F495191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1647 | 734 | 3294 | 452 |
Family's Representative Sequence
| Representative Sequence | 3300047315|Ga0495581_0062984|Ga0495581_0062984_143_1588 |
| Length | 481 |
| Sequence | VVSGLPQENALIQVSALGSLMPFTIAIIGRPNVGKSTLFNRLVGQKLALVDDEPGVTRDRREGEGRLGDLEFTVIDTAGLDEGVKGSLTARMQEQTETAIGLADALMFVVDARSGLTPNDRAFADFARRANKPVILVANKSEGKQGDAGAMEAYALGLGEPIQISAEHGKGLSELYDALRALMPEPAEAEQEFDDDDVMAQDEEIAKRPIRVAIVGRPNAGKSTLINHLLGEERLLTSAEAGTTRDSISVEINWKGRDFRVFDTAGLRRRSRIEEKLEKLSVADALRAVRFAEVVVLVMDAQNKFEEQDLRIADLIEREGRALVIAVNKWDLMGRQQGLISALRTDADHLLPQVKGMPIVAVSGLMGEGIDRLMSAIEQAYAVWNKRVPTASLNRWFEQAVDVNPPPAVSGRRLKLNYITQAKARPPSFVLFCSRADAVPQSYLRYLVNSLREYFELPGTPVRIALREKANPFAHKRKRPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 112 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 144 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 145 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 146 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 147 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 242 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 251 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 254 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 255 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 256 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 257 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 259 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 300 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 301 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 302 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 306 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 310 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 395 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 396 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 397 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 398 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 399 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 400 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 401 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 402 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 403 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 404 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 405 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 406 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 407 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 408 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 409 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 410 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 411 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 442 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 444 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 445 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 458 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 461 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 463 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 464 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 467 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 468 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 471 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 472 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 473 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 474 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 475 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 476 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 477 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 478 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 479 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 481 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 482 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 484 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 489 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 491 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 493 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 495 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 496 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 498 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 499 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 501 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 503 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 504 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 505 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 506 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 507 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 508 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 509 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 510 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 511 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 512 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 513 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 514 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 515 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 516 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 517 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 518 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 519 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 520 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 521 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 522 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 523 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 524 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 525 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 526 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 527 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 528 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 529 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 530 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 531 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 532 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 533 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 534 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 535 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 536 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 537 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 538 | 2791355199 | |||
| 539 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 540 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 541 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 542 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 543 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 544 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 545 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 546 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 547 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 548 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 549 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 550 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 551 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 552 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 553 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 554 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 555 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 556 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 557 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 558 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 559 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 560 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 561 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 562 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 563 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 564 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 565 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 566 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 567 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 568 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 569 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 570 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 571 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 572 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 573 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 574 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 575 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 576 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 577 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 578 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 579 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 580 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 581 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 582 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 583 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 584 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 585 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 586 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 587 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 588 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 589 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 590 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 591 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 592 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 593 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 594 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 595 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 596 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 597 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 598 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 599 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 600 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 601 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 602 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 603 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 604 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 605 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 606 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 607 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 608 | 2904699407 | |||
| 609 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 610 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 611 | 2906610324 | |||
| 612 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 613 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 614 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 615 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 616 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 617 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 618 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 619 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 620 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 621 | 2922368715 | |||
| 622 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 623 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 624 | 2922425934 | |||
| 625 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 626 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 627 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 628 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 629 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 630 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 631 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 632 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 633 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 634 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 635 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 636 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 637 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 638 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 639 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 640 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 641 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 642 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 643 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 644 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 645 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 646 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 647 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 648 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 649 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 650 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 651 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 652 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 653 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 654 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 655 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 656 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 657 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 658 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 659 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 660 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 661 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 662 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 663 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 664 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 665 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 666 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 667 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 668 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 669 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 670 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 671 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 672 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 673 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 674 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 675 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 676 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 677 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 678 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 679 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 680 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 681 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 682 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 683 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 684 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 685 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 686 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 687 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 688 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 689 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 690 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 691 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 692 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 693 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 694 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 695 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 696 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 697 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 698 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 699 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 700 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 701 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 702 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 703 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 704 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 705 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 706 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 707 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 708 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 709 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 710 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 711 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 712 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 713 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 714 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 715 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 716 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 717 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 718 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 719 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 720 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 721 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 722 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 723 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 724 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 725 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 726 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 727 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 728 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 729 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 730 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 731 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 732 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 733 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 734 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.11 |
| Metatranscriptomes | 0 |
| Isolates | 13.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.59 |
| Nodule | 10.99 |
| Rhizoplane | 5.28 |
| Rhizosphere | 67.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495581_0062984 | 3300047315 | Bacteria | 2143 |
| 2 | 2214745197 | 2209111006 | Bacteria | 17059 |
| 3 | ARcpr5oldR_c000207 | 3300000041 | Bacteria | 9900 |
| 4 | ARSoilYngRDRAFT_c00063 | 3300000042 | Bacteria | 17542 |
| 5 | ARcpr5yngRDRAFT_c000034 | 3300000043 | Bacteria | 21574 |
| 6 | ARSoilOldRDRAFT_c000200 | 3300000044 | Bacteria | 9653 |
| 7 | ARCol0yngRDRAFT_1000414 | 3300000652 | Bacteria | 5623 |
| 8 | JGI24739J22299_10018619 | 3300001989 | Bacteria | 2494 |
| 9 | JGI24737J22298_10002792 | 3300001990 | Bacteria | 6187 |
| 10 | JGI24750J21931_1000125 | 3300002070 | Bacteria | 12220 |
| 11 | JGI24738J21930_10011097 | 3300002075 | Bacteria | 1990 |
| 12 | JGI24749J21850_1003011 | 3300002076 | Bacteria | 2352 |
| 13 | JGI24034J26672_10002632 | 3300002239 | Bacteria | 2472 |
| 14 | JGI24742J22300_10001036 | 3300002244 | Bacteria | 4279 |
| 15 | JGI25406J46586_10000078 | 3300003203 | Bacteria | 44054 |
| 16 | JGI25406J46586_10020770 | 3300003203 | Bacteria | 2648 |
| 17 | JGI25153J46596_10000873 | 3300003215 | Bacteria | 18353 |
| 18 | JGI25153J46596_10001410 | 3300003215 | Bacteria | 14422 |
| 19 | JGI25153J46596_10003048 | 3300003215 | Bacteria | 9466 |
| 20 | JGI25153J46596_10004424 | 3300003215 | Bacteria | 7586 |
| 21 | JGI25160J50197_1001193 | 3300003354 | Bacteria | 13206 |
| 22 | JGI25160J50197_1002953 | 3300003354 | Bacteria | 7772 |
| 23 | JGI25160J50197_1004978 | 3300003354 | Bacteria | 5637 |
| 24 | Ga0055531_10014599 | 3300003794 | Bacteria | 3525 |
| 25 | Ga0055543_1005502 | 3300004625 | Bacteria | 3216 |
| 26 | Ga0065165_1001524 | 3300005262 | Bacteria | 24366 |
| 27 | Ga0065165_1003137 | 3300005262 | Bacteria | 12207 |
| 28 | Ga0065165_1023678 | 3300005262 | Bacteria | 2077 |
| 29 | Ga0065716_1001536 | 3300005277 | Bacteria | 7889 |
| 30 | Ga0065704_10004989 | 3300005289 | Bacteria | 4183 |
| 31 | Ga0065712_10073422 | 3300005290 | Bacteria | 4394 |
| 32 | Ga0065712_10083420 | 3300005290 | Bacteria | 2838 |
| 33 | Ga0065715_10005959 | 3300005293 | Bacteria | 5472 |
| 34 | Ga0065715_10009645 | 3300005293 | Bacteria | 4420 |
| 35 | Ga0070658_10140472 | 3300005327 | Bacteria | 2017 |
| 36 | Ga0070676_10035124 | 3300005328 | Bacteria | 2882 |
| 37 | Ga0070683_100011881 | 3300005329 | Bacteria | 7548 |
| 38 | Ga0070683_100029883 | 3300005329 | Bacteria | 4940 |
| 39 | Ga0070690_100009210 | 3300005330 | Bacteria | 5713 |
| 40 | Ga0070670_100053329 | 3300005331 | Bacteria | 3473 |
| 41 | Ga0070677_10000280 | 3300005333 | Bacteria | 17866 |
| 42 | Ga0068869_100001318 | 3300005334 | Bacteria | 14691 |
| 43 | Ga0070666_10045092 | 3300005335 | Bacteria | 2955 |
| 44 | Ga0070680_100000616 | 3300005336 | Bacteria | 24670 |
| 45 | Ga0070680_100017031 | 3300005336 | Bacteria | 5724 |
| 46 | Ga0070680_100020087 | 3300005336 | Bacteria | 5297 |
| 47 | Ga0070680_100070872 | 3300005336 | Bacteria | 2863 |
| 48 | Ga0070680_100105649 | 3300005336 | Bacteria | 2340 |
| 49 | Ga0070682_100001617 | 3300005337 | Bacteria | 12536 |
| 50 | Ga0068868_100045245 | 3300005338 | Bacteria | 3443 |
| 51 | Ga0068868_100068541 | 3300005338 | Bacteria | 2825 |
| 52 | Ga0068868_100137913 | 3300005338 | Bacteria | 2001 |
| 53 | Ga0070660_100032777 | 3300005339 | Bacteria | 3912 |
| 54 | Ga0070660_100154684 | 3300005339 | Bacteria | 1845 |
| 55 | Ga0070660_100163472 | 3300005339 | Bacteria | 1795 |
| 56 | Ga0070689_100002625 | 3300005340 | Bacteria | 11774 |
| 57 | Ga0070689_100012764 | 3300005340 | Bacteria | 6063 |
| 58 | Ga0070689_100036690 | 3300005340 | Bacteria | 3749 |
| 59 | Ga0070689_100069681 | 3300005340 | Bacteria | 2744 |
| 60 | Ga0070691_10000060 | 3300005341 | Bacteria | 30257 |
| 61 | Ga0070691_10008198 | 3300005341 | Bacteria | 4785 |
| 62 | Ga0070687_100001606 | 3300005343 | Bacteria | 8047 |
| 63 | Ga0070661_100003024 | 3300005344 | Bacteria | 11574 |
| 64 | Ga0070692_10003848 | 3300005345 | Bacteria | 6178 |
| 65 | Ga0070668_100026485 | 3300005347 | Bacteria | 4400 |
| 66 | Ga0070668_100047078 | 3300005347 | Bacteria | 3314 |
| 67 | Ga0070669_100045621 | 3300005353 | Bacteria | 3194 |
| 68 | Ga0070675_100011308 | 3300005354 | Bacteria | 6985 |
| 69 | Ga0070675_100015393 | 3300005354 | Bacteria | 6046 |
| 70 | Ga0070675_100071908 | 3300005354 | Bacteria | 2870 |
| 71 | Ga0070671_100017277 | 3300005355 | Bacteria | 5841 |
| 72 | Ga0070671_100030622 | 3300005355 | Bacteria | 4441 |
| 73 | Ga0070671_100037161 | 3300005355 | Bacteria | 4038 |
| 74 | Ga0070674_100000936 | 3300005356 | Bacteria | 15228 |
| 75 | Ga0070674_100021418 | 3300005356 | Bacteria | 4149 |
| 76 | Ga0070674_100108305 | 3300005356 | Bacteria | 2036 |
| 77 | Ga0070673_100004133 | 3300005364 | Bacteria | 9143 |
| 78 | Ga0070673_100039343 | 3300005364 | Bacteria | 3618 |
| 79 | Ga0070673_100133052 | 3300005364 | Bacteria | 2090 |
| 80 | Ga0070688_100000475 | 3300005365 | Bacteria | 20349 |
| 81 | Ga0070688_100143673 | 3300005365 | Bacteria | 1624 |
| 82 | Ga0070688_100182364 | 3300005365 | Bacteria | 1457 |
| 83 | Ga0070659_100003632 | 3300005366 | Bacteria | 10987 |
| 84 | Ga0070667_100072255 | 3300005367 | Bacteria | 2940 |
| 85 | Ga0070667_100082656 | 3300005367 | Bacteria | 2750 |
| 86 | Ga0070667_100170952 | 3300005367 | Bacteria | 1918 |
| 87 | Ga0070709_10004463 | 3300005434 | Bacteria | 7552 |
| 88 | Ga0070709_10004879 | 3300005434 | Bacteria | 7251 |
| 89 | Ga0070709_10006104 | 3300005434 | Bacteria | 6553 |
| 90 | Ga0070709_10007532 | 3300005434 | Bacteria | 5971 |
| 91 | Ga0070709_10015423 | 3300005434 | Bacteria | 4348 |
| 92 | Ga0070709_10023031 | 3300005434 | Bacteria | 3651 |
| 93 | Ga0070709_10075294 | 3300005434 | Bacteria | 2189 |
| 94 | Ga0070714_100001950 | 3300005435 | Bacteria | 15066 |
| 95 | Ga0070714_100008324 | 3300005435 | Bacteria | 8091 |
| 96 | Ga0070714_100011427 | 3300005435 | Bacteria | 7042 |
| 97 | Ga0070714_100094208 | 3300005435 | Bacteria | 2628 |
| 98 | Ga0070714_100095782 | 3300005435 | Bacteria | 2607 |
| 99 | Ga0070714_100162942 | 3300005435 | Bacteria | 2019 |
| 100 | Ga0070714_100179334 | 3300005435 | Bacteria | 1926 |
| 101 | Ga0070713_100001659 | 3300005436 | Bacteria | 14306 |
| 102 | Ga0070713_100003651 | 3300005436 | Bacteria | 10185 |
| 103 | Ga0070713_100025152 | 3300005436 | Bacteria | 4650 |
| 104 | Ga0070713_100027795 | 3300005436 | Bacteria | 4459 |
| 105 | Ga0070713_100039003 | 3300005436 | Bacteria | 3852 |
| 106 | Ga0070713_100065313 | 3300005436 | Bacteria | 3056 |
| 107 | Ga0070713_100167873 | 3300005436 | Bacteria | 1964 |
| 108 | Ga0070710_10000852 | 3300005437 | Bacteria | 14636 |
| 109 | Ga0070710_10001257 | 3300005437 | Bacteria | 12039 |
| 110 | Ga0070710_10007302 | 3300005437 | Bacteria | 5344 |
| 111 | Ga0070710_10017935 | 3300005437 | Bacteria | 3635 |
| 112 | Ga0070701_10008207 | 3300005438 | Bacteria | 4502 |
| 113 | Ga0070711_100003237 | 3300005439 | Bacteria | 9453 |
| 114 | Ga0070711_100004427 | 3300005439 | Bacteria | 8290 |
| 115 | Ga0070711_100004805 | 3300005439 | Bacteria | 8013 |
| 116 | Ga0070711_100026407 | 3300005439 | Bacteria | 3806 |
| 117 | Ga0070711_100027486 | 3300005439 | Bacteria | 3736 |
| 118 | Ga0070711_100100559 | 3300005439 | Bacteria | 2103 |
| 119 | Ga0070711_100143191 | 3300005439 | Bacteria | 1795 |
| 120 | Ga0070711_100154540 | 3300005439 | Bacteria | 1733 |
| 121 | Ga0070700_100000664 | 3300005441 | Bacteria | 17024 |
| 122 | Ga0070708_100057719 | 3300005445 | Bacteria | 3457 |
| 123 | Ga0070663_100003557 | 3300005455 | Bacteria | 8997 |
| 124 | Ga0070663_100019210 | 3300005455 | Bacteria | 4498 |
| 125 | Ga0070663_100076812 | 3300005455 | Bacteria | 2443 |
| 126 | Ga0070663_100087368 | 3300005455 | Bacteria | 2304 |
| 127 | Ga0070678_100013540 | 3300005456 | Bacteria | 5120 |
| 128 | Ga0070678_100027779 | 3300005456 | Bacteria | 3847 |
| 129 | Ga0070678_100071560 | 3300005456 | Bacteria | 2596 |
| 130 | Ga0070678_100086326 | 3300005456 | Bacteria | 2393 |
| 131 | Ga0070681_10006827 | 3300005458 | Bacteria | 11113 |
| 132 | Ga0070681_10036709 | 3300005458 | Bacteria | 4921 |
| 133 | Ga0070681_10051867 | 3300005458 | Bacteria | 4091 |
| 134 | Ga0070681_10059905 | 3300005458 | Bacteria | 3786 |
| 135 | Ga0070681_10120137 | 3300005458 | Bacteria | 2563 |
| 136 | Ga0070681_10141695 | 3300005458 | Bacteria | 2334 |
| 137 | Ga0070681_10182732 | 3300005458 | Bacteria | 2018 |
| 138 | Ga0070681_10223889 | 3300005458 | Bacteria | 1796 |
| 139 | Ga0068867_100036624 | 3300005459 | Bacteria | 3563 |
| 140 | Ga0068867_100109347 | 3300005459 | Bacteria | 2122 |
| 141 | Ga0070685_10010544 | 3300005466 | Bacteria | 4804 |
| 142 | Ga0070679_100013007 | 3300005530 | Bacteria | 7970 |
| 143 | Ga0070679_100017271 | 3300005530 | Bacteria | 6981 |
| 144 | Ga0070679_100022370 | 3300005530 | Bacteria | 6180 |
| 145 | Ga0070679_100068736 | 3300005530 | Bacteria | 3533 |
| 146 | Ga0070679_100069385 | 3300005530 | Bacteria | 3516 |
| 147 | Ga0070679_100112447 | 3300005530 | Bacteria | 2709 |
| 148 | Ga0070679_100192916 | 3300005530 | Bacteria | 2005 |
| 149 | Ga0070684_100000464 | 3300005535 | Bacteria | 27749 |
| 150 | Ga0070684_100028216 | 3300005535 | Bacteria | 4746 |
| 151 | Ga0070684_100031388 | 3300005535 | Bacteria | 4522 |
| 152 | Ga0070684_100045267 | 3300005535 | Bacteria | 3810 |
| 153 | Ga0070697_100139103 | 3300005536 | Bacteria | 2041 |
| 154 | Ga0068853_100057126 | 3300005539 | Bacteria | 3367 |
| 155 | Ga0068853_100059042 | 3300005539 | Bacteria | 3313 |
| 156 | Ga0068853_100059965 | 3300005539 | Bacteria | 3287 |
| 157 | Ga0068853_100225868 | 3300005539 | Bacteria | 1711 |
| 158 | Ga0070672_100002669 | 3300005543 | Bacteria | 11406 |
| 159 | Ga0070672_100077813 | 3300005543 | Bacteria | 2653 |
| 160 | Ga0070672_100204087 | 3300005543 | Bacteria | 1654 |
| 161 | Ga0070686_100001439 | 3300005544 | Bacteria | 13446 |
| 162 | Ga0070695_100004130 | 3300005545 | Bacteria | 8481 |
| 163 | Ga0070696_100058058 | 3300005546 | Bacteria | 2702 |
| 164 | Ga0070693_100012460 | 3300005547 | Bacteria | 4303 |
| 165 | Ga0070693_100040044 | 3300005547 | Bacteria | 2629 |
| 166 | Ga0070693_100057051 | 3300005547 | Bacteria | 2256 |
| 167 | Ga0070665_100141446 | 3300005548 | Bacteria | 2409 |
| 168 | Ga0070665_100317183 | 3300005548 | Bacteria | 1563 |
| 169 | Ga0070704_100004607 | 3300005549 | Bacteria | 7973 |
| 170 | Ga0070704_100029164 | 3300005549 | Bacteria | 3681 |
| 171 | Ga0068855_100015026 | 3300005563 | Bacteria | 9324 |
| 172 | Ga0068855_100082701 | 3300005563 | Bacteria | 3721 |
| 173 | Ga0068855_100085683 | 3300005563 | Bacteria | 3644 |
| 174 | Ga0068855_100247917 | 3300005563 | Bacteria | 1987 |
| 175 | Ga0070664_100028075 | 3300005564 | Bacteria | 4680 |
| 176 | Ga0068857_100017922 | 3300005577 | Bacteria | 6210 |
| 177 | Ga0068857_100049608 | 3300005577 | Bacteria | 3724 |
| 178 | Ga0068857_100063137 | 3300005577 | Bacteria | 3293 |
| 179 | Ga0068857_100274935 | 3300005577 | Bacteria | 1548 |
| 180 | Ga0068854_100009066 | 3300005578 | Bacteria | 6412 |
| 181 | Ga0068854_100021511 | 3300005578 | Bacteria | 4378 |
| 182 | Ga0068854_100030336 | 3300005578 | Bacteria | 3750 |
| 183 | Ga0068854_100041299 | 3300005578 | Bacteria | 3259 |
| 184 | Ga0068854_100079724 | 3300005578 | Bacteria | 2415 |
| 185 | Ga0068854_100093116 | 3300005578 | Bacteria | 2246 |
| 186 | Ga0068856_100000205 | 3300005614 | Bacteria | 63226 |
| 187 | Ga0068856_100008891 | 3300005614 | Bacteria | 9772 |
| 188 | Ga0068856_100178078 | 3300005614 | Bacteria | 2139 |
| 189 | Ga0070702_100035198 | 3300005615 | Bacteria | 2765 |
| 190 | Ga0070702_100060489 | 3300005615 | Bacteria | 2202 |
| 191 | Ga0068852_100061882 | 3300005616 | Bacteria | 3254 |
| 192 | Ga0068852_100101117 | 3300005616 | Bacteria | 2602 |
| 193 | Ga0068864_100004409 | 3300005618 | Bacteria | 11560 |
| 194 | Ga0068866_10000846 | 3300005718 | Bacteria | 13550 |
| 195 | Ga0068861_100068298 | 3300005719 | Bacteria | 2746 |
| 196 | Ga0068870_10001430 | 3300005840 | Bacteria | 9650 |
| 197 | Ga0068863_100022540 | 3300005841 | Bacteria | 6013 |
| 198 | Ga0068858_100058229 | 3300005842 | Bacteria | 3572 |
| 199 | Ga0068858_100068997 | 3300005842 | Bacteria | 3276 |
| 200 | Ga0068858_100177054 | 3300005842 | Bacteria | 2013 |
| 201 | Ga0068860_100002461 | 3300005843 | Bacteria | 19440 |
| 202 | Ga0068860_100034664 | 3300005843 | Bacteria | 4842 |
| 203 | Ga0068860_100139712 | 3300005843 | Bacteria | 2327 |
| 204 | Ga0068860_100173663 | 3300005843 | Bacteria | 2082 |
| 205 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 206 | Ga0081455_10003981 | 3300005937 | Bacteria | 16764 |
| 207 | Ga0081455_10005089 | 3300005937 | Bacteria | 14508 |
| 208 | Ga0081455_10010171 | 3300005937 | Bacteria | 9579 |
| 209 | Ga0081455_10014697 | 3300005937 | Bacteria | 7646 |
| 210 | Ga0081455_10104512 | 3300005937 | Bacteria | 2266 |
| 211 | Ga0081455_10108267 | 3300005937 | Bacteria | 2214 |
| 212 | Ga0081540_1001773 | 3300005983 | Bacteria | 18126 |
| 213 | Ga0081540_1004076 | 3300005983 | Bacteria | 11311 |
| 214 | Ga0081540_1019964 | 3300005983 | Bacteria | 4049 |
| 215 | Ga0081540_1022590 | 3300005983 | Bacteria | 3712 |
| 216 | Ga0081540_1038917 | 3300005983 | Bacteria | 2500 |
| 217 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 218 | Ga0081539_10001457 | 3300005985 | Bacteria | 40268 |
| 219 | Ga0070717_10002238 | 3300006028 | Bacteria | 13559 |
| 220 | Ga0070717_10003863 | 3300006028 | Bacteria | 10775 |
| 221 | Ga0070717_10006817 | 3300006028 | Bacteria | 8433 |
| 222 | Ga0070717_10019492 | 3300006028 | Bacteria | 5320 |
| 223 | Ga0070717_10080305 | 3300006028 | Bacteria | 2736 |
| 224 | Ga0070717_10124157 | 3300006028 | Bacteria | 2214 |
| 225 | Ga0070717_10225353 | 3300006028 | Bacteria | 1649 |
| 226 | Ga0075365_10004429 | 3300006038 | Bacteria | 7436 |
| 227 | Ga0075365_10019651 | 3300006038 | Bacteria | 4174 |
| 228 | Ga0075365_10144831 | 3300006038 | Bacteria | 1650 |
| 229 | Ga0075365_10148208 | 3300006038 | Bacteria | 1632 |
| 230 | Ga0075365_10169641 | 3300006038 | Bacteria | 1523 |
| 231 | Ga0075365_10174028 | 3300006038 | Bacteria | 1503 |
| 232 | Ga0075364_10030693 | 3300006051 | Bacteria | 3450 |
| 233 | Ga0075364_10083391 | 3300006051 | Bacteria | 2115 |
| 234 | Ga0075432_10005168 | 3300006058 | Bacteria | 4446 |
| 235 | Ga0070715_10000273 | 3300006163 | Bacteria | 12463 |
| 236 | Ga0070715_10036228 | 3300006163 | Bacteria | 2034 |
| 237 | Ga0070716_100001924 | 3300006173 | Bacteria | 9446 |
| 238 | Ga0070712_100022457 | 3300006175 | Bacteria | 4157 |
| 239 | Ga0070712_100029031 | 3300006175 | Bacteria | 3705 |
| 240 | Ga0070712_100055507 | 3300006175 | Bacteria | 2775 |
| 241 | Ga0070712_100148878 | 3300006175 | Bacteria | 1795 |
| 242 | Ga0075367_10025804 | 3300006178 | Bacteria | 3326 |
| 243 | Ga0075367_10051256 | 3300006178 | Bacteria | 2439 |
| 244 | Ga0075369_10014210 | 3300006186 | Bacteria | 3176 |
| 245 | Ga0075369_10024464 | 3300006186 | Bacteria | 2503 |
| 246 | Ga0097621_100003278 | 3300006237 | Bacteria | 11131 |
| 247 | Ga0097621_100019153 | 3300006237 | Bacteria | 5247 |
| 248 | Ga0075370_10115434 | 3300006353 | Bacteria | 1561 |
| 249 | Ga0068871_100036536 | 3300006358 | Bacteria | 3912 |
| 250 | Ga0075428_100012796 | 3300006844 | Bacteria | 9331 |
| 251 | Ga0075428_100075859 | 3300006844 | Bacteria | 3670 |
| 252 | Ga0075430_100000268 | 3300006846 | Bacteria | 36751 |
| 253 | Ga0075431_100005548 | 3300006847 | Bacteria | 12455 |
| 254 | Ga0075433_10000975 | 3300006852 | Bacteria | 20309 |
| 255 | Ga0075433_10117807 | 3300006852 | Bacteria | 2357 |
| 256 | Ga0075434_100001139 | 3300006871 | Bacteria | 21911 |
| 257 | Ga0075434_100006118 | 3300006871 | Bacteria | 11018 |
| 258 | Ga0075434_100009286 | 3300006871 | Bacteria | 9164 |
| 259 | Ga0075434_100046527 | 3300006871 | Bacteria | 4305 |
| 260 | Ga0075429_100002983 | 3300006880 | Bacteria | 14357 |
| 261 | Ga0068865_100006754 | 3300006881 | Bacteria | 7020 |
| 262 | Ga0068865_100047147 | 3300006881 | Bacteria | 2960 |
| 263 | Ga0099824_1006204 | 3300006942 | Bacteria | 16518 |
| 264 | Ga0099824_1006748 | 3300006942 | Bacteria | 15616 |
| 265 | Ga0099822_1004857 | 3300006943 | Bacteria | 17534 |
| 266 | Ga0075435_100007827 | 3300007076 | Bacteria | 7645 |
| 267 | Ga0075435_100210148 | 3300007076 | Bacteria | 1651 |
| 268 | Ga0105240_10002078 | 3300009093 | Bacteria | 32819 |
| 269 | Ga0105240_10013579 | 3300009093 | Bacteria | 11177 |
| 270 | Ga0105240_10016978 | 3300009093 | Bacteria | 9834 |
| 271 | Ga0105240_10064453 | 3300009093 | Bacteria | 4553 |
| 272 | Ga0105240_10126656 | 3300009093 | Bacteria | 3068 |
| 273 | Ga0105240_10219721 | 3300009093 | Bacteria | 2214 |
| 274 | Ga0111539_10000173 | 3300009094 | Bacteria | 74781 |
| 275 | Ga0111539_10000528 | 3300009094 | Bacteria | 48456 |
| 276 | Ga0105245_10035466 | 3300009098 | Bacteria | 4427 |
| 277 | Ga0105245_10080369 | 3300009098 | Bacteria | 2978 |
| 278 | Ga0105245_10259001 | 3300009098 | Bacteria | 1692 |
| 279 | Ga0105247_10005865 | 3300009101 | Bacteria | 7676 |
| 280 | Ga0105247_10037516 | 3300009101 | Bacteria | 2957 |
| 281 | Ga0114129_10001477 | 3300009147 | Bacteria | 31843 |
| 282 | Ga0114129_10015647 | 3300009147 | Bacteria | 10788 |
| 283 | Ga0105243_10008714 | 3300009148 | Bacteria | 7778 |
| 284 | Ga0105241_10031956 | 3300009174 | Bacteria | 3942 |
| 285 | Ga0105241_10070669 | 3300009174 | Bacteria | 2709 |
| 286 | Ga0105241_10086074 | 3300009174 | Bacteria | 2471 |
| 287 | Ga0105242_10025020 | 3300009176 | Bacteria | 4719 |
| 288 | Ga0105248_10098622 | 3300009177 | Bacteria | 3292 |
| 289 | Ga0105248_10105526 | 3300009177 | Bacteria | 3177 |
| 290 | Ga0105237_10007647 | 3300009545 | Bacteria | 11810 |
| 291 | Ga0105237_10009020 | 3300009545 | Bacteria | 10720 |
| 292 | Ga0105237_10031044 | 3300009545 | Bacteria | 5420 |
| 293 | Ga0105237_10226718 | 3300009545 | Bacteria | 1869 |
| 294 | Ga0105238_10010133 | 3300009551 | Bacteria | 9452 |
| 295 | Ga0105238_10026175 | 3300009551 | Bacteria | 5944 |
| 296 | Ga0105238_10030600 | 3300009551 | Bacteria | 5480 |
| 297 | Ga0105238_10084301 | 3300009551 | Bacteria | 3168 |
| 298 | Ga0105238_10196881 | 3300009551 | Bacteria | 1991 |
| 299 | Ga0105249_10015440 | 3300009553 | Bacteria | 6759 |
| 300 | Ga0105249_10030442 | 3300009553 | Bacteria | 4879 |
| 301 | Ga0105249_10175548 | 3300009553 | Bacteria | 2081 |
| 302 | Ga0105249_10381253 | 3300009553 | Bacteria | 1436 |
| 303 | Ga0099796_10025796 | 3300010159 | Bacteria | 1860 |
| 304 | Ga0105239_10005426 | 3300010375 | Bacteria | 14965 |
| 305 | Ga0105239_10016288 | 3300010375 | Bacteria | 8220 |
| 306 | Ga0105239_10037358 | 3300010375 | Bacteria | 5324 |
| 307 | Ga0105239_10045931 | 3300010375 | Bacteria | 4786 |
| 308 | Ga0105239_10047153 | 3300010375 | Bacteria | 4722 |
| 309 | Ga0105246_10003820 | 3300011119 | Bacteria | 9131 |
| 310 | Ga0105246_10046095 | 3300011119 | Bacteria | 2972 |
| 311 | Ga0157373_10039181 | 3300013100 | Bacteria | 3393 |
| 312 | Ga0157370_10124516 | 3300013104 | Bacteria | 2407 |
| 313 | Ga0157369_10003343 | 3300013105 | Bacteria | 19049 |
| 314 | Ga0157369_10046492 | 3300013105 | Bacteria | 4717 |
| 315 | Ga0157369_10269882 | 3300013105 | Bacteria | 1773 |
| 316 | Ga0157374_10012290 | 3300013296 | Bacteria | 7448 |
| 317 | Ga0157374_10068122 | 3300013296 | Bacteria | 3348 |
| 318 | Ga0157374_10114960 | 3300013296 | Bacteria | 2591 |
| 319 | Ga0157374_10188757 | 3300013296 | Bacteria | 2016 |
| 320 | Ga0157378_10011932 | 3300013297 | Bacteria | 7608 |
| 321 | Ga0157378_10143491 | 3300013297 | Bacteria | 2219 |
| 322 | Ga0157378_10160403 | 3300013297 | Bacteria | 2102 |
| 323 | Ga0163162_10045288 | 3300013306 | Bacteria | 4407 |
| 324 | Ga0163162_10048889 | 3300013306 | Bacteria | 4238 |
| 325 | Ga0157372_10095503 | 3300013307 | Bacteria | 3387 |
| 326 | Ga0157372_10112418 | 3300013307 | Bacteria | 3120 |
| 327 | Ga0157372_10188677 | 3300013307 | Bacteria | 2387 |
| 328 | Ga0157375_10044207 | 3300013308 | Bacteria | 4325 |
| 329 | Ga0157375_10099137 | 3300013308 | Bacteria | 2992 |
| 330 | Ga0157375_10157535 | 3300013308 | Bacteria | 2410 |
| 331 | Ga0157375_10253479 | 3300013308 | Bacteria | 1921 |
| 332 | Ga0163163_10001787 | 3300014325 | Bacteria | 18120 |
| 333 | Ga0163163_10002228 | 3300014325 | Bacteria | 16316 |
| 334 | Ga0163163_10041063 | 3300014325 | Bacteria | 4522 |
| 335 | Ga0163163_10121091 | 3300014325 | Bacteria | 2651 |
| 336 | Ga0157380_10030574 | 3300014326 | Bacteria | 4126 |
| 337 | Ga0157380_10113804 | 3300014326 | Bacteria | 2279 |
| 338 | Ga0182008_10057504 | 3300014497 | Bacteria | 1920 |
| 339 | Ga0157377_10001330 | 3300014745 | Bacteria | 10591 |
| 340 | Ga0157379_10080213 | 3300014968 | Bacteria | 2923 |
| 341 | Ga0157379_10170964 | 3300014968 | Bacteria | 1962 |
| 342 | Ga0157376_10042631 | 3300014969 | Bacteria | 3720 |
| 343 | Ga0157376_10071482 | 3300014969 | Bacteria | 2949 |
| 344 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 345 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 346 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 347 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 348 | Ga0213873_10001974 | 3300021358 | Bacteria | 3501 |
| 349 | Ga0213876_10001690 | 3300021384 | Bacteria | 13424 |
| 350 | Ga0213875_10029001 | 3300021388 | Bacteria | 2624 |
| 351 | Ga0224572_1009847 | 3300024225 | Bacteria | 1790 |
| 352 | Ga0209563_102264 | 3300025230 | Bacteria | 4445 |
| 353 | Ga0209677_100537 | 3300025253 | Bacteria | 21070 |
| 354 | Ga0209677_103297 | 3300025253 | Bacteria | 5335 |
| 355 | Ga0209148_1000613 | 3300025254 | Bacteria | 31818 |
| 356 | Ga0209233_1005864 | 3300025261 | Bacteria | 4031 |
| 357 | Ga0209233_1010201 | 3300025261 | Bacteria | 2826 |
| 358 | Ga0207666_1000006 | 3300025271 | Bacteria | 51882 |
| 359 | Ga0207666_1000644 | 3300025271 | Bacteria | 4180 |
| 360 | Ga0209455_1001277 | 3300025272 | Bacteria | 11778 |
| 361 | Ga0209455_1006204 | 3300025272 | Bacteria | 3564 |
| 362 | Ga0209564_1000767 | 3300025295 | Bacteria | 44877 |
| 363 | Ga0209758_1000140 | 3300025297 | Bacteria | 174267 |
| 364 | Ga0209758_1000164 | 3300025297 | Bacteria | 151759 |
| 365 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 366 | Ga0209758_1001601 | 3300025297 | Bacteria | 25859 |
| 367 | Ga0209758_1002397 | 3300025297 | Bacteria | 19252 |
| 368 | Ga0209758_1003800 | 3300025297 | Bacteria | 13297 |
| 369 | Ga0209758_1009162 | 3300025297 | Bacteria | 6227 |
| 370 | Ga0209256_1004401 | 3300025299 | Bacteria | 8877 |
| 371 | Ga0207426_1000626 | 3300025302 | Bacteria | 44875 |
| 372 | Ga0207426_1001803 | 3300025302 | Bacteria | 15932 |
| 373 | Ga0207426_1004225 | 3300025302 | Bacteria | 7139 |
| 374 | Ga0209257_1002059 | 3300025304 | Bacteria | 21302 |
| 375 | Ga0207697_10001754 | 3300025315 | Bacteria | 11655 |
| 376 | Ga0207653_10009403 | 3300025885 | Bacteria | 3043 |
| 377 | Ga0207682_10000040 | 3300025893 | Bacteria | 52878 |
| 378 | Ga0207692_10000214 | 3300025898 | Bacteria | 19493 |
| 379 | Ga0207692_10005215 | 3300025898 | Bacteria | 5189 |
| 380 | Ga0207710_10021294 | 3300025900 | Bacteria | 2777 |
| 381 | Ga0207688_10014533 | 3300025901 | Bacteria | 4278 |
| 382 | Ga0207688_10049196 | 3300025901 | Bacteria | 2356 |
| 383 | Ga0207688_10061314 | 3300025901 | Bacteria | 2120 |
| 384 | Ga0207647_10002967 | 3300025904 | Bacteria | 12763 |
| 385 | Ga0207647_10015473 | 3300025904 | Bacteria | 5227 |
| 386 | Ga0207647_10049226 | 3300025904 | Bacteria | 2615 |
| 387 | Ga0207647_10050100 | 3300025904 | Bacteria | 2587 |
| 388 | Ga0207699_10000379 | 3300025906 | Bacteria | 23393 |
| 389 | Ga0207699_10001095 | 3300025906 | Bacteria | 12787 |
| 390 | Ga0207699_10005078 | 3300025906 | Bacteria | 6296 |
| 391 | Ga0207699_10074575 | 3300025906 | Bacteria | 2084 |
| 392 | Ga0207645_10003655 | 3300025907 | Bacteria | 11607 |
| 393 | Ga0207645_10106794 | 3300025907 | Bacteria | 1810 |
| 394 | Ga0207643_10000046 | 3300025908 | Bacteria | 80736 |
| 395 | Ga0207654_10003188 | 3300025911 | Bacteria | 8290 |
| 396 | Ga0207654_10006353 | 3300025911 | Bacteria | 5942 |
| 397 | Ga0207654_10016493 | 3300025911 | Bacteria | 3847 |
| 398 | Ga0207654_10084329 | 3300025911 | Bacteria | 1921 |
| 399 | Ga0207707_10004014 | 3300025912 | Bacteria | 13065 |
| 400 | Ga0207707_10021050 | 3300025912 | Bacteria | 5698 |
| 401 | Ga0207707_10021698 | 3300025912 | Bacteria | 5613 |
| 402 | Ga0207707_10026218 | 3300025912 | Bacteria | 5095 |
| 403 | Ga0207707_10034615 | 3300025912 | Bacteria | 4419 |
| 404 | Ga0207695_10000910 | 3300025913 | Bacteria | 53286 |
| 405 | Ga0207695_10009322 | 3300025913 | Bacteria | 12149 |
| 406 | Ga0207695_10033825 | 3300025913 | Bacteria | 5568 |
| 407 | Ga0207695_10055378 | 3300025913 | Bacteria | 4133 |
| 408 | Ga0207695_10066027 | 3300025913 | Bacteria | 3718 |
| 409 | Ga0207671_10002587 | 3300025914 | Bacteria | 19123 |
| 410 | Ga0207671_10076695 | 3300025914 | Bacteria | 2501 |
| 411 | Ga0207693_10002346 | 3300025915 | Bacteria | 16445 |
| 412 | Ga0207693_10003562 | 3300025915 | Bacteria | 13302 |
| 413 | Ga0207693_10007817 | 3300025915 | Bacteria | 8778 |
| 414 | Ga0207693_10022850 | 3300025915 | Bacteria | 4965 |
| 415 | Ga0207693_10034870 | 3300025915 | Bacteria | 3969 |
| 416 | Ga0207663_10000628 | 3300025916 | Bacteria | 15643 |
| 417 | Ga0207660_10029889 | 3300025917 | Bacteria | 3742 |
| 418 | Ga0207660_10043420 | 3300025917 | Bacteria | 3160 |
| 419 | Ga0207660_10059490 | 3300025917 | Bacteria | 2743 |
| 420 | Ga0207660_10065192 | 3300025917 | Bacteria | 2631 |
| 421 | Ga0207662_10001270 | 3300025918 | Bacteria | 12138 |
| 422 | Ga0207662_10002365 | 3300025918 | Bacteria | 9453 |
| 423 | Ga0207657_10002140 | 3300025919 | Bacteria | 21397 |
| 424 | Ga0207657_10016821 | 3300025919 | Bacteria | 7040 |
| 425 | Ga0207657_10055164 | 3300025919 | Bacteria | 3434 |
| 426 | Ga0207657_10105056 | 3300025919 | Bacteria | 2338 |
| 427 | Ga0207657_10129531 | 3300025919 | Bacteria | 2069 |
| 428 | Ga0207649_10003855 | 3300025920 | Bacteria | 8177 |
| 429 | Ga0207652_10020518 | 3300025921 | Bacteria | 5443 |
| 430 | Ga0207652_10029861 | 3300025921 | Bacteria | 4562 |
| 431 | Ga0207652_10032852 | 3300025921 | Bacteria | 4366 |
| 432 | Ga0207652_10065476 | 3300025921 | Bacteria | 3147 |
| 433 | Ga0207652_10083096 | 3300025921 | Bacteria | 2804 |
| 434 | Ga0207652_10094319 | 3300025921 | Bacteria | 2635 |
| 435 | Ga0207652_10215805 | 3300025921 | Bacteria | 1728 |
| 436 | Ga0207694_10000157 | 3300025924 | Bacteria | 70076 |
| 437 | Ga0207694_10039954 | 3300025924 | Bacteria | 3611 |
| 438 | Ga0207694_10081499 | 3300025924 | Bacteria | 2542 |
| 439 | Ga0207650_10009127 | 3300025925 | Bacteria | 6777 |
| 440 | Ga0207650_10113578 | 3300025925 | Bacteria | 2100 |
| 441 | Ga0207659_10080673 | 3300025926 | Bacteria | 2404 |
| 442 | Ga0207659_10214645 | 3300025926 | Bacteria | 1544 |
| 443 | Ga0207687_10117983 | 3300025927 | Bacteria | 1980 |
| 444 | Ga0207700_10000290 | 3300025928 | Bacteria | 29736 |
| 445 | Ga0207700_10015816 | 3300025928 | Bacteria | 4991 |
| 446 | Ga0207700_10021985 | 3300025928 | Bacteria | 4369 |
| 447 | Ga0207700_10053583 | 3300025928 | Bacteria | 3023 |
| 448 | Ga0207700_10076524 | 3300025928 | Bacteria | 2597 |
| 449 | Ga0207700_10080567 | 3300025928 | Bacteria | 2539 |
| 450 | Ga0207700_10135371 | 3300025928 | Bacteria | 2017 |
| 451 | Ga0207664_10018261 | 3300025929 | Bacteria | 5159 |
| 452 | Ga0207664_10018330 | 3300025929 | Bacteria | 5150 |
| 453 | Ga0207664_10023247 | 3300025929 | Bacteria | 4641 |
| 454 | Ga0207664_10030290 | 3300025929 | Bacteria | 4132 |
| 455 | Ga0207664_10131051 | 3300025929 | Bacteria | 2111 |
| 456 | Ga0207664_10179395 | 3300025929 | Bacteria | 1817 |
| 457 | Ga0207644_10002541 | 3300025931 | Bacteria | 11742 |
| 458 | Ga0207644_10011352 | 3300025931 | Bacteria | 5893 |
| 459 | Ga0207644_10138352 | 3300025931 | Bacteria | 1872 |
| 460 | Ga0207690_10047293 | 3300025932 | Bacteria | 2854 |
| 461 | Ga0207706_10000929 | 3300025933 | Bacteria | 30046 |
| 462 | Ga0207706_10016427 | 3300025933 | Bacteria | 6682 |
| 463 | Ga0207706_10019475 | 3300025933 | Bacteria | 6105 |
| 464 | Ga0207686_10021591 | 3300025934 | Bacteria | 3697 |
| 465 | Ga0207709_10008343 | 3300025935 | Bacteria | 5735 |
| 466 | Ga0207709_10163609 | 3300025935 | Bacteria | 1554 |
| 467 | Ga0207670_10141063 | 3300025936 | Bacteria | 1777 |
| 468 | Ga0207669_10027433 | 3300025937 | Bacteria | 3118 |
| 469 | Ga0207704_10014558 | 3300025938 | Bacteria | 3975 |
| 470 | Ga0207665_10001305 | 3300025939 | Bacteria | 16794 |
| 471 | Ga0207665_10016936 | 3300025939 | Bacteria | 4785 |
| 472 | Ga0207665_10030619 | 3300025939 | Bacteria | 3558 |
| 473 | Ga0207665_10056650 | 3300025939 | Bacteria | 2646 |
| 474 | Ga0207691_10009584 | 3300025940 | Bacteria | 9296 |
| 475 | Ga0207691_10099548 | 3300025940 | Bacteria | 2596 |
| 476 | Ga0207711_10040182 | 3300025941 | Bacteria | 3979 |
| 477 | Ga0207711_10191095 | 3300025941 | Bacteria | 1866 |
| 478 | Ga0207711_10191689 | 3300025941 | Bacteria | 1863 |
| 479 | Ga0207689_10006509 | 3300025942 | Bacteria | 10313 |
| 480 | Ga0207661_10001362 | 3300025944 | Bacteria | 16378 |
| 481 | Ga0207661_10006014 | 3300025944 | Bacteria | 8571 |
| 482 | Ga0207661_10008276 | 3300025944 | Bacteria | 7430 |
| 483 | Ga0207661_10041416 | 3300025944 | Bacteria | 3626 |
| 484 | Ga0207679_10000763 | 3300025945 | Bacteria | 21224 |
| 485 | Ga0207679_10033372 | 3300025945 | Bacteria | 3621 |
| 486 | Ga0207667_10023580 | 3300025949 | Bacteria | 6776 |
| 487 | Ga0207667_10026403 | 3300025949 | Bacteria | 6346 |
| 488 | Ga0207667_10044845 | 3300025949 | Bacteria | 4684 |
| 489 | Ga0207667_10045421 | 3300025949 | Bacteria | 4652 |
| 490 | Ga0207667_10131448 | 3300025949 | Bacteria | 2578 |
| 491 | Ga0207667_10223495 | 3300025949 | Bacteria | 1929 |
| 492 | Ga0207651_10010247 | 3300025960 | Bacteria | 5184 |
| 493 | Ga0207651_10084284 | 3300025960 | Bacteria | 2301 |
| 494 | Ga0207668_10048856 | 3300025972 | Bacteria | 2905 |
| 495 | Ga0207640_10007930 | 3300025981 | Bacteria | 5860 |
| 496 | Ga0207640_10015340 | 3300025981 | Bacteria | 4433 |
| 497 | Ga0207640_10021906 | 3300025981 | Bacteria | 3816 |
| 498 | Ga0207640_10057689 | 3300025981 | Bacteria | 2555 |
| 499 | Ga0207640_10204882 | 3300025981 | Bacteria | 1498 |
| 500 | Ga0207658_10107758 | 3300025986 | Bacteria | 2196 |
| 501 | Ga0207658_10188318 | 3300025986 | Bacteria | 1713 |
| 502 | Ga0207677_10061004 | 3300026023 | Bacteria | 2609 |
| 503 | Ga0207677_10157340 | 3300026023 | Bacteria | 1761 |
| 504 | Ga0207703_10108450 | 3300026035 | Bacteria | 2365 |
| 505 | Ga0207639_10018019 | 3300026041 | Bacteria | 5009 |
| 506 | Ga0207639_10025447 | 3300026041 | Bacteria | 4291 |
| 507 | Ga0207639_10073790 | 3300026041 | Bacteria | 2676 |
| 508 | Ga0207639_10089205 | 3300026041 | Bacteria | 2463 |
| 509 | Ga0207639_10167612 | 3300026041 | Bacteria | 1857 |
| 510 | Ga0207678_10022365 | 3300026067 | Bacteria | 5538 |
| 511 | Ga0207678_10042921 | 3300026067 | Bacteria | 3915 |
| 512 | Ga0207678_10058942 | 3300026067 | Bacteria | 3304 |
| 513 | Ga0207708_10004046 | 3300026075 | Bacteria | 10777 |
| 514 | Ga0207708_10013208 | 3300026075 | Bacteria | 6165 |
| 515 | Ga0207708_10033993 | 3300026075 | Bacteria | 3877 |
| 516 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 517 | Ga0207702_10000048 | 3300026078 | Bacteria | 143125 |
| 518 | Ga0207702_10041826 | 3300026078 | Bacteria | 3843 |
| 519 | Ga0207702_10138982 | 3300026078 | Bacteria | 2196 |
| 520 | Ga0207641_10027420 | 3300026088 | Bacteria | 4703 |
| 521 | Ga0207648_10032664 | 3300026089 | Bacteria | 4593 |
| 522 | Ga0207676_10110779 | 3300026095 | Bacteria | 2296 |
| 523 | Ga0207674_10000647 | 3300026116 | Bacteria | 45307 |
| 524 | Ga0207674_10019475 | 3300026116 | Bacteria | 7348 |
| 525 | Ga0207674_10020460 | 3300026116 | Bacteria | 7148 |
| 526 | Ga0207674_10055214 | 3300026116 | Bacteria | 4040 |
| 527 | Ga0207674_10093681 | 3300026116 | Bacteria | 2992 |
| 528 | Ga0207675_100000322 | 3300026118 | Bacteria | 45568 |
| 529 | Ga0207675_100099013 | 3300026118 | Bacteria | 2746 |
| 530 | Ga0207675_100126993 | 3300026118 | Bacteria | 2416 |
| 531 | Ga0207675_100211307 | 3300026118 | Bacteria | 1866 |
| 532 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 533 | Ga0207683_10001293 | 3300026121 | Bacteria | 22621 |
| 534 | Ga0207683_10022736 | 3300026121 | Bacteria | 5385 |
| 535 | Ga0207683_10079477 | 3300026121 | Bacteria | 2908 |
| 536 | Ga0207683_10086355 | 3300026121 | Bacteria | 2789 |
| 537 | Ga0207683_10127238 | 3300026121 | Bacteria | 2290 |
| 538 | Ga0207698_10034569 | 3300026142 | Bacteria | 3686 |
| 539 | Ga0207698_10112081 | 3300026142 | Bacteria | 2289 |
| 540 | Ga0209389_1000061 | 3300027296 | Bacteria | 105698 |
| 541 | Ga0209389_1000233 | 3300027296 | Bacteria | 36791 |
| 542 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 543 | Ga0209589_1000465 | 3300027357 | Bacteria | 56891 |
| 544 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 545 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 546 | Ga0209489_102560 | 3300027361 | Bacteria | 36742 |
| 547 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 548 | Ga0209700_100062 | 3300027363 | Bacteria | 145471 |
| 549 | Ga0209971_1008209 | 3300027682 | Bacteria | 2476 |
| 550 | Ga0209998_10003231 | 3300027717 | Bacteria | 3596 |
| 551 | Ga0209974_10003995 | 3300027876 | Bacteria | 5274 |
| 552 | Ga0207428_10000291 | 3300027907 | Bacteria | 67245 |
| 553 | Ga0207428_10000303 | 3300027907 | Bacteria | 65124 |
| 554 | Ga0207428_10004591 | 3300027907 | Bacteria | 13090 |
| 555 | Ga0268266_10132623 | 3300028379 | Bacteria | 2229 |
| 556 | Ga0268266_10252429 | 3300028379 | Bacteria | 1632 |
| 557 | Ga0268265_10003775 | 3300028380 | Bacteria | 10745 |
| 558 | Ga0268264_10000149 | 3300028381 | Bacteria | 163972 |
| 559 | Ga0268264_10077581 | 3300028381 | Bacteria | 2830 |
| 560 | Ga0265337_1001406 | 3300028556 | Bacteria | 11820 |
| 561 | Ga0265337_1007816 | 3300028556 | Bacteria | 3963 |
| 562 | Ga0265319_1012289 | 3300028563 | Bacteria | 3469 |
| 563 | Ga0265318_10051844 | 3300028577 | Bacteria | 1540 |
| 564 | Ga0265336_10001016 | 3300028666 | Bacteria | 13775 |
| 565 | Ga0307517_10000772 | 3300028786 | Bacteria | 55020 |
| 566 | Ga0307515_10021427 | 3300028794 | Bacteria | 11463 |
| 567 | Ga0307515_10096058 | 3300028794 | Bacteria | 3639 |
| 568 | Ga0265338_10001205 | 3300028800 | Bacteria | 42738 |
| 569 | Ga0265338_10038005 | 3300028800 | Bacteria | 4569 |
| 570 | Ga0265330_10001924 | 3300031235 | Bacteria | 11547 |
| 571 | Ga0265330_10019625 | 3300031235 | Bacteria | 3095 |
| 572 | Ga0265325_10000029 | 3300031241 | Bacteria | 103942 |
| 573 | Ga0265325_10002293 | 3300031241 | Bacteria | 12974 |
| 574 | Ga0265325_10003329 | 3300031241 | Bacteria | 10565 |
| 575 | Ga0265325_10018954 | 3300031241 | Bacteria | 3810 |
| 576 | Ga0265340_10010828 | 3300031247 | Bacteria | 4869 |
| 577 | Ga0265340_10017331 | 3300031247 | Bacteria | 3725 |
| 578 | Ga0265339_10000465 | 3300031249 | Bacteria | 31657 |
| 579 | Ga0265339_10002336 | 3300031249 | Bacteria | 13644 |
| 580 | Ga0265339_10051392 | 3300031249 | Bacteria | 2249 |
| 581 | Ga0265316_10084326 | 3300031344 | Bacteria | 2433 |
| 582 | Ga0307509_10024209 | 3300031507 | Bacteria | 6801 |
| 583 | Ga0307509_10208554 | 3300031507 | Bacteria | 1782 |
| 584 | Ga0265313_10000006 | 3300031595 | Bacteria | 183184 |
| 585 | Ga0265313_10000183 | 3300031595 | Bacteria | 66629 |
| 586 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 587 | Ga0307508_10234307 | 3300031616 | Bacteria | 1433 |
| 588 | Ga0265314_10006174 | 3300031711 | Bacteria | 10644 |
| 589 | Ga0265314_10016765 | 3300031711 | Bacteria | 5773 |
| 590 | Ga0265342_10005467 | 3300031712 | Bacteria | 9669 |
| 591 | Ga0307516_10006873 | 3300031730 | Bacteria | 13250 |
| 592 | Ga0307516_10013909 | 3300031730 | Bacteria | 8540 |
| 593 | Ga0307516_10015330 | 3300031730 | Bacteria | 8066 |
| 594 | Ga0307413_10050953 | 3300031824 | Bacteria | 2491 |
| 595 | Ga0307410_10140170 | 3300031852 | Bacteria | 1788 |
| 596 | Ga0307414_10137251 | 3300032004 | Bacteria | 1909 |
| 597 | Ga0316583_10000523 | 3300032133 | Bacteria | 11541 |
| 598 | Ga0307510_10053275 | 3300033180 | Bacteria | 4255 |
| 599 | Ga0307510_10061725 | 3300033180 | Bacteria | 3837 |
| 600 | Ga0307510_10199292 | 3300033180 | Bacteria | 1539 |
| 601 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 602 | Ga0373948_0001308 | 3300034817 | Bacteria | 3417 |
| 603 | Ga0373948_0003865 | 3300034817 | Bacteria | 2335 |
| 604 | Ga0373950_0002811 | 3300034818 | Bacteria | 2436 |
| 605 | Ga0373958_0000676 | 3300034819 | Bacteria | 4310 |
| 606 | Ga0373938_0000022 | 3300034957 | Bacteria | 20030 |
| 607 | Ga0373928_0000047 | 3300035084 | Bacteria | 21023 |
| 608 | Ga0373928_0004151 | 3300035084 | Bacteria | 2763 |
| 609 | Ga0373928_0006672 | 3300035084 | Bacteria | 2220 |
| 610 | Ga0373934_0017260 | 3300035086 | Bacteria | 2753 |
| 611 | Ga0373934_0040526 | 3300035086 | Bacteria | 1837 |
| 612 | Ga0373944_0000339 | 3300035089 | Bacteria | 10505 |
| 613 | Ga0373944_0000350 | 3300035089 | Bacteria | 10418 |
| 614 | Ga0373949_0001400 | 3300035090 | Bacteria | 6934 |
| 615 | Ga0373949_0008195 | 3300035090 | Bacteria | 2289 |
| 616 | Ga0373951_0001054 | 3300035091 | Bacteria | 7405 |
| 617 | Ga0373952_0000105 | 3300035092 | Bacteria | 11290 |
| 618 | Ga0373923_0000770 | 3300035111 | Bacteria | 8324 |
| 619 | Ga0373932_0006455 | 3300035112 | Bacteria | 2774 |
| 620 | Ga0373939_0005537 | 3300035114 | Bacteria | 3010 |
| 621 | Ga0373945_0000820 | 3300035116 | Bacteria | 9125 |
| 622 | Ga0373945_0030989 | 3300035116 | Bacteria | 1887 |
| 623 | Ga0373953_0000239 | 3300035117 | Bacteria | 14970 |
| 624 | Ga0373953_0004113 | 3300035117 | Bacteria | 4613 |
| 625 | Ga0373954_0001738 | 3300035118 | Bacteria | 8931 |
| 626 | Ga0373954_0005936 | 3300035118 | Bacteria | 5309 |
| 627 | Ga0373954_0020353 | 3300035118 | Bacteria | 3001 |
| 628 | Ga0373954_0031701 | 3300035118 | Bacteria | 2441 |
| 629 | Ga0373954_0034305 | 3300035118 | Bacteria | 2350 |
| 630 | Ga0373954_0078574 | 3300035118 | Bacteria | 1574 |
| 631 | Ga0373956_0002833 | 3300035119 | Bacteria | 7013 |
| 632 | Ga0373957_0034461 | 3300035120 | Bacteria | 1875 |
| 633 | Ga0373960_0000925 | 3300035121 | Bacteria | 6259 |
| 634 | Ga0373943_0000061 | 3300035170 | Bacteria | 37449 |
| 635 | Ga0373943_0006074 | 3300035170 | Bacteria | 5424 |
| 636 | Ga0373943_0015843 | 3300035170 | Bacteria | 3429 |
| 637 | Ga0373943_0019619 | 3300035170 | Bacteria | 3110 |
| 638 | Ga0373943_0019660 | 3300035170 | Bacteria | 3107 |
| 639 | Ga0373943_0024439 | 3300035170 | Bacteria | 2817 |
| 640 | Ga0373943_0031241 | 3300035170 | Bacteria | 2526 |
| 641 | Ga0373946_0000417 | 3300035171 | Bacteria | 13848 |
| 642 | Ga0373946_0003998 | 3300035171 | Bacteria | 5245 |
| 643 | Ga0373955_0000210 | 3300035172 | Bacteria | 24373 |
| 644 | Ga0373955_0004764 | 3300035172 | Bacteria | 6035 |
| 645 | Ga0373955_0006846 | 3300035172 | Bacteria | 5211 |
| 646 | Ga0373955_0008373 | 3300035172 | Bacteria | 4801 |
| 647 | Ga0373955_0023446 | 3300035172 | Bacteria | 3143 |
| 648 | Ga0373942_0005353 | 3300035207 | Bacteria | 2978 |
| 649 | Ga0373961_0001233 | 3300035241 | Bacteria | 7866 |
| 650 | Ga0373962_0001787 | 3300035242 | Bacteria | 5119 |
| 651 | Ga0373924_0008268 | 3300035410 | Bacteria | 3776 |
| 652 | Ga0373924_0013778 | 3300035410 | Bacteria | 3043 |
| 653 | Ga0373924_0033493 | 3300035410 | Bacteria | 2074 |
| 654 | Ga0373931_0006062 | 3300035691 | Bacteria | 5630 |
| 655 | Ga0373931_0013930 | 3300035691 | Bacteria | 3923 |
| 656 | Ga0373931_0022502 | 3300035691 | Bacteria | 3173 |
| 657 | Ga0373935_0000602 | 3300035692 | Bacteria | 18790 |
| 658 | Ga0373935_0003114 | 3300035692 | Bacteria | 9576 |
| 659 | Ga0373935_0012999 | 3300035692 | Bacteria | 5017 |
| 660 | Ga0373935_0074880 | 3300035692 | Bacteria | 2189 |
| 661 | Ga0373935_0119540 | 3300035692 | Bacteria | 1758 |
| 662 | Ga0373935_0207899 | 3300035692 | Bacteria | 1355 |
| 663 | Ga0373927_0000069 | 3300035695 | Bacteria | 74096 |
| 664 | Ga0373927_0000275 | 3300035695 | Bacteria | 40382 |
| 665 | Ga0373927_0002225 | 3300035695 | Bacteria | 14255 |
| 666 | Ga0373927_0007415 | 3300035695 | Bacteria | 7427 |
| 667 | Ga0373927_0008118 | 3300035695 | Bacteria | 7082 |
| 668 | Ga0373927_0031474 | 3300035695 | Bacteria | 3457 |
| 669 | Ga0373927_0033098 | 3300035695 | Bacteria | 3365 |
| 670 | Ga0373927_0038411 | 3300035695 | Bacteria | 3108 |
| 671 | Ga0373927_0054070 | 3300035695 | Bacteria | 2597 |
| 672 | Ga0373927_0079125 | 3300035695 | Bacteria | 2129 |
| 673 | Ga0373933_0000235 | 3300035724 | Bacteria | 36446 |
| 674 | Ga0373933_0001755 | 3300035724 | Bacteria | 12583 |
| 675 | Ga0373933_0003240 | 3300035724 | Bacteria | 9087 |
| 676 | Ga0373933_0003450 | 3300035724 | Bacteria | 8799 |
| 677 | Ga0373933_0013766 | 3300035724 | Bacteria | 4487 |
| 678 | Ga0373933_0045006 | 3300035724 | Bacteria | 2616 |
| 679 | Ga0373947_0000187 | 3300035725 | Bacteria | 34086 |
| 680 | Ga0373947_0000385 | 3300035725 | Bacteria | 24888 |
| 681 | Ga0373947_0000967 | 3300035725 | Bacteria | 17537 |
| 682 | Ga0373947_0015091 | 3300035725 | Bacteria | 4434 |
| 683 | Ga0373947_0016982 | 3300035725 | Bacteria | 4182 |
| 684 | Ga0373947_0022314 | 3300035725 | Bacteria | 3670 |
| 685 | Ga0373947_0053197 | 3300035725 | Bacteria | 2441 |
| 686 | Ga0373937_0019845 | 3300036401 | Bacteria | 6020 |
| 687 | Ga0373937_0023996 | 3300036401 | Bacteria | 5499 |
| 688 | Ga0373937_0025035 | 3300036401 | Bacteria | 5387 |
| 689 | Ga0373937_0025676 | 3300036401 | Bacteria | 5320 |
| 690 | Ga0373937_0226896 | 3300036401 | Bacteria | 1758 |
| 691 | Ga0373925_0000791 | 3300037068 | Bacteria | 29167 |
| 692 | Ga0373925_0006683 | 3300037068 | Bacteria | 8459 |
| 693 | Ga0373925_0054208 | 3300037068 | Bacteria | 2998 |
| 694 | Ga0373925_0206569 | 3300037068 | Bacteria | 1563 |
| 695 | Ga0395900_0001120 | 3300037418 | Bacteria | 33947 |
| 696 | Ga0395900_0034552 | 3300037418 | Bacteria | 5208 |
| 697 | Ga0395900_0121340 | 3300037418 | Bacteria | 2681 |
| 698 | Ga0395898_0087444 | 3300037466 | Bacteria | 3002 |
| 699 | Ga0395898_0089518 | 3300037466 | Bacteria | 2962 |
| 700 | Ga0395898_0109182 | 3300037466 | Bacteria | 2653 |
| 701 | Ga0395905_0015063 | 3300037471 | Bacteria | 7366 |
| 702 | Ga0395905_0034684 | 3300037471 | Bacteria | 4739 |
| 703 | Ga0395905_0171121 | 3300037471 | Bacteria | 2040 |
| 704 | Ga0436364_1473129 | 3300037853 | Bacteria | 5124 |
| 705 | Ga0395901_0073892 | 3300038443 | Bacteria | 3556 |
| 706 | Ga0395901_0120747 | 3300038443 | Bacteria | 2754 |
| 707 | Ga0395901_0124045 | 3300038443 | Bacteria | 2714 |
| 708 | Ga0395901_0187242 | 3300038443 | Bacteria | 2171 |
| 709 | Ga0436365_1440273 | 3300039437 | Bacteria | 9786 |
| 710 | Ga0436361_0897580 | 3300039447 | Bacteria | 2761 |
| 711 | Ga0436362_0987899 | 3300039453 | Bacteria | 6862 |
| 712 | Ga0439443_005357 | 3300042003 | Bacteria | 1712 |
| 713 | Ga0439448_0018291 | 3300042005 | Bacteria | 2146 |
| 714 | Ga0451577_0149889 | 3300042876 | Bacteria | 2098 |
| 715 | Ga0466969_0057995 | 3300044656 | Bacteria | 1886 |
| 716 | Ga0466972_0000189 | 3300044658 | Bacteria | 47501 |
| 717 | Ga0466972_0007356 | 3300044658 | Bacteria | 5533 |
| 718 | Ga0453683_0000007 | 3300044673 | Bacteria | 581341 |
| 719 | Ga0466966_0000655 | 3300044684 | Bacteria | 22032 |
| 720 | Ga0466966_0079685 | 3300044684 | Bacteria | 2041 |
| 721 | Ga0466961_0001465 | 3300044693 | Bacteria | 14665 |
| 722 | Ga0466963_0031905 | 3300044694 | Bacteria | 3407 |
| 723 | Ga0466963_0033194 | 3300044694 | Bacteria | 3348 |
| 724 | Ga0466963_0033468 | 3300044694 | Bacteria | 3337 |
| 725 | Ga0466971_0028124 | 3300044719 | Bacteria | 2517 |
| 726 | Ga0466957_0005455 | 3300044842 | Bacteria | 7137 |
| 727 | Ga0466959_0041216 | 3300045049 | Bacteria | 3409 |
| 728 | Ga0466959_0065550 | 3300045049 | Bacteria | 2636 |
| 729 | Ga0466959_0193986 | 3300045049 | Bacteria | 1416 |
| 730 | Ga0451576_0048748 | 3300045051 | Bacteria | 4447 |
| 731 | Ga0466958_0025802 | 3300045836 | Bacteria | 3468 |
| 732 | Ga0466967_0068767 | 3300045976 | Bacteria | 3163 |
| 733 | Ga0466967_0131186 | 3300045976 | Bacteria | 2326 |
| 734 | Ga0466967_0229850 | 3300045976 | Bacteria | 1766 |
| 735 | Ga0495592_0004838 | 3300046454 | Bacteria | 9908 |
| 736 | Ga0495592_0010286 | 3300046454 | Bacteria | 7054 |
| 737 | Ga0495592_0030258 | 3300046454 | Bacteria | 4095 |
| 738 | Ga0495592_0038864 | 3300046454 | Bacteria | 3577 |
| 739 | Ga0495592_0076265 | 3300046454 | Bacteria | 2433 |
| 740 | Ga0495603_0001382 | 3300046455 | Bacteria | 14093 |
| 741 | Ga0495603_0004726 | 3300046455 | Bacteria | 8135 |
| 742 | Ga0495603_0012706 | 3300046455 | Bacteria | 5095 |
| 743 | Ga0495603_0025702 | 3300046455 | Bacteria | 3560 |
| 744 | Ga0495603_0042290 | 3300046455 | Bacteria | 2724 |
| 745 | Ga0495603_0045674 | 3300046455 | Bacteria | 2611 |
| 746 | Ga0495591_014080 | 3300046458 | Bacteria | 2892 |
| 747 | Ga0495629_0000083 | 3300046459 | Bacteria | 83715 |
| 748 | Ga0495629_0000329 | 3300046459 | Bacteria | 40545 |
| 749 | Ga0495629_0000721 | 3300046459 | Bacteria | 26824 |
| 750 | Ga0495629_0020254 | 3300046459 | Bacteria | 4750 |
| 751 | Ga0495638_0006737 | 3300046460 | Bacteria | 8322 |
| 752 | Ga0495638_0022234 | 3300046460 | Bacteria | 4164 |
| 753 | Ga0495641_0009705 | 3300046461 | Bacteria | 5688 |
| 754 | Ga0495641_0032985 | 3300046461 | Bacteria | 2461 |
| 755 | Ga0495651_0000395 | 3300046462 | Bacteria | 33751 |
| 756 | Ga0495651_0004021 | 3300046462 | Bacteria | 11241 |
| 757 | Ga0495651_0007002 | 3300046462 | Bacteria | 8625 |
| 758 | Ga0495651_0026970 | 3300046462 | Bacteria | 4472 |
| 759 | Ga0495651_0162939 | 3300046462 | Bacteria | 1596 |
| 760 | Ga0495653_0003944 | 3300046463 | Bacteria | 11986 |
| 761 | Ga0495653_0004234 | 3300046463 | Bacteria | 11627 |
| 762 | Ga0495653_0094600 | 3300046463 | Bacteria | 2177 |
| 763 | Ga0495580_0000716 | 3300046472 | Bacteria | 28310 |
| 764 | Ga0495580_0019177 | 3300046472 | Bacteria | 5082 |
| 765 | Ga0495582_0000094 | 3300046473 | Bacteria | 45642 |
| 766 | Ga0495582_0003339 | 3300046473 | Bacteria | 9023 |
| 767 | Ga0495582_0004669 | 3300046473 | Bacteria | 7704 |
| 768 | Ga0495582_0018325 | 3300046473 | Bacteria | 3830 |
| 769 | Ga0495582_0022886 | 3300046473 | Bacteria | 3418 |
| 770 | Ga0495605_0020821 | 3300046474 | Bacteria | 3482 |
| 771 | Ga0495605_0052069 | 3300046474 | Bacteria | 1991 |
| 772 | Ga0495639_0000150 | 3300046475 | Bacteria | 36003 |
| 773 | Ga0495662_0000080 | 3300046476 | Bacteria | 34571 |
| 774 | Ga0495662_0016714 | 3300046476 | Bacteria | 3554 |
| 775 | Ga0495664_0000662 | 3300046477 | Bacteria | 17523 |
| 776 | Ga0495664_0008600 | 3300046477 | Bacteria | 5694 |
| 777 | Ga0495664_0024018 | 3300046477 | Bacteria | 3540 |
| 778 | Ga0495664_0051239 | 3300046477 | Bacteria | 2451 |
| 779 | Ga0495664_0098621 | 3300046477 | Bacteria | 1759 |
| 780 | Ga0495584_0076249 | 3300046491 | Bacteria | 1686 |
| 781 | Ga0495585_0001303 | 3300046492 | Bacteria | 19900 |
| 782 | Ga0495594_0000433 | 3300046499 | Bacteria | 21075 |
| 783 | Ga0495594_0006111 | 3300046499 | Bacteria | 6192 |
| 784 | Ga0495594_0012537 | 3300046499 | Bacteria | 4416 |
| 785 | Ga0495594_0054424 | 3300046499 | Bacteria | 2205 |
| 786 | Ga0495606_0001450 | 3300046507 | Bacteria | 31779 |
| 787 | Ga0495606_0014755 | 3300046507 | Bacteria | 6070 |
| 788 | Ga0495606_0049637 | 3300046507 | Bacteria | 2750 |
| 789 | Ga0495606_0074233 | 3300046507 | Bacteria | 2131 |
| 790 | Ga0495608_0001144 | 3300046511 | Bacteria | 18769 |
| 791 | Ga0495608_0005204 | 3300046511 | Bacteria | 9296 |
| 792 | Ga0495608_0019490 | 3300046511 | Bacteria | 4667 |
| 793 | Ga0495616_0025296 | 3300046513 | Bacteria | 3173 |
| 794 | Ga0495616_0034991 | 3300046513 | Bacteria | 2603 |
| 795 | Ga0495618_0007675 | 3300046514 | Bacteria | 6524 |
| 796 | Ga0495618_0066416 | 3300046514 | Bacteria | 2293 |
| 797 | Ga0495618_0098046 | 3300046514 | Bacteria | 1875 |
| 798 | Ga0495618_0135342 | 3300046514 | Bacteria | 1576 |
| 799 | Ga0495628_0002354 | 3300046516 | Bacteria | 17059 |
| 800 | Ga0495628_0006385 | 3300046516 | Bacteria | 10302 |
| 801 | Ga0495628_0035160 | 3300046516 | Bacteria | 4028 |
| 802 | Ga0495628_0037332 | 3300046516 | Bacteria | 3895 |
| 803 | Ga0495628_0080403 | 3300046516 | Bacteria | 2533 |
| 804 | Ga0495630_0000875 | 3300046517 | Bacteria | 21129 |
| 805 | Ga0495630_0008635 | 3300046517 | Bacteria | 7312 |
| 806 | Ga0495630_0050012 | 3300046517 | Bacteria | 3128 |
| 807 | Ga0495630_0067663 | 3300046517 | Bacteria | 2685 |
| 808 | Ga0495630_0154120 | 3300046517 | Bacteria | 1749 |
| 809 | Ga0495643_0081923 | 3300046522 | Bacteria | 1677 |
| 810 | Ga0495644_0000434 | 3300046523 | Bacteria | 18447 |
| 811 | Ga0495648_0002087 | 3300046524 | Bacteria | 18883 |
| 812 | Ga0495663_0030622 | 3300046525 | Bacteria | 1595 |
| 813 | Ga0495652_0006074 | 3300046529 | Bacteria | 11294 |
| 814 | Ga0495652_0021509 | 3300046529 | Bacteria | 5732 |
| 815 | Ga0495652_0031303 | 3300046529 | Bacteria | 4659 |
| 816 | Ga0495652_0055445 | 3300046529 | Bacteria | 3371 |
| 817 | Ga0495652_0071178 | 3300046529 | Bacteria | 2904 |
| 818 | Ga0495652_0083231 | 3300046529 | Bacteria | 2634 |
| 819 | Ga0495652_0083644 | 3300046529 | Bacteria | 2626 |
| 820 | Ga0495652_0163759 | 3300046529 | Bacteria | 1723 |
| 821 | Ga0495665_0000533 | 3300046531 | Bacteria | 19262 |
| 822 | Ga0495665_0003951 | 3300046531 | Bacteria | 8016 |
| 823 | Ga0495665_0044463 | 3300046531 | Bacteria | 2360 |
| 824 | Ga0495640_0003907 | 3300046533 | Bacteria | 11934 |
| 825 | Ga0495640_0007742 | 3300046533 | Bacteria | 8452 |
| 826 | Ga0495640_0028558 | 3300046533 | Bacteria | 4015 |
| 827 | Ga0495640_0029207 | 3300046533 | Bacteria | 3962 |
| 828 | Ga0495640_0041269 | 3300046533 | Bacteria | 3225 |
| 829 | Ga0495586_0010306 | 3300046535 | Bacteria | 4971 |
| 830 | Ga0495586_0028080 | 3300046535 | Bacteria | 3011 |
| 831 | Ga0495586_0064726 | 3300046535 | Bacteria | 1992 |
| 832 | Ga0495587_0001492 | 3300046536 | Bacteria | 15604 |
| 833 | Ga0495587_0018363 | 3300046536 | Bacteria | 4338 |
| 834 | Ga0495587_0034734 | 3300046536 | Bacteria | 3039 |
| 835 | Ga0495587_0037957 | 3300046536 | Bacteria | 2890 |
| 836 | Ga0495587_0099010 | 3300046536 | Bacteria | 1681 |
| 837 | Ga0495598_0003353 | 3300046537 | Bacteria | 3395 |
| 838 | Ga0495609_0015485 | 3300046538 | Bacteria | 3570 |
| 839 | Ga0495609_0049891 | 3300046538 | Bacteria | 1867 |
| 840 | Ga0495621_0039707 | 3300046539 | Bacteria | 1647 |
| 841 | Ga0495597_0045864 | 3300046542 | Bacteria | 1938 |
| 842 | Ga0495645_0001112 | 3300046543 | Bacteria | 18197 |
| 843 | Ga0495645_0004397 | 3300046543 | Bacteria | 9631 |
| 844 | Ga0495645_0108211 | 3300046543 | Bacteria | 1969 |
| 845 | Ga0495622_0004731 | 3300046557 | Bacteria | 6302 |
| 846 | Ga0495622_0016576 | 3300046557 | Bacteria | 3433 |
| 847 | Ga0495622_0017927 | 3300046557 | Bacteria | 3297 |
| 848 | Ga0495622_0047993 | 3300046557 | Bacteria | 1984 |
| 849 | Ga0495633_0000643 | 3300046558 | Bacteria | 32448 |
| 850 | Ga0495667_0001683 | 3300046559 | Bacteria | 14667 |
| 851 | Ga0495667_0004005 | 3300046559 | Bacteria | 9893 |
| 852 | Ga0495667_0008713 | 3300046559 | Bacteria | 6889 |
| 853 | Ga0495667_0011539 | 3300046559 | Bacteria | 5981 |
| 854 | Ga0495667_0015316 | 3300046559 | Bacteria | 5179 |
| 855 | Ga0495667_0018588 | 3300046559 | Bacteria | 4693 |
| 856 | Ga0495667_0034353 | 3300046559 | Bacteria | 3391 |
| 857 | Ga0495667_0064923 | 3300046559 | Bacteria | 2387 |
| 858 | Ga0495667_0110481 | 3300046559 | Bacteria | 1776 |
| 859 | Ga0495656_0001948 | 3300046615 | Bacteria | 6809 |
| 860 | Ga0495656_0008685 | 3300046615 | Bacteria | 3635 |
| 861 | Ga0495668_0117860 | 3300046616 | Bacteria | 1452 |
| 862 | Ga0495634_0001187 | 3300046642 | Bacteria | 24132 |
| 863 | Ga0495634_0007336 | 3300046642 | Bacteria | 8295 |
| 864 | Ga0495634_0038527 | 3300046642 | Bacteria | 3259 |
| 865 | Ga0495611_0032018 | 3300046648 | Bacteria | 2317 |
| 866 | Ga0495635_0000229 | 3300046663 | Bacteria | 35647 |
| 867 | Ga0495635_0001379 | 3300046663 | Bacteria | 16201 |
| 868 | Ga0495635_0001715 | 3300046663 | Bacteria | 14757 |
| 869 | Ga0495635_0009501 | 3300046663 | Bacteria | 6797 |
| 870 | Ga0495635_0019366 | 3300046663 | Bacteria | 4745 |
| 871 | Ga0495635_0103139 | 3300046663 | Bacteria | 1949 |
| 872 | Ga0495635_0109330 | 3300046663 | Bacteria | 1889 |
| 873 | Ga0495635_0115734 | 3300046663 | Bacteria | 1830 |
| 874 | Ga0495659_0003909 | 3300046664 | Bacteria | 4725 |
| 875 | Ga0495661_0033777 | 3300046665 | Bacteria | 3224 |
| 876 | Ga0495661_0034523 | 3300046665 | Bacteria | 3182 |
| 877 | Ga0495661_0068020 | 3300046665 | Bacteria | 2091 |
| 878 | Ga0495588_0001035 | 3300046674 | Bacteria | 12106 |
| 879 | Ga0495588_0003248 | 3300046674 | Bacteria | 7051 |
| 880 | Ga0495657_0004582 | 3300046675 | Bacteria | 11039 |
| 881 | Ga0495657_0004695 | 3300046675 | Bacteria | 10887 |
| 882 | Ga0495657_0010875 | 3300046675 | Bacteria | 6831 |
| 883 | Ga0495657_0041075 | 3300046675 | Bacteria | 3168 |
| 884 | Ga0495599_0000421 | 3300046678 | Bacteria | 24238 |
| 885 | Ga0495599_0035246 | 3300046678 | Bacteria | 3141 |
| 886 | Ga0495599_0091645 | 3300046678 | Bacteria | 1896 |
| 887 | Ga0495623_0004340 | 3300046679 | Bacteria | 9329 |
| 888 | Ga0495623_0007441 | 3300046679 | Bacteria | 7108 |
| 889 | Ga0495623_0043055 | 3300046679 | Bacteria | 2873 |
| 890 | Ga0495646_0002150 | 3300046680 | Bacteria | 11975 |
| 891 | Ga0495646_0008370 | 3300046680 | Bacteria | 6575 |
| 892 | Ga0495646_0057833 | 3300046680 | Bacteria | 2319 |
| 893 | Ga0495646_0092892 | 3300046680 | Bacteria | 1740 |
| 894 | Ga0495647_0002484 | 3300046681 | Bacteria | 5834 |
| 895 | Ga0495647_0003746 | 3300046681 | Bacteria | 4885 |
| 896 | Ga0495647_0004744 | 3300046681 | Bacteria | 4434 |
| 897 | Ga0495647_0028886 | 3300046681 | Bacteria | 2047 |
| 898 | Ga0495658_0000334 | 3300046683 | Bacteria | 26467 |
| 899 | Ga0495658_0000930 | 3300046683 | Bacteria | 15630 |
| 900 | Ga0495658_0034611 | 3300046683 | Bacteria | 2772 |
| 901 | Ga0495613_0002993 | 3300046689 | Bacteria | 12649 |
| 902 | Ga0495613_0020701 | 3300046689 | Bacteria | 4904 |
| 903 | Ga0495613_0028421 | 3300046689 | Bacteria | 4159 |
| 904 | Ga0495613_0073230 | 3300046689 | Bacteria | 2496 |
| 905 | Ga0495613_0075494 | 3300046689 | Bacteria | 2454 |
| 906 | Ga0495613_0085620 | 3300046689 | Bacteria | 2286 |
| 907 | Ga0495624_0000096 | 3300046690 | Bacteria | 59307 |
| 908 | Ga0495624_0010831 | 3300046690 | Bacteria | 6284 |
| 909 | Ga0495624_0016957 | 3300046690 | Bacteria | 4898 |
| 910 | Ga0495670_0001695 | 3300046691 | Bacteria | 10830 |
| 911 | Ga0495670_0010532 | 3300046691 | Bacteria | 4544 |
| 912 | Ga0495670_0045547 | 3300046691 | Bacteria | 2190 |
| 913 | Ga0495649_0010278 | 3300046694 | Bacteria | 5526 |
| 914 | Ga0495589_0051170 | 3300046794 | Bacteria | 2043 |
| 915 | Ga0495600_0000610 | 3300046809 | Bacteria | 18459 |
| 916 | Ga0495600_0003611 | 3300046809 | Bacteria | 9119 |
| 917 | Ga0495600_0006125 | 3300046809 | Bacteria | 7286 |
| 918 | Ga0495600_0017288 | 3300046809 | Bacteria | 4585 |
| 919 | Ga0495600_0041592 | 3300046809 | Bacteria | 2995 |
| 920 | Ga0495600_0076751 | 3300046809 | Bacteria | 2182 |
| 921 | Ga0495600_0100946 | 3300046809 | Bacteria | 1881 |
| 922 | Ga0495581_0000095 | 3300047315 | Bacteria | 36670 |
| 923 | Ga0495581_0009859 | 3300047315 | Bacteria | 5527 |
| 924 | Ga0495581_0105902 | 3300047315 | Bacteria | 1634 |
| 925 | Ga0495581_0106427 | 3300047315 | Bacteria | 1630 |
| 926 | Ga0495604_0000797 | 3300047317 | Bacteria | 26510 |
| 927 | Ga0495604_0006295 | 3300047317 | Bacteria | 9420 |
| 928 | Ga0495604_0011105 | 3300047317 | Bacteria | 7149 |
| 929 | Ga0495604_0020488 | 3300047317 | Bacteria | 5281 |
| 930 | Ga0495604_0027070 | 3300047317 | Bacteria | 4562 |
| 931 | Ga0495604_0030177 | 3300047317 | Bacteria | 4309 |
| 932 | Ga0495604_0048548 | 3300047317 | Bacteria | 3302 |
| 933 | Ga0495604_0073039 | 3300047317 | Bacteria | 2590 |
| 934 | Ga0495604_0123508 | 3300047317 | Bacteria | 1870 |
| 935 | Ga0495674_0009440 | 3300047319 | Bacteria | 9269 |
| 936 | Ga0495674_0017914 | 3300047319 | Bacteria | 6595 |
| 937 | Ga0495674_0022977 | 3300047319 | Bacteria | 5745 |
| 938 | Ga0495674_0037800 | 3300047319 | Bacteria | 4336 |
| 939 | Ga0495674_0048131 | 3300047319 | Bacteria | 3775 |
| 940 | Ga0495674_0070867 | 3300047319 | Bacteria | 3011 |
| 941 | Ga0495674_0074411 | 3300047319 | Bacteria | 2925 |
| 942 | Ga0495672_0056452 | 3300047320 | Bacteria | 2284 |
| 943 | Ga0495672_0076850 | 3300047320 | Bacteria | 1873 |
| 944 | Ga0495676_0021481 | 3300047321 | Bacteria | 5635 |
| 945 | Ga0495676_0021580 | 3300047321 | Bacteria | 5620 |
| 946 | Ga0495676_0036821 | 3300047321 | Bacteria | 4081 |
| 947 | Ga0495676_0041429 | 3300047321 | Bacteria | 3790 |
| 948 | Ga0495676_0048711 | 3300047321 | Bacteria | 3414 |
| 949 | Ga0495680_0001729 | 3300047322 | Bacteria | 23181 |
| 950 | Ga0495680_0002991 | 3300047322 | Bacteria | 16880 |
| 951 | Ga0495680_0004264 | 3300047322 | Bacteria | 13730 |
| 952 | Ga0495680_0009851 | 3300047322 | Bacteria | 8566 |
| 953 | Ga0495680_0010215 | 3300047322 | Bacteria | 8381 |
| 954 | Ga0495680_0018408 | 3300047322 | Bacteria | 5932 |
| 955 | Ga0495680_0086501 | 3300047322 | Bacteria | 2358 |
| 956 | Ga0495680_0115095 | 3300047322 | Bacteria | 1990 |
| 957 | Ga0495687_008163 | 3300047443 | Bacteria | 6038 |
| 958 | Ga0495675_0000722 | 3300047444 | Bacteria | 20660 |
| 959 | Ga0495675_0001401 | 3300047444 | Bacteria | 14601 |
| 960 | Ga0495675_0003429 | 3300047444 | Bacteria | 9549 |
| 961 | Ga0495675_0025777 | 3300047444 | Bacteria | 3746 |
| 962 | Ga0495675_0062940 | 3300047444 | Bacteria | 2348 |
| 963 | Ga0495684_0001392 | 3300047471 | Bacteria | 19401 |
| 964 | Ga0495684_0001579 | 3300047471 | Bacteria | 18262 |
| 965 | Ga0495684_0028270 | 3300047471 | Bacteria | 4305 |
| 966 | Ga0495684_0052546 | 3300047471 | Bacteria | 3110 |
| 967 | Ga0495684_0185122 | 3300047471 | Bacteria | 1542 |
| 968 | Ga0495686_0005500 | 3300047472 | Bacteria | 9969 |
| 969 | Ga0495593_0000071 | 3300047673 | Bacteria | 43314 |
| 970 | Ga0495593_0004616 | 3300047673 | Bacteria | 8190 |
| 971 | Ga0495593_0006998 | 3300047673 | Bacteria | 6610 |
| 972 | Ga0495593_0052374 | 3300047673 | Bacteria | 2157 |
| 973 | Ga0495602_0006038 | 3300048088 | Bacteria | 12713 |
| 974 | Ga0495602_0021211 | 3300048088 | Bacteria | 6401 |
| 975 | Ga0495602_0034524 | 3300048088 | Bacteria | 4730 |
| 976 | Ga0495602_0108852 | 3300048088 | Bacteria | 2255 |
| 977 | Ga0495602_0210924 | 3300048088 | Bacteria | 1474 |
| 978 | Ga0495614_0021117 | 3300048089 | Bacteria | 2814 |
| 979 | Ga0495614_0024515 | 3300048089 | Bacteria | 2604 |
| 980 | Ga0496100_0045336 | 3300048903 | Bacteria | 2821 |
| 981 | Ga0496100_0055537 | 3300048903 | Bacteria | 2588 |
| 982 | Ga0496100_0068283 | 3300048903 | Bacteria | 2363 |
| 983 | Ga0496101_0004772 | 3300048904 | Bacteria | 8596 |
| 984 | Ga0496101_0041558 | 3300048904 | Bacteria | 3279 |
| 985 | Ga0496101_0061238 | 3300048904 | Bacteria | 2733 |
| 986 | Ga0496101_0078822 | 3300048904 | Bacteria | 2431 |
| 987 | Ga0496101_0109944 | 3300048904 | Bacteria | 2074 |
| 988 | Ga0496102_0045998 | 3300048905 | Bacteria | 3963 |
| 989 | Ga0496102_0071638 | 3300048905 | Bacteria | 3183 |
| 990 | Ga0496102_0106692 | 3300048905 | Bacteria | 2607 |
| 991 | Ga0496102_0269285 | 3300048905 | Bacteria | 1606 |
| 992 | Ga0496102_0321991 | 3300048905 | Bacteria | 1456 |
| 993 | Ga0496103_0023162 | 3300048906 | Bacteria | 3744 |
| 994 | Ga0496103_0032189 | 3300048906 | Bacteria | 3199 |
| 995 | Ga0496103_0041712 | 3300048906 | Bacteria | 2821 |
| 996 | Ga0496104_0000145 | 3300048907 | Bacteria | 65454 |
| 997 | Ga0496104_0003416 | 3300048907 | Bacteria | 13701 |
| 998 | Ga0496104_0028484 | 3300048907 | Bacteria | 5177 |
| 999 | Ga0496104_0032850 | 3300048907 | Bacteria | 4830 |
| 1000 | Ga0496104_0035759 | 3300048907 | Bacteria | 4639 |
| 1001 | Ga0496104_0058089 | 3300048907 | Bacteria | 3661 |
| 1002 | Ga0496104_0079555 | 3300048907 | Bacteria | 3124 |
| 1003 | Ga0496104_0187124 | 3300048907 | Bacteria | 1981 |
| 1004 | Ga0496104_0253773 | 3300048907 | Bacteria | 1671 |
| 1005 | Ga0496104_0259269 | 3300048907 | Bacteria | 1651 |
| 1006 | Ga0496105_0000885 | 3300048908 | Bacteria | 20493 |
| 1007 | Ga0496105_0007490 | 3300048908 | Bacteria | 8455 |
| 1008 | Ga0496105_0036368 | 3300048908 | Bacteria | 4056 |
| 1009 | Ga0496106_0001138 | 3300048909 | Bacteria | 19699 |
| 1010 | Ga0496106_0001915 | 3300048909 | Bacteria | 15604 |
| 1011 | Ga0496106_0003383 | 3300048909 | Bacteria | 11886 |
| 1012 | Ga0496106_0013990 | 3300048909 | Bacteria | 5933 |
| 1013 | Ga0496106_0031617 | 3300048909 | Bacteria | 3945 |
| 1014 | Ga0496106_0036494 | 3300048909 | Bacteria | 3677 |
| 1015 | Ga0496106_0085303 | 3300048909 | Bacteria | 2432 |
| 1016 | Ga0496106_0142180 | 3300048909 | Bacteria | 1888 |
| 1017 | Ga0496106_0194633 | 3300048909 | Bacteria | 1612 |
| 1018 | Ga0496107_0023015 | 3300048910 | Bacteria | 4404 |
| 1019 | Ga0496107_0027845 | 3300048910 | Bacteria | 4015 |
| 1020 | Ga0496107_0034837 | 3300048910 | Bacteria | 3607 |
| 1021 | Ga0496107_0041268 | 3300048910 | Bacteria | 3313 |
| 1022 | Ga0496107_0054244 | 3300048910 | Bacteria | 2893 |
| 1023 | Ga0496107_0091734 | 3300048910 | Bacteria | 2220 |
| 1024 | Ga0496107_0184885 | 3300048910 | Bacteria | 1548 |
| 1025 | Ga0496108_0001188 | 3300048911 | Bacteria | 20350 |
| 1026 | Ga0496108_0020613 | 3300048911 | Bacteria | 5417 |
| 1027 | Ga0496108_0023512 | 3300048911 | Bacteria | 5072 |
| 1028 | Ga0496108_0025991 | 3300048911 | Bacteria | 4828 |
| 1029 | Ga0496108_0032103 | 3300048911 | Bacteria | 4360 |
| 1030 | Ga0496108_0069301 | 3300048911 | Bacteria | 2976 |
| 1031 | Ga0496108_0090582 | 3300048911 | Bacteria | 2599 |
| 1032 | Ga0496109_0002905 | 3300048912 | Bacteria | 14317 |
| 1033 | Ga0496109_0008832 | 3300048912 | Bacteria | 8581 |
| 1034 | Ga0496109_0022414 | 3300048912 | Bacteria | 5593 |
| 1035 | Ga0496109_0076241 | 3300048912 | Bacteria | 3084 |
| 1036 | Ga0496109_0145314 | 3300048912 | Bacteria | 2218 |
| 1037 | Ga0496110_0010403 | 3300048913 | Bacteria | 7564 |
| 1038 | Ga0496110_0018881 | 3300048913 | Bacteria | 5793 |
| 1039 | Ga0496110_0036936 | 3300048913 | Bacteria | 4244 |
| 1040 | Ga0496110_0048966 | 3300048913 | Bacteria | 3706 |
| 1041 | Ga0496110_0066176 | 3300048913 | Bacteria | 3195 |
| 1042 | Ga0496110_0098257 | 3300048913 | Bacteria | 2623 |
| 1043 | Ga0496111_0026941 | 3300048914 | Bacteria | 4062 |
| 1044 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 1045 | Ga0496112_0004530 | 3300048915 | Bacteria | 11806 |
| 1046 | Ga0496112_0005125 | 3300048915 | Bacteria | 11263 |
| 1047 | Ga0496112_0009718 | 3300048915 | Bacteria | 8683 |
| 1048 | Ga0496112_0037207 | 3300048915 | Bacteria | 4750 |
| 1049 | Ga0496112_0041320 | 3300048915 | Bacteria | 4511 |
| 1050 | Ga0496112_0096763 | 3300048915 | Bacteria | 2922 |
| 1051 | Ga0496113_0000443 | 3300048916 | Bacteria | 20164 |
| 1052 | Ga0496113_0014520 | 3300048916 | Bacteria | 5376 |
| 1053 | Ga0496113_0077147 | 3300048916 | Bacteria | 2547 |
| 1054 | Ga0496113_0168875 | 3300048916 | Bacteria | 1732 |
| 1055 | Ga0496113_0171316 | 3300048916 | Bacteria | 1719 |
| 1056 | Ga0496114_0039615 | 3300048917 | Bacteria | 3899 |
| 1057 | Ga0496114_0070270 | 3300048917 | Bacteria | 2940 |
| 1058 | Ga0496114_0126290 | 3300048917 | Bacteria | 2205 |
| 1059 | Ga0496115_0036380 | 3300048918 | Bacteria | 3898 |
| 1060 | Ga0496115_0047436 | 3300048918 | Bacteria | 3435 |
| 1061 | Ga0496115_0059392 | 3300048918 | Bacteria | 3080 |
| 1062 | Ga0496115_0069026 | 3300048918 | Bacteria | 2862 |
| 1063 | Ga0496115_0069973 | 3300048918 | Bacteria | 2843 |
| 1064 | Ga0496115_0087099 | 3300048918 | Bacteria | 2548 |
| 1065 | Ga0496116_0005942 | 3300048919 | Bacteria | 11189 |
| 1066 | Ga0496116_0031530 | 3300048919 | Bacteria | 3793 |
| 1067 | Ga0496117_0009884 | 3300048920 | Bacteria | 8784 |
| 1068 | Ga0496117_0019260 | 3300048920 | Bacteria | 5613 |
| 1069 | Ga0496117_0037293 | 3300048920 | Bacteria | 3623 |
| 1070 | Ga0496117_0040810 | 3300048920 | Bacteria | 3408 |
| 1071 | Ga0496117_0046786 | 3300048920 | Bacteria | 3109 |
| 1072 | Ga0496118_0008788 | 3300048921 | Bacteria | 10358 |
| 1073 | Ga0496118_0017343 | 3300048921 | Bacteria | 6557 |
| 1074 | Ga0496118_0018968 | 3300048921 | Bacteria | 6167 |
| 1075 | Ga0496118_0035969 | 3300048921 | Bacteria | 4012 |
| 1076 | Ga0496118_0044681 | 3300048921 | Bacteria | 3466 |
| 1077 | Ga0496118_0048738 | 3300048921 | Bacteria | 3267 |
| 1078 | Ga0496118_0048992 | 3300048921 | Bacteria | 3256 |
| 1079 | Ga0496118_0061981 | 3300048921 | Bacteria | 2765 |
| 1080 | Ga0496118_0085644 | 3300048921 | Bacteria | 2193 |
| 1081 | Ga0496119_0025463 | 3300048922 | Bacteria | 4131 |
| 1082 | Ga0496119_0039369 | 3300048922 | Bacteria | 3039 |
| 1083 | Ga0496120_0043875 | 3300048923 | Bacteria | 2602 |
| 1084 | Ga0496120_0049844 | 3300048923 | Bacteria | 2401 |
| 1085 | Ga0496121_0000937 | 3300048924 | Bacteria | 52775 |
| 1086 | Ga0496121_0001335 | 3300048924 | Bacteria | 42241 |
| 1087 | Ga0496121_0001474 | 3300048924 | Bacteria | 39613 |
| 1088 | Ga0496121_0005011 | 3300048924 | Bacteria | 17327 |
| 1089 | Ga0496121_0006807 | 3300048924 | Bacteria | 14002 |
| 1090 | Ga0496121_0014083 | 3300048924 | Bacteria | 8529 |
| 1091 | Ga0496121_0032778 | 3300048924 | Bacteria | 4715 |
| 1092 | Ga0496121_0050185 | 3300048924 | Bacteria | 3528 |
| 1093 | Ga0496121_0126749 | 3300048924 | Bacteria | 1917 |
| 1094 | Ga0496122_0009141 | 3300048925 | Bacteria | 10501 |
| 1095 | Ga0496122_0087346 | 3300048925 | Bacteria | 2143 |
| 1096 | Ga0496123_0030260 | 3300048926 | Bacteria | 3965 |
| 1097 | Ga0496124_0009283 | 3300048927 | Bacteria | 10142 |
| 1098 | Ga0496124_0016051 | 3300048927 | Bacteria | 7146 |
| 1099 | Ga0496124_0076615 | 3300048927 | Bacteria | 2760 |
| 1100 | Ga0496124_0110916 | 3300048927 | Bacteria | 2208 |
| 1101 | Ga0496125_0000272 | 3300048928 | Bacteria | 105490 |
| 1102 | Ga0496125_0002030 | 3300048928 | Bacteria | 27427 |
| 1103 | Ga0496125_0003504 | 3300048928 | Bacteria | 18949 |
| 1104 | Ga0496125_0018180 | 3300048928 | Bacteria | 6680 |
| 1105 | Ga0496125_0025455 | 3300048928 | Bacteria | 5417 |
| 1106 | Ga0496125_0026937 | 3300048928 | Bacteria | 5221 |
| 1107 | Ga0496125_0046822 | 3300048928 | Bacteria | 3624 |
| 1108 | Ga0496126_0003412 | 3300048929 | Bacteria | 20085 |
| 1109 | Ga0496126_0019511 | 3300048929 | Bacteria | 6675 |
| 1110 | Ga0496126_0028347 | 3300048929 | Bacteria | 5338 |
| 1111 | Ga0496126_0035325 | 3300048929 | Bacteria | 4687 |
| 1112 | Ga0496126_0082350 | 3300048929 | Bacteria | 2843 |
| 1113 | Ga0496126_0086343 | 3300048929 | Bacteria | 2765 |
| 1114 | Ga0496126_0116789 | 3300048929 | Bacteria | 2319 |
| 1115 | Ga0496126_0130985 | 3300048929 | Bacteria | 2167 |
| 1116 | Ga0496126_0136947 | 3300048929 | Bacteria | 2111 |
| 1117 | Ga0496126_0149069 | 3300048929 | Bacteria | 2006 |
| 1118 | Ga0496126_0155554 | 3300048929 | Bacteria | 1957 |
| 1119 | Ga0501031_0002472 | 3300049568 | Bacteria | 11789 |
| 1120 | Ga0501031_0002962 | 3300049568 | Bacteria | 10865 |
| 1121 | Ga0501031_0063850 | 3300049568 | Bacteria | 2398 |
| 1122 | Ga0501031_0092670 | 3300049568 | Bacteria | 1971 |
| 1123 | Ga0501032_0000129 | 3300049569 | Bacteria | 62082 |
| 1124 | Ga0501032_0009674 | 3300049569 | Bacteria | 6983 |
| 1125 | Ga0501032_0015153 | 3300049569 | Bacteria | 5444 |
| 1126 | Ga0501032_0046590 | 3300049569 | Bacteria | 2930 |
| 1127 | Ga0501032_0069472 | 3300049569 | Bacteria | 2350 |
| 1128 | Ga0501032_0100578 | 3300049569 | Bacteria | 1915 |
| 1129 | Ga0501033_0000231 | 3300049570 | Bacteria | 53855 |
| 1130 | Ga0501033_0001179 | 3300049570 | Bacteria | 23588 |
| 1131 | Ga0501033_0007704 | 3300049570 | Bacteria | 8353 |
| 1132 | Ga0501033_0043128 | 3300049570 | Bacteria | 3360 |
| 1133 | Ga0501033_0044870 | 3300049570 | Bacteria | 3290 |
| 1134 | Ga0501033_0063029 | 3300049570 | Bacteria | 2729 |
| 1135 | Ga0501033_0086288 | 3300049570 | Bacteria | 2298 |
| 1136 | Ga0501034_0000244 | 3300049571 | Bacteria | 100222 |
| 1137 | Ga0501034_0000503 | 3300049571 | Bacteria | 63099 |
| 1138 | Ga0501034_0000623 | 3300049571 | Bacteria | 55353 |
| 1139 | Ga0501034_0030155 | 3300049571 | Bacteria | 5512 |
| 1140 | Ga0501034_0038456 | 3300049571 | Bacteria | 4844 |
| 1141 | Ga0501034_0048328 | 3300049571 | Bacteria | 4294 |
| 1142 | Ga0501034_0061444 | 3300049571 | Bacteria | 3772 |
| 1143 | Ga0501034_0156444 | 3300049571 | Bacteria | 2253 |
| 1144 | Ga0501034_0220854 | 3300049571 | Bacteria | 1847 |
| 1145 | Ga0501034_0296739 | 3300049571 | Bacteria | 1553 |
| 1146 | Ga0501036_0000232 | 3300049572 | Bacteria | 37236 |
| 1147 | Ga0501036_0000402 | 3300049572 | Bacteria | 30483 |
| 1148 | Ga0501036_0004701 | 3300049572 | Bacteria | 11025 |
| 1149 | Ga0501036_0012866 | 3300049572 | Bacteria | 6946 |
| 1150 | Ga0501036_0027168 | 3300049572 | Bacteria | 4835 |
| 1151 | Ga0501036_0062995 | 3300049572 | Bacteria | 3140 |
| 1152 | Ga0501037_0000106 | 3300049573 | Bacteria | 79430 |
| 1153 | Ga0501037_0000469 | 3300049573 | Bacteria | 32951 |
| 1154 | Ga0501037_0002940 | 3300049573 | Bacteria | 12357 |
| 1155 | Ga0501037_0008241 | 3300049573 | Bacteria | 7641 |
| 1156 | Ga0501037_0029572 | 3300049573 | Bacteria | 4048 |
| 1157 | Ga0501037_0048914 | 3300049573 | Bacteria | 3096 |
| 1158 | Ga0501037_0068557 | 3300049573 | Bacteria | 2582 |
| 1159 | Ga0501037_0109445 | 3300049573 | Bacteria | 1991 |
| 1160 | Ga0501037_0116296 | 3300049573 | Bacteria | 1924 |
| 1161 | Ga0501038_0000108 | 3300049574 | Bacteria | 70323 |
| 1162 | Ga0501038_0003879 | 3300049574 | Bacteria | 13900 |
| 1163 | Ga0501038_0012290 | 3300049574 | Bacteria | 7820 |
| 1164 | Ga0501038_0016811 | 3300049574 | Bacteria | 6622 |
| 1165 | Ga0501038_0026514 | 3300049574 | Bacteria | 5161 |
| 1166 | Ga0501038_0031774 | 3300049574 | Bacteria | 4663 |
| 1167 | Ga0501038_0036193 | 3300049574 | Bacteria | 4332 |
| 1168 | Ga0501038_0084164 | 3300049574 | Bacteria | 2676 |
| 1169 | Ga0501038_0095211 | 3300049574 | Bacteria | 2487 |
| 1170 | Ga0501038_0117812 | 3300049574 | Bacteria | 2193 |
| 1171 | Ga0501038_0172773 | 3300049574 | Bacteria | 1748 |
| 1172 | Ga0501039_0000097 | 3300049575 | Bacteria | 60744 |
| 1173 | Ga0501039_0006470 | 3300049575 | Bacteria | 8905 |
| 1174 | Ga0501039_0009378 | 3300049575 | Bacteria | 7461 |
| 1175 | Ga0501039_0022376 | 3300049575 | Bacteria | 4852 |
| 1176 | Ga0501039_0069795 | 3300049575 | Bacteria | 2729 |
| 1177 | Ga0501042_0061856 | 3300049578 | Bacteria | 2674 |
| 1178 | Ga0501042_0071705 | 3300049578 | Bacteria | 2478 |
| 1179 | Ga0501042_0109477 | 3300049578 | Bacteria | 1989 |
| 1180 | Ga0501043_0000035 | 3300049579 | Bacteria | 133200 |
| 1181 | Ga0501043_0003034 | 3300049579 | Bacteria | 13954 |
| 1182 | Ga0501043_0008766 | 3300049579 | Bacteria | 7962 |
| 1183 | Ga0501043_0011207 | 3300049579 | Bacteria | 7021 |
| 1184 | Ga0501043_0015084 | 3300049579 | Bacteria | 6049 |
| 1185 | Ga0501043_0031456 | 3300049579 | Bacteria | 4171 |
| 1186 | Ga0501043_0148820 | 3300049579 | Bacteria | 1832 |
| 1187 | Ga0501046_0000235 | 3300049580 | Bacteria | 57005 |
| 1188 | Ga0501046_0000461 | 3300049580 | Bacteria | 40695 |
| 1189 | Ga0501046_0007327 | 3300049580 | Bacteria | 9705 |
| 1190 | Ga0501046_0012893 | 3300049580 | Bacteria | 7106 |
| 1191 | Ga0501046_0019760 | 3300049580 | Bacteria | 5581 |
| 1192 | Ga0501046_0038614 | 3300049580 | Bacteria | 3830 |
| 1193 | Ga0501046_0059177 | 3300049580 | Bacteria | 3002 |
| 1194 | Ga0501046_0085935 | 3300049580 | Bacteria | 2425 |
| 1195 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 1196 | Ga0501047_0000844 | 3300049581 | Bacteria | 31650 |
| 1197 | Ga0501047_0003452 | 3300049581 | Bacteria | 14946 |
| 1198 | Ga0501047_0025596 | 3300049581 | Bacteria | 5672 |
| 1199 | Ga0501047_0057189 | 3300049581 | Bacteria | 3772 |
| 1200 | Ga0501047_0063534 | 3300049581 | Bacteria | 3561 |
| 1201 | Ga0501047_0064854 | 3300049581 | Bacteria | 3522 |
| 1202 | Ga0501047_0065630 | 3300049581 | Bacteria | 3498 |
| 1203 | Ga0501047_0094805 | 3300049581 | Bacteria | 2863 |
| 1204 | Ga0501048_0000116 | 3300049582 | Bacteria | 45512 |
| 1205 | Ga0501048_0013551 | 3300049582 | Bacteria | 6048 |
| 1206 | Ga0501048_0015067 | 3300049582 | Bacteria | 5715 |
| 1207 | Ga0501048_0056723 | 3300049582 | Bacteria | 2778 |
| 1208 | Ga0501048_0076039 | 3300049582 | Bacteria | 2370 |
| 1209 | Ga0501067_0000160 | 3300049583 | Bacteria | 37883 |
| 1210 | Ga0501067_0006302 | 3300049583 | Bacteria | 6580 |
| 1211 | Ga0501068_0000014 | 3300049584 | Bacteria | 62762 |
| 1212 | Ga0501068_0007906 | 3300049584 | Bacteria | 5893 |
| 1213 | Ga0501068_0014260 | 3300049584 | Bacteria | 4540 |
| 1214 | Ga0501068_0104941 | 3300049584 | Bacteria | 1754 |
| 1215 | Ga0501069_0033327 | 3300049585 | Bacteria | 2837 |
| 1216 | Ga0501069_0037920 | 3300049585 | Bacteria | 2659 |
| 1217 | Ga0501070_0000451 | 3300049586 | Bacteria | 37429 |
| 1218 | Ga0501070_0004754 | 3300049586 | Bacteria | 11621 |
| 1219 | Ga0501070_0012598 | 3300049586 | Bacteria | 7134 |
| 1220 | Ga0501070_0014374 | 3300049586 | Bacteria | 6660 |
| 1221 | Ga0501070_0051645 | 3300049586 | Bacteria | 3412 |
| 1222 | Ga0501070_0074984 | 3300049586 | Bacteria | 2800 |
| 1223 | Ga0501070_0086861 | 3300049586 | Bacteria | 2589 |
| 1224 | Ga0501070_0099139 | 3300049586 | Bacteria | 2410 |
| 1225 | Ga0501070_0268499 | 3300049586 | Bacteria | 1393 |
| 1226 | Ga0501071_0014074 | 3300049587 | Bacteria | 5468 |
| 1227 | Ga0501071_0037786 | 3300049587 | Bacteria | 3449 |
| 1228 | Ga0501072_0022678 | 3300049588 | Bacteria | 4870 |
| 1229 | Ga0501072_0028970 | 3300049588 | Bacteria | 4322 |
| 1230 | Ga0501072_0160141 | 3300049588 | Bacteria | 1795 |
| 1231 | Ga0501073_0000417 | 3300049589 | Bacteria | 29149 |
| 1232 | Ga0501073_0019066 | 3300049589 | Bacteria | 4957 |
| 1233 | Ga0501073_0019202 | 3300049589 | Bacteria | 4938 |
| 1234 | Ga0501073_0052987 | 3300049589 | Bacteria | 2841 |
| 1235 | Ga0501073_0066237 | 3300049589 | Bacteria | 2518 |
| 1236 | Ga0501074_0002156 | 3300049590 | Bacteria | 13623 |
| 1237 | Ga0501074_0033720 | 3300049590 | Bacteria | 3711 |
| 1238 | Ga0501074_0048290 | 3300049590 | Bacteria | 3075 |
| 1239 | Ga0501074_0059532 | 3300049590 | Bacteria | 2751 |
| 1240 | Ga0501074_0059619 | 3300049590 | Bacteria | 2749 |
| 1241 | Ga0501076_0021358 | 3300049592 | Bacteria | 4965 |
| 1242 | Ga0501076_0057987 | 3300049592 | Bacteria | 3076 |
| 1243 | Ga0501076_0154162 | 3300049592 | Bacteria | 1869 |
| 1244 | Ga0501077_0035996 | 3300049593 | Bacteria | 3153 |
| 1245 | Ga0501077_0038422 | 3300049593 | Bacteria | 3047 |
| 1246 | Ga0501077_0086186 | 3300049593 | Bacteria | 1991 |
| 1247 | Ga0501079_0000261 | 3300049741 | Bacteria | 32317 |
| 1248 | Ga0501079_0004123 | 3300049741 | Bacteria | 10751 |
| 1249 | Ga0501079_0011799 | 3300049741 | Bacteria | 6672 |
| 1250 | Ga0501079_0044093 | 3300049741 | Bacteria | 3442 |
| 1251 | Ga0501080_0005080 | 3300049742 | Bacteria | 11724 |
| 1252 | Ga0501080_0011207 | 3300049742 | Bacteria | 8207 |
| 1253 | Ga0501080_0024865 | 3300049742 | Bacteria | 5553 |
| 1254 | Ga0501080_0029565 | 3300049742 | Bacteria | 5101 |
| 1255 | Ga0501080_0032855 | 3300049742 | Bacteria | 4841 |
| 1256 | Ga0501080_0358665 | 3300049742 | Bacteria | 1315 |
| 1257 | Ga0501083_0000301 | 3300049744 | Bacteria | 31182 |
| 1258 | Ga0501083_0005733 | 3300049744 | Bacteria | 8789 |
| 1259 | Ga0501083_0026608 | 3300049744 | Bacteria | 3997 |
| 1260 | Ga0501083_0027311 | 3300049744 | Bacteria | 3939 |
| 1261 | Ga0501083_0041993 | 3300049744 | Bacteria | 3101 |
| 1262 | Ga0501083_0060940 | 3300049744 | Bacteria | 2520 |
| 1263 | Ga0501083_0079206 | 3300049744 | Bacteria | 2179 |
| 1264 | Ga0501035_0000250 | 3300049822 | Bacteria | 64768 |
| 1265 | Ga0501035_0000324 | 3300049822 | Bacteria | 55297 |
| 1266 | Ga0501035_0004892 | 3300049822 | Bacteria | 12711 |
| 1267 | Ga0501035_0019527 | 3300049822 | Bacteria | 6230 |
| 1268 | Ga0501035_0030491 | 3300049822 | Bacteria | 4915 |
| 1269 | Ga0501035_0044251 | 3300049822 | Bacteria | 4010 |
| 1270 | Ga0501035_0044282 | 3300049822 | Bacteria | 4008 |
| 1271 | Ga0501035_0062463 | 3300049822 | Bacteria | 3315 |
| 1272 | Ga0501035_0115806 | 3300049822 | Bacteria | 2346 |
| 1273 | Ga0501035_0127021 | 3300049822 | Bacteria | 2226 |
| 1274 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 1275 | Ga0501044_0000084 | 3300049823 | Bacteria | 114544 |
| 1276 | Ga0501044_0014934 | 3300049823 | Bacteria | 8372 |
| 1277 | Ga0501044_0027473 | 3300049823 | Bacteria | 6013 |
| 1278 | Ga0501044_0027559 | 3300049823 | Bacteria | 6002 |
| 1279 | Ga0501044_0028210 | 3300049823 | Bacteria | 5925 |
| 1280 | Ga0501044_0035217 | 3300049823 | Bacteria | 5243 |
| 1281 | Ga0501044_0045347 | 3300049823 | Bacteria | 4555 |
| 1282 | Ga0501044_0059176 | 3300049823 | Bacteria | 3926 |
| 1283 | Ga0501044_0071417 | 3300049823 | Bacteria | 3530 |
| 1284 | Ga0501044_0152058 | 3300049823 | Bacteria | 2296 |
| 1285 | Ga0501044_0168279 | 3300049823 | Bacteria | 2164 |
| 1286 | Ga0501044_0168448 | 3300049823 | Bacteria | 2163 |
| 1287 | Ga0501044_0298128 | 3300049823 | Bacteria | 1541 |
| 1288 | Ga0501044_0368476 | 3300049823 | Bacteria | 1353 |
| 1289 | Ga0501045_0005670 | 3300049824 | Bacteria | 8641 |
| 1290 | Ga0501045_0009071 | 3300049824 | Bacteria | 6949 |
| 1291 | nmdc:mga03n38_15408_c1 | 3300050490 | Bacteria | 2951 |
| 1292 | nmdc:mga00v17_33762_c1 | 3300050491 | Bacteria | 3034 |
| 1293 | nmdc:mga00v17_68224_c1 | 3300050491 | Bacteria | 2198 |
| 1294 | nmdc:mga0yw44_29098_c1 | 3300050492 | Bacteria | 3186 |
| 1295 | nmdc:mga0yw44_29737_c1 | 3300050492 | Bacteria | 3157 |
| 1296 | nmdc:mga0yw44_47661_c1 | 3300050492 | Bacteria | 2581 |
| 1297 | nmdc:mga0yw44_56942_c1 | 3300050492 | Bacteria | 2383 |
| 1298 | nmdc:mga0k408_115377_c1 | 3300050493 | Bacteria | 1589 |
| 1299 | nmdc:mga0k408_117922_c1 | 3300050493 | Bacteria | 1571 |
| 1300 | nmdc:mga06z11_8081_c1 | 3300050494 | Bacteria | 4366 |
| 1301 | nmdc:mga07m45_8434_c1 | 3300050496 | Bacteria | 5299 |
| 1302 | nmdc:mga05p37_10373_c1 | 3300050507 | Bacteria | 11061 |
| 1303 | nmdc:mga05p37_262_c1 | 3300050507 | Bacteria | 49144 |
| 1304 | nmdc:mga05p37_45856_c1 | 3300050507 | Bacteria | 5376 |
| 1305 | nmdc:mga09592_4178_c1 | 3300050508 | Bacteria | 11662 |
| 1306 | nmdc:mga0qj67_1846_c1 | 3300050509 | Bacteria | 15000 |
| 1307 | nmdc:mga06r32_510_c1 | 3300050510 | Bacteria | 33391 |
| 1308 | nmdc:mga08y16_172_c1 | 3300050511 | Bacteria | 56716 |
| 1309 | nmdc:mga08y16_2367_c1 | 3300050511 | Bacteria | 19360 |
| 1310 | nmdc:mga0n895_106_c1 | 3300050512 | Bacteria | 49191 |
| 1311 | nmdc:mga0n895_246203_c1 | 3300050512 | Bacteria | 1814 |
| 1312 | nmdc:mga0n895_70996_c1 | 3300050512 | Bacteria | 3452 |
| 1313 | nmdc:mga0n895_77461_c1 | 3300050512 | Bacteria | 3308 |
| 1314 | nmdc:mga0rr50_197826_c1 | 3300050513 | Bacteria | 1650 |
| 1315 | nmdc:mga0rr50_4447_c1 | 3300050513 | Bacteria | 8248 |
| 1316 | nmdc:mga0a205_1025_c1 | 3300050515 | Bacteria | 23241 |
| 1317 | nmdc:mga0a205_162402_c1 | 3300050515 | Bacteria | 2130 |
| 1318 | nmdc:mga0a205_23126_c1 | 3300050515 | Bacteria | 5894 |
| 1319 | nmdc:mga0sz30_5857_c1 | 3300050516 | Bacteria | 4530 |
| 1320 | Ga0495601_0000248 | 3300053077 | Bacteria | 28877 |
| 1321 | Ga0495601_0000865 | 3300053077 | Bacteria | 16507 |
| 1322 | Ga0495601_0031943 | 3300053077 | Bacteria | 3275 |
| 1323 | Ga0495601_0050975 | 3300053077 | Bacteria | 2612 |
| 1324 | Ga0495601_0135284 | 3300053077 | Bacteria | 1607 |
| 1325 | Ga0495612_0000231 | 3300053078 | Bacteria | 23627 |
| 1326 | Ga0495612_0000709 | 3300053078 | Bacteria | 13517 |
| 1327 | Ga0495612_0004165 | 3300053078 | Bacteria | 5996 |
| 1328 | Ga0495612_0007096 | 3300053078 | Bacteria | 4585 |
| 1329 | Ga0500635_0050458 | 3300053080 | Bacteria | 1423 |
| 1330 | Ga0495595_0000902 | 3300053084 | Bacteria | 11437 |
| 1331 | Ga0495595_0004065 | 3300053084 | Bacteria | 5856 |
| 1332 | Ga0495595_0011068 | 3300053084 | Bacteria | 3765 |
| 1333 | Ga0495595_0069548 | 3300053084 | Bacteria | 1662 |
| 1334 | Ga0495595_0099018 | 3300053084 | Bacteria | 1405 |
| 1335 | Ga0495619_0000176 | 3300053085 | Bacteria | 47128 |
| 1336 | Ga0495619_0002240 | 3300053085 | Bacteria | 12799 |
| 1337 | Ga0495619_0007115 | 3300053085 | Bacteria | 7084 |
| 1338 | Ga0495619_0009240 | 3300053085 | Bacteria | 6230 |
| 1339 | Ga0495619_0009880 | 3300053085 | Bacteria | 6014 |
| 1340 | Ga0495619_0014207 | 3300053085 | Bacteria | 5028 |
| 1341 | Ga0495619_0029531 | 3300053085 | Bacteria | 3542 |
| 1342 | Ga0495619_0048181 | 3300053085 | Bacteria | 2808 |
| 1343 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 1344 | Ga0500644_0000374 | 3300053088 | Bacteria | 21864 |
| 1345 | Ga0500647_0009566 | 3300053091 | Bacteria | 4257 |
| 1346 | Ga0500651_0075148 | 3300053093 | Bacteria | 2099 |
| 1347 | Ga0500651_0104052 | 3300053093 | Bacteria | 1738 |
| 1348 | Ga0500566_0000009 | 3300053094 | Bacteria | 131668 |
| 1349 | Ga0500566_0019227 | 3300053094 | Bacteria | 4010 |
| 1350 | Ga0500566_0027702 | 3300053094 | Bacteria | 3317 |
| 1351 | Ga0500566_0033322 | 3300053094 | Bacteria | 3003 |
| 1352 | Ga0500640_002642 | 3300053095 | Bacteria | 5991 |
| 1353 | Ga0500641_0006701 | 3300053096 | Bacteria | 4093 |
| 1354 | Ga0500641_0018542 | 3300053096 | Bacteria | 2619 |
| 1355 | Ga0500641_0047141 | 3300053096 | Bacteria | 1761 |
| 1356 | Ga0500650_0001452 | 3300053098 | Bacteria | 7173 |
| 1357 | Ga0500555_001483 | 3300053103 | Bacteria | 7130 |
| 1358 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 1359 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 1360 | Ga0500569_005997 | 3300053109 | Bacteria | 2641 |
| 1361 | Ga0500572_000326 | 3300053111 | Bacteria | 17035 |
| 1362 | Ga0500572_000505 | 3300053111 | Bacteria | 13397 |
| 1363 | Ga0500591_009529 | 3300053115 | Bacteria | 4563 |
| 1364 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1365 | Ga0500595_000480 | 3300053119 | Bacteria | 24621 |
| 1366 | Ga0500595_000735 | 3300053119 | Bacteria | 19469 |
| 1367 | Ga0500595_006825 | 3300053119 | Bacteria | 4805 |
| 1368 | Ga0500608_013990 | 3300053122 | Bacteria | 3570 |
| 1369 | Ga0500614_000329 | 3300053123 | Bacteria | 12280 |
| 1370 | Ga0500642_0000037 | 3300053130 | Bacteria | 98684 |
| 1371 | Ga0500642_0000173 | 3300053130 | Bacteria | 26732 |
| 1372 | Ga0500642_0079889 | 3300053130 | Bacteria | 1500 |
| 1373 | Ga0500652_000725 | 3300053131 | Bacteria | 11186 |
| 1374 | Ga0500658_0029030 | 3300053134 | Bacteria | 2149 |
| 1375 | Ga0500559_0000081 | 3300053136 | Bacteria | 75262 |
| 1376 | Ga0500559_0002268 | 3300053136 | Bacteria | 10160 |
| 1377 | Ga0500559_0004441 | 3300053136 | Bacteria | 6661 |
| 1378 | Ga0500559_0025398 | 3300053136 | Bacteria | 2520 |
| 1379 | Ga0500568_0000696 | 3300053139 | Bacteria | 24100 |
| 1380 | Ga0500568_0021256 | 3300053139 | Bacteria | 2794 |
| 1381 | Ga0500568_0021446 | 3300053139 | Bacteria | 2778 |
| 1382 | Ga0500577_0005339 | 3300053142 | Bacteria | 3456 |
| 1383 | Ga0500590_071892 | 3300053148 | Bacteria | 1717 |
| 1384 | Ga0500603_000175 | 3300053150 | Bacteria | 16391 |
| 1385 | Ga0500603_000411 | 3300053150 | Bacteria | 11193 |
| 1386 | Ga0500604_0005198 | 3300053151 | Bacteria | 3439 |
| 1387 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1388 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 1389 | Ga0500616_0000372 | 3300053153 | Bacteria | 62890 |
| 1390 | Ga0500616_0017440 | 3300053153 | Bacteria | 4073 |
| 1391 | Ga0500620_005382 | 3300053155 | Bacteria | 2958 |
| 1392 | Ga0500622_0005178 | 3300053156 | Bacteria | 7901 |
| 1393 | Ga0500622_0025897 | 3300053156 | Bacteria | 3097 |
| 1394 | Ga0500622_0033567 | 3300053156 | Bacteria | 2690 |
| 1395 | Ga0500627_0075146 | 3300053158 | Bacteria | 1501 |
| 1396 | Ga0500630_000849 | 3300053159 | Bacteria | 14175 |
| 1397 | Ga0500638_005176 | 3300053162 | Bacteria | 5153 |
| 1398 | Ga0500639_000199 | 3300053163 | Bacteria | 29793 |
| 1399 | Ga0500636_0000122 | 3300053177 | Bacteria | 40577 |
| 1400 | Ga0500636_0004899 | 3300053177 | Bacteria | 7602 |
| 1401 | Ga0500636_0030680 | 3300053177 | Bacteria | 3181 |
| 1402 | Ga0500637_0003088 | 3300053178 | Bacteria | 7595 |
| 1403 | Ga0500637_0085450 | 3300053178 | Bacteria | 1824 |
| 1404 | Ga0500625_007714 | 3300053729 | Bacteria | 4698 |
| 1405 | Ga0500645_001945 | 3300053730 | Bacteria | 9794 |
| 1406 | Ga0500609_001123 | 3300053731 | Bacteria | 3984 |
| 1407 | Ga0500601_000050 | 3300053737 | Bacteria | 24752 |
| 1408 | Ga0501084_0063797 | 3300054114 | Bacteria | 3084 |
| 1409 | Ga0501084_0067824 | 3300054114 | Bacteria | 2986 |
| 1410 | Ga0501084_0101321 | 3300054114 | Bacteria | 2418 |
| 1411 | Ga0500661_000167 | 3300055283 | Bacteria | 11335 |
| 1412 | Ga0501082_0048170 | 3300060353 | Bacteria | 3673 |
| 1413 | Ga0501082_0049463 | 3300060353 | Bacteria | 3625 |
| 1414 | Ga0501082_0074501 | 3300060353 | Bacteria | 2924 |
| 1415 | 2507508428 | 2507262055 | Bacteria | 8048963 |
| 1416 | 2508542496 | 2508501009 | Bacteria | 7784016 |
| 1417 | 2508691731 | 2508501042 | Bacteria | 8719808 |
| 1418 | 2509150549 | 2508501128 | Bacteria | 8613869 |
| 1419 | 2511394184 | 2511231028 | Bacteria | 8046582 |
| 1420 | 2513625539 | 2513237092 | Bacteria | 8341956 |
| 1421 | 2513644477 | 2513237094 | Bacteria | 8789602 |
| 1422 | 2513645684 | 2513237095 | Bacteria | 8976980 |
| 1423 | 2513658016 | 2513237096 | Bacteria | 8722461 |
| 1424 | 2513676106 | 2513237098 | Bacteria | 9902361 |
| 1425 | 2513692721 | 2513237101 | Bacteria | 7952346 |
| 1426 | 2513701126 | 2513237102 | Bacteria | 7703324 |
| 1427 | 2513717147 | 2513237104 | Bacteria | 10034502 |
| 1428 | 2513855720 | 2513237137 | Bacteria | 9558895 |
| 1429 | 2513872930 | 2513237139 | Bacteria | 8737671 |
| 1430 | 2513893979 | 2513237141 | Bacteria | 8496279 |
| 1431 | 2513919890 | 2513237145 | Bacteria | 8979722 |
| 1432 | 2514013689 | 2513237161 | Bacteria | 8871253 |
| 1433 | 2515627078 | 2515154112 | Bacteria | 8294334 |
| 1434 | 2517107768 | 2517093001 | Bacteria | 9002274 |
| 1435 | 2517892257 | 2517572143 | Bacteria | 9484767 |
| 1436 | 2524437508 | 2524023205 | Bacteria | 8918781 |
| 1437 | 2524465665 | 2524023210 | Bacteria | 9029266 |
| 1438 | 2524540308 | 2524023228 | Bacteria | 10118060 |
| 1439 | 2528852387 | 2528768022 | Bacteria | 10457665 |
| 1440 | 2603859596 | 2602042107 | Bacteria | 6226103 |
| 1441 | 2617347354 | 2617270735 | Bacteria | 9163226 |
| 1442 | 2617375588 | 2617270741 | Bacteria | 8201522 |
| 1443 | 2643756660 | 2643221547 | Bacteria | 4740017 |
| 1444 | 2644288803 | 2643221651 | Bacteria | 4798932 |
| 1445 | 2671120495 | 2667528175 | Bacteria | 7532676 |
| 1446 | 2723844899 | 2721755755 | Bacteria | 8322773 |
| 1447 | 2728747389 | 2728368998 | Bacteria | 8720350 |
| 1448 | 2745076500 | 2744054633 | Bacteria | 8678936 |
| 1449 | 2793065424 | 2791355196 | Bacteria | 7323613 |
| 1450 | 2793072402 | 2791355197 | Bacteria | 8420563 |
| 1451 | 2793082230 | |||
| 1452 | 2805915172 | 2802429603 | Bacteria | 8777136 |
| 1453 | 2818238727 | 2816332527 | Bacteria | 8933356 |
| 1454 | 2824608166 | 2824600985 | Bacteria | 8488197 |
| 1455 | 2824610299 | 2824609381 | Bacteria | 8672835 |
| 1456 | 2824617891 | 2824617872 | Bacteria | 8814715 |
| 1457 | 2824634354 | 2824626560 | Bacteria | 8813858 |
| 1458 | 2824643473 | 2824635225 | Bacteria | 8785348 |
| 1459 | 2824649705 | 2824644064 | Bacteria | 8743947 |
| 1460 | 2824661156 | 2824653114 | Bacteria | 8493680 |
| 1461 | 2824669301 | 2824661429 | Bacteria | 9877870 |
| 1462 | 2824678702 | 2824671348 | Bacteria | 8369588 |
| 1463 | 2824685184 | 2824679649 | Bacteria | 8248951 |
| 1464 | 2824695166 | 2824687955 | Bacteria | 8360029 |
| 1465 | 2824701477 | 2824696289 | Bacteria | 8335049 |
| 1466 | 2824709044 | 2824704595 | Bacteria | 9667483 |
| 1467 | 2824722333 | 2824714736 | Bacteria | 8717648 |
| 1468 | 2824731958 | 2824723954 | Bacteria | 8758240 |
| 1469 | 2824735271 | 2824732956 | Bacteria | 7810675 |
| 1470 | 2824752348 | 2824746037 | Bacteria | 7911610 |
| 1471 | 2824761810 | 2824753945 | Bacteria | 9787441 |
| 1472 | 2824770003 | 2824763712 | Bacteria | 9792355 |
| 1473 | 2824780897 | 2824773399 | Bacteria | 8360218 |
| 1474 | 2838123579 | 2838122688 | Bacteria | 8803140 |
| 1475 | 2841946777 | 2841941048 | Bacteria | 8688029 |
| 1476 | 2841949679 | 2841949485 | Bacteria | 8680857 |
| 1477 | 2841958820 | 2841957949 | Bacteria | 8652217 |
| 1478 | 2841971814 | 2841966195 | Bacteria | 8673214 |
| 1479 | 2841974841 | 2841974524 | Bacteria | 8931498 |
| 1480 | 2841983598 | 2841983080 | Bacteria | 8395090 |
| 1481 | 2842038898 | 2842038055 | Bacteria | 8002051 |
| 1482 | 2842048156 | 2842045827 | Bacteria | 8006841 |
| 1483 | 2844319226 | 2844315083 | Bacteria | 8138177 |
| 1484 | 2847936379 | 2847930680 | Bacteria | 9342022 |
| 1485 | 2847946729 | 2847939898 | Bacteria | 8606328 |
| 1486 | 2849079154 | 2849076700 | Bacteria | 7039503 |
| 1487 | 2857514141 | 2857509624 | Bacteria | 7472071 |
| 1488 | 2857528993 | 2857524615 | Bacteria | 6615449 |
| 1489 | 2874598207 | 2874590934 | Bacteria | 8299676 |
| 1490 | 2874605380 | 2874604998 | Bacteria | 7834745 |
| 1491 | 2874615083 | 2874612657 | Bacteria | 8252029 |
| 1492 | 2874627679 | 2874620515 | Bacteria | 8290088 |
| 1493 | 2874632018 | 2874628541 | Bacteria | 8630250 |
| 1494 | 2874652736 | 2874645413 | Bacteria | 8214782 |
| 1495 | 2876764676 | 2876761206 | Bacteria | 10111113 |
| 1496 | 2876778315 | 2876771140 | Bacteria | 8287509 |
| 1497 | 2876809908 | 2876808645 | Bacteria | 8824342 |
| 1498 | 2876825816 | 2876818435 | Bacteria | 8274608 |
| 1499 | 2879082109 | 2879074833 | Bacteria | 8279565 |
| 1500 | 2879090162 | 2879083081 | Bacteria | 8587928 |
| 1501 | 2879105743 | 2879099564 | Bacteria | 10442239 |
| 1502 | 2879110202 | 2879110137 | Bacteria | 8907982 |
| 1503 | 2879135256 | 2879127579 | Bacteria | 8294491 |
| 1504 | 2879150465 | 2879142872 | Bacteria | 8267021 |
| 1505 | 2881368680 | 2881364244 | Bacteria | 7710352 |
| 1506 | 2881673521 | 2881665667 | Bacteria | 8175609 |
| 1507 | 2885373001 | 2885366525 | Bacteria | 8326213 |
| 1508 | 2885381914 | 2885374607 | Bacteria | 8927485 |
| 1509 | 2885389915 | 2885383462 | Bacteria | 9473874 |
| 1510 | 2885411434 | 2885409591 | Bacteria | 9235467 |
| 1511 | 2888384225 | 2888378607 | Bacteria | 9652610 |
| 1512 | 2888393647 | 2888388044 | Bacteria | 7304136 |
| 1513 | 2888424700 | 2888419890 | Bacteria | 7857137 |
| 1514 | 2889039668 | 2889033259 | Bacteria | 9099371 |
| 1515 | 2893070453 | 2893066018 | Bacteria | 6158120 |
| 1516 | 2903731068 | 2903727486 | Bacteria | 8281579 |
| 1517 | 2903749154 | 2903748898 | Bacteria | 9972761 |
| 1518 | 2903776946 | 2903768456 | Bacteria | 9749579 |
| 1519 | 2904673001 | 2904666416 | Bacteria | 8226587 |
| 1520 | 2904694607 | 2904690495 | Bacteria | 9412302 |
| 1521 | 2904702423 | |||
| 1522 | 2904714828 | 2904711408 | Bacteria | 9771557 |
| 1523 | 2906607425 | 2906602504 | Bacteria | 8295279 |
| 1524 | 2906618761 | |||
| 1525 | 2906629742 | 2906626472 | Bacteria | 8826946 |
| 1526 | 2906638095 | 2906635258 | Bacteria | 8601019 |
| 1527 | 2906649023 | 2906643746 | Bacteria | 8722424 |
| 1528 | 2906666232 | 2906660503 | Bacteria | 8595048 |
| 1529 | 2908742538 | 2908739725 | Bacteria | 8628932 |
| 1530 | 2908760162 | 2908756301 | Bacteria | 8864324 |
| 1531 | 2908780345 | 2908775508 | Bacteria | 8092255 |
| 1532 | 2919076396 | 2919073203 | Bacteria | 6531949 |
| 1533 | 2922365523 | 2922361189 | Bacteria | 7436256 |
| 1534 | 2922374573 | |||
| 1535 | 2922391149 | 2922386360 | Bacteria | 7017218 |
| 1536 | 2922400641 | 2922393267 | Bacteria | 8285685 |
| 1537 | 2922430436 | |||
| 1538 | 2929618238 | 2929615660 | Bacteria | 9193770 |
| 1539 | 2929632426 | 2929624759 | Bacteria | 9339455 |
| 1540 | 2932790532 | 2932784394 | Bacteria | 9704911 |
| 1541 | 2932799790 | 2932794094 | Bacteria | 7915132 |
| 1542 | 2932806959 | 2932801729 | Bacteria | 7987968 |
| 1543 | 2932810953 | 2932809354 | Bacteria | 9135765 |
| 1544 | 2932823717 | 2932818245 | Bacteria | 9955613 |
| 1545 | 2932830163 | 2932828146 | Bacteria | 9745859 |
| 1546 | 2933580166 | 2933577622 | Bacteria | 9116884 |
| 1547 | 2935609032 | 2935608549 | Bacteria | 8203142 |
| 1548 | 2935622611 | 2935616580 | Bacteria | 9032984 |
| 1549 | 2935631529 | 2935630451 | Bacteria | 8169952 |
| 1550 | 2935642589 | 2935638405 | Bacteria | 10015038 |
| 1551 | 2935653260 | 2935648319 | Bacteria | 8801166 |
| 1552 | 2935660269 | 2935656913 | Bacteria | 8965014 |
| 1553 | 2935668107 | 2935665750 | Bacteria | 9571747 |
| 1554 | 2935676140 | 2935675223 | Bacteria | 9928132 |
| 1555 | 2935686124 | 2935684952 | Bacteria | 9590419 |
| 1556 | 2935701250 | 2935694250 | Bacteria | 9291695 |
| 1557 | 2935705967 | 2935703347 | Bacteria | 10242284 |
| 1558 | 2935714676 | 2935713505 | Bacteria | 9608509 |
| 1559 | 2935725295 | 2935722832 | Bacteria | 9608746 |
| 1560 | 2935732345 | 2935732158 | Bacteria | 9706831 |
| 1561 | 2935741724 | 2935741537 | Bacteria | 9707219 |
| 1562 | 2935752089 | 2935750917 | Bacteria | 9590372 |
| 1563 | 2935766437 | 2935760218 | Bacteria | 9817913 |
| 1564 | 2935771885 | 2935769743 | Bacteria | 7878163 |
| 1565 | 2935778683 | 2935777560 | Bacteria | 8077691 |
| 1566 | 2935788931 | 2935785616 | Bacteria | 7962367 |
| 1567 | 2935795269 | 2935793552 | Bacteria | 8012592 |
| 1568 | 2935802966 | 2935801545 | Bacteria | 9301974 |
| 1569 | 2935814283 | 2935810662 | Bacteria | 9401221 |
| 1570 | 2935822192 | 2935819856 | Bacteria | 8261050 |
| 1571 | 2935831420 | 2935827899 | Bacteria | 10038562 |
| 1572 | 2935838280 | 2935837841 | Bacteria | 9454360 |
| 1573 | 2935847774 | 2935847175 | Bacteria | 8228321 |
| 1574 | 2935860860 | 2935855204 | Bacteria | 9035059 |
| 1575 | 2935869803 | 2935864058 | Bacteria | 9784707 |
| 1576 | 2935878778 | 2935873716 | Bacteria | 9632195 |
| 1577 | 2935886917 | 2935883170 | Bacteria | 7964738 |
| 1578 | 2935908954 | 2935908558 | Bacteria | 8568796 |
| 1579 | 2935919672 | 2935916978 | Bacteria | 9113783 |
| 1580 | 2935926472 | 2935926038 | Bacteria | 8601059 |
| 1581 | 2935934922 | 2935934488 | Bacteria | 8602579 |
| 1582 | 2935943372 | 2935942939 | Bacteria | 8599779 |
| 1583 | 2935951810 | 2935951376 | Bacteria | 8602333 |
| 1584 | 2935960571 | 2935959822 | Bacteria | 7869783 |
| 1585 | 2935967935 | 2935967501 | Bacteria | 8603075 |
| 1586 | 2935978560 | 2935975950 | Bacteria | 8347125 |
| 1587 | 2935987587 | 2935984226 | Bacteria | 8302647 |
| 1588 | 2935994826 | 2935992306 | Bacteria | 9802711 |
| 1589 | 2936003468 | 2936002035 | Bacteria | 9362176 |
| 1590 | 2936016130 | 2936011229 | Bacteria | 8801034 |
| 1591 | 2936024763 | 2936019824 | Bacteria | 8804134 |
| 1592 | 2936032011 | 2936028420 | Bacteria | 8965941 |
| 1593 | 2936039839 | 2936037263 | Bacteria | 9446081 |
| 1594 | 2936049872 | 2936046547 | Bacteria | 8903709 |
| 1595 | 2936060824 | 2936055302 | Bacteria | 8785755 |
| 1596 | 2940557108 | 2940556831 | Bacteria | 9590747 |
| 1597 | 2941511323 | 2941507105 | Bacteria | 8166816 |
| 1598 | 2941519024 | 2941515067 | Bacteria | 8166720 |
| 1599 | 2941526396 | 2941523033 | Bacteria | 8169134 |
| 1600 | 2941532982 | 2941531003 | Bacteria | 7653939 |
| 1601 | 2941539052 | 2941538514 | Bacteria | 9402094 |
| 1602 | 3005480351 | 3005474847 | Bacteria | 9259049 |
| 1603 | 3005484476 | 3005483717 | Bacteria | 7877331 |
| 1604 | 3005510490 | 3005506211 | Bacteria | 6943378 |
| 1605 | 3005587884 | 3005587118 | Bacteria | 7794411 |
| 1606 | 3005599396 | 3005594810 | Bacteria | 8716512 |
| 1607 | 3005715058 | 3005710791 | Bacteria | 7622528 |
| 1608 | 3005722471 | 3005718088 | Bacteria | 8283608 |
| 1609 | 8006931877 | 8006926726 | Bacteria | 6749210 |
| 1610 | 8006940524 | 8006933436 | Bacteria | 10410654 |
| 1611 | 8006967151 | 8006964411 | Bacteria | 8966052 |
| 1612 | 8006980212 | 8006973647 | Bacteria | 10679141 |
| 1613 | 8006986569 | 8006984368 | Bacteria | 9651211 |
| 1614 | 8006995847 | 8006994254 | Bacteria | 8309700 |
| 1615 | 8016529457 | 8016522445 | Bacteria | 8156687 |
| 1616 | 8016547886 | 8016539877 | Bacteria | 8155419 |
| 1617 | 8016554247 | 8016548790 | Bacteria | 8155074 |
| 1618 | 8016562620 | 8016557553 | Bacteria | 8154380 |
| 1619 | 8016577164 | 8016575299 | Bacteria | 8154085 |
| 1620 | 8016591572 | 8016583857 | Bacteria | 10421953 |
| 1621 | 8016600406 | 8016595262 | Bacteria | 8149947 |
| 1622 | 8016610332 | 8016603502 | Bacteria | 8731218 |
| 1623 | 8016614598 | 8016613128 | Bacteria | 8794220 |
| 1624 | 8016626401 | 8016622563 | Bacteria | 7999408 |
| 1625 | 8016640160 | 8016630954 | Bacteria | 9217207 |
| 1626 | 8017063521 | 8017057580 | Bacteria | 10023680 |
| 1627 | 8019534433 | 8019530166 | Bacteria | 8155624 |
| 1628 | 8019545036 | 8019538911 | Bacteria | 7872763 |
| 1629 | 8019553490 | 8019547302 | Bacteria | 7996444 |
| 1630 | 8019556597 | 8019555841 | Bacteria | 9642137 |
| 1631 | 8019568711 | 8019565922 | Bacteria | 9639779 |
| 1632 | 8019582841 | 8019576017 | Bacteria | 10049540 |
| 1633 | 8019590635 | 8019586578 | Bacteria | 10212056 |
| 1634 | 8019600718 | 8019597564 | Bacteria | 10041141 |
| 1635 | 8019617831 | 8019608314 | Bacteria | 10042931 |
| 1636 | 8019628343 | 8019619141 | Bacteria | 9218857 |
| 1637 | 8019634286 | 8019629233 | Bacteria | 8687553 |
| 1638 | 8019645449 | 8019638758 | Bacteria | 9062356 |
| 1639 | 8019658563 | 8019648815 | Bacteria | 10014479 |
| 1640 | 8019662160 | 8019659431 | Bacteria | 8577854 |
| 1641 | 8019671677 | 8019668869 | Bacteria | 8791617 |
| 1642 | 8019690233 | 8019687851 | Bacteria | 8712826 |
| 1643 | 8055746173 | 8055742211 | Bacteria | 9226248 |
| 1644 | 8056673685 | 8056673599 | Bacteria | 7871253 |
| 1645 | 8056686776 | 8056681323 | Bacteria | 8472857 |
| 1646 | 8056691366 | 8056689827 | Bacteria | 6712655 |
| 1647 | 8056968187 | 8056967851 | Bacteria | 9038162 |
| 1648 | Ga0495581_0062984 | |||
| 1649 | 2214745197 | |||
| 1650 | ARcpr5oldR_c000207 | |||
| 1651 | ARSoilYngRDRAFT_c00063 | |||
| 1652 | ARcpr5yngRDRAFT_c000034 | |||
| 1653 | ARSoilOldRDRAFT_c000200 | |||
| 1654 | ARCol0yngRDRAFT_1000414 | |||
| 1655 | JGI24739J22299_10018619 | |||
| 1656 | JGI24737J22298_10002792 | |||
| 1657 | JGI24750J21931_1000125 | |||
| 1658 | JGI24738J21930_10011097 | |||
| 1659 | JGI24749J21850_1003011 | |||
| 1660 | JGI24034J26672_10002632 | |||
| 1661 | JGI24742J22300_10001036 | |||
| 1662 | JGI25406J46586_10000078 | |||
| 1663 | JGI25406J46586_10020770 | |||
| 1664 | JGI25153J46596_10000873 | |||
| 1665 | JGI25153J46596_10001410 | |||
| 1666 | JGI25153J46596_10003048 | |||
| 1667 | JGI25153J46596_10004424 | |||
| 1668 | JGI25160J50197_1001193 | |||
| 1669 | JGI25160J50197_1002953 | |||
| 1670 | JGI25160J50197_1004978 | |||
| 1671 | Ga0055531_10014599 | |||
| 1672 | Ga0055543_1005502 | |||
| 1673 | Ga0065165_1001524 | |||
| 1674 | Ga0065165_1003137 | |||
| 1675 | Ga0065165_1023678 | |||
| 1676 | Ga0065716_1001536 | |||
| 1677 | Ga0065704_10004989 | |||
| 1678 | Ga0065712_10073422 | |||
| 1679 | Ga0065712_10083420 | |||
| 1680 | Ga0065715_10005959 | |||
| 1681 | Ga0065715_10009645 | |||
| 1682 | Ga0070658_10140472 | |||
| 1683 | Ga0070676_10035124 | |||
| 1684 | Ga0070683_100011881 | |||
| 1685 | Ga0070683_100029883 | |||
| 1686 | Ga0070690_100009210 | |||
| 1687 | Ga0070670_100053329 | |||
| 1688 | Ga0070677_10000280 | |||
| 1689 | Ga0068869_100001318 | |||
| 1690 | Ga0070666_10045092 | |||
| 1691 | Ga0070680_100000616 | |||
| 1692 | Ga0070680_100017031 | |||
| 1693 | Ga0070680_100020087 | |||
| 1694 | Ga0070680_100070872 | |||
| 1695 | Ga0070680_100105649 | |||
| 1696 | Ga0070682_100001617 | |||
| 1697 | Ga0068868_100045245 | |||
| 1698 | Ga0068868_100068541 | |||
| 1699 | Ga0068868_100137913 | |||
| 1700 | Ga0070660_100032777 | |||
| 1701 | Ga0070660_100154684 | |||
| 1702 | Ga0070660_100163472 | |||
| 1703 | Ga0070689_100002625 | |||
| 1704 | Ga0070689_100012764 | |||
| 1705 | Ga0070689_100036690 | |||
| 1706 | Ga0070689_100069681 | |||
| 1707 | Ga0070691_10000060 | |||
| 1708 | Ga0070691_10008198 | |||
| 1709 | Ga0070687_100001606 | |||
| 1710 | Ga0070661_100003024 | |||
| 1711 | Ga0070692_10003848 | |||
| 1712 | Ga0070668_100026485 | |||
| 1713 | Ga0070668_100047078 | |||
| 1714 | Ga0070669_100045621 | |||
| 1715 | Ga0070675_100011308 | |||
| 1716 | Ga0070675_100015393 | |||
| 1717 | Ga0070675_100071908 | |||
| 1718 | Ga0070671_100017277 | |||
| 1719 | Ga0070671_100030622 | |||
| 1720 | Ga0070671_100037161 | |||
| 1721 | Ga0070674_100000936 | |||
| 1722 | Ga0070674_100021418 | |||
| 1723 | Ga0070674_100108305 | |||
| 1724 | Ga0070673_100004133 | |||
| 1725 | Ga0070673_100039343 | |||
| 1726 | Ga0070673_100133052 | |||
| 1727 | Ga0070688_100000475 | |||
| 1728 | Ga0070688_100143673 | |||
| 1729 | Ga0070688_100182364 | |||
| 1730 | Ga0070659_100003632 | |||
| 1731 | Ga0070667_100072255 | |||
| 1732 | Ga0070667_100082656 | |||
| 1733 | Ga0070667_100170952 | |||
| 1734 | Ga0070709_10004463 | |||
| 1735 | Ga0070709_10004879 | |||
| 1736 | Ga0070709_10006104 | |||
| 1737 | Ga0070709_10007532 | |||
| 1738 | Ga0070709_10015423 | |||
| 1739 | Ga0070709_10023031 | |||
| 1740 | Ga0070709_10075294 | |||
| 1741 | Ga0070714_100001950 | |||
| 1742 | Ga0070714_100008324 | |||
| 1743 | Ga0070714_100011427 | |||
| 1744 | Ga0070714_100094208 | |||
| 1745 | Ga0070714_100095782 | |||
| 1746 | Ga0070714_100162942 | |||
| 1747 | Ga0070714_100179334 | |||
| 1748 | Ga0070713_100001659 | |||
| 1749 | Ga0070713_100003651 | |||
| 1750 | Ga0070713_100025152 | |||
| 1751 | Ga0070713_100027795 | |||
| 1752 | Ga0070713_100039003 | |||
| 1753 | Ga0070713_100065313 | |||
| 1754 | Ga0070713_100167873 | |||
| 1755 | Ga0070710_10000852 | |||
| 1756 | Ga0070710_10001257 | |||
| 1757 | Ga0070710_10007302 | |||
| 1758 | Ga0070710_10017935 | |||
| 1759 | Ga0070701_10008207 | |||
| 1760 | Ga0070711_100003237 | |||
| 1761 | Ga0070711_100004427 | |||
| 1762 | Ga0070711_100004805 | |||
| 1763 | Ga0070711_100026407 | |||
| 1764 | Ga0070711_100027486 | |||
| 1765 | Ga0070711_100100559 | |||
| 1766 | Ga0070711_100143191 | |||
| 1767 | Ga0070711_100154540 | |||
| 1768 | Ga0070700_100000664 | |||
| 1769 | Ga0070708_100057719 | |||
| 1770 | Ga0070663_100003557 | |||
| 1771 | Ga0070663_100019210 | |||
| 1772 | Ga0070663_100076812 | |||
| 1773 | Ga0070663_100087368 | |||
| 1774 | Ga0070678_100013540 | |||
| 1775 | Ga0070678_100027779 | |||
| 1776 | Ga0070678_100071560 | |||
| 1777 | Ga0070678_100086326 | |||
| 1778 | Ga0070681_10006827 | |||
| 1779 | Ga0070681_10036709 | |||
| 1780 | Ga0070681_10051867 | |||
| 1781 | Ga0070681_10059905 | |||
| 1782 | Ga0070681_10120137 | |||
| 1783 | Ga0070681_10141695 | |||
| 1784 | Ga0070681_10182732 | |||
| 1785 | Ga0070681_10223889 | |||
| 1786 | Ga0068867_100036624 | |||
| 1787 | Ga0068867_100109347 | |||
| 1788 | Ga0070685_10010544 | |||
| 1789 | Ga0070679_100013007 | |||
| 1790 | Ga0070679_100017271 | |||
| 1791 | Ga0070679_100022370 | |||
| 1792 | Ga0070679_100068736 | |||
| 1793 | Ga0070679_100069385 | |||
| 1794 | Ga0070679_100112447 | |||
| 1795 | Ga0070679_100192916 | |||
| 1796 | Ga0070684_100000464 | |||
| 1797 | Ga0070684_100028216 | |||
| 1798 | Ga0070684_100031388 | |||
| 1799 | Ga0070684_100045267 | |||
| 1800 | Ga0070697_100139103 | |||
| 1801 | Ga0068853_100057126 | |||
| 1802 | Ga0068853_100059042 | |||
| 1803 | Ga0068853_100059965 | |||
| 1804 | Ga0068853_100225868 | |||
| 1805 | Ga0070672_100002669 | |||
| 1806 | Ga0070672_100077813 | |||
| 1807 | Ga0070672_100204087 | |||
| 1808 | Ga0070686_100001439 | |||
| 1809 | Ga0070695_100004130 | |||
| 1810 | Ga0070696_100058058 | |||
| 1811 | Ga0070693_100012460 | |||
| 1812 | Ga0070693_100040044 | |||
| 1813 | Ga0070693_100057051 | |||
| 1814 | Ga0070665_100141446 | |||
| 1815 | Ga0070665_100317183 | |||
| 1816 | Ga0070704_100004607 | |||
| 1817 | Ga0070704_100029164 | |||
| 1818 | Ga0068855_100015026 | |||
| 1819 | Ga0068855_100082701 | |||
| 1820 | Ga0068855_100085683 | |||
| 1821 | Ga0068855_100247917 | |||
| 1822 | Ga0070664_100028075 | |||
| 1823 | Ga0068857_100017922 | |||
| 1824 | Ga0068857_100049608 | |||
| 1825 | Ga0068857_100063137 | |||
| 1826 | Ga0068857_100274935 | |||
| 1827 | Ga0068854_100009066 | |||
| 1828 | Ga0068854_100021511 | |||
| 1829 | Ga0068854_100030336 | |||
| 1830 | Ga0068854_100041299 | |||
| 1831 | Ga0068854_100079724 | |||
| 1832 | Ga0068854_100093116 | |||
| 1833 | Ga0068856_100000205 | |||
| 1834 | Ga0068856_100008891 | |||
| 1835 | Ga0068856_100178078 | |||
| 1836 | Ga0070702_100035198 | |||
| 1837 | Ga0070702_100060489 | |||
| 1838 | Ga0068852_100061882 | |||
| 1839 | Ga0068852_100101117 | |||
| 1840 | Ga0068864_100004409 | |||
| 1841 | Ga0068866_10000846 | |||
| 1842 | Ga0068861_100068298 | |||
| 1843 | Ga0068870_10001430 | |||
| 1844 | Ga0068863_100022540 | |||
| 1845 | Ga0068858_100058229 | |||
| 1846 | Ga0068858_100068997 | |||
| 1847 | Ga0068858_100177054 | |||
| 1848 | Ga0068860_100002461 | |||
| 1849 | Ga0068860_100034664 | |||
| 1850 | Ga0068860_100139712 | |||
| 1851 | Ga0068860_100173663 | |||
| 1852 | Ga0081455_10000009 | |||
| 1853 | Ga0081455_10003981 | |||
| 1854 | Ga0081455_10005089 | |||
| 1855 | Ga0081455_10010171 | |||
| 1856 | Ga0081455_10014697 | |||
| 1857 | Ga0081455_10104512 | |||
| 1858 | Ga0081455_10108267 | |||
| 1859 | Ga0081540_1001773 | |||
| 1860 | Ga0081540_1004076 | |||
| 1861 | Ga0081540_1019964 | |||
| 1862 | Ga0081540_1022590 | |||
| 1863 | Ga0081540_1038917 | |||
| 1864 | Ga0081539_10000273 | |||
| 1865 | Ga0081539_10001457 | |||
| 1866 | Ga0070717_10002238 | |||
| 1867 | Ga0070717_10003863 | |||
| 1868 | Ga0070717_10006817 | |||
| 1869 | Ga0070717_10019492 | |||
| 1870 | Ga0070717_10080305 | |||
| 1871 | Ga0070717_10124157 | |||
| 1872 | Ga0070717_10225353 | |||
| 1873 | Ga0075365_10004429 | |||
| 1874 | Ga0075365_10019651 | |||
| 1875 | Ga0075365_10144831 | |||
| 1876 | Ga0075365_10148208 | |||
| 1877 | Ga0075365_10169641 | |||
| 1878 | Ga0075365_10174028 | |||
| 1879 | Ga0075364_10030693 | |||
| 1880 | Ga0075364_10083391 | |||
| 1881 | Ga0075432_10005168 | |||
| 1882 | Ga0070715_10000273 | |||
| 1883 | Ga0070715_10036228 | |||
| 1884 | Ga0070716_100001924 | |||
| 1885 | Ga0070712_100022457 | |||
| 1886 | Ga0070712_100029031 | |||
| 1887 | Ga0070712_100055507 | |||
| 1888 | Ga0070712_100148878 | |||
| 1889 | Ga0075367_10025804 | |||
| 1890 | Ga0075367_10051256 | |||
| 1891 | Ga0075369_10014210 | |||
| 1892 | Ga0075369_10024464 | |||
| 1893 | Ga0097621_100003278 | |||
| 1894 | Ga0097621_100019153 | |||
| 1895 | Ga0075370_10115434 | |||
| 1896 | Ga0068871_100036536 | |||
| 1897 | Ga0075428_100012796 | |||
| 1898 | Ga0075428_100075859 | |||
| 1899 | Ga0075430_100000268 | |||
| 1900 | Ga0075431_100005548 | |||
| 1901 | Ga0075433_10000975 | |||
| 1902 | Ga0075433_10117807 | |||
| 1903 | Ga0075434_100001139 | |||
| 1904 | Ga0075434_100006118 | |||
| 1905 | Ga0075434_100009286 | |||
| 1906 | Ga0075434_100046527 | |||
| 1907 | Ga0075429_100002983 | |||
| 1908 | Ga0068865_100006754 | |||
| 1909 | Ga0068865_100047147 | |||
| 1910 | Ga0099824_1006204 | |||
| 1911 | Ga0099824_1006748 | |||
| 1912 | Ga0099822_1004857 | |||
| 1913 | Ga0075435_100007827 | |||
| 1914 | Ga0075435_100210148 | |||
| 1915 | Ga0105240_10002078 | |||
| 1916 | Ga0105240_10013579 | |||
| 1917 | Ga0105240_10016978 | |||
| 1918 | Ga0105240_10064453 | |||
| 1919 | Ga0105240_10126656 | |||
| 1920 | Ga0105240_10219721 | |||
| 1921 | Ga0111539_10000173 | |||
| 1922 | Ga0111539_10000528 | |||
| 1923 | Ga0105245_10035466 | |||
| 1924 | Ga0105245_10080369 | |||
| 1925 | Ga0105245_10259001 | |||
| 1926 | Ga0105247_10005865 | |||
| 1927 | Ga0105247_10037516 | |||
| 1928 | Ga0114129_10001477 | |||
| 1929 | Ga0114129_10015647 | |||
| 1930 | Ga0105243_10008714 | |||
| 1931 | Ga0105241_10031956 | |||
| 1932 | Ga0105241_10070669 | |||
| 1933 | Ga0105241_10086074 | |||
| 1934 | Ga0105242_10025020 | |||
| 1935 | Ga0105248_10098622 | |||
| 1936 | Ga0105248_10105526 | |||
| 1937 | Ga0105237_10007647 | |||
| 1938 | Ga0105237_10009020 | |||
| 1939 | Ga0105237_10031044 | |||
| 1940 | Ga0105237_10226718 | |||
| 1941 | Ga0105238_10010133 | |||
| 1942 | Ga0105238_10026175 | |||
| 1943 | Ga0105238_10030600 | |||
| 1944 | Ga0105238_10084301 | |||
| 1945 | Ga0105238_10196881 | |||
| 1946 | Ga0105249_10015440 | |||
| 1947 | Ga0105249_10030442 | |||
| 1948 | Ga0105249_10175548 | |||
| 1949 | Ga0105249_10381253 | |||
| 1950 | Ga0099796_10025796 | |||
| 1951 | Ga0105239_10005426 | |||
| 1952 | Ga0105239_10016288 | |||
| 1953 | Ga0105239_10037358 | |||
| 1954 | Ga0105239_10045931 | |||
| 1955 | Ga0105239_10047153 | |||
| 1956 | Ga0105246_10003820 | |||
| 1957 | Ga0105246_10046095 | |||
| 1958 | Ga0157373_10039181 | |||
| 1959 | Ga0157370_10124516 | |||
| 1960 | Ga0157369_10003343 | |||
| 1961 | Ga0157369_10046492 | |||
| 1962 | Ga0157369_10269882 | |||
| 1963 | Ga0157374_10012290 | |||
| 1964 | Ga0157374_10068122 | |||
| 1965 | Ga0157374_10114960 | |||
| 1966 | Ga0157374_10188757 | |||
| 1967 | Ga0157378_10011932 | |||
| 1968 | Ga0157378_10143491 | |||
| 1969 | Ga0157378_10160403 | |||
| 1970 | Ga0163162_10045288 | |||
| 1971 | Ga0163162_10048889 | |||
| 1972 | Ga0157372_10095503 | |||
| 1973 | Ga0157372_10112418 | |||
| 1974 | Ga0157372_10188677 | |||
| 1975 | Ga0157375_10044207 | |||
| 1976 | Ga0157375_10099137 | |||
| 1977 | Ga0157375_10157535 | |||
| 1978 | Ga0157375_10253479 | |||
| 1979 | Ga0163163_10001787 | |||
| 1980 | Ga0163163_10002228 | |||
| 1981 | Ga0163163_10041063 | |||
| 1982 | Ga0163163_10121091 | |||
| 1983 | Ga0157380_10030574 | |||
| 1984 | Ga0157380_10113804 | |||
| 1985 | Ga0182008_10057504 | |||
| 1986 | Ga0157377_10001330 | |||
| 1987 | Ga0157379_10080213 | |||
| 1988 | Ga0157379_10170964 | |||
| 1989 | Ga0157376_10042631 | |||
| 1990 | Ga0157376_10071482 | |||
| 1991 | Ga0214544_1000002 | |||
| 1992 | Ga0214542_1000001 | |||
| 1993 | Ga0214545_1000001 | |||
| 1994 | Ga0214543_1000001 | |||
| 1995 | Ga0213873_10001974 | |||
| 1996 | Ga0213876_10001690 | |||
| 1997 | Ga0213875_10029001 | |||
| 1998 | Ga0224572_1009847 | |||
| 1999 | Ga0209563_102264 | |||
| 2000 | Ga0209677_100537 | |||
| 2001 | Ga0209677_103297 | |||
| 2002 | Ga0209148_1000613 | |||
| 2003 | Ga0209233_1005864 | |||
| 2004 | Ga0209233_1010201 | |||
| 2005 | Ga0207666_1000006 | |||
| 2006 | Ga0207666_1000644 | |||
| 2007 | Ga0209455_1001277 | |||
| 2008 | Ga0209455_1006204 | |||
| 2009 | Ga0209564_1000767 | |||
| 2010 | Ga0209758_1000140 | |||
| 2011 | Ga0209758_1000164 | |||
| 2012 | Ga0209758_1000252 | |||
| 2013 | Ga0209758_1001601 | |||
| 2014 | Ga0209758_1002397 | |||
| 2015 | Ga0209758_1003800 | |||
| 2016 | Ga0209758_1009162 | |||
| 2017 | Ga0209256_1004401 | |||
| 2018 | Ga0207426_1000626 | |||
| 2019 | Ga0207426_1001803 | |||
| 2020 | Ga0207426_1004225 | |||
| 2021 | Ga0209257_1002059 | |||
| 2022 | Ga0207697_10001754 | |||
| 2023 | Ga0207653_10009403 | |||
| 2024 | Ga0207682_10000040 | |||
| 2025 | Ga0207692_10000214 | |||
| 2026 | Ga0207692_10005215 | |||
| 2027 | Ga0207710_10021294 | |||
| 2028 | Ga0207688_10014533 | |||
| 2029 | Ga0207688_10049196 | |||
| 2030 | Ga0207688_10061314 | |||
| 2031 | Ga0207647_10002967 | |||
| 2032 | Ga0207647_10015473 | |||
| 2033 | Ga0207647_10049226 | |||
| 2034 | Ga0207647_10050100 | |||
| 2035 | Ga0207699_10000379 | |||
| 2036 | Ga0207699_10001095 | |||
| 2037 | Ga0207699_10005078 | |||
| 2038 | Ga0207699_10074575 | |||
| 2039 | Ga0207645_10003655 | |||
| 2040 | Ga0207645_10106794 | |||
| 2041 | Ga0207643_10000046 | |||
| 2042 | Ga0207654_10003188 | |||
| 2043 | Ga0207654_10006353 | |||
| 2044 | Ga0207654_10016493 | |||
| 2045 | Ga0207654_10084329 | |||
| 2046 | Ga0207707_10004014 | |||
| 2047 | Ga0207707_10021050 | |||
| 2048 | Ga0207707_10021698 | |||
| 2049 | Ga0207707_10026218 | |||
| 2050 | Ga0207707_10034615 | |||
| 2051 | Ga0207695_10000910 | |||
| 2052 | Ga0207695_10009322 | |||
| 2053 | Ga0207695_10033825 | |||
| 2054 | Ga0207695_10055378 | |||
| 2055 | Ga0207695_10066027 | |||
| 2056 | Ga0207671_10002587 | |||
| 2057 | Ga0207671_10076695 | |||
| 2058 | Ga0207693_10002346 | |||
| 2059 | Ga0207693_10003562 | |||
| 2060 | Ga0207693_10007817 | |||
| 2061 | Ga0207693_10022850 | |||
| 2062 | Ga0207693_10034870 | |||
| 2063 | Ga0207663_10000628 | |||
| 2064 | Ga0207660_10029889 | |||
| 2065 | Ga0207660_10043420 | |||
| 2066 | Ga0207660_10059490 | |||
| 2067 | Ga0207660_10065192 | |||
| 2068 | Ga0207662_10001270 | |||
| 2069 | Ga0207662_10002365 | |||
| 2070 | Ga0207657_10002140 | |||
| 2071 | Ga0207657_10016821 | |||
| 2072 | Ga0207657_10055164 | |||
| 2073 | Ga0207657_10105056 | |||
| 2074 | Ga0207657_10129531 | |||
| 2075 | Ga0207649_10003855 | |||
| 2076 | Ga0207652_10020518 | |||
| 2077 | Ga0207652_10029861 | |||
| 2078 | Ga0207652_10032852 | |||
| 2079 | Ga0207652_10065476 | |||
| 2080 | Ga0207652_10083096 | |||
| 2081 | Ga0207652_10094319 | |||
| 2082 | Ga0207652_10215805 | |||
| 2083 | Ga0207694_10000157 | |||
| 2084 | Ga0207694_10039954 | |||
| 2085 | Ga0207694_10081499 | |||
| 2086 | Ga0207650_10009127 | |||
| 2087 | Ga0207650_10113578 | |||
| 2088 | Ga0207659_10080673 | |||
| 2089 | Ga0207659_10214645 | |||
| 2090 | Ga0207687_10117983 | |||
| 2091 | Ga0207700_10000290 | |||
| 2092 | Ga0207700_10015816 | |||
| 2093 | Ga0207700_10021985 | |||
| 2094 | Ga0207700_10053583 | |||
| 2095 | Ga0207700_10076524 | |||
| 2096 | Ga0207700_10080567 | |||
| 2097 | Ga0207700_10135371 | |||
| 2098 | Ga0207664_10018261 | |||
| 2099 | Ga0207664_10018330 | |||
| 2100 | Ga0207664_10023247 | |||
| 2101 | Ga0207664_10030290 | |||
| 2102 | Ga0207664_10131051 | |||
| 2103 | Ga0207664_10179395 | |||
| 2104 | Ga0207644_10002541 | |||
| 2105 | Ga0207644_10011352 | |||
| 2106 | Ga0207644_10138352 | |||
| 2107 | Ga0207690_10047293 | |||
| 2108 | Ga0207706_10000929 | |||
| 2109 | Ga0207706_10016427 | |||
| 2110 | Ga0207706_10019475 | |||
| 2111 | Ga0207686_10021591 | |||
| 2112 | Ga0207709_10008343 | |||
| 2113 | Ga0207709_10163609 | |||
| 2114 | Ga0207670_10141063 | |||
| 2115 | Ga0207669_10027433 | |||
| 2116 | Ga0207704_10014558 | |||
| 2117 | Ga0207665_10001305 | |||
| 2118 | Ga0207665_10016936 | |||
| 2119 | Ga0207665_10030619 | |||
| 2120 | Ga0207665_10056650 | |||
| 2121 | Ga0207691_10009584 | |||
| 2122 | Ga0207691_10099548 | |||
| 2123 | Ga0207711_10040182 | |||
| 2124 | Ga0207711_10191095 | |||
| 2125 | Ga0207711_10191689 | |||
| 2126 | Ga0207689_10006509 | |||
| 2127 | Ga0207661_10001362 | |||
| 2128 | Ga0207661_10006014 | |||
| 2129 | Ga0207661_10008276 | |||
| 2130 | Ga0207661_10041416 | |||
| 2131 | Ga0207679_10000763 | |||
| 2132 | Ga0207679_10033372 | |||
| 2133 | Ga0207667_10023580 | |||
| 2134 | Ga0207667_10026403 | |||
| 2135 | Ga0207667_10044845 | |||
| 2136 | Ga0207667_10045421 | |||
| 2137 | Ga0207667_10131448 | |||
| 2138 | Ga0207667_10223495 | |||
| 2139 | Ga0207651_10010247 | |||
| 2140 | Ga0207651_10084284 | |||
| 2141 | Ga0207668_10048856 | |||
| 2142 | Ga0207640_10007930 | |||
| 2143 | Ga0207640_10015340 | |||
| 2144 | Ga0207640_10021906 | |||
| 2145 | Ga0207640_10057689 | |||
| 2146 | Ga0207640_10204882 | |||
| 2147 | Ga0207658_10107758 | |||
| 2148 | Ga0207658_10188318 | |||
| 2149 | Ga0207677_10061004 | |||
| 2150 | Ga0207677_10157340 | |||
| 2151 | Ga0207703_10108450 | |||
| 2152 | Ga0207639_10018019 | |||
| 2153 | Ga0207639_10025447 | |||
| 2154 | Ga0207639_10073790 | |||
| 2155 | Ga0207639_10089205 | |||
| 2156 | Ga0207639_10167612 | |||
| 2157 | Ga0207678_10022365 | |||
| 2158 | Ga0207678_10042921 | |||
| 2159 | Ga0207678_10058942 | |||
| 2160 | Ga0207708_10004046 | |||
| 2161 | Ga0207708_10013208 | |||
| 2162 | Ga0207708_10033993 | |||
| 2163 | Ga0207702_10000002 | |||
| 2164 | Ga0207702_10000048 | |||
| 2165 | Ga0207702_10041826 | |||
| 2166 | Ga0207702_10138982 | |||
| 2167 | Ga0207641_10027420 | |||
| 2168 | Ga0207648_10032664 | |||
| 2169 | Ga0207676_10110779 | |||
| 2170 | Ga0207674_10000647 | |||
| 2171 | Ga0207674_10019475 | |||
| 2172 | Ga0207674_10020460 | |||
| 2173 | Ga0207674_10055214 | |||
| 2174 | Ga0207674_10093681 | |||
| 2175 | Ga0207675_100000322 | |||
| 2176 | Ga0207675_100099013 | |||
| 2177 | Ga0207675_100126993 | |||
| 2178 | Ga0207675_100211307 | |||
| 2179 | Ga0207683_10000004 | |||
| 2180 | Ga0207683_10001293 | |||
| 2181 | Ga0207683_10022736 | |||
| 2182 | Ga0207683_10079477 | |||
| 2183 | Ga0207683_10086355 | |||
| 2184 | Ga0207683_10127238 | |||
| 2185 | Ga0207698_10034569 | |||
| 2186 | Ga0207698_10112081 | |||
| 2187 | Ga0209389_1000061 | |||
| 2188 | Ga0209389_1000233 | |||
| 2189 | Ga0209589_1000001 | |||
| 2190 | Ga0209589_1000465 | |||
| 2191 | Ga0209489_100001 | |||
| 2192 | Ga0209489_100006 | |||
| 2193 | Ga0209489_102560 | |||
| 2194 | Ga0209700_100001 | |||
| 2195 | Ga0209700_100062 | |||
| 2196 | Ga0209971_1008209 | |||
| 2197 | Ga0209998_10003231 | |||
| 2198 | Ga0209974_10003995 | |||
| 2199 | Ga0207428_10000291 | |||
| 2200 | Ga0207428_10000303 | |||
| 2201 | Ga0207428_10004591 | |||
| 2202 | Ga0268266_10132623 | |||
| 2203 | Ga0268266_10252429 | |||
| 2204 | Ga0268265_10003775 | |||
| 2205 | Ga0268264_10000149 | |||
| 2206 | Ga0268264_10077581 | |||
| 2207 | Ga0265337_1001406 | |||
| 2208 | Ga0265337_1007816 | |||
| 2209 | Ga0265319_1012289 | |||
| 2210 | Ga0265318_10051844 | |||
| 2211 | Ga0265336_10001016 | |||
| 2212 | Ga0307517_10000772 | |||
| 2213 | Ga0307515_10021427 | |||
| 2214 | Ga0307515_10096058 | |||
| 2215 | Ga0265338_10001205 | |||
| 2216 | Ga0265338_10038005 | |||
| 2217 | Ga0265330_10001924 | |||
| 2218 | Ga0265330_10019625 | |||
| 2219 | Ga0265325_10000029 | |||
| 2220 | Ga0265325_10002293 | |||
| 2221 | Ga0265325_10003329 | |||
| 2222 | Ga0265325_10018954 | |||
| 2223 | Ga0265340_10010828 | |||
| 2224 | Ga0265340_10017331 | |||
| 2225 | Ga0265339_10000465 | |||
| 2226 | Ga0265339_10002336 | |||
| 2227 | Ga0265339_10051392 | |||
| 2228 | Ga0265316_10084326 | |||
| 2229 | Ga0307509_10024209 | |||
| 2230 | Ga0307509_10208554 | |||
| 2231 | Ga0265313_10000006 | |||
| 2232 | Ga0265313_10000183 | |||
| 2233 | Ga0307508_10000009 | |||
| 2234 | Ga0307508_10234307 | |||
| 2235 | Ga0265314_10006174 | |||
| 2236 | Ga0265314_10016765 | |||
| 2237 | Ga0265342_10005467 | |||
| 2238 | Ga0307516_10006873 | |||
| 2239 | Ga0307516_10013909 | |||
| 2240 | Ga0307516_10015330 | |||
| 2241 | Ga0307413_10050953 | |||
| 2242 | Ga0307410_10140170 | |||
| 2243 | Ga0307414_10137251 | |||
| 2244 | Ga0316583_10000523 | |||
| 2245 | Ga0307510_10053275 | |||
| 2246 | Ga0307510_10061725 | |||
| 2247 | Ga0307510_10199292 | |||
| 2248 | Ga0315911_1000001 | |||
| 2249 | Ga0373948_0001308 | |||
| 2250 | Ga0373948_0003865 | |||
| 2251 | Ga0373950_0002811 | |||
| 2252 | Ga0373958_0000676 | |||
| 2253 | Ga0373938_0000022 | |||
| 2254 | Ga0373928_0000047 | |||
| 2255 | Ga0373928_0004151 | |||
| 2256 | Ga0373928_0006672 | |||
| 2257 | Ga0373934_0017260 | |||
| 2258 | Ga0373934_0040526 | |||
| 2259 | Ga0373944_0000339 | |||
| 2260 | Ga0373944_0000350 | |||
| 2261 | Ga0373949_0001400 | |||
| 2262 | Ga0373949_0008195 | |||
| 2263 | Ga0373951_0001054 | |||
| 2264 | Ga0373952_0000105 | |||
| 2265 | Ga0373923_0000770 | |||
| 2266 | Ga0373932_0006455 | |||
| 2267 | Ga0373939_0005537 | |||
| 2268 | Ga0373945_0000820 | |||
| 2269 | Ga0373945_0030989 | |||
| 2270 | Ga0373953_0000239 | |||
| 2271 | Ga0373953_0004113 | |||
| 2272 | Ga0373954_0001738 | |||
| 2273 | Ga0373954_0005936 | |||
| 2274 | Ga0373954_0020353 | |||
| 2275 | Ga0373954_0031701 | |||
| 2276 | Ga0373954_0034305 | |||
| 2277 | Ga0373954_0078574 | |||
| 2278 | Ga0373956_0002833 | |||
| 2279 | Ga0373957_0034461 | |||
| 2280 | Ga0373960_0000925 | |||
| 2281 | Ga0373943_0000061 | |||
| 2282 | Ga0373943_0006074 | |||
| 2283 | Ga0373943_0015843 | |||
| 2284 | Ga0373943_0019619 | |||
| 2285 | Ga0373943_0019660 | |||
| 2286 | Ga0373943_0024439 | |||
| 2287 | Ga0373943_0031241 | |||
| 2288 | Ga0373946_0000417 | |||
| 2289 | Ga0373946_0003998 | |||
| 2290 | Ga0373955_0000210 | |||
| 2291 | Ga0373955_0004764 | |||
| 2292 | Ga0373955_0006846 | |||
| 2293 | Ga0373955_0008373 | |||
| 2294 | Ga0373955_0023446 | |||
| 2295 | Ga0373942_0005353 | |||
| 2296 | Ga0373961_0001233 | |||
| 2297 | Ga0373962_0001787 | |||
| 2298 | Ga0373924_0008268 | |||
| 2299 | Ga0373924_0013778 | |||
| 2300 | Ga0373924_0033493 | |||
| 2301 | Ga0373931_0006062 | |||
| 2302 | Ga0373931_0013930 | |||
| 2303 | Ga0373931_0022502 | |||
| 2304 | Ga0373935_0000602 | |||
| 2305 | Ga0373935_0003114 | |||
| 2306 | Ga0373935_0012999 | |||
| 2307 | Ga0373935_0074880 | |||
| 2308 | Ga0373935_0119540 | |||
| 2309 | Ga0373935_0207899 | |||
| 2310 | Ga0373927_0000069 | |||
| 2311 | Ga0373927_0000275 | |||
| 2312 | Ga0373927_0002225 | |||
| 2313 | Ga0373927_0007415 | |||
| 2314 | Ga0373927_0008118 | |||
| 2315 | Ga0373927_0031474 | |||
| 2316 | Ga0373927_0033098 | |||
| 2317 | Ga0373927_0038411 | |||
| 2318 | Ga0373927_0054070 | |||
| 2319 | Ga0373927_0079125 | |||
| 2320 | Ga0373933_0000235 | |||
| 2321 | Ga0373933_0001755 | |||
| 2322 | Ga0373933_0003240 | |||
| 2323 | Ga0373933_0003450 | |||
| 2324 | Ga0373933_0013766 | |||
| 2325 | Ga0373933_0045006 | |||
| 2326 | Ga0373947_0000187 | |||
| 2327 | Ga0373947_0000385 | |||
| 2328 | Ga0373947_0000967 | |||
| 2329 | Ga0373947_0015091 | |||
| 2330 | Ga0373947_0016982 | |||
| 2331 | Ga0373947_0022314 | |||
| 2332 | Ga0373947_0053197 | |||
| 2333 | Ga0373937_0019845 | |||
| 2334 | Ga0373937_0023996 | |||
| 2335 | Ga0373937_0025035 | |||
| 2336 | Ga0373937_0025676 | |||
| 2337 | Ga0373937_0226896 | |||
| 2338 | Ga0373925_0000791 | |||
| 2339 | Ga0373925_0006683 | |||
| 2340 | Ga0373925_0054208 | |||
| 2341 | Ga0373925_0206569 | |||
| 2342 | Ga0395900_0001120 | |||
| 2343 | Ga0395900_0034552 | |||
| 2344 | Ga0395900_0121340 | |||
| 2345 | Ga0395898_0087444 | |||
| 2346 | Ga0395898_0089518 | |||
| 2347 | Ga0395898_0109182 | |||
| 2348 | Ga0395905_0015063 | |||
| 2349 | Ga0395905_0034684 | |||
| 2350 | Ga0395905_0171121 | |||
| 2351 | Ga0436364_1473129 | |||
| 2352 | Ga0395901_0073892 | |||
| 2353 | Ga0395901_0120747 | |||
| 2354 | Ga0395901_0124045 | |||
| 2355 | Ga0395901_0187242 | |||
| 2356 | Ga0436365_1440273 | |||
| 2357 | Ga0436361_0897580 | |||
| 2358 | Ga0436362_0987899 | |||
| 2359 | Ga0439443_005357 | |||
| 2360 | Ga0439448_0018291 | |||
| 2361 | Ga0451577_0149889 | |||
| 2362 | Ga0466969_0057995 | |||
| 2363 | Ga0466972_0000189 | |||
| 2364 | Ga0466972_0007356 | |||
| 2365 | Ga0453683_0000007 | |||
| 2366 | Ga0466966_0000655 | |||
| 2367 | Ga0466966_0079685 | |||
| 2368 | Ga0466961_0001465 | |||
| 2369 | Ga0466963_0031905 | |||
| 2370 | Ga0466963_0033194 | |||
| 2371 | Ga0466963_0033468 | |||
| 2372 | Ga0466971_0028124 | |||
| 2373 | Ga0466957_0005455 | |||
| 2374 | Ga0466959_0041216 | |||
| 2375 | Ga0466959_0065550 | |||
| 2376 | Ga0466959_0193986 | |||
| 2377 | Ga0451576_0048748 | |||
| 2378 | Ga0466958_0025802 | |||
| 2379 | Ga0466967_0068767 | |||
| 2380 | Ga0466967_0131186 | |||
| 2381 | Ga0466967_0229850 | |||
| 2382 | Ga0495592_0004838 | |||
| 2383 | Ga0495592_0010286 | |||
| 2384 | Ga0495592_0030258 | |||
| 2385 | Ga0495592_0038864 | |||
| 2386 | Ga0495592_0076265 | |||
| 2387 | Ga0495603_0001382 | |||
| 2388 | Ga0495603_0004726 | |||
| 2389 | Ga0495603_0012706 | |||
| 2390 | Ga0495603_0025702 | |||
| 2391 | Ga0495603_0042290 | |||
| 2392 | Ga0495603_0045674 | |||
| 2393 | Ga0495591_014080 | |||
| 2394 | Ga0495629_0000083 | |||
| 2395 | Ga0495629_0000329 | |||
| 2396 | Ga0495629_0000721 | |||
| 2397 | Ga0495629_0020254 | |||
| 2398 | Ga0495638_0006737 | |||
| 2399 | Ga0495638_0022234 | |||
| 2400 | Ga0495641_0009705 | |||
| 2401 | Ga0495641_0032985 | |||
| 2402 | Ga0495651_0000395 | |||
| 2403 | Ga0495651_0004021 | |||
| 2404 | Ga0495651_0007002 | |||
| 2405 | Ga0495651_0026970 | |||
| 2406 | Ga0495651_0162939 | |||
| 2407 | Ga0495653_0003944 | |||
| 2408 | Ga0495653_0004234 | |||
| 2409 | Ga0495653_0094600 | |||
| 2410 | Ga0495580_0000716 | |||
| 2411 | Ga0495580_0019177 | |||
| 2412 | Ga0495582_0000094 | |||
| 2413 | Ga0495582_0003339 | |||
| 2414 | Ga0495582_0004669 | |||
| 2415 | Ga0495582_0018325 | |||
| 2416 | Ga0495582_0022886 | |||
| 2417 | Ga0495605_0020821 | |||
| 2418 | Ga0495605_0052069 | |||
| 2419 | Ga0495639_0000150 | |||
| 2420 | Ga0495662_0000080 | |||
| 2421 | Ga0495662_0016714 | |||
| 2422 | Ga0495664_0000662 | |||
| 2423 | Ga0495664_0008600 | |||
| 2424 | Ga0495664_0024018 | |||
| 2425 | Ga0495664_0051239 | |||
| 2426 | Ga0495664_0098621 | |||
| 2427 | Ga0495584_0076249 | |||
| 2428 | Ga0495585_0001303 | |||
| 2429 | Ga0495594_0000433 | |||
| 2430 | Ga0495594_0006111 | |||
| 2431 | Ga0495594_0012537 | |||
| 2432 | Ga0495594_0054424 | |||
| 2433 | Ga0495606_0001450 | |||
| 2434 | Ga0495606_0014755 | |||
| 2435 | Ga0495606_0049637 | |||
| 2436 | Ga0495606_0074233 | |||
| 2437 | Ga0495608_0001144 | |||
| 2438 | Ga0495608_0005204 | |||
| 2439 | Ga0495608_0019490 | |||
| 2440 | Ga0495616_0025296 | |||
| 2441 | Ga0495616_0034991 | |||
| 2442 | Ga0495618_0007675 | |||
| 2443 | Ga0495618_0066416 | |||
| 2444 | Ga0495618_0098046 | |||
| 2445 | Ga0495618_0135342 | |||
| 2446 | Ga0495628_0002354 | |||
| 2447 | Ga0495628_0006385 | |||
| 2448 | Ga0495628_0035160 | |||
| 2449 | Ga0495628_0037332 | |||
| 2450 | Ga0495628_0080403 | |||
| 2451 | Ga0495630_0000875 | |||
| 2452 | Ga0495630_0008635 | |||
| 2453 | Ga0495630_0050012 | |||
| 2454 | Ga0495630_0067663 | |||
| 2455 | Ga0495630_0154120 | |||
| 2456 | Ga0495643_0081923 | |||
| 2457 | Ga0495644_0000434 | |||
| 2458 | Ga0495648_0002087 | |||
| 2459 | Ga0495663_0030622 | |||
| 2460 | Ga0495652_0006074 | |||
| 2461 | Ga0495652_0021509 | |||
| 2462 | Ga0495652_0031303 | |||
| 2463 | Ga0495652_0055445 | |||
| 2464 | Ga0495652_0071178 | |||
| 2465 | Ga0495652_0083231 | |||
| 2466 | Ga0495652_0083644 | |||
| 2467 | Ga0495652_0163759 | |||
| 2468 | Ga0495665_0000533 | |||
| 2469 | Ga0495665_0003951 | |||
| 2470 | Ga0495665_0044463 | |||
| 2471 | Ga0495640_0003907 | |||
| 2472 | Ga0495640_0007742 | |||
| 2473 | Ga0495640_0028558 | |||
| 2474 | Ga0495640_0029207 | |||
| 2475 | Ga0495640_0041269 | |||
| 2476 | Ga0495586_0010306 | |||
| 2477 | Ga0495586_0028080 | |||
| 2478 | Ga0495586_0064726 | |||
| 2479 | Ga0495587_0001492 | |||
| 2480 | Ga0495587_0018363 | |||
| 2481 | Ga0495587_0034734 | |||
| 2482 | Ga0495587_0037957 | |||
| 2483 | Ga0495587_0099010 | |||
| 2484 | Ga0495598_0003353 | |||
| 2485 | Ga0495609_0015485 | |||
| 2486 | Ga0495609_0049891 | |||
| 2487 | Ga0495621_0039707 | |||
| 2488 | Ga0495597_0045864 | |||
| 2489 | Ga0495645_0001112 | |||
| 2490 | Ga0495645_0004397 | |||
| 2491 | Ga0495645_0108211 | |||
| 2492 | Ga0495622_0004731 | |||
| 2493 | Ga0495622_0016576 | |||
| 2494 | Ga0495622_0017927 | |||
| 2495 | Ga0495622_0047993 | |||
| 2496 | Ga0495633_0000643 | |||
| 2497 | Ga0495667_0001683 | |||
| 2498 | Ga0495667_0004005 | |||
| 2499 | Ga0495667_0008713 | |||
| 2500 | Ga0495667_0011539 | |||
| 2501 | Ga0495667_0015316 | |||
| 2502 | Ga0495667_0018588 | |||
| 2503 | Ga0495667_0034353 | |||
| 2504 | Ga0495667_0064923 | |||
| 2505 | Ga0495667_0110481 | |||
| 2506 | Ga0495656_0001948 | |||
| 2507 | Ga0495656_0008685 | |||
| 2508 | Ga0495668_0117860 | |||
| 2509 | Ga0495634_0001187 | |||
| 2510 | Ga0495634_0007336 | |||
| 2511 | Ga0495634_0038527 | |||
| 2512 | Ga0495611_0032018 | |||
| 2513 | Ga0495635_0000229 | |||
| 2514 | Ga0495635_0001379 | |||
| 2515 | Ga0495635_0001715 | |||
| 2516 | Ga0495635_0009501 | |||
| 2517 | Ga0495635_0019366 | |||
| 2518 | Ga0495635_0103139 | |||
| 2519 | Ga0495635_0109330 | |||
| 2520 | Ga0495635_0115734 | |||
| 2521 | Ga0495659_0003909 | |||
| 2522 | Ga0495661_0033777 | |||
| 2523 | Ga0495661_0034523 | |||
| 2524 | Ga0495661_0068020 | |||
| 2525 | Ga0495588_0001035 | |||
| 2526 | Ga0495588_0003248 | |||
| 2527 | Ga0495657_0004582 | |||
| 2528 | Ga0495657_0004695 | |||
| 2529 | Ga0495657_0010875 | |||
| 2530 | Ga0495657_0041075 | |||
| 2531 | Ga0495599_0000421 | |||
| 2532 | Ga0495599_0035246 | |||
| 2533 | Ga0495599_0091645 | |||
| 2534 | Ga0495623_0004340 | |||
| 2535 | Ga0495623_0007441 | |||
| 2536 | Ga0495623_0043055 | |||
| 2537 | Ga0495646_0002150 | |||
| 2538 | Ga0495646_0008370 | |||
| 2539 | Ga0495646_0057833 | |||
| 2540 | Ga0495646_0092892 | |||
| 2541 | Ga0495647_0002484 | |||
| 2542 | Ga0495647_0003746 | |||
| 2543 | Ga0495647_0004744 | |||
| 2544 | Ga0495647_0028886 | |||
| 2545 | Ga0495658_0000334 | |||
| 2546 | Ga0495658_0000930 | |||
| 2547 | Ga0495658_0034611 | |||
| 2548 | Ga0495613_0002993 | |||
| 2549 | Ga0495613_0020701 | |||
| 2550 | Ga0495613_0028421 | |||
| 2551 | Ga0495613_0073230 | |||
| 2552 | Ga0495613_0075494 | |||
| 2553 | Ga0495613_0085620 | |||
| 2554 | Ga0495624_0000096 | |||
| 2555 | Ga0495624_0010831 | |||
| 2556 | Ga0495624_0016957 | |||
| 2557 | Ga0495670_0001695 | |||
| 2558 | Ga0495670_0010532 | |||
| 2559 | Ga0495670_0045547 | |||
| 2560 | Ga0495649_0010278 | |||
| 2561 | Ga0495589_0051170 | |||
| 2562 | Ga0495600_0000610 | |||
| 2563 | Ga0495600_0003611 | |||
| 2564 | Ga0495600_0006125 | |||
| 2565 | Ga0495600_0017288 | |||
| 2566 | Ga0495600_0041592 | |||
| 2567 | Ga0495600_0076751 | |||
| 2568 | Ga0495600_0100946 | |||
| 2569 | Ga0495581_0000095 | |||
| 2570 | Ga0495581_0009859 | |||
| 2571 | Ga0495581_0105902 | |||
| 2572 | Ga0495581_0106427 | |||
| 2573 | Ga0495604_0000797 | |||
| 2574 | Ga0495604_0006295 | |||
| 2575 | Ga0495604_0011105 | |||
| 2576 | Ga0495604_0020488 | |||
| 2577 | Ga0495604_0027070 | |||
| 2578 | Ga0495604_0030177 | |||
| 2579 | Ga0495604_0048548 | |||
| 2580 | Ga0495604_0073039 | |||
| 2581 | Ga0495604_0123508 | |||
| 2582 | Ga0495674_0009440 | |||
| 2583 | Ga0495674_0017914 | |||
| 2584 | Ga0495674_0022977 | |||
| 2585 | Ga0495674_0037800 | |||
| 2586 | Ga0495674_0048131 | |||
| 2587 | Ga0495674_0070867 | |||
| 2588 | Ga0495674_0074411 | |||
| 2589 | Ga0495672_0056452 | |||
| 2590 | Ga0495672_0076850 | |||
| 2591 | Ga0495676_0021481 | |||
| 2592 | Ga0495676_0021580 | |||
| 2593 | Ga0495676_0036821 | |||
| 2594 | Ga0495676_0041429 | |||
| 2595 | Ga0495676_0048711 | |||
| 2596 | Ga0495680_0001729 | |||
| 2597 | Ga0495680_0002991 | |||
| 2598 | Ga0495680_0004264 | |||
| 2599 | Ga0495680_0009851 | |||
| 2600 | Ga0495680_0010215 | |||
| 2601 | Ga0495680_0018408 | |||
| 2602 | Ga0495680_0086501 | |||
| 2603 | Ga0495680_0115095 | |||
| 2604 | Ga0495687_008163 | |||
| 2605 | Ga0495675_0000722 | |||
| 2606 | Ga0495675_0001401 | |||
| 2607 | Ga0495675_0003429 | |||
| 2608 | Ga0495675_0025777 | |||
| 2609 | Ga0495675_0062940 | |||
| 2610 | Ga0495684_0001392 | |||
| 2611 | Ga0495684_0001579 | |||
| 2612 | Ga0495684_0028270 | |||
| 2613 | Ga0495684_0052546 | |||
| 2614 | Ga0495684_0185122 | |||
| 2615 | Ga0495686_0005500 | |||
| 2616 | Ga0495593_0000071 | |||
| 2617 | Ga0495593_0004616 | |||
| 2618 | Ga0495593_0006998 | |||
| 2619 | Ga0495593_0052374 | |||
| 2620 | Ga0495602_0006038 | |||
| 2621 | Ga0495602_0021211 | |||
| 2622 | Ga0495602_0034524 | |||
| 2623 | Ga0495602_0108852 | |||
| 2624 | Ga0495602_0210924 | |||
| 2625 | Ga0495614_0021117 | |||
| 2626 | Ga0495614_0024515 | |||
| 2627 | Ga0496100_0045336 | |||
| 2628 | Ga0496100_0055537 | |||
| 2629 | Ga0496100_0068283 | |||
| 2630 | Ga0496101_0004772 | |||
| 2631 | Ga0496101_0041558 | |||
| 2632 | Ga0496101_0061238 | |||
| 2633 | Ga0496101_0078822 | |||
| 2634 | Ga0496101_0109944 | |||
| 2635 | Ga0496102_0045998 | |||
| 2636 | Ga0496102_0071638 | |||
| 2637 | Ga0496102_0106692 | |||
| 2638 | Ga0496102_0269285 | |||
| 2639 | Ga0496102_0321991 | |||
| 2640 | Ga0496103_0023162 | |||
| 2641 | Ga0496103_0032189 | |||
| 2642 | Ga0496103_0041712 | |||
| 2643 | Ga0496104_0000145 | |||
| 2644 | Ga0496104_0003416 | |||
| 2645 | Ga0496104_0028484 | |||
| 2646 | Ga0496104_0032850 | |||
| 2647 | Ga0496104_0035759 | |||
| 2648 | Ga0496104_0058089 | |||
| 2649 | Ga0496104_0079555 | |||
| 2650 | Ga0496104_0187124 | |||
| 2651 | Ga0496104_0253773 | |||
| 2652 | Ga0496104_0259269 | |||
| 2653 | Ga0496105_0000885 | |||
| 2654 | Ga0496105_0007490 | |||
| 2655 | Ga0496105_0036368 | |||
| 2656 | Ga0496106_0001138 | |||
| 2657 | Ga0496106_0001915 | |||
| 2658 | Ga0496106_0003383 | |||
| 2659 | Ga0496106_0013990 | |||
| 2660 | Ga0496106_0031617 | |||
| 2661 | Ga0496106_0036494 | |||
| 2662 | Ga0496106_0085303 | |||
| 2663 | Ga0496106_0142180 | |||
| 2664 | Ga0496106_0194633 | |||
| 2665 | Ga0496107_0023015 | |||
| 2666 | Ga0496107_0027845 | |||
| 2667 | Ga0496107_0034837 | |||
| 2668 | Ga0496107_0041268 | |||
| 2669 | Ga0496107_0054244 | |||
| 2670 | Ga0496107_0091734 | |||
| 2671 | Ga0496107_0184885 | |||
| 2672 | Ga0496108_0001188 | |||
| 2673 | Ga0496108_0020613 | |||
| 2674 | Ga0496108_0023512 | |||
| 2675 | Ga0496108_0025991 | |||
| 2676 | Ga0496108_0032103 | |||
| 2677 | Ga0496108_0069301 | |||
| 2678 | Ga0496108_0090582 | |||
| 2679 | Ga0496109_0002905 | |||
| 2680 | Ga0496109_0008832 | |||
| 2681 | Ga0496109_0022414 | |||
| 2682 | Ga0496109_0076241 | |||
| 2683 | Ga0496109_0145314 | |||
| 2684 | Ga0496110_0010403 | |||
| 2685 | Ga0496110_0018881 | |||
| 2686 | Ga0496110_0036936 | |||
| 2687 | Ga0496110_0048966 | |||
| 2688 | Ga0496110_0066176 | |||
| 2689 | Ga0496110_0098257 | |||
| 2690 | Ga0496111_0026941 | |||
| 2691 | Ga0496112_0000021 | |||
| 2692 | Ga0496112_0004530 | |||
| 2693 | Ga0496112_0005125 | |||
| 2694 | Ga0496112_0009718 | |||
| 2695 | Ga0496112_0037207 | |||
| 2696 | Ga0496112_0041320 | |||
| 2697 | Ga0496112_0096763 | |||
| 2698 | Ga0496113_0000443 | |||
| 2699 | Ga0496113_0014520 | |||
| 2700 | Ga0496113_0077147 | |||
| 2701 | Ga0496113_0168875 | |||
| 2702 | Ga0496113_0171316 | |||
| 2703 | Ga0496114_0039615 | |||
| 2704 | Ga0496114_0070270 | |||
| 2705 | Ga0496114_0126290 | |||
| 2706 | Ga0496115_0036380 | |||
| 2707 | Ga0496115_0047436 | |||
| 2708 | Ga0496115_0059392 | |||
| 2709 | Ga0496115_0069026 | |||
| 2710 | Ga0496115_0069973 | |||
| 2711 | Ga0496115_0087099 | |||
| 2712 | Ga0496116_0005942 | |||
| 2713 | Ga0496116_0031530 | |||
| 2714 | Ga0496117_0009884 | |||
| 2715 | Ga0496117_0019260 | |||
| 2716 | Ga0496117_0037293 | |||
| 2717 | Ga0496117_0040810 | |||
| 2718 | Ga0496117_0046786 | |||
| 2719 | Ga0496118_0008788 | |||
| 2720 | Ga0496118_0017343 | |||
| 2721 | Ga0496118_0018968 | |||
| 2722 | Ga0496118_0035969 | |||
| 2723 | Ga0496118_0044681 | |||
| 2724 | Ga0496118_0048738 | |||
| 2725 | Ga0496118_0048992 | |||
| 2726 | Ga0496118_0061981 | |||
| 2727 | Ga0496118_0085644 | |||
| 2728 | Ga0496119_0025463 | |||
| 2729 | Ga0496119_0039369 | |||
| 2730 | Ga0496120_0043875 | |||
| 2731 | Ga0496120_0049844 | |||
| 2732 | Ga0496121_0000937 | |||
| 2733 | Ga0496121_0001335 | |||
| 2734 | Ga0496121_0001474 | |||
| 2735 | Ga0496121_0005011 | |||
| 2736 | Ga0496121_0006807 | |||
| 2737 | Ga0496121_0014083 | |||
| 2738 | Ga0496121_0032778 | |||
| 2739 | Ga0496121_0050185 | |||
| 2740 | Ga0496121_0126749 | |||
| 2741 | Ga0496122_0009141 | |||
| 2742 | Ga0496122_0087346 | |||
| 2743 | Ga0496123_0030260 | |||
| 2744 | Ga0496124_0009283 | |||
| 2745 | Ga0496124_0016051 | |||
| 2746 | Ga0496124_0076615 | |||
| 2747 | Ga0496124_0110916 | |||
| 2748 | Ga0496125_0000272 | |||
| 2749 | Ga0496125_0002030 | |||
| 2750 | Ga0496125_0003504 | |||
| 2751 | Ga0496125_0018180 | |||
| 2752 | Ga0496125_0025455 | |||
| 2753 | Ga0496125_0026937 | |||
| 2754 | Ga0496125_0046822 | |||
| 2755 | Ga0496126_0003412 | |||
| 2756 | Ga0496126_0019511 | |||
| 2757 | Ga0496126_0028347 | |||
| 2758 | Ga0496126_0035325 | |||
| 2759 | Ga0496126_0082350 | |||
| 2760 | Ga0496126_0086343 | |||
| 2761 | Ga0496126_0116789 | |||
| 2762 | Ga0496126_0130985 | |||
| 2763 | Ga0496126_0136947 | |||
| 2764 | Ga0496126_0149069 | |||
| 2765 | Ga0496126_0155554 | |||
| 2766 | Ga0501031_0002472 | |||
| 2767 | Ga0501031_0002962 | |||
| 2768 | Ga0501031_0063850 | |||
| 2769 | Ga0501031_0092670 | |||
| 2770 | Ga0501032_0000129 | |||
| 2771 | Ga0501032_0009674 | |||
| 2772 | Ga0501032_0015153 | |||
| 2773 | Ga0501032_0046590 | |||
| 2774 | Ga0501032_0069472 | |||
| 2775 | Ga0501032_0100578 | |||
| 2776 | Ga0501033_0000231 | |||
| 2777 | Ga0501033_0001179 | |||
| 2778 | Ga0501033_0007704 | |||
| 2779 | Ga0501033_0043128 | |||
| 2780 | Ga0501033_0044870 | |||
| 2781 | Ga0501033_0063029 | |||
| 2782 | Ga0501033_0086288 | |||
| 2783 | Ga0501034_0000244 | |||
| 2784 | Ga0501034_0000503 | |||
| 2785 | Ga0501034_0000623 | |||
| 2786 | Ga0501034_0030155 | |||
| 2787 | Ga0501034_0038456 | |||
| 2788 | Ga0501034_0048328 | |||
| 2789 | Ga0501034_0061444 | |||
| 2790 | Ga0501034_0156444 | |||
| 2791 | Ga0501034_0220854 | |||
| 2792 | Ga0501034_0296739 | |||
| 2793 | Ga0501036_0000232 | |||
| 2794 | Ga0501036_0000402 | |||
| 2795 | Ga0501036_0004701 | |||
| 2796 | Ga0501036_0012866 | |||
| 2797 | Ga0501036_0027168 | |||
| 2798 | Ga0501036_0062995 | |||
| 2799 | Ga0501037_0000106 | |||
| 2800 | Ga0501037_0000469 | |||
| 2801 | Ga0501037_0002940 | |||
| 2802 | Ga0501037_0008241 | |||
| 2803 | Ga0501037_0029572 | |||
| 2804 | Ga0501037_0048914 | |||
| 2805 | Ga0501037_0068557 | |||
| 2806 | Ga0501037_0109445 | |||
| 2807 | Ga0501037_0116296 | |||
| 2808 | Ga0501038_0000108 | |||
| 2809 | Ga0501038_0003879 | |||
| 2810 | Ga0501038_0012290 | |||
| 2811 | Ga0501038_0016811 | |||
| 2812 | Ga0501038_0026514 | |||
| 2813 | Ga0501038_0031774 | |||
| 2814 | Ga0501038_0036193 | |||
| 2815 | Ga0501038_0084164 | |||
| 2816 | Ga0501038_0095211 | |||
| 2817 | Ga0501038_0117812 | |||
| 2818 | Ga0501038_0172773 | |||
| 2819 | Ga0501039_0000097 | |||
| 2820 | Ga0501039_0006470 | |||
| 2821 | Ga0501039_0009378 | |||
| 2822 | Ga0501039_0022376 | |||
| 2823 | Ga0501039_0069795 | |||
| 2824 | Ga0501042_0061856 | |||
| 2825 | Ga0501042_0071705 | |||
| 2826 | Ga0501042_0109477 | |||
| 2827 | Ga0501043_0000035 | |||
| 2828 | Ga0501043_0003034 | |||
| 2829 | Ga0501043_0008766 | |||
| 2830 | Ga0501043_0011207 | |||
| 2831 | Ga0501043_0015084 | |||
| 2832 | Ga0501043_0031456 | |||
| 2833 | Ga0501043_0148820 | |||
| 2834 | Ga0501046_0000235 | |||
| 2835 | Ga0501046_0000461 | |||
| 2836 | Ga0501046_0007327 | |||
| 2837 | Ga0501046_0012893 | |||
| 2838 | Ga0501046_0019760 | |||
| 2839 | Ga0501046_0038614 | |||
| 2840 | Ga0501046_0059177 | |||
| 2841 | Ga0501046_0085935 | |||
| 2842 | Ga0501047_0000010 | |||
| 2843 | Ga0501047_0000844 | |||
| 2844 | Ga0501047_0003452 | |||
| 2845 | Ga0501047_0025596 | |||
| 2846 | Ga0501047_0057189 | |||
| 2847 | Ga0501047_0063534 | |||
| 2848 | Ga0501047_0064854 | |||
| 2849 | Ga0501047_0065630 | |||
| 2850 | Ga0501047_0094805 | |||
| 2851 | Ga0501048_0000116 | |||
| 2852 | Ga0501048_0013551 | |||
| 2853 | Ga0501048_0015067 | |||
| 2854 | Ga0501048_0056723 | |||
| 2855 | Ga0501048_0076039 | |||
| 2856 | Ga0501067_0000160 | |||
| 2857 | Ga0501067_0006302 | |||
| 2858 | Ga0501068_0000014 | |||
| 2859 | Ga0501068_0007906 | |||
| 2860 | Ga0501068_0014260 | |||
| 2861 | Ga0501068_0104941 | |||
| 2862 | Ga0501069_0033327 | |||
| 2863 | Ga0501069_0037920 | |||
| 2864 | Ga0501070_0000451 | |||
| 2865 | Ga0501070_0004754 | |||
| 2866 | Ga0501070_0012598 | |||
| 2867 | Ga0501070_0014374 | |||
| 2868 | Ga0501070_0051645 | |||
| 2869 | Ga0501070_0074984 | |||
| 2870 | Ga0501070_0086861 | |||
| 2871 | Ga0501070_0099139 | |||
| 2872 | Ga0501070_0268499 | |||
| 2873 | Ga0501071_0014074 | |||
| 2874 | Ga0501071_0037786 | |||
| 2875 | Ga0501072_0022678 | |||
| 2876 | Ga0501072_0028970 | |||
| 2877 | Ga0501072_0160141 | |||
| 2878 | Ga0501073_0000417 | |||
| 2879 | Ga0501073_0019066 | |||
| 2880 | Ga0501073_0019202 | |||
| 2881 | Ga0501073_0052987 | |||
| 2882 | Ga0501073_0066237 | |||
| 2883 | Ga0501074_0002156 | |||
| 2884 | Ga0501074_0033720 | |||
| 2885 | Ga0501074_0048290 | |||
| 2886 | Ga0501074_0059532 | |||
| 2887 | Ga0501074_0059619 | |||
| 2888 | Ga0501076_0021358 | |||
| 2889 | Ga0501076_0057987 | |||
| 2890 | Ga0501076_0154162 | |||
| 2891 | Ga0501077_0035996 | |||
| 2892 | Ga0501077_0038422 | |||
| 2893 | Ga0501077_0086186 | |||
| 2894 | Ga0501079_0000261 | |||
| 2895 | Ga0501079_0004123 | |||
| 2896 | Ga0501079_0011799 | |||
| 2897 | Ga0501079_0044093 | |||
| 2898 | Ga0501080_0005080 | |||
| 2899 | Ga0501080_0011207 | |||
| 2900 | Ga0501080_0024865 | |||
| 2901 | Ga0501080_0029565 | |||
| 2902 | Ga0501080_0032855 | |||
| 2903 | Ga0501080_0358665 | |||
| 2904 | Ga0501083_0000301 | |||
| 2905 | Ga0501083_0005733 | |||
| 2906 | Ga0501083_0026608 | |||
| 2907 | Ga0501083_0027311 | |||
| 2908 | Ga0501083_0041993 | |||
| 2909 | Ga0501083_0060940 | |||
| 2910 | Ga0501083_0079206 | |||
| 2911 | Ga0501035_0000250 | |||
| 2912 | Ga0501035_0000324 | |||
| 2913 | Ga0501035_0004892 | |||
| 2914 | Ga0501035_0019527 | |||
| 2915 | Ga0501035_0030491 | |||
| 2916 | Ga0501035_0044251 | |||
| 2917 | Ga0501035_0044282 | |||
| 2918 | Ga0501035_0062463 | |||
| 2919 | Ga0501035_0115806 | |||
| 2920 | Ga0501035_0127021 | |||
| 2921 | Ga0501044_0000051 | |||
| 2922 | Ga0501044_0000084 | |||
| 2923 | Ga0501044_0014934 | |||
| 2924 | Ga0501044_0027473 | |||
| 2925 | Ga0501044_0027559 | |||
| 2926 | Ga0501044_0028210 | |||
| 2927 | Ga0501044_0035217 | |||
| 2928 | Ga0501044_0045347 | |||
| 2929 | Ga0501044_0059176 | |||
| 2930 | Ga0501044_0071417 | |||
| 2931 | Ga0501044_0152058 | |||
| 2932 | Ga0501044_0168279 | |||
| 2933 | Ga0501044_0168448 | |||
| 2934 | Ga0501044_0298128 | |||
| 2935 | Ga0501044_0368476 | |||
| 2936 | Ga0501045_0005670 | |||
| 2937 | Ga0501045_0009071 | |||
| 2938 | nmdc:mga03n38_15408_c1 | |||
| 2939 | nmdc:mga00v17_33762_c1 | |||
| 2940 | nmdc:mga00v17_68224_c1 | |||
| 2941 | nmdc:mga0yw44_29098_c1 | |||
| 2942 | nmdc:mga0yw44_29737_c1 | |||
| 2943 | nmdc:mga0yw44_47661_c1 | |||
| 2944 | nmdc:mga0yw44_56942_c1 | |||
| 2945 | nmdc:mga0k408_115377_c1 | |||
| 2946 | nmdc:mga0k408_117922_c1 | |||
| 2947 | nmdc:mga06z11_8081_c1 | |||
| 2948 | nmdc:mga07m45_8434_c1 | |||
| 2949 | nmdc:mga05p37_10373_c1 | |||
| 2950 | nmdc:mga05p37_262_c1 | |||
| 2951 | nmdc:mga05p37_45856_c1 | |||
| 2952 | nmdc:mga09592_4178_c1 | |||
| 2953 | nmdc:mga0qj67_1846_c1 | |||
| 2954 | nmdc:mga06r32_510_c1 | |||
| 2955 | nmdc:mga08y16_172_c1 | |||
| 2956 | nmdc:mga08y16_2367_c1 | |||
| 2957 | nmdc:mga0n895_106_c1 | |||
| 2958 | nmdc:mga0n895_246203_c1 | |||
| 2959 | nmdc:mga0n895_70996_c1 | |||
| 2960 | nmdc:mga0n895_77461_c1 | |||
| 2961 | nmdc:mga0rr50_197826_c1 | |||
| 2962 | nmdc:mga0rr50_4447_c1 | |||
| 2963 | nmdc:mga0a205_1025_c1 | |||
| 2964 | nmdc:mga0a205_162402_c1 | |||
| 2965 | nmdc:mga0a205_23126_c1 | |||
| 2966 | nmdc:mga0sz30_5857_c1 | |||
| 2967 | Ga0495601_0000248 | |||
| 2968 | Ga0495601_0000865 | |||
| 2969 | Ga0495601_0031943 | |||
| 2970 | Ga0495601_0050975 | |||
| 2971 | Ga0495601_0135284 | |||
| 2972 | Ga0495612_0000231 | |||
| 2973 | Ga0495612_0000709 | |||
| 2974 | Ga0495612_0004165 | |||
| 2975 | Ga0495612_0007096 | |||
| 2976 | Ga0500635_0050458 | |||
| 2977 | Ga0495595_0000902 | |||
| 2978 | Ga0495595_0004065 | |||
| 2979 | Ga0495595_0011068 | |||
| 2980 | Ga0495595_0069548 | |||
| 2981 | Ga0495595_0099018 | |||
| 2982 | Ga0495619_0000176 | |||
| 2983 | Ga0495619_0002240 | |||
| 2984 | Ga0495619_0007115 | |||
| 2985 | Ga0495619_0009240 | |||
| 2986 | Ga0495619_0009880 | |||
| 2987 | Ga0495619_0014207 | |||
| 2988 | Ga0495619_0029531 | |||
| 2989 | Ga0495619_0048181 | |||
| 2990 | Ga0500643_000032 | |||
| 2991 | Ga0500644_0000374 | |||
| 2992 | Ga0500647_0009566 | |||
| 2993 | Ga0500651_0075148 | |||
| 2994 | Ga0500651_0104052 | |||
| 2995 | Ga0500566_0000009 | |||
| 2996 | Ga0500566_0019227 | |||
| 2997 | Ga0500566_0027702 | |||
| 2998 | Ga0500566_0033322 | |||
| 2999 | Ga0500640_002642 | |||
| 3000 | Ga0500641_0006701 | |||
| 3001 | Ga0500641_0018542 | |||
| 3002 | Ga0500641_0047141 | |||
| 3003 | Ga0500650_0001452 | |||
| 3004 | Ga0500555_001483 | |||
| 3005 | Ga0500556_0000004 | |||
| 3006 | Ga0500557_000004 | |||
| 3007 | Ga0500569_005997 | |||
| 3008 | Ga0500572_000326 | |||
| 3009 | Ga0500572_000505 | |||
| 3010 | Ga0500591_009529 | |||
| 3011 | Ga0500595_000002 | |||
| 3012 | Ga0500595_000480 | |||
| 3013 | Ga0500595_000735 | |||
| 3014 | Ga0500595_006825 | |||
| 3015 | Ga0500608_013990 | |||
| 3016 | Ga0500614_000329 | |||
| 3017 | Ga0500642_0000037 | |||
| 3018 | Ga0500642_0000173 | |||
| 3019 | Ga0500642_0079889 | |||
| 3020 | Ga0500652_000725 | |||
| 3021 | Ga0500658_0029030 | |||
| 3022 | Ga0500559_0000081 | |||
| 3023 | Ga0500559_0002268 | |||
| 3024 | Ga0500559_0004441 | |||
| 3025 | Ga0500559_0025398 | |||
| 3026 | Ga0500568_0000696 | |||
| 3027 | Ga0500568_0021256 | |||
| 3028 | Ga0500568_0021446 | |||
| 3029 | Ga0500577_0005339 | |||
| 3030 | Ga0500590_071892 | |||
| 3031 | Ga0500603_000175 | |||
| 3032 | Ga0500603_000411 | |||
| 3033 | Ga0500604_0005198 | |||
| 3034 | Ga0500616_0000002 | |||
| 3035 | Ga0500616_0000014 | |||
| 3036 | Ga0500616_0000372 | |||
| 3037 | Ga0500616_0017440 | |||
| 3038 | Ga0500620_005382 | |||
| 3039 | Ga0500622_0005178 | |||
| 3040 | Ga0500622_0025897 | |||
| 3041 | Ga0500622_0033567 | |||
| 3042 | Ga0500627_0075146 | |||
| 3043 | Ga0500630_000849 | |||
| 3044 | Ga0500638_005176 | |||
| 3045 | Ga0500639_000199 | |||
| 3046 | Ga0500636_0000122 | |||
| 3047 | Ga0500636_0004899 | |||
| 3048 | Ga0500636_0030680 | |||
| 3049 | Ga0500637_0003088 | |||
| 3050 | Ga0500637_0085450 | |||
| 3051 | Ga0500625_007714 | |||
| 3052 | Ga0500645_001945 | |||
| 3053 | Ga0500609_001123 | |||
| 3054 | Ga0500601_000050 | |||
| 3055 | Ga0501084_0063797 | |||
| 3056 | Ga0501084_0067824 | |||
| 3057 | Ga0501084_0101321 | |||
| 3058 | Ga0500661_000167 | |||
| 3059 | Ga0501082_0048170 | |||
| 3060 | Ga0501082_0049463 | |||
| 3061 | Ga0501082_0074501 | |||
| 3062 | 2507508428 | |||
| 3063 | 2508542496 | |||
| 3064 | 2508691731 | |||
| 3065 | 2509150549 | |||
| 3066 | 2511394184 | |||
| 3067 | 2513625539 | |||
| 3068 | 2513644477 | |||
| 3069 | 2513645684 | |||
| 3070 | 2513658016 | |||
| 3071 | 2513676106 | |||
| 3072 | 2513692721 | |||
| 3073 | 2513701126 | |||
| 3074 | 2513717147 | |||
| 3075 | 2513855720 | |||
| 3076 | 2513872930 | |||
| 3077 | 2513893979 | |||
| 3078 | 2513919890 | |||
| 3079 | 2514013689 | |||
| 3080 | 2515627078 | |||
| 3081 | 2517107768 | |||
| 3082 | 2517892257 | |||
| 3083 | 2524437508 | |||
| 3084 | 2524465665 | |||
| 3085 | 2524540308 | |||
| 3086 | 2528852387 | |||
| 3087 | 2603859596 | |||
| 3088 | 2617347354 | |||
| 3089 | 2617375588 | |||
| 3090 | 2643756660 | |||
| 3091 | 2644288803 | |||
| 3092 | 2671120495 | |||
| 3093 | 2723844899 | |||
| 3094 | 2728747389 | |||
| 3095 | 2745076500 | |||
| 3096 | 2793065424 | |||
| 3097 | 2793072402 | |||
| 3098 | 2793082230 | |||
| 3099 | 2805915172 | |||
| 3100 | 2818238727 | |||
| 3101 | 2824608166 | |||
| 3102 | 2824610299 | |||
| 3103 | 2824617891 | |||
| 3104 | 2824634354 | |||
| 3105 | 2824643473 | |||
| 3106 | 2824649705 | |||
| 3107 | 2824661156 | |||
| 3108 | 2824669301 | |||
| 3109 | 2824678702 | |||
| 3110 | 2824685184 | |||
| 3111 | 2824695166 | |||
| 3112 | 2824701477 | |||
| 3113 | 2824709044 | |||
| 3114 | 2824722333 | |||
| 3115 | 2824731958 | |||
| 3116 | 2824735271 | |||
| 3117 | 2824752348 | |||
| 3118 | 2824761810 | |||
| 3119 | 2824770003 | |||
| 3120 | 2824780897 | |||
| 3121 | 2838123579 | |||
| 3122 | 2841946777 | |||
| 3123 | 2841949679 | |||
| 3124 | 2841958820 | |||
| 3125 | 2841971814 | |||
| 3126 | 2841974841 | |||
| 3127 | 2841983598 | |||
| 3128 | 2842038898 | |||
| 3129 | 2842048156 | |||
| 3130 | 2844319226 | |||
| 3131 | 2847936379 | |||
| 3132 | 2847946729 | |||
| 3133 | 2849079154 | |||
| 3134 | 2857514141 | |||
| 3135 | 2857528993 | |||
| 3136 | 2874598207 | |||
| 3137 | 2874605380 | |||
| 3138 | 2874615083 | |||
| 3139 | 2874627679 | |||
| 3140 | 2874632018 | |||
| 3141 | 2874652736 | |||
| 3142 | 2876764676 | |||
| 3143 | 2876778315 | |||
| 3144 | 2876809908 | |||
| 3145 | 2876825816 | |||
| 3146 | 2879082109 | |||
| 3147 | 2879090162 | |||
| 3148 | 2879105743 | |||
| 3149 | 2879110202 | |||
| 3150 | 2879135256 | |||
| 3151 | 2879150465 | |||
| 3152 | 2881368680 | |||
| 3153 | 2881673521 | |||
| 3154 | 2885373001 | |||
| 3155 | 2885381914 | |||
| 3156 | 2885389915 | |||
| 3157 | 2885411434 | |||
| 3158 | 2888384225 | |||
| 3159 | 2888393647 | |||
| 3160 | 2888424700 | |||
| 3161 | 2889039668 | |||
| 3162 | 2893070453 | |||
| 3163 | 2903731068 | |||
| 3164 | 2903749154 | |||
| 3165 | 2903776946 | |||
| 3166 | 2904673001 | |||
| 3167 | 2904694607 | |||
| 3168 | 2904702423 | |||
| 3169 | 2904714828 | |||
| 3170 | 2906607425 | |||
| 3171 | 2906618761 | |||
| 3172 | 2906629742 | |||
| 3173 | 2906638095 | |||
| 3174 | 2906649023 | |||
| 3175 | 2906666232 | |||
| 3176 | 2908742538 | |||
| 3177 | 2908760162 | |||
| 3178 | 2908780345 | |||
| 3179 | 2919076396 | |||
| 3180 | 2922365523 | |||
| 3181 | 2922374573 | |||
| 3182 | 2922391149 | |||
| 3183 | 2922400641 | |||
| 3184 | 2922430436 | |||
| 3185 | 2929618238 | |||
| 3186 | 2929632426 | |||
| 3187 | 2932790532 | |||
| 3188 | 2932799790 | |||
| 3189 | 2932806959 | |||
| 3190 | 2932810953 | |||
| 3191 | 2932823717 | |||
| 3192 | 2932830163 | |||
| 3193 | 2933580166 | |||
| 3194 | 2935609032 | |||
| 3195 | 2935622611 | |||
| 3196 | 2935631529 | |||
| 3197 | 2935642589 | |||
| 3198 | 2935653260 | |||
| 3199 | 2935660269 | |||
| 3200 | 2935668107 | |||
| 3201 | 2935676140 | |||
| 3202 | 2935686124 | |||
| 3203 | 2935701250 | |||
| 3204 | 2935705967 | |||
| 3205 | 2935714676 | |||
| 3206 | 2935725295 | |||
| 3207 | 2935732345 | |||
| 3208 | 2935741724 | |||
| 3209 | 2935752089 | |||
| 3210 | 2935766437 | |||
| 3211 | 2935771885 | |||
| 3212 | 2935778683 | |||
| 3213 | 2935788931 | |||
| 3214 | 2935795269 | |||
| 3215 | 2935802966 | |||
| 3216 | 2935814283 | |||
| 3217 | 2935822192 | |||
| 3218 | 2935831420 | |||
| 3219 | 2935838280 | |||
| 3220 | 2935847774 | |||
| 3221 | 2935860860 | |||
| 3222 | 2935869803 | |||
| 3223 | 2935878778 | |||
| 3224 | 2935886917 | |||
| 3225 | 2935908954 | |||
| 3226 | 2935919672 | |||
| 3227 | 2935926472 | |||
| 3228 | 2935934922 | |||
| 3229 | 2935943372 | |||
| 3230 | 2935951810 | |||
| 3231 | 2935960571 | |||
| 3232 | 2935967935 | |||
| 3233 | 2935978560 | |||
| 3234 | 2935987587 | |||
| 3235 | 2935994826 | |||
| 3236 | 2936003468 | |||
| 3237 | 2936016130 | |||
| 3238 | 2936024763 | |||
| 3239 | 2936032011 | |||
| 3240 | 2936039839 | |||
| 3241 | 2936049872 | |||
| 3242 | 2936060824 | |||
| 3243 | 2940557108 | |||
| 3244 | 2941511323 | |||
| 3245 | 2941519024 | |||
| 3246 | 2941526396 | |||
| 3247 | 2941532982 | |||
| 3248 | 2941539052 | |||
| 3249 | 3005480351 | |||
| 3250 | 3005484476 | |||
| 3251 | 3005510490 | |||
| 3252 | 3005587884 | |||
| 3253 | 3005599396 | |||
| 3254 | 3005715058 | |||
| 3255 | 3005722471 | |||
| 3256 | 8006931877 | |||
| 3257 | 8006940524 | |||
| 3258 | 8006967151 | |||
| 3259 | 8006980212 | |||
| 3260 | 8006986569 | |||
| 3261 | 8006995847 | |||
| 3262 | 8016529457 | |||
| 3263 | 8016547886 | |||
| 3264 | 8016554247 | |||
| 3265 | 8016562620 | |||
| 3266 | 8016577164 | |||
| 3267 | 8016591572 | |||
| 3268 | 8016600406 | |||
| 3269 | 8016610332 | |||
| 3270 | 8016614598 | |||
| 3271 | 8016626401 | |||
| 3272 | 8016640160 | |||
| 3273 | 8017063521 | |||
| 3274 | 8019534433 | |||
| 3275 | 8019545036 | |||
| 3276 | 8019553490 | |||
| 3277 | 8019556597 | |||
| 3278 | 8019568711 | |||
| 3279 | 8019582841 | |||
| 3280 | 8019590635 | |||
| 3281 | 8019600718 | |||
| 3282 | 8019617831 | |||
| 3283 | 8019628343 | |||
| 3284 | 8019634286 | |||
| 3285 | 8019645449 | |||
| 3286 | 8019658563 | |||
| 3287 | 8019662160 | |||
| 3288 | 8019671677 | |||
| 3289 | 8019690233 | |||
| 3290 | 8055746173 | |||
| 3291 | 8056673685 | |||
| 3292 | 8056686776 | |||
| 3293 | 8056691366 | |||
| 3294 | 8056968187 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dyk-assembly2.cif.gz_B | crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 | 0.87 | 3 | 164 |
| 5x4b-assembly2.cif.gz_B | crystal structure of n-terminal g-domain of enga from bacillus subtilis | 0.8688 | 1 | 163 |
| 5x4b-assembly2.cif.gz_B | crystal structure of n-terminal g-domain of enga from bacillus subtilis | 0.8632 | 1 | 163 |
| 2dyk-assembly2.cif.gz_B | crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 | 0.8592 | 3 | 164 |
| 5x4b-assembly1.cif.gz_A | crystal structure of n-terminal g-domain of enga from bacillus subtilis | 0.8581 | 2 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LQJ5_519_603_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9432 | 355 | 437 | 3.30.300.20 |
| af_P9WNL3_375_455_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9416 | 355 | 437 | 3.30.300.20 |
| af_O77338_818_899_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9414 | 356 | 437 | 3.30.300.20 |
| af_A0A144A297_839_927_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9388 | 351 | 438 | 3.30.300.20 |
| af_P0A6P5_373_459_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9321 | 350 | 436 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1UIS5-F1-model_v4 | deleted | 0.9545 | 338 | 437 |
|
| AF-A0A357LK53-F1-model_v4 | Ribosome biogenesis GTPase Der | 0.9452 | 306 | 441 |
|
| AF-A0A257XFX5-F1-model_v4 | Ribosome biogenesis GTPase Der | 0.9443 | 247 | 441 |
GO:0003924
GO:0005525 |
| AF-A0A519NRY1-F1-model_v4 | Ribosome biogenesis GTPase Der | 0.9404 | 321 | 441 |
|
| AF-A0A3D2W2N3-F1-model_v4 | Ribosome biogenesis GTPase Der | 0.9353 | 312 | 441 |
|