
1848 Ga0105242_10033598
1849 Ga0105242_10164967
1850 Ga0105242_10440437
1851 Ga0105237_10005994
1852 Ga0105237_10093575
1853 Ga0105237_10149362
1854 Ga0105237_10268524
1855 Ga0105237_10340359
1856 Ga0105238_10000037
1857 Ga0105238_10080399
1858 Ga0105239_10013749
1859 Ga0105239_10092298
1860 Ga0105246_10000162
1861 Ga0105246_10000432
1862 Ga0105246_10019035
1863 Ga0105246_10025124
1864 Ga0105246_10111801
1865 Ga0105246_10169006
1866 Ga0157345_1000059
1867 Ga0157373_10003992
1868 Ga0157373_10007482
1869 Ga0157373_10011402
1870 Ga0157373_10043148
1871 Ga0157373_10043917
1872 Ga0157373_10085841
1873 Ga0157373_10129501
1874 Ga0157373_10152386
1875 Ga0157373_10178942
1876 Ga0157371_10000039
1877 Ga0157371_10011165
1878 Ga0157371_10025849
1879 Ga0157371_10115285
1880 Ga0157371_10163806
1881 Ga0157371_10227328
1882 Ga0157370_10000070
1883 Ga0157370_10011932
1884 Ga0157370_10039117
1885 Ga0157370_10052578
1886 Ga0157370_10072242
1887 Ga0157370_10105658
1888 Ga0157370_10141128
1889 Ga0157370_10386291
1890 Ga0157369_10039350
1891 Ga0157369_10052988
1892 Ga0157369_10086792
1893 Ga0157369_10094667
1894 Ga0157369_10095256
1895 Ga0157369_10133358
1896 Ga0157369_10138981
1897 Ga0163162_10048268
1898 Ga0163162_10770004
1899 Ga0163162_11101635
1900 Ga0157372_10109402
1901 Ga0157372_10131463
1902 Ga0157375_10086735
1903 Ga0157375_10090932
1904 Ga0157375_10249140
1905 Ga0157375_10382958
1906 Ga0157375_10911217
1907 Ga0157380_10410785
1908 Ga0182008_10000662
1909 Ga0182008_10003064
1910 Ga0182008_10005030
1911 Ga0182008_10013293
1912 Ga0182008_10013647
1913 Ga0182008_10024543
1914 Ga0182008_10025165
1915 Ga0182008_10026256
1916 Ga0182008_10052314
1917 Ga0182008_10097056
1918 Ga0182008_10153588
1919 Ga0157376_10340397
1920 Ga0182006_1006448
1921 Ga0182006_1010871
1922 Ga0182006_1014777
1923 Ga0182006_1016147
1924 Ga0182006_1020055
1925 Ga0182006_1020526
1926 Ga0182006_1023930
1927 Ga0182006_1028676
1928 Ga0182006_1044379
1929 Ga0182006_1050795
1930 Ga0182006_1068441
1931 Ga0182006_1148228
1932 Ga0182007_10001352
1933 Ga0182007_10001934
1934 Ga0182007_10006630
1935 Ga0182007_10017947
1936 Ga0182007_10019671
1937 Ga0182007_10025132
1938 Ga0182007_10026086
1939 Ga0182005_1000183
1940 Ga0182005_1007397
1941 Ga0182005_1010616
1942 Ga0182005_1021610
1943 Ga0182005_1035003
1944 Ga0183362_10001
1945 Ga0183361_10004
1946 Ga0163161_10046855
1947 Ga0163161_10101646
1948 Ga0163161_10124933
1949 Ga0163161_10167083
1950 Ga0163161_10173430
1951 Ga0163161_10181486
1952 Ga0163161_10215667
1953 Ga0163161_10239651
1954 Ga0163161_10258045
1955 Ga0163161_10279826
1956 Ga0163161_10287576
1957 Ga0163161_10325029
1958 Ga0209435_100004
1959 Ga0209435_100046
1960 Ga0209435_100377
1961 Ga0209435_100768
1962 Ga0209760_100027
1963 Ga0209760_101344
1964 Ga0209784_100004
1965 Ga0209784_100007
1966 Ga0209784_100009
1967 Ga0209566_100004
1968 Ga0209566_100007
1969 Ga0209566_100009
1970 Ga0209674_100006
1971 Ga0209674_100018
1972 Ga0209674_100021
1973 Ga0209147_100009
1974 Ga0209147_100011
1975 Ga0209147_100157
1976 Ga0209563_100009
1977 Ga0209563_100018
1978 Ga0209563_100020
1979 Ga0209563_100268
1980 Ga0207427_100006
1981 Ga0207427_100149
1982 Ga0209437_100004
1983 Ga0209437_100013
1984 Ga0209437_100207
1985 Ga0209437_100939
1986 Ga0209258_100851
1987 Ga0209258_100913
1988 Ga0209258_101397
1989 Ga0209646_1000141
1990 Ga0209646_1000149
1991 Ga0209646_1000156
1992 Ga0209646_1000184
1993 Ga0209646_1000233
1994 Ga0209646_1000524
1995 Ga0209026_1000066
1996 Ga0209026_1000776
1997 Ga0209677_100005
1998 Ga0209677_100010
1999 Ga0209677_100012
2000 Ga0209148_1012493
2001 Ga0209148_1015404
2002 Ga0209759_1000072
2003 Ga0209759_1000182
2004 Ga0209759_1001083
2005 Ga0209759_1001715
2006 Ga0209233_1000005
2007 Ga0209233_1000022
2008 Ga0209565_1001951
2009 Ga0209455_1001032
2010 Ga0209455_1002502
2011 Ga0209673_1011314
2012 Ga0209130_1010307
2013 Ga0209130_1032862
2014 Ga0209675_1000078
2015 Ga0209675_1000573
2016 Ga0209675_1001701
2017 Ga0209675_1003212
2018 Ga0209675_1004183
2019 Ga0209676_1000015
2020 Ga0209676_1000030
2021 Ga0209676_1000041
2022 Ga0209676_1000121
2023 Ga0209676_1007094
2024 Ga0209676_1026401
2025 Ga0209025_1000019
2026 Ga0209025_1000051
2027 Ga0209025_1003638
2028 Ga0209025_1034026
2029 Ga0209564_1000133
2030 Ga0209564_1020032
2031 Ga0209050_1000024
2032 Ga0209050_1000030
2033 Ga0209050_1000228
2034 Ga0209050_1000332
2035 Ga0209050_1001473
2036 Ga0209050_1011157
2037 Ga0209050_1022072
2038 Ga0209050_1035225
2039 Ga0209256_1000030
2040 Ga0209256_1000699
2041 Ga0209051_1000004
2042 Ga0209051_1000012
2043 Ga0209051_1000023
2044 Ga0209051_1000367
2045 Ga0209051_1001294
2046 Ga0209051_1007252
2047 Ga0209051_1009205
2048 Ga0209257_1000012
2049 Ga0209257_1000063
2050 Ga0209257_1000262
2051 Ga0209257_1022106
2052 Ga0207656_10000006
2053 Ga0207696_1000020
2054 Ga0207696_1000031
2055 Ga0207696_1001215
2056 Ga0207696_1003799
2057 Ga0207696_1005266
2058 Ga0207696_1024464
2059 Ga0207696_1041534
2060 Ga0207655_1000033
2061 Ga0207655_1000083
2062 Ga0207655_1000703
2063 Ga0207655_1002748
2064 Ga0207655_1005392
2065 Ga0207655_1005543
2066 Ga0207655_1005590
2067 Ga0207655_1007307
2068 Ga0207655_1012751
2069 Ga0207655_1012880
2070 Ga0207655_1013705
2071 Ga0207655_1015570
2072 Ga0207655_1020094
2073 Ga0207655_1041823
2074 Ga0207655_1142231
2075 Ga0207713_1000032
2076 Ga0207713_1000079
2077 Ga0207713_1000659
2078 Ga0207713_1000750
2079 Ga0207713_1000837
2080 Ga0207713_1001056
2081 Ga0207713_1002266
2082 Ga0207713_1002477
2083 Ga0207713_1006015
2084 Ga0207713_1007842
2085 Ga0207713_1007888
2086 Ga0207713_1008313
2087 Ga0207713_1011258
2088 Ga0207713_1021313
2089 Ga0207713_1022601
2090 Ga0207688_10362594
2091 Ga0207645_10307425
2092 Ga0207695_10000748
2093 Ga0207695_10000979
2094 Ga0207695_10085612
2095 Ga0207671_10000131
2096 Ga0207671_10027798
2097 Ga0207671_10312044
2098 Ga0207657_10210920
2099 Ga0207649_10000012
2100 Ga0207649_10194479
2101 Ga0207681_10000381
2102 Ga0207681_10000482
2103 Ga0207681_10009066
2104 Ga0207694_10000069
2105 Ga0207694_10033085
2106 Ga0207694_10340000
2107 Ga0207650_10000338
2108 Ga0207650_10000564
2109 Ga0207650_10176277
2110 Ga0207659_10173289
2111 Ga0207664_10665713
2112 Ga0207644_10289078
2113 Ga0207706_10001424
2114 Ga0207706_10042839
2115 Ga0207686_10000663
2116 Ga0207686_10241547
2117 Ga0207686_10271493
2118 Ga0207709_10000248
2119 Ga0207709_10003176
2120 Ga0207709_10181605
2121 Ga0207709_10203623
2122 Ga0207669_10759510
2123 Ga0207665_10052433
2124 Ga0207679_10000015
2125 Ga0207667_10000043
2126 Ga0207667_10030089
2127 Ga0207667_10223683
2128 Ga0207667_10398203
2129 Ga0207651_10280762
2130 Ga0207640_10015014
2131 Ga0207677_10102893
2132 Ga0207639_10000286
2133 Ga0207702_10027104
2134 Ga0207702_10333543
2135 Ga0207648_10239465
2136 Ga0207674_10246713
2137 Ga0207675_101211330
2138 Ga0207683_10472243
2139 Ga0207698_10000966
2140 Ga0209281_1000016
2141 Ga0209281_1000019
2142 Ga0209281_1000084
2143 Ga0209281_1005170
2144 Ga0209281_1007590
2145 Ga0209371_1000871
2146 Ga0209282_1000058
2147 Ga0207428_10007071
2148 Ga0207428_10072024
2149 Ga0207428_10076055
2150 Ga0207428_10085395
2151 Ga0207428_10093304
2152 Ga0268266_10004944
2153 Ga0268266_10040199
2154 Ga0268266_10290161
2155 Ga0268266_10622091
2156 Ga0268266_10834620
2157 Ga0307517_10186905
2158 Ga0307515_10000215
2159 Ga0268256_1000771
2160 Ga0307511_10003163
2161 Ga0307511_10046070
2162 Ga0307511_10105971
2163 Ga0316178_1051183
2164 Ga0316183_1079327
2165 Ga0316181_1054368
2166 Ga0265332_10002934
2167 Ga0265329_10028102
2168 Ga0265340_10001308
2169 Ga0265331_10011421
2170 Ga0265327_10036761
2171 Ga0265327_10058111
2172 Ga0265316_10053295
2173 Ga0265316_10199969
2174 Ga0307513_10146120
2175 Ga0307509_10141275
2176 Ga0307509_10373778
2177 Ga0307408_100000002
2178 Ga0307408_100018437
2179 Ga0307408_100030557
2180 Ga0307408_100135174
2181 Ga0307408_100368944
2182 Ga0307408_100839944
2183 Ga0265314_10038167
2184 Ga0265342_10002113
2185 Ga0307516_10329423
2186 Ga0307405_10021286
2187 Ga0307405_10030612
2188 Ga0307405_10118288
2189 Ga0307405_10219610
2190 Ga0307405_10445495
2191 Ga0307413_10467860
2192 Ga0307406_10031651
2193 Ga0307406_10064864
2194 Ga0307406_10422248
2195 Ga0307412_10000401
2196 Ga0307412_10014881
2197 Ga0307412_10027454
2198 Ga0307412_10114444
2199 Ga0307412_10128873
2200 Ga0307412_10143622
2201 Ga0307412_10229525
2202 Ga0307409_100114929
2203 Ga0307416_100168469
2204 Ga0307416_100235127
2205 Ga0307416_100313562
2206 Ga0307416_101373701
2207 Ga0307414_10018847
2208 Ga0307414_10351963
2209 Ga0307414_10529026
2210 Ga0307414_11003013
2211 Ga0307411_10021537
2212 Ga0307411_10044282
2213 Ga0307411_10069287
2214 Ga0307510_10081644
2215 Ga0395899_0000478
2216 Ga0395899_0002559
2217 Ga0395899_0003641
2218 Ga0395899_0010527
2219 Ga0395899_0021543
2220 Ga0395900_0000689
2221 Ga0395900_0009793
2222 Ga0395900_0054673
2223 Ga0395900_0067915
2224 Ga0395898_0006853
2225 Ga0395898_0012935
2226 Ga0395898_0542779
2227 Ga0395905_0001455
2228 Ga0395905_0006806
2229 Ga0395905_0040143
2230 Ga0395905_0131624
2231 Ga0395901_0000448
2232 Ga0395901_0013926
2233 Ga0395901_0021143
2234 Ga0395901_0707761
2235 Ga0237819_00552
2236 Ga0436361_0383577
2237 Ga0439436_0002185
2238 Ga0439436_0014730
2239 Ga0439436_0031731
2240 Ga0439438_003027
2241 Ga0439438_008131
2242 Ga0439438_009379
2243 Ga0439438_029762
2244 Ga0439438_056012
2245 Ga0439447_002518
2246 Ga0439447_003011
2247 Ga0439447_005933
2248 Ga0439447_008182
2249 Ga0439447_041380
2250 Ga0439447_048871
2251 Ga0439453_0033084
2252 Ga0439461_0060740
2253 Ga0439466_0002249
2254 Ga0439466_0002406
2255 Ga0439466_0002488
2256 Ga0439466_0005445
2257 Ga0439466_0007824
2258 Ga0439466_0011931
2259 Ga0439466_0022629
2260 Ga0439466_0072787
2261 Ga0439465_0002411
2262 Ga0439431_0000362
2263 Ga0439433_0000386
2264 Ga0439442_003449
2265 Ga0439445_0000121
2266 Ga0439448_0000259
2267 Ga0439432_000513
2268 Ga0439432_001999
2269 Ga0439432_012071
2270 Ga0439432_015834
2271 Ga0439432_032113
2272 Ga0439432_059886
2273 Ga0439449_0001222
2274 Ga0439449_0052621
2275 Ga0439450_003664
2276 Ga0439451_000646
2277 Ga0439451_003347
2278 Ga0439451_004400
2279 Ga0439451_008272
2280 Ga0439451_048696
2281 Ga0439451_051306
2282 Ga0439452_002368
2283 Ga0439452_002759
2284 Ga0439452_008262
2285 Ga0439452_008471
2286 Ga0439452_022738
2287 Ga0439452_048695
2288 Ga0439455_0023343
2289 Ga0439456_001671
2290 Ga0439456_004150
2291 Ga0439456_042724
2292 Ga0439462_0011605
2293 Ga0439463_001315
2294 Ga0439463_001732
2295 Ga0439463_003054
2296 Ga0439463_029998
2297 Ga0450911_001308
2298 Ga0450911_007537
2299 Ga0450919_001489
2300 Ga0450919_003601
2301 Ga0450920_001631
2302 Ga0450923_015979
2303 Ga0450890_003335
2304 Ga0450900_001223
2305 Ga0450902_004412
2306 Ga0450902_016447
2307 Ga0450903_001035
2308 Ga0450903_009052
2309 Ga0450903_015548
2310 Ga0450905_001395
2311 Ga0450906_001441
2312 Ga0450906_004512
2313 Ga0450907_001403
2314 Ga0450907_001502
2315 Ga0450907_001564
2316 Ga0450910_001446
2317 Ga0439446_0017528
2318 Ga0439446_0021589
2319 Ga0450908_011990
2320 Ga0450908_022912
2321 Ga0450908_042764
2322 Ga0450909_002330
2323 Ga0450909_007436
2324 Ga0439434_0034102
2325 Ga0439434_0104232
2326 Ga0439464_0002118
2327 Ga0439460_0000913
2328 Ga0439460_0027876
2329 Ga0450918_000196
2330 Ga0450918_004059
2331 Ga0450901_000243
2332 Ga0439440_0011461
2333 Ga0466969_0002577
2334 Ga0466972_0003793
2335 Ga0466972_0029120
2336 Ga0466972_0184092
2337 Ga0466965_0004441
2338 Ga0466965_0015148
2339 Ga0466965_0038432
2340 Ga0466965_0161174
2341 Ga0466966_0052393
2342 Ga0466966_0080819
2343 Ga0466961_0017656
2344 Ga0466964_0001947
2345 Ga0466964_0017499
2346 Ga0466964_0026220
2347 Ga0466964_0214650
2348 Ga0466968_0007003
2349 Ga0466968_0007529
2350 Ga0466968_0008302
2351 Ga0466957_0020683
2352 Ga0466960_0127563
2353 Ga0466960_0140472
2354 Ga0466960_0325598
2355 Ga0466959_0014864
2356 Ga0466959_0045215
2357 Ga0466959_0365778
2358 Ga0466958_0077912
2359 Ga0466967_0010798
2360 Ga0495617_008515
2361 Ga0495617_011744
2362 Ga0495617_015578
2363 Ga0495627_000083
2364 Ga0495627_003909
2365 Ga0495627_005462
2366 Ga0495627_006280
2367 Ga0495627_008624
2368 Ga0495627_009171
2369 Ga0495627_024339
2370 Ga0495627_041276
2371 Ga0495592_0064774
2372 Ga0495603_0004335
2373 Ga0495603_0080815
2374 Ga0495603_0102798
2375 Ga0495590_0012084
2376 Ga0495590_0014464
2377 Ga0495590_0025283
2378 Ga0495590_0073097
2379 Ga0495590_0074436
2380 Ga0495590_0138886
2381 Ga0495591_000002
2382 Ga0495591_000113
2383 Ga0495591_003516
2384 Ga0495591_003651
2385 Ga0495591_004074
2386 Ga0495591_008694
2387 Ga0495591_009701
2388 Ga0495591_009752
2389 Ga0495591_013527
2390 Ga0495591_014025
2391 Ga0495591_015116
2392 Ga0495591_022913
2393 Ga0495591_034834
2394 Ga0495591_036110
2395 Ga0495591_044438
2396 Ga0495591_051672
2397 Ga0495591_073907
2398 Ga0495638_0031008
2399 Ga0495638_0103993
2400 Ga0495638_0192496
2401 Ga0495638_0207299
2402 Ga0495638_0238693
2403 Ga0495651_0017632
2404 Ga0495651_0126203
2405 Ga0495651_0154753
2406 Ga0495651_0187053
2407 Ga0495653_0013706
2408 Ga0495653_0019246
2409 Ga0495653_0026743
2410 Ga0495653_0107228
2411 Ga0495653_0409177
2412 Ga0495650_0000623
2413 Ga0495650_0002491
2414 Ga0495650_0003593
2415 Ga0495650_0067092
2416 Ga0495650_0073259
2417 Ga0495650_0089405
2418 Ga0495580_0002103
2419 Ga0495605_0000048
2420 Ga0495605_0000100
2421 Ga0495605_0000122
2422 Ga0495605_0000157
2423 Ga0495605_0000339
2424 Ga0495605_0001304
2425 Ga0495605_0003104
2426 Ga0495605_0007095
2427 Ga0495605_0008405
2428 Ga0495605_0009534
2429 Ga0495605_0024062
2430 Ga0495605_0040719
2431 Ga0495605_0041933
2432 Ga0495605_0060194
2433 Ga0495605_0062160
2434 Ga0495605_0072134
2435 Ga0495605_0131142
2436 Ga0495639_0003059
2437 Ga0495639_0003490
2438 Ga0495639_0143286
2439 Ga0495584_0002441
2440 Ga0495584_0007556
2441 Ga0495584_0008229
2442 Ga0495584_0017198
2443 Ga0495584_0022541
2444 Ga0495584_0026803
2445 Ga0495584_0073146
2446 Ga0495584_0106135
2447 Ga0495584_0124228
2448 Ga0495584_0166746
2449 Ga0495585_0010646
2450 Ga0495585_0025718
2451 Ga0495585_0036941
2452 Ga0495585_0058636
2453 Ga0495585_0116298
2454 Ga0495594_0026034
2455 Ga0495594_0028474
2456 Ga0495596_0000060
2457 Ga0495596_0008186
2458 Ga0495596_0088404
2459 Ga0495607_0000025
2460 Ga0495607_0000700
2461 Ga0495607_0004307
2462 Ga0495607_0009429
2463 Ga0495607_0010126
2464 Ga0495607_0013887
2465 Ga0495607_0020703
2466 Ga0495607_0023824
2467 Ga0495607_0027473
2468 Ga0495607_0027597
2469 Ga0495607_0032656
2470 Ga0495607_0036551
2471 Ga0495607_0047097
2472 Ga0495607_0052257
2473 Ga0495607_0071229
2474 Ga0495607_0087140
2475 Ga0495607_0105796
2476 Ga0495607_0113072
2477 Ga0495607_0124743
2478 Ga0495607_0229300
2479 Ga0495583_0000096
2480 Ga0495583_0000174
2481 Ga0495583_0002655
2482 Ga0495583_0005999
2483 Ga0495583_0006439
2484 Ga0495583_0007722
2485 Ga0495583_0007740
2486 Ga0495583_0017638
2487 Ga0495583_0021365
2488 Ga0495583_0056286
2489 Ga0495606_0002388
2490 Ga0495606_0007622
2491 Ga0495606_0008130
2492 Ga0495606_0011278
2493 Ga0495606_0013494
2494 Ga0495606_0014237
2495 Ga0495606_0025647
2496 Ga0495606_0035068
2497 Ga0495606_0062812
2498 Ga0495606_0067153
2499 Ga0495606_0154542
2500 Ga0495606_0157725
2501 Ga0495606_0339071
2502 Ga0495606_0345354
2503 Ga0495608_0008033
2504 Ga0495610_0000793
2505 Ga0495610_0011986
2506 Ga0495610_0019717
2507 Ga0495610_0021338
2508 Ga0495610_0023286
2509 Ga0495610_0025576
2510 Ga0495610_0027599
2511 Ga0495610_0036476
2512 Ga0495610_0063291
2513 Ga0495610_0065205
2514 Ga0495610_0085897
2515 Ga0495610_0115229
2516 Ga0495610_0115843
2517 Ga0495610_0127871
2518 Ga0495616_0011878
2519 Ga0495616_0015111
2520 Ga0495616_0025697
2521 Ga0495616_0026041
2522 Ga0495616_0028635
2523 Ga0495616_0058116
2524 Ga0495616_0082227
2525 Ga0495616_0095331
2526 Ga0495618_0014135
2527 Ga0495620_0000085
2528 Ga0495620_0000306
2529 Ga0495620_0006325
2530 Ga0495620_0010688
2531 Ga0495620_0012319
2532 Ga0495620_0015484
2533 Ga0495620_0018041
2534 Ga0495620_0019621
2535 Ga0495620_0027695
2536 Ga0495628_0000076
2537 Ga0495628_0011291
2538 Ga0495628_0145649
2539 Ga0495631_0002255
2540 Ga0495631_0018449
2541 Ga0495631_0018531
2542 Ga0495631_0033479
2543 Ga0495631_0084394
2544 Ga0495631_0123550
2545 Ga0495632_0000843
2546 Ga0495632_0007773
2547 Ga0495632_0015914
2548 Ga0495632_0017927
2549 Ga0495632_0020548
2550 Ga0495632_0023533
2551 Ga0495632_0025244
2552 Ga0495632_0028338
2553 Ga0495632_0052463
2554 Ga0495632_0095995
2555 Ga0495632_0102171
2556 Ga0495632_0109272
2557 Ga0495632_0139413
2558 Ga0495637_0000301
2559 Ga0495637_0000948
2560 Ga0495637_0007787
2561 Ga0495637_0009362
2562 Ga0495637_0010322
2563 Ga0495637_0015564
2564 Ga0495637_0019071
2565 Ga0495637_0020136
2566 Ga0495637_0033696
2567 Ga0495637_0035009
2568 Ga0495637_0046098
2569 Ga0495637_0050312
2570 Ga0495637_0056721
2571 Ga0495637_0062852
2572 Ga0495637_0129753
2573 Ga0495643_0000017
2574 Ga0495643_0009169
2575 Ga0495643_0024262
2576 Ga0495643_0032085
2577 Ga0495643_0092113
2578 Ga0495643_0142913
2579 Ga0495643_0163289
2580 Ga0495643_0210030
2581 Ga0495643_0293515
2582 Ga0495644_0008107
2583 Ga0495644_0010436
2584 Ga0495644_0015458
2585 Ga0495644_0018365
2586 Ga0495648_0005408
2587 Ga0495648_0006603
2588 Ga0495648_0017221
2589 Ga0495648_0018140
2590 Ga0495648_0031268
2591 Ga0495648_0039184
2592 Ga0495648_0040940
2593 Ga0495648_0042386
2594 Ga0495648_0094394
2595 Ga0495648_0103956
2596 Ga0495648_0131601
2597 Ga0495648_0167299
2598 Ga0495648_0187893
2599 Ga0495666_0003913
2600 Ga0495666_0067328
2601 Ga0495642_0003183
2602 Ga0495642_0003695
2603 Ga0495642_0048265
2604 Ga0495652_0024033
2605 Ga0495652_0048460
2606 Ga0495652_0083701
2607 Ga0495654_0000446
2608 Ga0495654_0008111
2609 Ga0495654_0011590
2610 Ga0495654_0011680
2611 Ga0495654_0013053
2612 Ga0495654_0014627
2613 Ga0495654_0017413
2614 Ga0495654_0022733
2615 Ga0495654_0022931
2616 Ga0495654_0028942
2617 Ga0495654_0031638
2618 Ga0495654_0056740
2619 Ga0495654_0080553
2620 Ga0495654_0081388
2621 Ga0495654_0094659
2622 Ga0495654_0118859
2623 Ga0495654_0126113
2624 Ga0495654_0143185
2625 Ga0495587_0014770
2626 Ga0495609_0000012
2627 Ga0495609_0000023
2628 Ga0495609_0000088
2629 Ga0495609_0000132
2630 Ga0495609_0000649
2631 Ga0495609_0007369
2632 Ga0495609_0015268
2633 Ga0495609_0028323
2634 Ga0495609_0033448
2635 Ga0495609_0087541
2636 Ga0495609_0090652
2637 Ga0495597_0000011
2638 Ga0495597_0000185
2639 Ga0495597_0001086
2640 Ga0495597_0015149
2641 Ga0495597_0016172
2642 Ga0495597_0021177
2643 Ga0495597_0028158
2644 Ga0495597_0090729
2645 Ga0495597_0120057
2646 Ga0495597_0135545
2647 Ga0495597_0151658
2648 Ga0495645_0055410
2649 Ga0495622_0011715
2650 Ga0495622_0016547
2651 Ga0495622_0020286
2652 Ga0495622_0084911
2653 Ga0495622_0101775
2654 Ga0495633_0000034
2655 Ga0495633_0009015
2656 Ga0495633_0014506
2657 Ga0495656_0003752
2658 Ga0495656_0082991
2659 Ga0495656_0114758
2660 Ga0495668_0006815
2661 Ga0495668_0016904
2662 Ga0495668_0026872
2663 Ga0495668_0086948
2664 Ga0495668_0198571
2665 Ga0495634_0016357
2666 Ga0495634_0052805
2667 Ga0495634_0126500
2668 Ga0495611_0001661
2669 Ga0495611_0004094
2670 Ga0495611_0004457
2671 Ga0495611_0082749
2672 Ga0495611_0168905
2673 Ga0495625_0000061
2674 Ga0495625_0001913
2675 Ga0495625_0012656
2676 Ga0495625_0014555
2677 Ga0495625_0038915
2678 Ga0495625_0045837
2679 Ga0495625_0201382
2680 Ga0495625_0209300
2681 Ga0495625_0230565
2682 Ga0495635_0041374
2683 Ga0495635_0155319
2684 Ga0495659_0002669
2685 Ga0495659_0077951
2686 Ga0495661_0000004
2687 Ga0495661_0000036
2688 Ga0495661_0000060
2689 Ga0495661_0000187
2690 Ga0495661_0001218
2691 Ga0495661_0002367
2692 Ga0495661_0009192
2693 Ga0495661_0048174
2694 Ga0495661_0097426
2695 Ga0495661_0140827
2696 Ga0495661_0162307
2697 Ga0495588_0158347
2698 Ga0495588_0274324
2699 Ga0495657_0100484
2700 Ga0495657_0220054
2701 Ga0495599_0034503
2702 Ga0495623_0006955
2703 Ga0495623_0039096
2704 Ga0495646_0003698
2705 Ga0495669_0008374
2706 Ga0495613_0122405
2707 Ga0495613_0415467
2708 Ga0495624_0011454
2709 Ga0495624_0020811
2710 Ga0495624_0030721
2711 Ga0495670_0024067
2712 Ga0495670_0025848
2713 Ga0495670_0032353
2714 Ga0495670_0038481
2715 Ga0495670_0056069
2716 Ga0495670_0078241
2717 Ga0495670_0244214
2718 Ga0495670_0369036
2719 Ga0495671_0000662
2720 Ga0495671_0001738
2721 Ga0495671_0001929
2722 Ga0495671_0004125
2723 Ga0495671_0023909
2724 Ga0495671_0028439
2725 Ga0495671_0028502
2726 Ga0495671_0035860
2727 Ga0495671_0054514
2728 Ga0495671_0059564
2729 Ga0495671_0060744
2730 Ga0495671_0078233
2731 Ga0495671_0086076
2732 Ga0495671_0100340
2733 Ga0495671_0125138
2734 Ga0495671_0144353
2735 Ga0495649_0007545
2736 Ga0495649_0013292
2737 Ga0495649_0015889
2738 Ga0495649_0023844
2739 Ga0495649_0030657
2740 Ga0495649_0056291
2741 Ga0495649_0064754
2742 Ga0495649_0072808
2743 Ga0495649_0078469
2744 Ga0495649_0080867
2745 Ga0495649_0096429
2746 Ga0495649_0104176
2747 Ga0495589_0003318
2748 Ga0495589_0010874
2749 Ga0495589_0021478
2750 Ga0495589_0022326
2751 Ga0495589_0082550
2752 Ga0495589_0231540
2753 Ga0495600_0003938
2754 Ga0495600_0179248
2755 Ga0495600_0185820
2756 Ga0495600_0204923
2757 Ga0495660_0003401
2758 Ga0495660_0003415
2759 Ga0495660_0011226
2760 Ga0495660_0026559
2761 Ga0495660_0028351
2762 Ga0495660_0028386
2763 Ga0495660_0038247
2764 Ga0495660_0050839
2765 Ga0495660_0053651
2766 Ga0495660_0065478
2767 Ga0495660_0089028
2768 Ga0495660_0097599
2769 Ga0495660_0160907
2770 Ga0495660_0176078
2771 Ga0495660_0210676
2772 Ga0495604_0000948
2773 Ga0495604_0050468
2774 Ga0495604_0094930
2775 Ga0495604_0182182
2776 Ga0495604_0218715
2777 Ga0495636_0011170
2778 Ga0495674_0093556
2779 Ga0495672_0006253
2780 Ga0495672_0007817
2781 Ga0495672_0008177
2782 Ga0495672_0010931
2783 Ga0495672_0013983
2784 Ga0495672_0017033
2785 Ga0495672_0017358
2786 Ga0495672_0018955
2787 Ga0495672_0025697
2788 Ga0495672_0032878
2789 Ga0495672_0036278
2790 Ga0495672_0037415
2791 Ga0495672_0040141
2792 Ga0495672_0042164
2793 Ga0495672_0072442
2794 Ga0495672_0088004
2795 Ga0495672_0100895
2796 Ga0495672_0108685
2797 Ga0495672_0165702
2798 Ga0495672_0242159
2799 Ga0495676_0000011
2800 Ga0495676_0020361
2801 Ga0495676_0173689
2802 Ga0495680_0055612
2803 Ga0495680_0342418
2804 Ga0495683_0000028
2805 Ga0495683_0000034
2806 Ga0495683_0000070
2807 Ga0495683_0017499
2808 Ga0495683_0022075
2809 Ga0495683_0057785
2810 Ga0495687_006777
2811 Ga0495687_008366
2812 Ga0495687_008443
2813 Ga0495675_0039511
2814 Ga0495677_0019091
2815 Ga0495677_0093214
2816 Ga0495679_000028
2817 Ga0495679_000370
2818 Ga0495679_004083
2819 Ga0495679_013446
2820 Ga0495679_031520
2821 Ga0495679_054703
2822 Ga0495679_059342
2823 Ga0495673_0002589
2824 Ga0495673_0004790
2825 Ga0495673_0005801
2826 Ga0495673_0015551
2827 Ga0495673_0015946
2828 Ga0495673_0016029
2829 Ga0495673_0017738
2830 Ga0495673_0018232
2831 Ga0495673_0023496
2832 Ga0495673_0025842
2833 Ga0495673_0029397
2834 Ga0495673_0035779
2835 Ga0495673_0040254
2836 Ga0495673_0049794
2837 Ga0495673_0050604
2838 Ga0495673_0057994
2839 Ga0495673_0064001
2840 Ga0495673_0076174
2841 Ga0495673_0088590
2842 Ga0495673_0115752
2843 Ga0495673_0125643
2844 Ga0495673_0141971
2845 Ga0495673_0174170
2846 Ga0495681_0008476
2847 Ga0495681_0019090
2848 Ga0495681_0021856
2849 Ga0495681_0022771
2850 Ga0495681_0024639
2851 Ga0495681_0027271
2852 Ga0495681_0031133
2853 Ga0495681_0041865
2854 Ga0495681_0045559
2855 Ga0495681_0059234
2856 Ga0495681_0062733
2857 Ga0495681_0071169
2858 Ga0495681_0110542
2859 Ga0495681_0151488
2860 Ga0495684_0095672
2861 Ga0495686_0104090
2862 Ga0495686_0113864
2863 Ga0495686_0142235
2864 Ga0495686_0148283
2865 Ga0495593_0078652
2866 Ga0495593_0127608
2867 Ga0495593_0135498
2868 Ga0495602_0009002
2869 Ga0495602_0376219
2870 Ga0495626_0000024
2871 Ga0495626_0006473
2872 Ga0495626_0007135
2873 Ga0495626_0016350
2874 Ga0495626_0022425
2875 Ga0495626_0044773
2876 Ga0495626_0052961
2877 Ga0495626_0070204
2878 Ga0495626_0076772
2879 Ga0496100_0039148
2880 Ga0496101_0009650
2881 Ga0496102_0004242
2882 Ga0496102_0004534
2883 Ga0496103_0013210
2884 Ga0496104_0137938
2885 Ga0496105_0002236
2886 Ga0496106_0011540
2887 Ga0496107_0315144
2888 Ga0496110_0038468
2889 Ga0496110_0195940
2890 Ga0496111_0187292
2891 Ga0496112_0441141
2892 Ga0496112_0569987
2893 Ga0496114_0002270
2894 Ga0496114_0102391
2895 Ga0496116_0001954
2896 Ga0496116_0006985
2897 Ga0496116_0020749
2898 Ga0496116_0022501
2899 Ga0496116_0029771
2900 Ga0496116_0041683
2901 Ga0496116_0065419
2902 Ga0496116_0117438
2903 Ga0496116_0135888
2904 Ga0496116_0138478
2905 Ga0496117_0004774
2906 Ga0496117_0012455
2907 Ga0496117_0029302
2908 Ga0496117_0087048
2909 Ga0496117_0124601
2910 Ga0496117_0147306
2911 Ga0496117_0159215
2912 Ga0496118_0014455
2913 Ga0496118_0073811
2914 Ga0496118_0095396
2915 Ga0496118_0110003
2916 Ga0496118_0141186
2917 Ga0496118_0182613
2918 Ga0496118_0206247
2919 Ga0496119_0052709
2920 Ga0496119_0191494
2921 Ga0496120_0005221
2922 Ga0496120_0015311
2923 Ga0496121_0001365
2924 Ga0496121_0013843
2925 Ga0496121_0015990
2926 Ga0496121_0016038
2927 Ga0496121_0017647
2928 Ga0496121_0043798
2929 Ga0496121_0086255
2930 Ga0496121_0096435
2931 Ga0496121_0155626
2932 Ga0496121_0221953
2933 Ga0496121_0300223
2934 Ga0496121_0484260
2935 Ga0496122_0000449
2936 Ga0496122_0000616
2937 Ga0496122_0000669
2938 Ga0496122_0001392
2939 Ga0496122_0003626
2940 Ga0496122_0011766
2941 Ga0496122_0020263
2942 Ga0496122_0038861
2943 Ga0496122_0071453
2944 Ga0496122_0123299
2945 Ga0496122_0127065
2946 Ga0496123_0000263
2947 Ga0496123_0000632
2948 Ga0496123_0000977
2949 Ga0496123_0001569
2950 Ga0496123_0008524
2951 Ga0496123_0065943
2952 Ga0496123_0067508
2953 Ga0496123_0071585
2954 Ga0496123_0090133
2955 Ga0496124_0000073
2956 Ga0496124_0007897
2957 Ga0496124_0015211
2958 Ga0496124_0015525
2959 Ga0496124_0050107
2960 Ga0496124_0081214
2961 Ga0496124_0087475
2962 Ga0496124_0174404
2963 Ga0496124_0381807
2964 Ga0496125_0000168
2965 Ga0496125_0000319
2966 Ga0496125_0000947
2967 Ga0496125_0003314
2968 Ga0496125_0005089
2969 Ga0496125_0005136
2970 Ga0496125_0026564
2971 Ga0496125_0037898
2972 Ga0496125_0046824
2973 Ga0496125_0057758
2974 Ga0496125_0062306
2975 Ga0496125_0211080
2976 Ga0496126_0023661
2977 Ga0496126_0024217
2978 Ga0496126_0086476
2979 Ga0496126_0101023
2980 Ga0496126_0150981
2981 Ga0496126_0226004
2982 Ga0496126_0248988
2983 Ga0496126_0360461
2984 Ga0495678_000049
2985 Ga0495678_000160
2986 Ga0495678_009421
2987 Ga0495678_013793
2988 Ga0495678_018525
2989 Ga0495678_018970
2990 Ga0495678_020127
2991 Ga0495678_021976
2992 Ga0495678_025529
2993 Ga0495678_026414
2994 Ga0495678_053864
2995 Ga0495678_060446
2996 Ga0495678_102818
2997 Ga0495682_0000090
2998 Ga0495682_0001506
2999 Ga0495682_0028204
3000 Ga0495682_0040104
3001 Ga0495682_0087915
3002 Ga0501238_007309
3003 Ga0501241_022199
3004 nmdc:mga00v17_11469_c1
3005 nmdc:mga00v17_188609_c1
3006 nmdc:mga00v17_50346_c1
3007 nmdc:mga0yw44_249364_c1
3008 nmdc:mga0k408_184357_c1
3009 nmdc:mga0k408_198142_c1
3010 nmdc:mga0k408_2992_c1
3011 nmdc:mga06z11_105374_c1
3012 nmdc:mga08x19_251483_c1
3013 nmdc:mga08x19_355381_c1
3014 Ga0495601_0019812
3015 Ga0500646_0000914
3016 Ga0500583_0006260
3017 Ga0500583_0179503
3018 Ga0500641_0022457
3019 Ga0500650_0065649
3020 Ga0500594_0011721
3021 Ga0500595_001205
3022 Ga0500618_023789
3023 Ga0500618_025568
3024 Ga0500655_004044
3025 Ga0500559_0000578
3026 Ga0500573_0034392
3027 Ga0500586_056689
3028 Ga0500604_0003723
3029 Ga0500619_003230
3030 2511249605
3031 2511254814
3032 2511266028
3033 2511273340
3034 2511275051
3035 2511288501
3036 2511297998
3037 2511303991
3038 2511311963
3039 2511320679
3040 2511327969
3041 2511329712
3042 2511335884
3043 2511344754
3044 2511349517
3045 2511360140
3046 2511365982
3047 2511368993
3048 2511384059
3049 2511412133
3050 2511827682
3051 2512037785
3052 2512326631
3053 2514045004
3054 2514045247
3055 2514045305
3056 2521560192
3057 2550695313
3058 2550695898
3059 2553004989
3060 2574431087
3061 2583795681
3062 2597860925
3063 2597866672
3064 2597872530
3065 2599327552
3066 2599400495
3067 2599449819
3068 2599485840
3069 2599500304
3070 2599505792
3071 2599511893
3072 2599516877
3073 2599614472
3074 2599768102
3075 2599804620
3076 2599879080
3077 2599885538
3078 2599892745
3079 2599897252
3080 2599902896
3081 2599930673
3082 2599942311
3083 2599951494
3084 2599954276
3085 2599961961
3086 2599965984
3087 2599972351
3088 2599977966
3089 2599982881
3090 2599988369
3091 2599994030
3092 2599999164
3093 2600004265
3094 2600012133
3095 2600020445
3096 2600026302
3097 2600032047
3098 2600036015
3099 2600044580
3100 2600046695
3101 2600054877
3102 2600061090
3103 2600068003
3104 2600071912
3105 2600076500
3106 2600358950
3107 2600363506
3108 2600444136
3109 2601627449
3110 2601693403
3111 2601798521
3112 2602008386
3113 2606077415
3114 2606129339
3115 2621296804
3116 2624483451
3117 2624494976
3118 2643843003
3119 2643861719
3120 2643872308
3121 2643955591
3122 2644020385
3123 2644028505
3124 2644184440
3125 2644246219
3126 2644283185
3127 2644624726
3128 2652546691
3129 2671089598
3130 2671128545
3131 2671771627
3132 2677897174
3133 2678266191
3134 2715749791
3135 2715754809
3136 2718636656
3137 2723251408
3138 2723876522
3139 2738671624
3140 2738690393
3141 2738750018
3142 2738807296
3143 2738859058
3144 2738894656
3145 2739199100
3146 2739252448
3147 2739259039
3148 2739266167
3149 2739289968
3150 2739295280
3151 2739312464
3152 2743740465
3153 2745007423
3154 2765571360
3155 2774118335
3156 2774135524
3157 2784261773
3158 2784313616
3159 2794593797
3160 2807408848
3161 2807457179
3162 2808855656
3163 2808926782
3164 2808928401
3165 2808935507
3166 2808948943
3167 2808950416
3168 2808959798
3169 2808964115
3170 2808976190
3171 2808982470
3172 2808994346
3173 2808999049
3174 2809033228
3175 2809129703
3176 2809149242
3177 2809217227
3178 2817494083
3179 2819543929
3180 2819592889
3181 2819592919
3182 2819616549
3183 2819655175
3184 2823425757
3185 2825655053
3186 2826581861
3187 2834030994
3188 2839099201
3189 2842735689
3190 2842749122
3191 2842805863
3192 2842816885
3193 2842831245
3194 2842833498
3195 2842837941
3196 2842845728
3197 2842854151
3198 2842855665
3199 2844667141
3200 2852616393
3201 2852619383
3202 2852659721
3203 2852671361
3204 2855732747
3205 2855771499
3206 2857553213
3207 2857577578
3208 2860341759
3209 2860873068
3210 2878035392
3211 2880236039
3212 2881415543
3213 2884813274
3214 2884838572
3215 2884854863
3216 2885195978
3217 2891634427
3218 2896156468
3219 2897806768
3220 2904435818
3221 2904440767
3222 2904480751
3223 2904518915
3224 2904535366
3225 2904551402
3226 2904588486
3227 2904594626
3228 2904605858
3229 2908452628
3230 2913042572
3231 2919048933
3232 2919065477
3233 2919084835
3234 2919389152
3235 2919485699
3236 2919488128
3237 2919502515
3238 2919700532
3239 2923159558
3240 2923513938
3241 2923589041
3242 2926064188
3243 2928134200
3244 2929149961
3245 2929195192
3246 2931372598
3247 2931396457
3248 2931398122
3249 2939640764
3250 2941482521
3251 2945930873
3252 2945966903
3253 2946013238
3254 2946027945
3255 2947234470
3256 2969310216
3257 2974294041
3258 2984286556
3259 2988731498
3260 2998145438
3261 2998344656
3262 3007399357
3263 3007425770
3264 3007517224
3265 3007618865
3266 3007721799
3267 3007859231
3268 3007865065
3269 3007866742
3270 3007872938
3271 639787418
3272 8015693656
3273 8019777639
3274 8029995466
3275 8034965083
3276 8054007067
3277 8054285680
3278 8054349543
3279 8054508978
3280 8054931855
3281 8055776903
3282 8055823949
3283 8056131647
3284 8056137353
3285 8056140402
3286 8056148814
3287 8056151450
3288 8056159743
3289 8056163670
3290 8056171269
3291 8056182039
3292 8056570507

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

56

235

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8402 4 216
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8332 4 216
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7206 16 206
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7106 14 215
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.6899 20 214
ID Description Score Start End Superfamily
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8469 15 215 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8428 4 215 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8308 17 215 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8288 4 215 1.10.3720.10
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8198 85 215 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A430DZQ7-F1-model_v4 ABC transporter permease subunit 0.8848 1 218 GO:0006865
GO:0022857
GO:0043190
AF-A0A3S4MXR4-F1-model_v4 AcnD 0.8834 1 215 GO:0016829
GO:0022857
GO:0043190
AF-A0A1Y0L479-F1-model_v4 ABC transporter 0.8833 1 218 GO:0006865
GO:0022857
GO:0043190
AF-A0A502SB01-F1-model_v4 Amino acid ABC transporter permease 0.8832 1 217 GO:0006865
GO:0022857
GO:0043190
AF-A0A7Z2NYA0-F1-model_v4 ABC transporter permease subunit 0.8822 1 218 GO:0006865
GO:0022857
GO:0043190

Map