F495192

General Info

Members Datasets Scaffolds Average Seq Length
1648 736 3296 588

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10007030|Ga0099794_100070304
Length 659
Sequence MMSEADAAGRLAEPGLDLGATPAPRGAGYRVLARKYRPAAFEDLIGQEAMVRTLSNAFEAGRIPQAWILTGVRGVGKTTTARILARGLNYELPDGSIHAPTIRMPVLGVHCAAIMESRHMDVLEMDAASHNGVDDIRQINDAVRYAPVNARYKVYILDEVHMLSNQAFNALLKTLEEPPPHAKFIFATTEIREVPITVLSRCQRFDLRRVESDRLVSHLEGILAKEKVAAEPEALALIARAAEGSVRDSLSLLDQAISHAAGSVRAEDVRAMLGLADHSRIVELFDALMRGDITHALGELRDQYDSGADPLVVLTELAAFTHFVTRVKIVPAVAEDRALAEIERKRGRDFAAGLSMRVLSRTWQMLLKGIAEVKEAARPVAAAEMVLVRIAYAADLPSPDDVIRSLGDASQRPAAAPARPSVPSPSALAGEDRVETRPLGATPPRSFTNPPPPTEKGRAGEGREGARTSXRQALAPSXXXXMRDPVSRSAVTPAAAQLPTFARFSDLIAFVGAQRDLQLRAILERDVRLVRFEDGKLEIALEPTASRALIGDLGRRLAALTGRRWMVAVSAEAGEPTVRSQLDARREEFKRGLQAHPVVQRVLARFPGAEIVAVRQPEPEPAQPVAAVDDDELPPEMPIDDGGSAFGAHGRPDDVDDDL

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
121 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
153 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
154 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
155 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
156 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
234 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
236 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
237 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
247 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
248 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
249 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
250 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
251 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
252 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
253 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
254 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
258 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
259 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
260 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
261 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
262 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
265 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
266 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
267 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
270 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
271 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
275 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
278 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
279 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
280 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
281 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
282 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
289 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
290 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
291 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
292 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
293 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
294 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
309 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
321 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
324 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
325 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
379 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
396 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
397 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
398 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
399 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
400 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
439 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
440 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
441 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
442 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
445 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
446 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
447 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
448 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
449 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
450 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
451 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
459 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
464 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
465 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
466 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
467 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
468 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
469 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
470 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
471 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
472 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
475 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
476 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
477 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
478 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
479 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
480 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
481 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
482 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
485 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
488 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
489 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
490 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
491 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
492 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
493 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
494 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
495 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
496 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
497 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
498 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
499 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
500 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
501 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
502 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
503 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
504 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
505 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
506 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
507 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
508 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
509 2508501050 Microvirga lupini Lut6 Isolate Nodule
510 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
511 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
512 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
513 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
514 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
515 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
516 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
517 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
518 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
519 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
520 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
521 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
522 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
523 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
524 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
525 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
526 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
527 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
528 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
529 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
530 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
531 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
532 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
533 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
534 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
535 2643221651 Afipia sp. Root123D2 Isolate Unclassified
536 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
537 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
538 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
539 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
540 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
541 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
542 2773857925 Microvirga vignae BR3299 Isolate Unclassified
543 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
544 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
545 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
546 2791355199
547 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
548 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
549 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
550 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
551 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
552 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
553 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
554 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
555 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
556 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
557 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
558 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
559 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
560 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
561 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
562 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
563 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
564 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
565 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
566 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
567 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
568 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
569 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
570 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
571 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
572 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
573 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
574 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
575 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
576 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
577 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
578 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
579 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
580 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
581 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
582 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
583 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
584 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
585 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
586 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
587 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
588 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
589 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
590 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
591 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
592 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
593 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
594 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
595 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
596 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
597 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
598 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
599 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
600 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
601 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
602 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
603 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
604 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
605 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
606 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
607 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
608 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
609 2904699407
610 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
611 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
612 2906610324
613 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
614 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
615 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
616 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
617 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
618 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
619 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
620 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
621 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
622 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
623 2922368715
624 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
625 2922425934
626 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
627 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
628 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
629 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
630 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
631 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
632 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
633 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
634 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
635 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
636 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
637 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
638 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
639 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
640 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
641 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
642 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
643 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
644 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
645 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
646 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
647 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
648 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
649 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
650 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
651 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
652 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
653 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
654 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
655 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
656 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
657 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
658 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
659 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
660 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
661 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
662 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
663 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
664 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
665 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
666 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
667 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
668 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
669 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
670 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
671 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
672 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
673 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
674 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
675 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
676 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
677 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
678 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
679 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
680 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
681 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
682 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
683 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
684 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
685 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
686 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
687 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
688 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
689 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
690 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
691 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
692 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
693 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
694 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
695 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
696 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
697 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
698 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
699 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
700 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
701 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
702 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
703 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
704 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
705 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
706 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
707 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
708 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
709 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
710 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
711 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
712 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
713 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
714 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
715 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
716 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
717 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
718 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
719 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
720 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
721 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
722 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
723 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
724 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
725 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
726 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
727 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
728 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
729 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
730 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
731 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
732 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
733 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
734 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
735 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
736 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.24
Metatranscriptomes 0
Isolates 13.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.7
Nodule 10.74
Rhizoplane 5.16
Rhizosphere 71.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10007030 3300007265 Bacteria 4595
2 2214544925 2209111006 Bacteria 18798
3 ARSoilYngRDRAFT_c00196 3300000042 Bacteria 10143
4 ARcpr5yngRDRAFT_c000115 3300000043 Bacteria 12589
5 ARSoilOldRDRAFT_c000011 3300000044 Bacteria 42914
6 ARCol0oldRDRAFT_c00183 3300000045 Bacteria 5726
7 ARCol0yngRDRAFT_1000146 3300000652 Bacteria 12593
8 JGI24746J21847_1001493 3300001977 Bacteria 3720
9 JGI24739J22299_10000724 3300001989 Bacteria 11949
10 JGI24737J22298_10017327 3300001990 Bacteria 2321
11 JGI24743J22301_10000145 3300001991 Bacteria 7176
12 JGI24750J21931_1000096 3300002070 Bacteria 13445
13 JGI24750J21931_1000628 3300002070 Bacteria 5302
14 JGI24745J21846_1000468 3300002073 Bacteria 3588
15 JGI24034J26672_10000231 3300002239 Bacteria 7381
16 JGI24742J22300_10000137 3300002244 Bacteria 10780
17 JGI24742J22300_10000225 3300002244 Bacteria 8423
18 JGI24751J29686_10005184 3300002459 Bacteria 2652
19 JGI25406J46586_10002038 3300003203 Bacteria 9531
20 JGI25406J46586_10006723 3300003203 Bacteria 5284
21 JGI25153J46596_10005134 3300003215 Bacteria 6902
22 JGI25153J46596_10008913 3300003215 Bacteria 4734
23 JGI25160J50197_1010421 3300003354 Bacteria 3364
24 Ga0055524_1010431 3300003775 Bacteria 3698
25 Ga0055531_10001561 3300003794 Bacteria 16764
26 Ga0055543_1005034 3300004625 Bacteria 3448
27 Ga0065165_1004017 3300005262 Bacteria 9596
28 Ga0065165_1016982 3300005262 Bacteria 2700
29 Ga0065712_10002828 3300005290 Bacteria 4139
30 Ga0065712_10104129 3300005290 Bacteria 1968
31 Ga0065715_10001079 3300005293 Bacteria 7146
32 Ga0065715_10106350 3300005293 Bacteria 2835
33 Ga0070676_10000506 3300005328 Bacteria 18658
34 Ga0070683_100009453 3300005329 Bacteria 8336
35 Ga0070683_100029992 3300005329 Bacteria 4932
36 Ga0070683_100098852 3300005329 Bacteria 2746
37 Ga0070690_100002629 3300005330 Bacteria 9678
38 Ga0070690_100006878 3300005330 Bacteria 6471
39 Ga0070690_100061831 3300005330 Bacteria 2414
40 Ga0070690_100066516 3300005330 Bacteria 2333
41 Ga0070670_100023715 3300005331 Bacteria 5280
42 Ga0070677_10000227 3300005333 Bacteria 19393
43 Ga0068869_100001832 3300005334 Bacteria 12767
44 Ga0068869_100062645 3300005334 Bacteria 2730
45 Ga0070666_10005187 3300005335 Bacteria 7977
46 Ga0070680_100003424 3300005336 Bacteria 11842
47 Ga0070680_100039841 3300005336 Bacteria 3801
48 Ga0070680_100048147 3300005336 Bacteria 3474
49 Ga0070680_100067147 3300005336 Bacteria 2941
50 Ga0070680_100123735 3300005336 Bacteria 2160
51 Ga0070680_100124176 3300005336 Bacteria 2156
52 Ga0070682_100001699 3300005337 Bacteria 12232
53 Ga0070682_100012002 3300005337 Bacteria 4956
54 Ga0070682_100066044 3300005337 Bacteria 2300
55 Ga0068868_100003128 3300005338 Bacteria 11515
56 Ga0068868_100007757 3300005338 Bacteria 7659
57 Ga0068868_100089723 3300005338 Bacteria 2475
58 Ga0070660_100044302 3300005339 Bacteria 3402
59 Ga0070660_100078764 3300005339 Bacteria 2584
60 Ga0070689_100000668 3300005340 Bacteria 20748
61 Ga0070689_100001841 3300005340 Bacteria 13666
62 Ga0070689_100002942 3300005340 Bacteria 11202
63 Ga0070689_100015324 3300005340 Bacteria 5587
64 Ga0070689_100065179 3300005340 Bacteria 2836
65 Ga0070691_10020196 3300005341 Bacteria 3076
66 Ga0070691_10050495 3300005341 Bacteria 1984
67 Ga0070687_100000527 3300005343 Bacteria 12848
68 Ga0070661_100003238 3300005344 Bacteria 11222
69 Ga0070692_10010704 3300005345 Bacteria 4187
70 Ga0070692_10055383 3300005345 Bacteria 2073
71 Ga0070668_100003117 3300005347 Bacteria 12247
72 Ga0070669_100001315 3300005353 Bacteria 17944
73 Ga0070669_100072348 3300005353 Bacteria 2552
74 Ga0070669_100114625 3300005353 Bacteria 2049
75 Ga0070675_100002954 3300005354 Bacteria 12826
76 Ga0070675_100037764 3300005354 Bacteria 3936
77 Ga0070675_100040190 3300005354 Bacteria 3817
78 Ga0070675_100142502 3300005354 Bacteria 2049
79 Ga0070671_100005343 3300005355 Bacteria 10241
80 Ga0070671_100006990 3300005355 Bacteria 9041
81 Ga0070671_100012266 3300005355 Bacteria 6896
82 Ga0070671_100024307 3300005355 Bacteria 4959
83 Ga0070671_100032237 3300005355 Bacteria 4333
84 Ga0070671_100033261 3300005355 Bacteria 4263
85 Ga0070674_100002968 3300005356 Bacteria 9419
86 Ga0070674_100025125 3300005356 Bacteria 3874
87 Ga0070673_100010750 3300005364 Bacteria 6210
88 Ga0070673_100015906 3300005364 Bacteria 5300
89 Ga0070673_100034527 3300005364 Bacteria 3828
90 Ga0070688_100001124 3300005365 Bacteria 13400
91 Ga0070688_100001239 3300005365 Bacteria 12735
92 Ga0070688_100034220 3300005365 Bacteria 3075
93 Ga0070688_100050115 3300005365 Bacteria 2600
94 Ga0070659_100002622 3300005366 Bacteria 12786
95 Ga0070659_100015601 3300005366 Bacteria 5690
96 Ga0070659_100019333 3300005366 Bacteria 5160
97 Ga0070667_100005188 3300005367 Bacteria 10886
98 Ga0070703_10016096 3300005406 Bacteria 2144
99 Ga0070709_10002507 3300005434 Bacteria 9940
100 Ga0070709_10009423 3300005434 Bacteria 5386
101 Ga0070709_10012754 3300005434 Bacteria 4710
102 Ga0070709_10026735 3300005434 Bacteria 3423
103 Ga0070709_10054804 3300005434 Bacteria 2515
104 Ga0070714_100009155 3300005435 Bacteria 7772
105 Ga0070714_100028781 3300005435 Bacteria 4613
106 Ga0070714_100051704 3300005435 Bacteria 3504
107 Ga0070714_100073185 3300005435 Bacteria 2968
108 Ga0070714_100082668 3300005435 Bacteria 2798
109 Ga0070710_10000903 3300005437 Bacteria 14219
110 Ga0070710_10004937 3300005437 Bacteria 6308
111 Ga0070710_10020747 3300005437 Bacteria 3413
112 Ga0070710_10036876 3300005437 Bacteria 2675
113 Ga0070701_10007244 3300005438 Bacteria 4723
114 Ga0070701_10053875 3300005438 Bacteria 2095
115 Ga0070711_100012263 3300005439 Bacteria 5348
116 Ga0070711_100017211 3300005439 Bacteria 4599
117 Ga0070711_100025613 3300005439 Bacteria 3861
118 Ga0070711_100035725 3300005439 Bacteria 3325
119 Ga0070711_100045660 3300005439 Bacteria 2981
120 Ga0070705_100001458 3300005440 Bacteria 12507
121 Ga0070700_100001211 3300005441 Bacteria 12787
122 Ga0070700_100010023 3300005441 Bacteria 5217
123 Ga0070700_100017124 3300005441 Bacteria 4138
124 Ga0070694_100001764 3300005444 Bacteria 12786
125 Ga0070663_100000761 3300005455 Bacteria 17492
126 Ga0070663_100009537 3300005455 Bacteria 6014
127 Ga0070663_100018311 3300005455 Bacteria 4589
128 Ga0070663_100024383 3300005455 Bacteria 4071
129 Ga0070678_100000525 3300005456 Bacteria 18583
130 Ga0070678_100029237 3300005456 Bacteria 3771
131 Ga0070678_100075040 3300005456 Bacteria 2543
132 Ga0070662_100002656 3300005457 Bacteria 11031
133 Ga0070662_100070763 3300005457 Bacteria 2570
134 Ga0070662_100071322 3300005457 Bacteria 2561
135 Ga0070662_100077875 3300005457 Bacteria 2461
136 Ga0070681_10004977 3300005458 Bacteria 12786
137 Ga0070681_10037132 3300005458 Bacteria 4889
138 Ga0070681_10120278 3300005458 Bacteria 2561
139 Ga0070681_10124495 3300005458 Bacteria 2510
140 Ga0070681_10145457 3300005458 Bacteria 2299
141 Ga0068867_100002950 3300005459 Bacteria 11984
142 Ga0070685_10004716 3300005466 Bacteria 6899
143 Ga0070685_10011159 3300005466 Bacteria 4696
144 Ga0070699_100057122 3300005518 Bacteria 3380
145 Ga0070679_100007748 3300005530 Bacteria 10056
146 Ga0070679_100010782 3300005530 Bacteria 8677
147 Ga0070679_100022232 3300005530 Bacteria 6198
148 Ga0070679_100058286 3300005530 Bacteria 3848
149 Ga0070679_100065645 3300005530 Bacteria 3617
150 Ga0070679_100148160 3300005530 Bacteria 2324
151 Ga0070684_100005941 3300005535 Bacteria 9401
152 Ga0070684_100056781 3300005535 Bacteria 3417
153 Ga0070684_100086347 3300005535 Bacteria 2784
154 Ga0070684_100169813 3300005535 Bacteria 1981
155 Ga0070697_100034721 3300005536 Bacteria 4067
156 Ga0068853_100003070 3300005539 Bacteria 12759
157 Ga0068853_100049207 3300005539 Bacteria 3622
158 Ga0068853_100056561 3300005539 Bacteria 3383
159 Ga0068853_100059817 3300005539 Bacteria 3291
160 Ga0068853_100069156 3300005539 Bacteria 3071
161 Ga0068853_100165439 3300005539 Bacteria 1998
162 Ga0070672_100002960 3300005543 Bacteria 10932
163 Ga0070672_100062100 3300005543 Bacteria 2947
164 Ga0070672_100103387 3300005543 Bacteria 2313
165 Ga0070686_100001573 3300005544 Bacteria 12811
166 Ga0070686_100008515 3300005544 Bacteria 5746
167 Ga0070695_100002369 3300005545 Bacteria 10826
168 Ga0070696_100031689 3300005546 Bacteria 3624
169 Ga0070693_100000880 3300005547 Bacteria 13363
170 Ga0070693_100037923 3300005547 Bacteria 2690
171 Ga0070693_100055925 3300005547 Bacteria 2275
172 Ga0070665_100055045 3300005548 Bacteria 3990
173 Ga0070665_100080377 3300005548 Bacteria 3265
174 Ga0070665_100155774 3300005548 Bacteria 2286
175 Ga0070665_100201318 3300005548 Bacteria 1992
176 Ga0070704_100001917 3300005549 Bacteria 11493
177 Ga0068855_100009051 3300005563 Bacteria 12031
178 Ga0068855_100019978 3300005563 Bacteria 8045
179 Ga0068855_100048708 3300005563 Bacteria 5000
180 Ga0068855_100083697 3300005563 Bacteria 3695
181 Ga0070664_100002660 3300005564 Bacteria 14408
182 Ga0070664_100002934 3300005564 Bacteria 13792
183 Ga0070664_100022881 3300005564 Bacteria 5155
184 Ga0068857_100000358 3300005577 Bacteria 31869
185 Ga0068857_100034853 3300005577 Bacteria 4453
186 Ga0068857_100049440 3300005577 Bacteria 3730
187 Ga0068854_100007075 3300005578 Bacteria 7161
188 Ga0068854_100031509 3300005578 Bacteria 3685
189 Ga0068854_100047206 3300005578 Bacteria 3068
190 Ga0068854_100102802 3300005578 Bacteria 2144
191 Ga0068856_100003436 3300005614 Bacteria 16012
192 Ga0068856_100015293 3300005614 Bacteria 7415
193 Ga0068856_100094517 3300005614 Bacteria 2976
194 Ga0070702_100000526 3300005615 Bacteria 13792
195 Ga0070702_100003230 3300005615 Bacteria 7253
196 Ga0070702_100011165 3300005615 Bacteria 4460
197 Ga0068852_100009893 3300005616 Bacteria 7097
198 Ga0068852_100061935 3300005616 Bacteria 3252
199 Ga0068859_100005591 3300005617 Bacteria 12805
200 Ga0068859_100027680 3300005617 Bacteria 5685
201 Ga0068864_100001988 3300005618 Bacteria 16835
202 Ga0068866_10000916 3300005718 Bacteria 12945
203 Ga0068861_100001805 3300005719 Bacteria 13785
204 Ga0068861_100140817 3300005719 Bacteria 1968
205 Ga0068851_10013003 3300005834 Bacteria 3934
206 Ga0068851_10047779 3300005834 Bacteria 2168
207 Ga0068870_10000025 3300005840 Bacteria 46848
208 Ga0068863_100115350 3300005841 Bacteria 2559
209 Ga0068863_100166408 3300005841 Bacteria 2114
210 Ga0068858_100003227 3300005842 Bacteria 16273
211 Ga0068858_100027064 3300005842 Bacteria 5326
212 Ga0068860_100007120 3300005843 Bacteria 11192
213 Ga0068860_100008962 3300005843 Bacteria 9967
214 Ga0068860_100135000 3300005843 Bacteria 2369
215 Ga0068862_100011988 3300005844 Bacteria 7161
216 Ga0068862_100017821 3300005844 Bacteria 5912
217 Ga0068862_100145990 3300005844 Bacteria 2102
218 Ga0068862_100153724 3300005844 Bacteria 2049
219 Ga0081455_10000276 3300005937 Bacteria 68055
220 Ga0081455_10002463 3300005937 Bacteria 22024
221 Ga0081455_10005910 3300005937 Bacteria 13278
222 Ga0081455_10020788 3300005937 Bacteria 6170
223 Ga0081455_10050490 3300005937 Bacteria 3577
224 Ga0081455_10051347 3300005937 Bacteria 3538
225 Ga0081455_10062051 3300005937 Bacteria 3143
226 Ga0081538_10006470 3300005981 Bacteria 10310
227 Ga0081538_10012206 3300005981 Bacteria 6901
228 Ga0081540_1000075 3300005983 Bacteria 106804
229 Ga0081540_1004394 3300005983 Bacteria 10776
230 Ga0081540_1004944 3300005983 Bacteria 10022
231 Ga0081540_1020408 3300005983 Bacteria 3986
232 Ga0081540_1021191 3300005983 Bacteria 3881
233 Ga0081540_1030810 3300005983 Bacteria 2964
234 Ga0081540_1038950 3300005983 Bacteria 2497
235 Ga0081539_10000040 3300005985 Bacteria 292753
236 Ga0081539_10001975 3300005985 Bacteria 31233
237 Ga0081539_10016429 3300005985 Bacteria 5287
238 Ga0070717_10006939 3300006028 Bacteria 8369
239 Ga0070717_10028486 3300006028 Bacteria 4472
240 Ga0070717_10049387 3300006028 Bacteria 3453
241 Ga0075365_10004228 3300006038 Bacteria 7568
242 Ga0075365_10065035 3300006038 Bacteria 2444
243 Ga0075368_10018327 3300006042 Bacteria 2630
244 Ga0075363_100016540 3300006048 Bacteria 3644
245 Ga0075363_100026212 3300006048 Bacteria 2980
246 Ga0075364_10014353 3300006051 Bacteria 4894
247 Ga0070715_10001500 3300006163 Bacteria 6813
248 Ga0070715_10011258 3300006163 Bacteria 3217
249 Ga0070712_100001447 3300006175 Bacteria 14474
250 Ga0070712_100002943 3300006175 Bacteria 10550
251 Ga0070712_100016890 3300006175 Bacteria 4719
252 Ga0070712_100044119 3300006175 Bacteria 3073
253 Ga0075362_10003665 3300006177 Bacteria 5420
254 Ga0075367_10004928 3300006178 Bacteria 6578
255 Ga0075367_10044929 3300006178 Bacteria 2591
256 Ga0097621_100000456 3300006237 Bacteria 28666
257 Ga0097621_100037561 3300006237 Bacteria 3882
258 Ga0075370_10043991 3300006353 Bacteria 2524
259 Ga0068871_100000269 3300006358 Bacteria 35773
260 Ga0068871_100049393 3300006358 Bacteria 3400
261 Ga0075428_100000690 3300006844 Bacteria 34808
262 Ga0075428_100013445 3300006844 Bacteria 9108
263 Ga0075428_100024912 3300006844 Bacteria 6618
264 Ga0075428_100116778 3300006844 Bacteria 2906
265 Ga0075430_100000092 3300006846 Bacteria 52226
266 Ga0075430_100000094 3300006846 Bacteria 52204
267 Ga0075430_100069749 3300006846 Bacteria 2948
268 Ga0075431_100002169 3300006847 Bacteria 18764
269 Ga0075431_100004121 3300006847 Bacteria 14193
270 Ga0075431_100102463 3300006847 Bacteria 2954
271 Ga0075433_10001242 3300006852 Bacteria 18605
272 Ga0075433_10079040 3300006852 Bacteria 2898
273 Ga0075434_100000299 3300006871 Bacteria 35320
274 Ga0075434_100011399 3300006871 Bacteria 8385
275 Ga0075434_100029399 3300006871 Bacteria 5406
276 Ga0075434_100155179 3300006871 Bacteria 2309
277 Ga0075429_100002930 3300006880 Bacteria 14473
278 Ga0075429_100022441 3300006880 Bacteria 5473
279 Ga0075429_100057386 3300006880 Bacteria 3390
280 Ga0068865_100001731 3300006881 Bacteria 12818
281 Ga0068865_100025293 3300006881 Bacteria 3903
282 Ga0068865_100063086 3300006881 Bacteria 2603
283 Ga0075436_100009525 3300006914 Bacteria 6646
284 Ga0097620_100005590 3300006931 Bacteria 12805
285 Ga0097620_100027680 3300006931 Bacteria 5685
286 Ga0099824_1005597 3300006942 Bacteria 17628
287 Ga0099822_1029915 3300006943 Bacteria 4178
288 Ga0075435_100004453 3300007076 Bacteria 9627
289 Ga0075435_100018551 3300007076 Bacteria 5295
290 Ga0075435_100068134 3300007076 Bacteria 2898
291 Ga0105251_10011399 3300009011 Bacteria 5081
292 Ga0105240_10004679 3300009093 Bacteria 20687
293 Ga0105240_10030589 3300009093 Bacteria 6995
294 Ga0105240_10049444 3300009093 Bacteria 5306
295 Ga0105240_10150088 3300009093 Bacteria 2777
296 Ga0111539_10003217 3300009094 Bacteria 21607
297 Ga0111539_10003331 3300009094 Bacteria 21223
298 Ga0111539_10007321 3300009094 Bacteria 14133
299 Ga0111539_10014441 3300009094 Bacteria 9855
300 Ga0111539_10018158 3300009094 Bacteria 8712
301 Ga0111539_10173984 3300009094 Bacteria 2515
302 Ga0111539_10239665 3300009094 Bacteria 2111
303 Ga0105245_10000183 3300009098 Bacteria 59105
304 Ga0105245_10000837 3300009098 Bacteria 28055
305 Ga0105245_10068437 3300009098 Bacteria 3217
306 Ga0105245_10074891 3300009098 Bacteria 3081
307 Ga0105247_10028634 3300009101 Bacteria 3371
308 Ga0105247_10065605 3300009101 Bacteria 2259
309 Ga0114129_10001218 3300009147 Bacteria 34180
310 Ga0114129_10002246 3300009147 Bacteria 26676
311 Ga0114129_10020755 3300009147 Bacteria 9335
312 Ga0114129_10060727 3300009147 Bacteria 5285
313 Ga0114129_10077847 3300009147 Bacteria 4612
314 Ga0105243_10001561 3300009148 Bacteria 20018
315 Ga0105243_10011635 3300009148 Bacteria 6656
316 Ga0105243_10037604 3300009148 Bacteria 3763
317 Ga0105243_10038555 3300009148 Bacteria 3721
318 Ga0105243_10056281 3300009148 Bacteria 3127
319 Ga0105241_10003567 3300009174 Bacteria 11569
320 Ga0105241_10017304 3300009174 Bacteria 5294
321 Ga0105241_10027426 3300009174 Bacteria 4242
322 Ga0105242_10000701 3300009176 Bacteria 26184
323 Ga0105242_10012638 3300009176 Bacteria 6501
324 Ga0105242_10023312 3300009176 Bacteria 4878
325 Ga0105248_10006263 3300009177 Bacteria 13046
326 Ga0105248_10011058 3300009177 Bacteria 9953
327 Ga0105248_10072442 3300009177 Bacteria 3872
328 Ga0105248_10156269 3300009177 Bacteria 2574
329 Ga0105237_10088204 3300009545 Bacteria 3091
330 Ga0105237_10118300 3300009545 Bacteria 2643
331 Ga0105237_10128712 3300009545 Bacteria 2526
332 Ga0105237_10144832 3300009545 Bacteria 2371
333 Ga0105238_10002649 3300009551 Bacteria 17824
334 Ga0105238_10048497 3300009551 Bacteria 4280
335 Ga0105238_10127490 3300009551 Bacteria 2523
336 Ga0105249_10009795 3300009553 Bacteria 8397
337 Ga0105249_10121261 3300009553 Bacteria 2485
338 Ga0105239_10007315 3300010375 Bacteria 12675
339 Ga0105239_10036529 3300010375 Bacteria 5394
340 Ga0105239_10174368 3300010375 Bacteria 2405
341 Ga0105246_10002447 3300011119 Bacteria 11209
342 Ga0105246_10044208 3300011119 Bacteria 3026
343 Ga0157373_10001725 3300013100 Bacteria 16609
344 Ga0157373_10004265 3300013100 Bacteria 10768
345 Ga0157373_10098846 3300013100 Bacteria 2054
346 Ga0157371_10004441 3300013102 Bacteria 12242
347 Ga0157370_10040794 3300013104 Bacteria 4481
348 Ga0157370_10062026 3300013104 Bacteria 3546
349 Ga0157370_10072847 3300013104 Bacteria 3241
350 Ga0157370_10093233 3300013104 Bacteria 2826
351 Ga0157370_10151965 3300013104 Bacteria 2154
352 Ga0157369_10164915 3300013105 Bacteria 2337
353 Ga0157374_10000463 3300013296 Bacteria 36848
354 Ga0157374_10029135 3300013296 Bacteria 4995
355 Ga0157374_10038879 3300013296 Bacteria 4376
356 Ga0157378_10000613 3300013297 Bacteria 33512
357 Ga0157378_10005022 3300013297 Bacteria 11616
358 Ga0163162_10005908 3300013306 Bacteria 11842
359 Ga0163162_10105052 3300013306 Bacteria 2919
360 Ga0157375_10004786 3300013308 Bacteria 11768
361 Ga0157375_10148713 3300013308 Bacteria 2476
362 Ga0163163_10001239 3300014325 Bacteria 21547
363 Ga0163163_10015456 3300014325 Bacteria 7058
364 Ga0163163_10064891 3300014325 Bacteria 3624
365 Ga0163163_10109370 3300014325 Bacteria 2791
366 Ga0157380_10005539 3300014326 Bacteria 8827
367 Ga0157380_10007021 3300014326 Bacteria 7969
368 Ga0157379_10003902 3300014968 Bacteria 12714
369 Ga0157379_10004696 3300014968 Bacteria 11727
370 Ga0157379_10010527 3300014968 Bacteria 8062
371 Ga0157376_10004121 3300014969 Bacteria 10068
372 Ga0183365_10005 3300015684 Bacteria 249619
373 Ga0163161_10001492 3300017792 Bacteria 17279
374 Ga0163161_10016341 3300017792 Bacteria 5180
375 Ga0214544_1000007 3300021320 Bacteria 379989
376 Ga0214542_1000007 3300021321 Bacteria 291816
377 Ga0214545_1000006 3300021324 Bacteria 291693
378 Ga0214543_1000009 3300021327 Bacteria 384302
379 Ga0213873_10004647 3300021358 Bacteria 2579
380 Ga0213876_10011819 3300021384 Bacteria 4655
381 Ga0213876_10026411 3300021384 Bacteria 3062
382 Ga0213875_10000011 3300021388 Bacteria 332447
383 Ga0209563_100836 3300025230 Bacteria 9161
384 Ga0209677_100870 3300025253 Bacteria 14853
385 Ga0209677_103014 3300025253 Bacteria 5807
386 Ga0209148_1000819 3300025254 Bacteria 22428
387 Ga0209148_1003093 3300025254 Bacteria 4874
388 Ga0209233_1002233 3300025261 Bacteria 7245
389 Ga0209233_1002460 3300025261 Bacteria 6799
390 Ga0209673_1021407 3300025273 Bacteria 2261
391 Ga0207673_1000039 3300025290 Bacteria 10384
392 Ga0209564_1000842 3300025295 Bacteria 41342
393 Ga0209564_1004040 3300025295 Bacteria 9261
394 Ga0209758_1000015 3300025297 Bacteria 851943
395 Ga0209758_1000161 3300025297 Bacteria 154278
396 Ga0209758_1000798 3300025297 Bacteria 44669
397 Ga0209758_1001478 3300025297 Bacteria 27491
398 Ga0209758_1003077 3300025297 Bacteria 15844
399 Ga0209758_1006528 3300025297 Bacteria 8326
400 Ga0207426_1000186 3300025302 Bacteria 154130
401 Ga0209257_1000983 3300025304 Bacteria 38689
402 Ga0207697_10000763 3300025315 Bacteria 18220
403 Ga0207656_10005224 3300025321 Bacteria 4572
404 Ga0207653_10016374 3300025885 Bacteria 2329
405 Ga0207682_10000062 3300025893 Bacteria 46841
406 Ga0207692_10012844 3300025898 Bacteria 3612
407 Ga0207642_10002857 3300025899 Bacteria 5392
408 Ga0207710_10009862 3300025900 Bacteria 4015
409 Ga0207710_10015503 3300025900 Bacteria 3222
410 Ga0207688_10001992 3300025901 Bacteria 10954
411 Ga0207688_10006793 3300025901 Bacteria 6227
412 Ga0207680_10000740 3300025903 Bacteria 15389
413 Ga0207647_10003504 3300025904 Bacteria 11767
414 Ga0207647_10011763 3300025904 Bacteria 6122
415 Ga0207647_10044532 3300025904 Bacteria 2772
416 Ga0207647_10047561 3300025904 Bacteria 2667
417 Ga0207685_10000809 3300025905 Bacteria 5800
418 Ga0207699_10001144 3300025906 Bacteria 12551
419 Ga0207699_10019708 3300025906 Bacteria 3602
420 Ga0207645_10000248 3300025907 Bacteria 44949
421 Ga0207645_10041103 3300025907 Bacteria 2961
422 Ga0207643_10000064 3300025908 Bacteria 70490
423 Ga0207643_10057354 3300025908 Bacteria 2217
424 Ga0207654_10000874 3300025911 Bacteria 16703
425 Ga0207654_10001623 3300025911 Bacteria 11742
426 Ga0207707_10002084 3300025912 Bacteria 18100
427 Ga0207707_10015886 3300025912 Bacteria 6566
428 Ga0207707_10088287 3300025912 Bacteria 2708
429 Ga0207695_10000006 3300025913 Bacteria 1135309
430 Ga0207695_10053399 3300025913 Bacteria 4227
431 Ga0207695_10072745 3300025913 Bacteria 3505
432 Ga0207695_10131584 3300025913 Bacteria 2459
433 Ga0207671_10001082 3300025914 Bacteria 33044
434 Ga0207671_10016546 3300025914 Bacteria 5727
435 Ga0207671_10047462 3300025914 Bacteria 3179
436 Ga0207693_10001801 3300025915 Bacteria 18789
437 Ga0207693_10002520 3300025915 Bacteria 15918
438 Ga0207693_10020205 3300025915 Bacteria 5297
439 Ga0207693_10028189 3300025915 Bacteria 4437
440 Ga0207693_10029262 3300025915 Bacteria 4353
441 Ga0207693_10047590 3300025915 Bacteria 3369
442 Ga0207693_10058667 3300025915 Bacteria 3015
443 Ga0207693_10093764 3300025915 Bacteria 2353
444 Ga0207663_10000260 3300025916 Bacteria 23036
445 Ga0207663_10009733 3300025916 Bacteria 5089
446 Ga0207663_10031931 3300025916 Bacteria 3121
447 Ga0207660_10000194 3300025917 Bacteria 38742
448 Ga0207660_10001899 3300025917 Bacteria 13916
449 Ga0207660_10065909 3300025917 Bacteria 2618
450 Ga0207662_10001637 3300025918 Bacteria 10959
451 Ga0207662_10025322 3300025918 Bacteria 3418
452 Ga0207662_10035289 3300025918 Bacteria 2920
453 Ga0207657_10003965 3300025919 Bacteria 15718
454 Ga0207657_10006919 3300025919 Bacteria 11695
455 Ga0207657_10035372 3300025919 Bacteria 4480
456 Ga0207649_10000234 3300025920 Bacteria 45397
457 Ga0207649_10059410 3300025920 Bacteria 2399
458 Ga0207652_10001613 3300025921 Bacteria 19823
459 Ga0207652_10002210 3300025921 Bacteria 16600
460 Ga0207652_10014326 3300025921 Bacteria 6421
461 Ga0207652_10059725 3300025921 Bacteria 3287
462 Ga0207681_10000794 3300025923 Bacteria 20828
463 Ga0207694_10000306 3300025924 Bacteria 46009
464 Ga0207650_10024593 3300025925 Bacteria 4283
465 Ga0207650_10030481 3300025925 Bacteria 3886
466 Ga0207659_10000172 3300025926 Bacteria 38725
467 Ga0207659_10028313 3300025926 Bacteria 3806
468 Ga0207659_10036392 3300025926 Bacteria 3409
469 Ga0207659_10119127 3300025926 Bacteria 2020
470 Ga0207687_10002217 3300025927 Bacteria 13242
471 Ga0207700_10012823 3300025928 Bacteria 5422
472 Ga0207700_10022444 3300025928 Bacteria 4332
473 Ga0207700_10117488 3300025928 Bacteria 2151
474 Ga0207664_10016500 3300025929 Bacteria 5389
475 Ga0207664_10023534 3300025929 Bacteria 4617
476 Ga0207644_10040591 3300025931 Bacteria 3290
477 Ga0207644_10066567 3300025931 Bacteria 2623
478 Ga0207690_10000796 3300025932 Bacteria 20342
479 Ga0207690_10011303 3300025932 Bacteria 5335
480 Ga0207690_10076263 3300025932 Bacteria 2327
481 Ga0207706_10005059 3300025933 Bacteria 12314
482 Ga0207706_10062109 3300025933 Bacteria 3290
483 Ga0207706_10092551 3300025933 Bacteria 2658
484 Ga0207686_10001093 3300025934 Bacteria 15891
485 Ga0207709_10001438 3300025935 Bacteria 16619
486 Ga0207709_10010457 3300025935 Bacteria 5107
487 Ga0207709_10035895 3300025935 Bacteria 2935
488 Ga0207709_10064502 3300025935 Bacteria 2300
489 Ga0207670_10000608 3300025936 Bacteria 19358
490 Ga0207670_10000807 3300025936 Bacteria 16336
491 Ga0207670_10052583 3300025936 Bacteria 2739
492 Ga0207669_10000141 3300025937 Bacteria 34618
493 Ga0207669_10036469 3300025937 Bacteria 2810
494 Ga0207704_10000755 3300025938 Bacteria 14264
495 Ga0207704_10008791 3300025938 Bacteria 4848
496 Ga0207665_10004374 3300025939 Bacteria 9383
497 Ga0207665_10004936 3300025939 Bacteria 8898
498 Ga0207665_10017370 3300025939 Bacteria 4728
499 Ga0207691_10000720 3300025940 Bacteria 32686
500 Ga0207691_10002355 3300025940 Bacteria 18498
501 Ga0207691_10006997 3300025940 Bacteria 10884
502 Ga0207691_10062352 3300025940 Bacteria 3383
503 Ga0207691_10084978 3300025940 Bacteria 2840
504 Ga0207711_10004836 3300025941 Bacteria 11448
505 Ga0207711_10032056 3300025941 Bacteria 4441
506 Ga0207711_10091468 3300025941 Bacteria 2676
507 Ga0207711_10093668 3300025941 Bacteria 2646
508 Ga0207689_10004430 3300025942 Bacteria 12738
509 Ga0207689_10018680 3300025942 Bacteria 5849
510 Ga0207661_10000098 3300025944 Bacteria 55518
511 Ga0207661_10007875 3300025944 Bacteria 7592
512 Ga0207679_10000174 3300025945 Bacteria 53051
513 Ga0207679_10004250 3300025945 Bacteria 8902
514 Ga0207679_10048313 3300025945 Bacteria 3097
515 Ga0207667_10004743 3300025949 Bacteria 16630
516 Ga0207667_10029793 3300025949 Bacteria 5913
517 Ga0207667_10055800 3300025949 Bacteria 4151
518 Ga0207667_10059856 3300025949 Bacteria 3987
519 Ga0207651_10002999 3300025960 Bacteria 8177
520 Ga0207651_10101017 3300025960 Bacteria 2140
521 Ga0207712_10000659 3300025961 Bacteria 26800
522 Ga0207668_10001107 3300025972 Bacteria 16030
523 Ga0207668_10038300 3300025972 Bacteria 3216
524 Ga0207640_10000846 3300025981 Bacteria 17376
525 Ga0207640_10071028 3300025981 Bacteria 2343
526 Ga0207658_10001843 3300025986 Bacteria 15875
527 Ga0207658_10036240 3300025986 Bacteria 3536
528 Ga0207677_10002504 3300026023 Bacteria 9628
529 Ga0207677_10044516 3300026023 Bacteria 2958
530 Ga0207703_10002433 3300026035 Bacteria 16135
531 Ga0207703_10005387 3300026035 Bacteria 10302
532 Ga0207703_10088155 3300026035 Bacteria 2603
533 Ga0207639_10001774 3300026041 Bacteria 14522
534 Ga0207639_10007131 3300026041 Bacteria 7616
535 Ga0207639_10022198 3300026041 Bacteria 4569
536 Ga0207678_10001059 3300026067 Bacteria 25176
537 Ga0207678_10009212 3300026067 Bacteria 8688
538 Ga0207678_10031363 3300026067 Bacteria 4637
539 Ga0207678_10057982 3300026067 Bacteria 3332
540 Ga0207678_10080115 3300026067 Bacteria 2796
541 Ga0207708_10001417 3300026075 Bacteria 17962
542 Ga0207708_10002793 3300026075 Bacteria 12833
543 Ga0207708_10063316 3300026075 Bacteria 2826
544 Ga0207702_10000122 3300026078 Bacteria 91685
545 Ga0207702_10007668 3300026078 Bacteria 9176
546 Ga0207702_10008899 3300026078 Bacteria 8461
547 Ga0207702_10134619 3300026078 Bacteria 2228
548 Ga0207641_10000622 3300026088 Bacteria 38657
549 Ga0207641_10007557 3300026088 Bacteria 9040
550 Ga0207648_10009300 3300026089 Bacteria 9423
551 Ga0207676_10002696 3300026095 Bacteria 12630
552 Ga0207676_10026665 3300026095 Bacteria 4297
553 Ga0207674_10001342 3300026116 Bacteria 31848
554 Ga0207674_10014657 3300026116 Bacteria 8644
555 Ga0207674_10017155 3300026116 Bacteria 7903
556 Ga0207674_10046931 3300026116 Bacteria 4432
557 Ga0207674_10144681 3300026116 Bacteria 2336
558 Ga0207675_100006706 3300026118 Bacteria 10886
559 Ga0207675_100011711 3300026118 Bacteria 8203
560 Ga0207683_10001193 3300026121 Bacteria 23509
561 Ga0207683_10045199 3300026121 Bacteria 3850
562 Ga0207683_10101830 3300026121 Bacteria 2564
563 Ga0209389_1000328 3300027296 Bacteria 29034
564 Ga0209589_1000017 3300027357 Bacteria 215546
565 Ga0209589_1003134 3300027357 Bacteria 29000
566 Ga0209489_100018 3300027361 Bacteria 215546
567 Ga0209489_103754 3300027361 Bacteria 29057
568 Ga0209700_100014 3300027363 Bacteria 299349
569 Ga0209700_100028 3300027363 Bacteria 215546
570 Ga0210002_1000638 3300027617 Bacteria 4734
571 Ga0209588_1011823 3300027671 Bacteria 2643
572 Ga0209966_1004024 3300027695 Bacteria 2480
573 Ga0209998_10001504 3300027717 Bacteria 5603
574 Ga0209974_10001402 3300027876 Bacteria 8719
575 Ga0207428_10000513 3300027907 Bacteria 46311
576 Ga0207428_10000626 3300027907 Bacteria 41522
577 Ga0207428_10001020 3300027907 Bacteria 31018
578 Ga0207428_10009473 3300027907 Bacteria 8721
579 Ga0268266_10009223 3300028379 Bacteria 8704
580 Ga0268266_10011610 3300028379 Bacteria 7646
581 Ga0268266_10018776 3300028379 Bacteria 5891
582 Ga0268266_10018923 3300028379 Bacteria 5867
583 Ga0268266_10086973 3300028379 Bacteria 2733
584 Ga0268266_10105625 3300028379 Bacteria 2488
585 Ga0268265_10002370 3300028380 Bacteria 14256
586 Ga0268265_10097726 3300028380 Bacteria 2363
587 Ga0268264_10000110 3300028381 Bacteria 206663
588 Ga0268264_10000187 3300028381 Bacteria 129270
589 Ga0268264_10006546 3300028381 Bacteria 9807
590 Ga0268264_10071289 3300028381 Bacteria 2943
591 Ga0268264_10144411 3300028381 Bacteria 2126
592 Ga0265337_1001215 3300028556 Bacteria 13090
593 Ga0265334_10026341 3300028573 Bacteria 2347
594 Ga0265336_10000764 3300028666 Bacteria 17051
595 Ga0307517_10000066 3300028786 Bacteria 141370
596 Ga0265338_10000973 3300028800 Bacteria 48208
597 Ga0265338_10021562 3300028800 Bacteria 6712
598 Ga0265338_10062901 3300028800 Bacteria 3240
599 Ga0265324_10003352 3300029957 Bacteria 7675
600 Ga0265330_10025186 3300031235 Bacteria 2697
601 Ga0265330_10029428 3300031235 Bacteria 2470
602 Ga0265332_10003602 3300031238 Bacteria 7431
603 Ga0265325_10003292 3300031241 Bacteria 10625
604 Ga0265325_10006295 3300031241 Bacteria 7221
605 Ga0265325_10007950 3300031241 Bacteria 6300
606 Ga0265325_10023341 3300031241 Bacteria 3378
607 Ga0265340_10001645 3300031247 Bacteria 12826
608 Ga0265340_10029097 3300031247 Bacteria 2776
609 Ga0265339_10000069 3300031249 Bacteria 90219
610 Ga0265339_10004839 3300031249 Bacteria 9099
611 Ga0265339_10007305 3300031249 Bacteria 7158
612 Ga0265331_10017214 3300031250 Bacteria 3775
613 Ga0265331_10022476 3300031250 Bacteria 3217
614 Ga0265327_10000130 3300031251 Bacteria 165066
615 Ga0265316_10082137 3300031344 Bacteria 2469
616 Ga0265316_10097918 3300031344 Bacteria 2232
617 Ga0307509_10034527 3300031507 Bacteria 5556
618 Ga0307408_100022413 3300031548 Bacteria 4291
619 Ga0265313_10000386 3300031595 Bacteria 47422
620 Ga0265313_10000525 3300031595 Bacteria 40049
621 Ga0265313_10005935 3300031595 Bacteria 8833
622 Ga0265313_10006744 3300031595 Bacteria 8032
623 Ga0265313_10008290 3300031595 Bacteria 6926
624 Ga0307508_10001545 3300031616 Bacteria 25766
625 Ga0265314_10002489 3300031711 Bacteria 18827
626 Ga0265314_10008132 3300031711 Bacteria 9027
627 Ga0265342_10000245 3300031712 Bacteria 60848
628 Ga0265342_10001939 3300031712 Bacteria 18542
629 Ga0316576_10020401 3300031727 Bacteria 4562
630 Ga0307516_10000001 3300031730 Bacteria 510338
631 Ga0307516_10056008 3300031730 Bacteria 3846
632 Ga0307510_10026558 3300033180 Bacteria 6652
633 Ga0307510_10039402 3300033180 Bacteria 5206
634 Ga0307510_10133565 3300033180 Bacteria 2146
635 Ga0315911_1000033 3300033442 Bacteria 67159
636 Ga0373948_0000049 3300034817 Bacteria 12986
637 Ga0373958_0000026 3300034819 Bacteria 16079
638 Ga0373959_0000446 3300034820 Bacteria 7792
639 Ga0373938_0000133 3300034957 Bacteria 10609
640 Ga0373938_0000337 3300034957 Bacteria 7445
641 Ga0373938_0003695 3300034957 Bacteria 2520
642 Ga0373926_0010417 3300035083 Bacteria 3118
643 Ga0373929_0000110 3300035085 Bacteria 13537
644 Ga0373934_0029264 3300035086 Bacteria 2150
645 Ga0373940_0000409 3300035088 Bacteria 6529
646 Ga0373944_0001321 3300035089 Bacteria 6236
647 Ga0373944_0006972 3300035089 Bacteria 3019
648 Ga0373944_0010142 3300035089 Bacteria 2563
649 Ga0373949_0000771 3300035090 Bacteria 10307
650 Ga0373949_0001010 3300035090 Bacteria 8668
651 Ga0373949_0002903 3300035090 Bacteria 4226
652 Ga0373951_0001038 3300035091 Bacteria 7468
653 Ga0373952_0000200 3300035092 Bacteria 9497
654 Ga0373952_0000271 3300035092 Bacteria 8517
655 Ga0373923_0000365 3300035111 Bacteria 10291
656 Ga0373932_0013210 3300035112 Bacteria 2048
657 Ga0373936_0002908 3300035113 Bacteria 6397
658 Ga0373936_0006874 3300035113 Bacteria 4280
659 Ga0373936_0014831 3300035113 Bacteria 2982
660 Ga0373936_0032359 3300035113 Bacteria 2068
661 Ga0373939_0001604 3300035114 Bacteria 5459
662 Ga0373941_0000177 3300035115 Bacteria 11867
663 Ga0373945_0000773 3300035116 Bacteria 9339
664 Ga0373945_0002050 3300035116 Bacteria 6263
665 Ga0373945_0007095 3300035116 Bacteria 3625
666 Ga0373953_0002305 3300035117 Bacteria 5741
667 Ga0373953_0010859 3300035117 Bacteria 3181
668 Ga0373953_0016591 3300035117 Bacteria 2691
669 Ga0373954_0001844 3300035118 Bacteria 8749
670 Ga0373954_0003693 3300035118 Bacteria 6515
671 Ga0373954_0004386 3300035118 Bacteria 6069
672 Ga0373954_0042229 3300035118 Bacteria 2126
673 Ga0373956_0001114 3300035119 Bacteria 11079
674 Ga0373956_0012758 3300035119 Bacteria 3489
675 Ga0373956_0022639 3300035119 Bacteria 2690
676 Ga0373957_0005169 3300035120 Bacteria 4032
677 Ga0373960_0002058 3300035121 Bacteria 4524
678 Ga0373943_0000371 3300035170 Bacteria 19059
679 Ga0373943_0016042 3300035170 Bacteria 3411
680 Ga0373943_0022654 3300035170 Bacteria 2913
681 Ga0373946_0001609 3300035171 Bacteria 7854
682 Ga0373946_0003088 3300035171 Bacteria 5899
683 Ga0373946_0003694 3300035171 Bacteria 5423
684 Ga0373946_0003981 3300035171 Bacteria 5255
685 Ga0373946_0017748 3300035171 Bacteria 2726
686 Ga0373955_0000087 3300035172 Bacteria 37402
687 Ga0373955_0019309 3300035172 Bacteria 3403
688 Ga0373955_0022872 3300035172 Bacteria 3176
689 Ga0373942_0000533 3300035207 Bacteria 10673
690 Ga0373942_0002312 3300035207 Bacteria 4658
691 Ga0373961_0009181 3300035241 Bacteria 2416
692 Ga0373962_0000275 3300035242 Bacteria 11095
693 Ga0373962_0003026 3300035242 Bacteria 4026
694 Ga0316574_0000409 3300035398 Bacteria 16937
695 Ga0373931_0002417 3300035691 Bacteria 8259
696 Ga0373931_0003207 3300035691 Bacteria 7302
697 Ga0373931_0013686 3300035691 Bacteria 3954
698 Ga0373931_0018753 3300035691 Bacteria 3444
699 Ga0373931_0043522 3300035691 Bacteria 2365
700 Ga0373935_0000249 3300035692 Bacteria 26486
701 Ga0373935_0001440 3300035692 Bacteria 13192
702 Ga0373935_0001638 3300035692 Bacteria 12510
703 Ga0373935_0009616 3300035692 Bacteria 5788
704 Ga0373935_0017387 3300035692 Bacteria 4362
705 Ga0373935_0022258 3300035692 Bacteria 3885
706 Ga0373935_0023343 3300035692 Bacteria 3800
707 Ga0373935_0038689 3300035692 Bacteria 2987
708 Ga0373935_0065574 3300035692 Bacteria 2331
709 Ga0373927_0000496 3300035695 Bacteria 29963
710 Ga0373927_0005789 3300035695 Bacteria 8482
711 Ga0373927_0013727 3300035695 Bacteria 5378
712 Ga0373927_0017197 3300035695 Bacteria 4764
713 Ga0373927_0038948 3300035695 Bacteria 3085
714 Ga0373927_0052483 3300035695 Bacteria 2638
715 Ga0373927_0057648 3300035695 Bacteria 2511
716 Ga0373927_0076999 3300035695 Bacteria 2160
717 Ga0373933_0001541 3300035724 Bacteria 13482
718 Ga0373933_0003396 3300035724 Bacteria 8876
719 Ga0373933_0015198 3300035724 Bacteria 4290
720 Ga0373933_0020661 3300035724 Bacteria 3732
721 Ga0373933_0052379 3300035724 Bacteria 2442
722 Ga0373947_0000172 3300035725 Bacteria 35133
723 Ga0373947_0000552 3300035725 Bacteria 21816
724 Ga0373947_0001425 3300035725 Bacteria 14710
725 Ga0373947_0003284 3300035725 Bacteria 9583
726 Ga0373947_0005148 3300035725 Bacteria 7658
727 Ga0373947_0008568 3300035725 Bacteria 5888
728 Ga0373947_0043715 3300035725 Bacteria 2676
729 Ga0373937_0000006 3300036401 Bacteria 194781
730 Ga0373937_0003940 3300036401 Bacteria 12549
731 Ga0373937_0006385 3300036401 Bacteria 10173
732 Ga0373937_0008551 3300036401 Bacteria 8892
733 Ga0373937_0013102 3300036401 Bacteria 7302
734 Ga0373937_0020237 3300036401 Bacteria 5964
735 Ga0373937_0037460 3300036401 Bacteria 4419
736 Ga0373937_0053496 3300036401 Bacteria 3703
737 Ga0373937_0084498 3300036401 Bacteria 2936
738 Ga0316584_0023349 3300036712 Bacteria 4519
739 Ga0373925_0000002 3300037068 Bacteria 368879
740 Ga0373925_0001273 3300037068 Bacteria 22250
741 Ga0373925_0001642 3300037068 Bacteria 18838
742 Ga0373925_0006254 3300037068 Bacteria 8780
743 Ga0373925_0007268 3300037068 Bacteria 8093
744 Ga0373925_0012599 3300037068 Bacteria 6128
745 Ga0373925_0013241 3300037068 Bacteria 5967
746 Ga0395899_0034774 3300037312 Bacteria 3785
747 Ga0395900_0000962 3300037418 Bacteria 37526
748 Ga0395900_0001475 3300037418 Bacteria 28056
749 Ga0395898_0016645 3300037466 Bacteria 7516
750 Ga0395898_0020156 3300037466 Bacteria 6774
751 Ga0395898_0031972 3300037466 Bacteria 5253
752 Ga0395898_0061080 3300037466 Bacteria 3661
753 Ga0395898_0075158 3300037466 Bacteria 3264
754 Ga0395905_0000156 3300037471 Bacteria 112215
755 Ga0395905_0007000 3300037471 Bacteria 11273
756 Ga0395905_0021976 3300037471 Bacteria 6035
757 Ga0395905_0114742 3300037471 Bacteria 2531
758 Ga0436364_0271330 3300037853 Bacteria 2398
759 Ga0436364_0500047 3300037853 Bacteria 2906
760 Ga0436364_0728139 3300037853 Bacteria 64829
761 Ga0436364_0992626 3300037853 Bacteria 2737
762 Ga0395901_0002873 3300038443 Bacteria 17387
763 Ga0395901_0010605 3300038443 Bacteria 9335
764 Ga0395901_0067052 3300038443 Bacteria 3738
765 Ga0400483_004403 3300039062 Bacteria 2791
766 Ga0400483_116415 3300039062 Bacteria 2124
767 Ga0400483_160454 3300039062 Bacteria 4978
768 Ga0436365_0018961 3300039437 Bacteria 4434
769 Ga0436365_0675935 3300039437 Bacteria 6448
770 Ga0436365_0918738 3300039437 Bacteria 2142
771 Ga0436365_1445082 3300039437 Bacteria 11095
772 Ga0436365_1839688 3300039437 Bacteria 4542
773 Ga0436361_0314376 3300039447 Bacteria 17837
774 Ga0436363_1035293 3300039450 Bacteria 14114
775 Ga0439460_0006942 3300042461 Bacteria 2821
776 Ga0451577_0068027 3300042876 Bacteria 3177
777 Ga0466969_0013555 3300044656 Bacteria 4293
778 Ga0466972_0000048 3300044658 Bacteria 119165
779 Ga0466972_0004536 3300044658 Bacteria 6955
780 Ga0466966_0001825 3300044684 Bacteria 13815
781 Ga0466966_0034354 3300044684 Bacteria 3279
782 Ga0466961_0000010 3300044693 Bacteria 137550
783 Ga0466963_0002918 3300044694 Bacteria 9655
784 Ga0466963_0014154 3300044694 Bacteria 4915
785 Ga0466968_0033848 3300044735 Bacteria 2130
786 Ga0466959_0025251 3300045049 Bacteria 4403
787 Ga0451576_0004729 3300045051 Bacteria 17496
788 Ga0451576_0013587 3300045051 Bacteria 9101
789 Ga0466967_0043269 3300045976 Bacteria 3898
790 Ga0466967_0090501 3300045976 Bacteria 2780
791 Ga0495617_014253 3300046452 Bacteria 2702
792 Ga0495592_0000039 3300046454 Bacteria 124471
793 Ga0495592_0001131 3300046454 Bacteria 18562
794 Ga0495592_0006064 3300046454 Bacteria 8982
795 Ga0495592_0007618 3300046454 Bacteria 8111
796 Ga0495592_0013776 3300046454 Bacteria 6148
797 Ga0495592_0045577 3300046454 Bacteria 3271
798 Ga0495592_0053790 3300046454 Bacteria 2985
799 Ga0495592_0089180 3300046454 Bacteria 2215
800 Ga0495603_0000104 3300046455 Bacteria 39821
801 Ga0495603_0037324 3300046455 Bacteria 2915
802 Ga0495603_0052457 3300046455 Bacteria 2421
803 Ga0495629_0000748 3300046459 Bacteria 26249
804 Ga0495629_0002078 3300046459 Bacteria 15535
805 Ga0495629_0006821 3300046459 Bacteria 8443
806 Ga0495629_0012882 3300046459 Bacteria 6049
807 Ga0495629_0022194 3300046459 Bacteria 4527
808 Ga0495629_0034735 3300046459 Bacteria 3564
809 Ga0495629_0054255 3300046459 Bacteria 2803
810 Ga0495638_0008996 3300046460 Bacteria 7039
811 Ga0495638_0024230 3300046460 Bacteria 3959
812 Ga0495638_0035210 3300046460 Bacteria 3193
813 Ga0495641_0030325 3300046461 Bacteria 2595
814 Ga0495651_0000611 3300046462 Bacteria 27721
815 Ga0495651_0001571 3300046462 Bacteria 17667
816 Ga0495651_0011467 3300046462 Bacteria 6807
817 Ga0495651_0021445 3300046462 Bacteria 5021
818 Ga0495651_0079930 3300046462 Bacteria 2470
819 Ga0495651_0092655 3300046462 Bacteria 2263
820 Ga0495651_0100880 3300046462 Bacteria 2149
821 Ga0495653_0000006 3300046463 Bacteria 363285
822 Ga0495653_0007005 3300046463 Bacteria 9251
823 Ga0495653_0011146 3300046463 Bacteria 7352
824 Ga0495653_0018841 3300046463 Bacteria 5601
825 Ga0495653_0030224 3300046463 Bacteria 4317
826 Ga0495653_0037262 3300046463 Bacteria 3822
827 Ga0495580_0003617 3300046472 Bacteria 13095
828 Ga0495580_0010851 3300046472 Bacteria 7070
829 Ga0495580_0026401 3300046472 Bacteria 4234
830 Ga0495582_0000063 3300046473 Bacteria 54381
831 Ga0495582_0012713 3300046473 Bacteria 4639
832 Ga0495639_0000224 3300046475 Bacteria 28629
833 Ga0495662_0000297 3300046476 Bacteria 21564
834 Ga0495662_0013952 3300046476 Bacteria 3910
835 Ga0495662_0023254 3300046476 Bacteria 2993
836 Ga0495664_0000002 3300046477 Bacteria 625183
837 Ga0495664_0006271 3300046477 Bacteria 6566
838 Ga0495664_0015744 3300046477 Bacteria 4303
839 Ga0495664_0044123 3300046477 Bacteria 2642
840 Ga0495664_0050217 3300046477 Bacteria 2476
841 Ga0495585_0000546 3300046492 Bacteria 35582
842 Ga0495585_0059640 3300046492 Bacteria 2102
843 Ga0495594_0001344 3300046499 Bacteria 12765
844 Ga0495596_0037352 3300046500 Bacteria 1921
845 Ga0495606_0003923 3300046507 Bacteria 15309
846 Ga0495606_0018849 3300046507 Bacteria 5160
847 Ga0495608_0000009 3300046511 Bacteria 266614
848 Ga0495608_0000557 3300046511 Bacteria 25706
849 Ga0495608_0002360 3300046511 Bacteria 13601
850 Ga0495608_0075138 3300046511 Bacteria 2202
851 Ga0495610_0017707 3300046512 Bacteria 4054
852 Ga0495610_0020667 3300046512 Bacteria 3649
853 Ga0495618_0000005 3300046514 Bacteria 230421
854 Ga0495618_0003917 3300046514 Bacteria 9189
855 Ga0495618_0007259 3300046514 Bacteria 6704
856 Ga0495618_0027475 3300046514 Bacteria 3541
857 Ga0495618_0057516 3300046514 Bacteria 2462
858 Ga0495618_0094208 3300046514 Bacteria 1915
859 Ga0495628_0000002 3300046516 Bacteria 589399
860 Ga0495628_0008721 3300046516 Bacteria 8675
861 Ga0495628_0018145 3300046516 Bacteria 5835
862 Ga0495628_0019167 3300046516 Bacteria 5658
863 Ga0495628_0031426 3300046516 Bacteria 4295
864 Ga0495628_0044261 3300046516 Bacteria 3542
865 Ga0495628_0063330 3300046516 Bacteria 2898
866 Ga0495630_0018505 3300046517 Bacteria 5118
867 Ga0495630_0024736 3300046517 Bacteria 4438
868 Ga0495637_0005275 3300046520 Bacteria 6612
869 Ga0495637_0018544 3300046520 Bacteria 3226
870 Ga0495644_0000208 3300046523 Bacteria 27638
871 Ga0495648_0001804 3300046524 Bacteria 20615
872 Ga0495648_0037123 3300046524 Bacteria 3134
873 Ga0495666_0027747 3300046526 Bacteria 2786
874 Ga0495642_0000952 3300046528 Bacteria 13558
875 Ga0495652_0000004 3300046529 Bacteria 588877
876 Ga0495652_0011295 3300046529 Bacteria 8080
877 Ga0495652_0043946 3300046529 Bacteria 3848
878 Ga0495665_0000290 3300046531 Bacteria 25439
879 Ga0495665_0009753 3300046531 Bacteria 5198
880 Ga0495665_0035624 3300046531 Bacteria 2658
881 Ga0495665_0039329 3300046531 Bacteria 2519
882 Ga0495640_0000005 3300046533 Bacteria 318271
883 Ga0495640_0005790 3300046533 Bacteria 9814
884 Ga0495640_0016952 3300046533 Bacteria 5438
885 Ga0495640_0026837 3300046533 Bacteria 4158
886 Ga0495640_0066325 3300046533 Bacteria 2435
887 Ga0495586_0004986 3300046535 Bacteria 7101
888 Ga0495586_0012468 3300046535 Bacteria 4509
889 Ga0495586_0018134 3300046535 Bacteria 3744
890 Ga0495587_0000007 3300046536 Bacteria 290788
891 Ga0495587_0001059 3300046536 Bacteria 18102
892 Ga0495587_0020929 3300046536 Bacteria 4035
893 Ga0495598_0004142 3300046537 Bacteria 3123
894 Ga0495609_0003197 3300046538 Bacteria 9515
895 Ga0495645_0000003 3300046543 Bacteria 570133
896 Ga0495645_0006734 3300046543 Bacteria 7983
897 Ga0495645_0007749 3300046543 Bacteria 7469
898 Ga0495645_0039626 3300046543 Bacteria 3436
899 Ga0495645_0068183 3300046543 Bacteria 2568
900 Ga0495633_0002198 3300046558 Bacteria 13962
901 Ga0495667_0000002 3300046559 Bacteria 437535
902 Ga0495667_0009830 3300046559 Bacteria 6479
903 Ga0495667_0016261 3300046559 Bacteria 5025
904 Ga0495667_0070092 3300046559 Bacteria 2287
905 Ga0495667_0074627 3300046559 Bacteria 2208
906 Ga0495656_0000116 3300046615 Bacteria 31062
907 Ga0495668_0013241 3300046616 Bacteria 4874
908 Ga0495668_0067894 3300046616 Bacteria 1961
909 Ga0495634_0000022 3300046642 Bacteria 118988
910 Ga0495634_0005885 3300046642 Bacteria 9366
911 Ga0495634_0013980 3300046642 Bacteria 5797
912 Ga0495634_0014410 3300046642 Bacteria 5701
913 Ga0495634_0023350 3300046642 Bacteria 4349
914 Ga0495634_0083444 3300046642 Bacteria 2085
915 Ga0495611_0002902 3300046648 Bacteria 7654
916 Ga0495625_0014130 3300046660 Bacteria 6389
917 Ga0495635_0000020 3300046663 Bacteria 189698
918 Ga0495635_0009729 3300046663 Bacteria 6720
919 Ga0495635_0012565 3300046663 Bacteria 5934
920 Ga0495635_0017837 3300046663 Bacteria 4958
921 Ga0495635_0067122 3300046663 Bacteria 2460
922 Ga0495635_0070813 3300046663 Bacteria 2390
923 Ga0495659_0000633 3300046664 Bacteria 12802
924 Ga0495659_0013796 3300046664 Bacteria 2636
925 Ga0495661_0009454 3300046665 Bacteria 6690
926 Ga0495588_0006115 3300046674 Bacteria 5404
927 Ga0495588_0007718 3300046674 Bacteria 4912
928 Ga0495657_0000435 3300046675 Bacteria 38963
929 Ga0495657_0023694 3300046675 Bacteria 4384
930 Ga0495657_0039556 3300046675 Bacteria 3239
931 Ga0495657_0050904 3300046675 Bacteria 2783
932 Ga0495657_0051901 3300046675 Bacteria 2752
933 Ga0495657_0065141 3300046675 Bacteria 2397
934 Ga0495599_0000001 3300046678 Bacteria 537563
935 Ga0495599_0001663 3300046678 Bacteria 12840
936 Ga0495623_0000001 3300046679 Bacteria 313861
937 Ga0495623_0000278 3300046679 Bacteria 33474
938 Ga0495623_0004162 3300046679 Bacteria 9528
939 Ga0495623_0029868 3300046679 Bacteria 3507
940 Ga0495623_0047063 3300046679 Bacteria 2737
941 Ga0495646_0000014 3300046680 Bacteria 143781
942 Ga0495646_0007424 3300046680 Bacteria 6966
943 Ga0495646_0016960 3300046680 Bacteria 4625
944 Ga0495646_0043120 3300046680 Bacteria 2765
945 Ga0495647_0000453 3300046681 Bacteria 11831
946 Ga0495647_0000596 3300046681 Bacteria 10696
947 Ga0495647_0010922 3300046681 Bacteria 3102
948 Ga0495658_0000366 3300046683 Bacteria 25377
949 Ga0495658_0001515 3300046683 Bacteria 12183
950 Ga0495658_0003288 3300046683 Bacteria 8032
951 Ga0495658_0011776 3300046683 Bacteria 4408
952 Ga0495658_0054631 3300046683 Bacteria 2272
953 Ga0495669_0017680 3300046684 Bacteria 3062
954 Ga0495669_0060642 3300046684 Bacteria 1710
955 Ga0495613_0000449 3300046689 Bacteria 35095
956 Ga0495613_0011155 3300046689 Bacteria 6673
957 Ga0495613_0016658 3300046689 Bacteria 5471
958 Ga0495624_0000224 3300046690 Bacteria 44228
959 Ga0495624_0004050 3300046690 Bacteria 10780
960 Ga0495624_0037184 3300046690 Bacteria 3134
961 Ga0495624_0054059 3300046690 Bacteria 2533
962 Ga0495670_0003609 3300046691 Bacteria 7600
963 Ga0495670_0018418 3300046691 Bacteria 3437
964 Ga0495600_0000006 3300046809 Bacteria 151916
965 Ga0495600_0002049 3300046809 Bacteria 11360
966 Ga0495600_0005150 3300046809 Bacteria 7861
967 Ga0495600_0006047 3300046809 Bacteria 7331
968 Ga0495600_0009892 3300046809 Bacteria 5905
969 Ga0495600_0020263 3300046809 Bacteria 4254
970 Ga0495600_0069145 3300046809 Bacteria 2307
971 Ga0495581_0001337 3300047315 Bacteria 13627
972 Ga0495581_0002953 3300047315 Bacteria 9735
973 Ga0495581_0025215 3300047315 Bacteria 3448
974 Ga0495581_0027196 3300047315 Bacteria 3317
975 Ga0495581_0039068 3300047315 Bacteria 2747
976 Ga0495604_0000005 3300047317 Bacteria 424516
977 Ga0495604_0006090 3300047317 Bacteria 9571
978 Ga0495604_0007032 3300047317 Bacteria 8922
979 Ga0495604_0010819 3300047317 Bacteria 7245
980 Ga0495604_0026104 3300047317 Bacteria 4650
981 Ga0495604_0031612 3300047317 Bacteria 4198
982 Ga0495604_0035035 3300047317 Bacteria 3966
983 Ga0495604_0063261 3300047317 Bacteria 2823
984 Ga0495604_0101996 3300047317 Bacteria 2107
985 Ga0495674_0000003 3300047319 Bacteria 562126
986 Ga0495674_0000747 3300047319 Bacteria 30766
987 Ga0495674_0005032 3300047319 Bacteria 12712
988 Ga0495674_0013887 3300047319 Bacteria 7555
989 Ga0495674_0024269 3300047319 Bacteria 5574
990 Ga0495674_0026746 3300047319 Bacteria 5277
991 Ga0495674_0044939 3300047319 Bacteria 3924
992 Ga0495674_0068500 3300047319 Bacteria 3071
993 Ga0495674_0069963 3300047319 Bacteria 3033
994 Ga0495674_0074364 3300047319 Bacteria 2926
995 Ga0495672_0081727 3300047320 Bacteria 1798
996 Ga0495676_0015297 3300047321 Bacteria 6836
997 Ga0495676_0020900 3300047321 Bacteria 5731
998 Ga0495676_0021862 3300047321 Bacteria 5577
999 Ga0495676_0041727 3300047321 Bacteria 3773
1000 Ga0495680_0000002 3300047322 Bacteria 197533
1001 Ga0495680_0003135 3300047322 Bacteria 16479
1002 Ga0495680_0006572 3300047322 Bacteria 10788
1003 Ga0495680_0008513 3300047322 Bacteria 9321
1004 Ga0495680_0008658 3300047322 Bacteria 9235
1005 Ga0495680_0012421 3300047322 Bacteria 7495
1006 Ga0495680_0029387 3300047322 Bacteria 4501
1007 Ga0495687_013484 3300047443 Bacteria 4261
1008 Ga0495675_0000010 3300047444 Bacteria 153375
1009 Ga0495675_0000740 3300047444 Bacteria 20363
1010 Ga0495675_0003665 3300047444 Bacteria 9285
1011 Ga0495675_0003968 3300047444 Bacteria 8969
1012 Ga0495675_0020780 3300047444 Bacteria 4178
1013 Ga0495684_0000028 3300047471 Bacteria 123549
1014 Ga0495684_0000133 3300047471 Bacteria 54433
1015 Ga0495684_0007961 3300047471 Bacteria 8191
1016 Ga0495684_0025738 3300047471 Bacteria 4521
1017 Ga0495684_0036720 3300047471 Bacteria 3756
1018 Ga0495686_0011217 3300047472 Bacteria 6319
1019 Ga0495686_0017623 3300047472 Bacteria 4805
1020 Ga0495593_0000108 3300047673 Bacteria 38360
1021 Ga0495593_0006553 3300047673 Bacteria 6815
1022 Ga0495593_0006602 3300047673 Bacteria 6788
1023 Ga0495602_0000054 3300048088 Bacteria 111411
1024 Ga0495602_0002218 3300048088 Bacteria 19614
1025 Ga0495602_0013696 3300048088 Bacteria 8272
1026 Ga0495602_0032943 3300048088 Bacteria 4871
1027 Ga0495602_0033274 3300048088 Bacteria 4838
1028 Ga0495602_0039514 3300048088 Bacteria 4343
1029 Ga0495602_0072271 3300048088 Bacteria 2942
1030 Ga0495626_0006198 3300048091 Bacteria 6835
1031 Ga0496100_0000447 3300048903 Bacteria 19924
1032 Ga0496100_0006283 3300048903 Bacteria 6470
1033 Ga0496100_0024645 3300048903 Bacteria 3671
1034 Ga0496101_0001349 3300048904 Bacteria 14712
1035 Ga0496102_0002354 3300048905 Bacteria 16125
1036 Ga0496102_0006835 3300048905 Bacteria 9737
1037 Ga0496102_0014185 3300048905 Bacteria 6923
1038 Ga0496102_0030385 3300048905 Bacteria 4836
1039 Ga0496102_0104318 3300048905 Bacteria 2637
1040 Ga0496103_0001066 3300048906 Bacteria 19147
1041 Ga0496103_0005364 3300048906 Bacteria 7679
1042 Ga0496103_0008597 3300048906 Bacteria 6063
1043 Ga0496104_0000126 3300048907 Bacteria 70488
1044 Ga0496104_0000752 3300048907 Bacteria 27722
1045 Ga0496104_0007793 3300048907 Bacteria 9490
1046 Ga0496104_0010461 3300048907 Bacteria 8286
1047 Ga0496104_0015234 3300048907 Bacteria 6960
1048 Ga0496104_0024677 3300048907 Bacteria 5533
1049 Ga0496104_0131979 3300048907 Bacteria 2399
1050 Ga0496105_0000117 3300048908 Bacteria 54274
1051 Ga0496105_0002078 3300048908 Bacteria 14498
1052 Ga0496105_0002637 3300048908 Bacteria 13054
1053 Ga0496105_0010940 3300048908 Bacteria 7148
1054 Ga0496105_0031489 3300048908 Bacteria 4348
1055 Ga0496106_0001027 3300048909 Bacteria 20532
1056 Ga0496106_0008822 3300048909 Bacteria 7451
1057 Ga0496106_0024431 3300048909 Bacteria 4493
1058 Ga0496106_0037327 3300048909 Bacteria 3634
1059 Ga0496106_0081209 3300048909 Bacteria 2491
1060 Ga0496107_0001211 3300048910 Bacteria 15713
1061 Ga0496107_0002063 3300048910 Bacteria 12844
1062 Ga0496107_0002318 3300048910 Bacteria 12290
1063 Ga0496107_0009385 3300048910 Bacteria 6784
1064 Ga0496107_0040449 3300048910 Bacteria 3346
1065 Ga0496107_0045302 3300048910 Bacteria 3164
1066 Ga0496107_0068845 3300048910 Bacteria 2568
1067 Ga0496108_0000649 3300048911 Bacteria 27099
1068 Ga0496108_0000847 3300048911 Bacteria 23809
1069 Ga0496108_0006065 3300048911 Bacteria 9774
1070 Ga0496108_0010226 3300048911 Bacteria 7619
1071 Ga0496108_0019934 3300048911 Bacteria 5508
1072 Ga0496108_0027547 3300048911 Bacteria 4694
1073 Ga0496108_0122908 3300048911 Bacteria 2227
1074 Ga0496108_0131082 3300048911 Bacteria 2155
1075 Ga0496109_0000188 3300048912 Bacteria 61633
1076 Ga0496109_0000739 3300048912 Bacteria 27160
1077 Ga0496109_0004864 3300048912 Bacteria 11211
1078 Ga0496109_0010096 3300048912 Bacteria 8055
1079 Ga0496109_0017086 3300048912 Bacteria 6349
1080 Ga0496109_0078092 3300048912 Bacteria 3047
1081 Ga0496109_0117865 3300048912 Bacteria 2472
1082 Ga0496110_0002115 3300048913 Bacteria 14831
1083 Ga0496110_0005853 3300048913 Bacteria 9666
1084 Ga0496110_0006025 3300048913 Bacteria 9550
1085 Ga0496110_0006959 3300048913 Bacteria 8998
1086 Ga0496110_0060429 3300048913 Bacteria 3342
1087 Ga0496110_0104112 3300048913 Bacteria 2546
1088 Ga0496111_0000976 3300048914 Bacteria 15643
1089 Ga0496111_0011620 3300048914 Bacteria 5939
1090 Ga0496111_0015450 3300048914 Bacteria 5241
1091 Ga0496111_0016474 3300048914 Bacteria 5092
1092 Ga0496111_0090151 3300048914 Bacteria 2246
1093 Ga0496112_0000051 3300048915 Bacteria 82351
1094 Ga0496112_0001001 3300048915 Bacteria 20717
1095 Ga0496112_0001693 3300048915 Bacteria 17188
1096 Ga0496112_0004717 3300048915 Bacteria 11615
1097 Ga0496112_0008518 3300048915 Bacteria 9187
1098 Ga0496112_0021534 3300048915 Bacteria 6132
1099 Ga0496112_0197265 3300048915 Bacteria 1973
1100 Ga0496113_0000309 3300048916 Bacteria 23203
1101 Ga0496113_0004222 3300048916 Bacteria 8788
1102 Ga0496113_0019954 3300048916 Bacteria 4701
1103 Ga0496113_0020929 3300048916 Bacteria 4608
1104 Ga0496113_0065648 3300048916 Bacteria 2747
1105 Ga0496113_0087786 3300048916 Bacteria 2392
1106 Ga0496113_0101638 3300048916 Bacteria 2229
1107 Ga0496113_0120937 3300048916 Bacteria 2047
1108 Ga0496114_0001734 3300048917 Bacteria 16551
1109 Ga0496115_0000592 3300048918 Bacteria 27769
1110 Ga0496115_0013668 3300048918 Bacteria 6145
1111 Ga0496115_0029324 3300048918 Bacteria 4321
1112 Ga0496115_0048466 3300048918 Bacteria 3398
1113 Ga0496115_0049277 3300048918 Bacteria 3371
1114 Ga0496116_0053797 3300048919 Bacteria 2656
1115 Ga0496119_0002392 3300048922 Bacteria 20610
1116 Ga0496119_0015482 3300048922 Bacteria 5867
1117 Ga0496121_0000144 3300048924 Bacteria 156856
1118 Ga0496121_0000596 3300048924 Bacteria 67893
1119 Ga0496121_0004310 3300048924 Bacteria 19264
1120 Ga0496121_0004660 3300048924 Bacteria 18214
1121 Ga0496121_0017154 3300048924 Bacteria 7416
1122 Ga0496121_0032832 3300048924 Bacteria 4709
1123 Ga0496121_0039271 3300048924 Bacteria 4174
1124 Ga0496122_0001783 3300048925 Bacteria 33000
1125 Ga0496123_0008945 3300048926 Bacteria 9107
1126 Ga0496124_0002408 3300048927 Bacteria 24540
1127 Ga0496125_0000595 3300048928 Bacteria 61641
1128 Ga0496125_0003506 3300048928 Bacteria 18947
1129 Ga0496125_0005815 3300048928 Bacteria 13547
1130 Ga0496125_0028181 3300048928 Bacteria 5078
1131 Ga0496125_0046373 3300048928 Bacteria 3646
1132 Ga0496125_0077724 3300048928 Bacteria 2556
1133 Ga0496125_0081619 3300048928 Bacteria 2469
1134 Ga0496126_0003899 3300048929 Bacteria 18338
1135 Ga0496126_0007999 3300048929 Bacteria 11480
1136 Ga0496126_0012837 3300048929 Bacteria 8561
1137 Ga0496126_0021036 3300048929 Bacteria 6384
1138 Ga0496126_0030316 3300048929 Bacteria 5125
1139 Ga0496126_0052472 3300048929 Bacteria 3705
1140 Ga0496126_0063799 3300048929 Bacteria 3301
1141 Ga0501031_0000377 3300049568 Bacteria 26157
1142 Ga0501031_0012135 3300049568 Bacteria 5617
1143 Ga0501032_0000040 3300049569 Bacteria 115662
1144 Ga0501032_0002502 3300049569 Bacteria 14350
1145 Ga0501032_0003836 3300049569 Bacteria 11418
1146 Ga0501032_0013306 3300049569 Bacteria 5857
1147 Ga0501032_0078260 3300049569 Bacteria 2201
1148 Ga0501033_0000128 3300049570 Bacteria 73419
1149 Ga0501033_0001178 3300049570 Bacteria 23600
1150 Ga0501033_0011352 3300049570 Bacteria 6816
1151 Ga0501033_0021458 3300049570 Bacteria 4872
1152 Ga0501033_0023415 3300049570 Bacteria 4657
1153 Ga0501033_0024205 3300049570 Bacteria 4581
1154 Ga0501033_0080366 3300049570 Bacteria 2392
1155 Ga0501033_0095098 3300049570 Bacteria 2177
1156 Ga0501034_0000113 3300049571 Bacteria 149824
1157 Ga0501034_0000139 3300049571 Bacteria 135587
1158 Ga0501034_0000734 3300049571 Bacteria 49577
1159 Ga0501034_0008567 3300049571 Bacteria 10794
1160 Ga0501034_0027285 3300049571 Bacteria 5809
1161 Ga0501034_0040597 3300049571 Bacteria 4710
1162 Ga0501034_0050837 3300049571 Bacteria 4179
1163 Ga0501034_0091177 3300049571 Bacteria 3045
1164 Ga0501034_0099947 3300049571 Bacteria 2895
1165 Ga0501034_0172222 3300049571 Bacteria 2131
1166 Ga0501036_0000281 3300049572 Bacteria 35045
1167 Ga0501036_0001021 3300049572 Bacteria 21132
1168 Ga0501036_0006538 3300049572 Bacteria 9470
1169 Ga0501036_0013510 3300049572 Bacteria 6787
1170 Ga0501036_0037511 3300049572 Bacteria 4099
1171 Ga0501036_0085478 3300049572 Bacteria 2666
1172 Ga0501036_0101222 3300049572 Bacteria 2437
1173 Ga0501037_0000041 3300049573 Bacteria 118457
1174 Ga0501037_0007235 3300049573 Bacteria 8109
1175 Ga0501037_0010813 3300049573 Bacteria 6705
1176 Ga0501037_0016247 3300049573 Bacteria 5477
1177 Ga0501037_0029550 3300049573 Bacteria 4049
1178 Ga0501037_0035491 3300049573 Bacteria 3677
1179 Ga0501038_0000057 3300049574 Bacteria 92766
1180 Ga0501038_0005284 3300049574 Bacteria 12008
1181 Ga0501038_0011176 3300049574 Bacteria 8198
1182 Ga0501038_0011832 3300049574 Bacteria 7964
1183 Ga0501038_0035298 3300049574 Bacteria 4390
1184 Ga0501038_0039580 3300049574 Bacteria 4123
1185 Ga0501038_0040069 3300049574 Bacteria 4094
1186 Ga0501038_0047168 3300049574 Bacteria 3732
1187 Ga0501038_0084076 3300049574 Bacteria 2678
1188 Ga0501039_0003963 3300049575 Bacteria 11120
1189 Ga0501039_0009975 3300049575 Bacteria 7240
1190 Ga0501039_0040950 3300049575 Bacteria 3576
1191 Ga0501039_0072066 3300049575 Bacteria 2685
1192 Ga0501040_0007238 3300049576 Bacteria 7189
1193 Ga0501042_0011820 3300049578 Bacteria 5898
1194 Ga0501043_0005571 3300049579 Bacteria 10146
1195 Ga0501043_0006408 3300049579 Bacteria 9455
1196 Ga0501043_0013603 3300049579 Bacteria 6366
1197 Ga0501043_0045583 3300049579 Bacteria 3448
1198 Ga0501043_0049660 3300049579 Bacteria 3298
1199 Ga0501043_0129558 3300049579 Bacteria 1977
1200 Ga0501046_0004620 3300049580 Bacteria 12437
1201 Ga0501046_0004930 3300049580 Bacteria 12008
1202 Ga0501046_0023744 3300049580 Bacteria 5039
1203 Ga0501046_0030618 3300049580 Bacteria 4366
1204 Ga0501046_0041485 3300049580 Bacteria 3672
1205 Ga0501047_0000044 3300049581 Bacteria 174789
1206 Ga0501047_0000316 3300049581 Bacteria 55680
1207 Ga0501047_0014278 3300049581 Bacteria 7552
1208 Ga0501047_0014677 3300049581 Bacteria 7454
1209 Ga0501047_0023190 3300049581 Bacteria 5959
1210 Ga0501047_0033027 3300049581 Bacteria 4996
1211 Ga0501047_0034863 3300049581 Bacteria 4858
1212 Ga0501047_0039892 3300049581 Bacteria 4541
1213 Ga0501047_0046028 3300049581 Bacteria 4217
1214 Ga0501047_0062559 3300049581 Bacteria 3589
1215 Ga0501047_0160895 3300049581 Bacteria 2117
1216 Ga0501048_0000117 3300049582 Bacteria 45344
1217 Ga0501048_0000150 3300049582 Bacteria 42721
1218 Ga0501048_0096172 3300049582 Bacteria 2089
1219 Ga0501067_0000938 3300049583 Bacteria 15626
1220 Ga0501067_0013575 3300049583 Bacteria 4511
1221 Ga0501068_0002415 3300049584 Bacteria 9914
1222 Ga0501068_0003582 3300049584 Bacteria 8389
1223 Ga0501068_0003857 3300049584 Bacteria 8138
1224 Ga0501068_0013654 3300049584 Bacteria 4624
1225 Ga0501068_0037876 3300049584 Bacteria 2887
1226 Ga0501069_0003718 3300049585 Bacteria 7844
1227 Ga0501070_0007839 3300049586 Bacteria 9050
1228 Ga0501070_0013553 3300049586 Bacteria 6872
1229 Ga0501070_0020893 3300049586 Bacteria 5493
1230 Ga0501070_0021944 3300049586 Bacteria 5349
1231 Ga0501070_0063600 3300049586 Bacteria 3056
1232 Ga0501071_0012138 3300049587 Bacteria 5829
1233 Ga0501072_0000156 3300049588 Bacteria 50717
1234 Ga0501072_0024705 3300049588 Bacteria 4677
1235 Ga0501072_0030786 3300049588 Bacteria 4198
1236 Ga0501073_0000669 3300049589 Bacteria 24040
1237 Ga0501073_0001123 3300049589 Bacteria 19412
1238 Ga0501073_0012453 3300049589 Bacteria 6205
1239 Ga0501073_0055643 3300049589 Bacteria 2767
1240 Ga0501073_0060632 3300049589 Bacteria 2640
1241 Ga0501073_0076230 3300049589 Bacteria 2333
1242 Ga0501074_0000035 3300049590 Bacteria 64770
1243 Ga0501074_0004481 3300049590 Bacteria 9996
1244 Ga0501074_0042702 3300049590 Bacteria 3280
1245 Ga0501074_0045884 3300049590 Bacteria 3160
1246 Ga0501075_0011391 3300049591 Bacteria 6294
1247 Ga0501076_0033146 3300049592 Bacteria 4033
1248 Ga0501077_0048355 3300049593 Bacteria 2702
1249 Ga0501079_0006733 3300049741 Bacteria 8645
1250 Ga0501079_0012752 3300049741 Bacteria 6420
1251 Ga0501079_0054248 3300049741 Bacteria 3091
1252 Ga0501079_0084001 3300049741 Bacteria 2463
1253 Ga0501080_0001372 3300049742 Bacteria 20366
1254 Ga0501080_0005918 3300049742 Bacteria 10953
1255 Ga0501080_0008844 3300049742 Bacteria 9155
1256 Ga0501080_0012618 3300049742 Bacteria 7746
1257 Ga0501080_0016712 3300049742 Bacteria 6775
1258 Ga0501080_0025835 3300049742 Bacteria 5455
1259 Ga0501080_0047476 3300049742 Bacteria 3997
1260 Ga0501080_0073288 3300049742 Bacteria 3185
1261 Ga0501080_0147701 3300049742 Bacteria 2173
1262 Ga0501080_0227707 3300049742 Bacteria 1704
1263 Ga0501081_0130493 3300049743 Bacteria 1795
1264 Ga0501083_0000641 3300049744 Bacteria 22636
1265 Ga0501083_0002096 3300049744 Bacteria 13707
1266 Ga0501083_0025692 3300049744 Bacteria 4076
1267 Ga0501083_0056150 3300049744 Bacteria 2639
1268 Ga0501035_0000128 3300049822 Bacteria 92297
1269 Ga0501035_0001398 3300049822 Bacteria 24778
1270 Ga0501035_0001896 3300049822 Bacteria 21033
1271 Ga0501035_0003226 3300049822 Bacteria 15629
1272 Ga0501035_0007549 3300049822 Bacteria 10162
1273 Ga0501035_0065467 3300049822 Bacteria 3227
1274 Ga0501035_0120991 3300049822 Bacteria 2288
1275 Ga0501044_0000108 3300049823 Bacteria 100968
1276 Ga0501044_0000144 3300049823 Bacteria 87628
1277 Ga0501044_0004517 3300049823 Bacteria 15560
1278 Ga0501044_0006423 3300049823 Bacteria 12992
1279 Ga0501044_0006995 3300049823 Bacteria 12411
1280 Ga0501044_0009598 3300049823 Bacteria 10531
1281 Ga0501044_0015426 3300049823 Bacteria 8229
1282 Ga0501044_0016058 3300049823 Bacteria 8050
1283 Ga0501044_0084700 3300049823 Bacteria 3203
1284 Ga0501044_0098447 3300049823 Bacteria 2944
1285 Ga0501044_0122369 3300049823 Bacteria 2601
1286 Ga0501045_0002782 3300049824 Bacteria 11952
1287 nmdc:mga03n38_3068_c1 3300050490 Bacteria 5296
1288 nmdc:mga00v17_34356_c1 3300050491 Bacteria 3011
1289 nmdc:mga00v17_7005_c1 3300050491 Bacteria 6001
1290 nmdc:mga0yw44_394_c1 3300050492 Bacteria 14330
1291 nmdc:mga0yw44_53581_c1 3300050492 Bacteria 2451
1292 nmdc:mga06z11_17712_c1 3300050494 Bacteria 3240
1293 nmdc:mga06z11_2169_c1 3300050494 Bacteria 7450
1294 nmdc:mga06z11_43367_c1 3300050494 Bacteria 2263
1295 nmdc:mga04h51_4218_c1 3300050495 Bacteria 3556
1296 nmdc:mga05p37_1114_c1 3300050507 Bacteria 30870
1297 nmdc:mga05p37_12753_c1 3300050507 Bacteria 10045
1298 nmdc:mga05p37_6040_c1 3300050507 Bacteria 14258
1299 nmdc:mga05p37_6080_c1 3300050507 Bacteria 14214
1300 nmdc:mga09592_1302_c1 3300050508 Bacteria 20054
1301 nmdc:mga09592_2437_c1 3300050508 Bacteria 15007
1302 nmdc:mga0qj67_276_c1 3300050509 Bacteria 35718
1303 nmdc:mga0qj67_3495_c1 3300050509 Bacteria 11327
1304 nmdc:mga0qj67_55_c1 3300050509 Bacteria 83015
1305 nmdc:mga06r32_158737_c1 3300050510 Bacteria 2243
1306 nmdc:mga06r32_3415_c1 3300050510 Bacteria 14208
1307 nmdc:mga06r32_3728_c1 3300050510 Bacteria 13639
1308 nmdc:mga06r32_51211_c1 3300050510 Bacteria 3951
1309 nmdc:mga08y16_13103_c1 3300050511 Bacteria 8722
1310 nmdc:mga08y16_189609_c1 3300050511 Bacteria 2133
1311 nmdc:mga08y16_25960_c1 3300050511 Bacteria 6180
1312 nmdc:mga08y16_3668_c1 3300050511 Bacteria 15982
1313 nmdc:mga08y16_3857_c1 3300050511 Bacteria 15589
1314 nmdc:mga08y16_3921_c1 3300050511 Bacteria 15490
1315 nmdc:mga0n895_17357_c1 3300050512 Bacteria 6632
1316 nmdc:mga0n895_3698_c1 3300050512 Bacteria 12366
1317 nmdc:mga0n895_6170_c1 3300050512 Bacteria 10131
1318 nmdc:mga0n895_651_c1 3300050512 Bacteria 24245
1319 nmdc:mga0n895_682_c1 3300050512 Bacteria 23848
1320 nmdc:mga0rr50_2190_c1 3300050513 Bacteria 10950
1321 nmdc:mga0rr50_23079_c1 3300050513 Bacteria 4283
1322 nmdc:mga0rr50_919_c1 3300050513 Bacteria 15930
1323 nmdc:mga0a205_1012_c1 3300050515 Bacteria 23345
1324 nmdc:mga0a205_1633_c1 3300050515 Bacteria 19288
1325 nmdc:mga0a205_89051_c1 3300050515 Bacteria 2983
1326 Ga0495601_0000008 3300053077 Bacteria 362152
1327 Ga0495601_0000128 3300053077 Bacteria 42850
1328 Ga0495601_0001082 3300053077 Bacteria 14935
1329 Ga0495601_0003910 3300053077 Bacteria 8565
1330 Ga0495601_0004226 3300053077 Bacteria 8290
1331 Ga0495601_0005377 3300053077 Bacteria 7459
1332 Ga0495601_0006799 3300053077 Bacteria 6697
1333 Ga0495601_0021111 3300053077 Bacteria 3985
1334 Ga0495601_0022129 3300053077 Bacteria 3901
1335 Ga0495601_0030518 3300053077 Bacteria 3347
1336 Ga0495601_0053187 3300053077 Bacteria 2559
1337 Ga0495612_0000002 3300053078 Bacteria 310466
1338 Ga0495612_0002018 3300053078 Bacteria 8363
1339 Ga0495612_0002324 3300053078 Bacteria 7835
1340 Ga0495612_0004821 3300053078 Bacteria 5585
1341 Ga0495612_0028142 3300053078 Bacteria 2262
1342 Ga0495612_0031191 3300053078 Bacteria 2148
1343 Ga0500635_0000853 3300053080 Bacteria 7488
1344 Ga0495655_0001385 3300053083 Bacteria 3725
1345 Ga0495595_0000008 3300053084 Bacteria 196206
1346 Ga0495595_0003217 3300053084 Bacteria 6484
1347 Ga0495595_0004385 3300053084 Bacteria 5679
1348 Ga0495595_0006145 3300053084 Bacteria 4882
1349 Ga0495595_0014384 3300053084 Bacteria 3356
1350 Ga0495619_0000002 3300053085 Bacteria 530226
1351 Ga0495619_0000016 3300053085 Bacteria 231442
1352 Ga0495619_0000231 3300053085 Bacteria 40742
1353 Ga0495619_0000252 3300053085 Bacteria 38976
1354 Ga0495619_0000406 3300053085 Bacteria 29319
1355 Ga0495619_0000974 3300053085 Bacteria 18750
1356 Ga0495619_0002852 3300053085 Bacteria 11264
1357 Ga0495619_0010526 3300053085 Bacteria 5819
1358 Ga0495619_0014426 3300053085 Bacteria 4991
1359 Ga0495619_0031485 3300053085 Bacteria 3437
1360 Ga0500643_000079 3300053087 Bacteria 104107
1361 Ga0500643_003892 3300053087 Bacteria 6935
1362 Ga0500644_0002084 3300053088 Bacteria 5078
1363 Ga0500651_0010373 3300053093 Bacteria 5582
1364 Ga0500566_0002184 3300053094 Bacteria 11532
1365 Ga0500566_0002304 3300053094 Bacteria 11295
1366 Ga0500641_0011471 3300053096 Bacteria 3217
1367 Ga0500650_0026000 3300053098 Bacteria 2622
1368 Ga0500555_014708 3300053103 Bacteria 2256
1369 Ga0500555_016186 3300053103 Bacteria 2149
1370 Ga0500556_0000005 3300053104 Bacteria 581135
1371 Ga0500556_0000250 3300053104 Bacteria 43584
1372 Ga0500556_0008341 3300053104 Bacteria 2986
1373 Ga0500557_000100 3300053105 Bacteria 26874
1374 Ga0500562_000167 3300053108 Bacteria 18265
1375 Ga0500562_014811 3300053108 Bacteria 1998
1376 Ga0500572_001778 3300053111 Bacteria 5539
1377 Ga0500592_000696 3300053116 Bacteria 5534
1378 Ga0500595_000010 3300053119 Bacteria 275806
1379 Ga0500595_003306 3300053119 Bacteria 7587
1380 Ga0500595_003815 3300053119 Bacteria 6930
1381 Ga0500595_004235 3300053119 Bacteria 6481
1382 Ga0500595_006137 3300053119 Bacteria 5144
1383 Ga0500595_022046 3300053119 Bacteria 2263
1384 Ga0500608_000199 3300053122 Bacteria 23889
1385 Ga0500608_000330 3300053122 Bacteria 18247
1386 Ga0500642_0000009 3300053130 Bacteria 286829
1387 Ga0500642_0000562 3300053130 Bacteria 11248
1388 Ga0500642_0039030 3300053130 Bacteria 2039
1389 Ga0500559_0000696 3300053136 Bacteria 22137
1390 Ga0500559_0001190 3300053136 Bacteria 15467
1391 Ga0500573_0013027 3300053140 Bacteria 4678
1392 Ga0500586_000887 3300053145 Bacteria 6169
1393 Ga0500616_0000001 3300053153 Bacteria 1986011
1394 Ga0500616_0000035 3300053153 Bacteria 394242
1395 Ga0500616_0000038 3300053153 Bacteria 386801
1396 Ga0500616_0024308 3300053153 Bacteria 3369
1397 Ga0500620_001131 3300053155 Bacteria 4734
1398 Ga0500622_0003335 3300053156 Bacteria 10828
1399 Ga0500638_001356 3300053162 Bacteria 7566
1400 Ga0500639_029084 3300053163 Bacteria 2919
1401 Ga0500636_0000407 3300053177 Bacteria 23672
1402 Ga0500636_0004693 3300053177 Bacteria 7757
1403 Ga0500637_0000366 3300053178 Bacteria 17135
1404 Ga0500576_024767 3300053725 Bacteria 2736
1405 Ga0500645_002629 3300053730 Bacteria 7863
1406 Ga0500599_002488 3300053736 Bacteria 2211
1407 Ga0501084_0002007 3300054114 Bacteria 16265
1408 Ga0501084_0011232 3300054114 Bacteria 7414
1409 Ga0500661_004901 3300055283 Bacteria 2504
1410 Ga0501082_0000002 3300060353 Bacteria 186546
1411 Ga0501082_0002249 3300060353 Bacteria 16902
1412 Ga0501082_0014678 3300060353 Bacteria 6750
1413 Ga0501082_0050425 3300060353 Bacteria 3589
1414 Ga0501082_0058902 3300060353 Bacteria 3309
1415 Ga0501082_0062334 3300060353 Bacteria 3210
1416 Ga0501082_0120978 3300060353 Bacteria 2269
1417 Ga0466962_0031646 3300061719 Bacteria 2533
1418 2507504659 2507262055 Bacteria 8048963
1419 2508539620 2508501009 Bacteria 7784016
1420 2508694936 2508501042 Bacteria 8719808
1421 2508727710 2508501050 Bacteria 9633614
1422 2509077605 2508501114 Bacteria 7082538
1423 2509149897 2508501128 Bacteria 8613869
1424 2513590572 2513237087 Bacteria 5817514
1425 2513627007 2513237092 Bacteria 8341956
1426 2513638542 2513237094 Bacteria 8789602
1427 2513653109 2513237095 Bacteria 8976980
1428 2513658971 2513237096 Bacteria 8722461
1429 2513698962 2513237101 Bacteria 7952346
1430 2513699150 2513237102 Bacteria 7703324
1431 2513714858 2513237104 Bacteria 10034502
1432 2513863890 2513237137 Bacteria 9558895
1433 2513875656 2513237139 Bacteria 8737671
1434 2513889635 2513237141 Bacteria 8496279
1435 2513921235 2513237145 Bacteria 8979722
1436 2514016324 2513237161 Bacteria 8871253
1437 2515624125 2515154112 Bacteria 8294334
1438 2517105836 2517093001 Bacteria 9002274
1439 2517889334 2517572143 Bacteria 9484767
1440 2524438627 2524023205 Bacteria 8918781
1441 2524540382 2524023228 Bacteria 10118060
1442 2528851479 2528768022 Bacteria 10457665
1443 2603857933 2602042107 Bacteria 6226103
1444 2617347489 2617270735 Bacteria 9163226
1445 2617377108 2617270741 Bacteria 8201522
1446 2643758733 2643221547 Bacteria 4740017
1447 2644290592 2643221651 Bacteria 4798932
1448 2671121381 2667528175 Bacteria 7532676
1449 2715501514 2713897090 Bacteria 3353799
1450 2723849158 2721755755 Bacteria 8322773
1451 2728754266 2728368998 Bacteria 8720350
1452 2739792036 2739367756 Bacteria 4553612
1453 2745077656 2744054633 Bacteria 8678936
1454 2774869106 2773857925 Bacteria 6472445
1455 2776258439 2775506901 Bacteria 9631051
1456 2793063267 2791355196 Bacteria 7323613
1457 2793070999 2791355197 Bacteria 8420563
1458 2793078485
1459 2805919332 2802429603 Bacteria 8777136
1460 2818243395 2816332527 Bacteria 8933356
1461 2824622538 2824617872 Bacteria 8814715
1462 2824633899 2824626560 Bacteria 8813858
1463 2824674711 2824671348 Bacteria 8369588
1464 2824684144 2824679649 Bacteria 8248951
1465 2824752539 2824746037 Bacteria 7911610
1466 2824770620 2824763712 Bacteria 9792355
1467 2824780169 2824773399 Bacteria 8360218
1468 2828309284 2828305725 Bacteria 4916900
1469 2835319702 2835312727 Bacteria 7413381
1470 2838130268 2838122688 Bacteria 8803140
1471 2840882151 2840878972 Bacteria 5483153
1472 2841944289 2841941048 Bacteria 8688029
1473 2841954534 2841949485 Bacteria 8680857
1474 2841963417 2841957949 Bacteria 8652217
1475 2841969066 2841966195 Bacteria 8673214
1476 2841979840 2841974524 Bacteria 8931498
1477 2841989562 2841983080 Bacteria 8395090
1478 2842044067 2842038055 Bacteria 8002051
1479 2842051944 2842045827 Bacteria 8006841
1480 2844316036 2844315083 Bacteria 8138177
1481 2847931523 2847930680 Bacteria 9342022
1482 2847941583 2847939898 Bacteria 8606328
1483 2849082506 2849076700 Bacteria 7039503
1484 2854682524 2854681122 Bacteria 4548679
1485 2857515803 2857509624 Bacteria 7472071
1486 2857527308 2857524615 Bacteria 6615449
1487 2874593152 2874590934 Bacteria 8299676
1488 2874606904 2874604998 Bacteria 7834745
1489 2874620262 2874612657 Bacteria 8252029
1490 2874634319 2874628541 Bacteria 8630250
1491 2874645726 2874645413 Bacteria 8214782
1492 2876763384 2876761206 Bacteria 10111113
1493 2876773192 2876771140 Bacteria 8287509
1494 2876810693 2876808645 Bacteria 8824342
1495 2876820499 2876818435 Bacteria 8274608
1496 2879076862 2879074833 Bacteria 8279565
1497 2879091353 2879083081 Bacteria 8587928
1498 2879100198 2879099564 Bacteria 10442239
1499 2879112586 2879110137 Bacteria 8907982
1500 2879131049 2879127579 Bacteria 8294491
1501 2879150256 2879142872 Bacteria 8267021
1502 2881364926 2881364244 Bacteria 7710352
1503 2881673181 2881665667 Bacteria 8175609
1504 2882461321 2882456835 Bacteria 6863978
1505 2883579066 2883577096 Bacteria 4709178
1506 2884301165 2884298095 Bacteria 3823049
1507 2885368169 2885366525 Bacteria 8326213
1508 2885377768 2885374607 Bacteria 8927485
1509 2885413754 2885409591 Bacteria 9235467
1510 2888378828 2888378607 Bacteria 9652610
1511 2888391194 2888388044 Bacteria 7304136
1512 2888427253 2888419890 Bacteria 7857137
1513 2889036148 2889033259 Bacteria 9099371
1514 2893071848 2893066018 Bacteria 6158120
1515 2894242173 2894232714 Bacteria 8834183
1516 2898796745 2898795034 Bacteria 4294459
1517 2899261333 2899259804 Bacteria 3320927
1518 2903729568 2903727486 Bacteria 8281579
1519 2903752982 2903748898 Bacteria 9972761
1520 2904692460 2904690495 Bacteria 9412302
1521 2904709209
1522 2904719866 2904711408 Bacteria 9771557
1523 2906606073 2906602504 Bacteria 8295279
1524 2906613186
1525 2906635069 2906626472 Bacteria 8826946
1526 2906645643 2906643746 Bacteria 8722424
1527 2906668658 2906660503 Bacteria 8595048
1528 2908747943 2908739725 Bacteria 8628932
1529 2908764386 2908756301 Bacteria 8864324
1530 2908783020 2908775508 Bacteria 8092255
1531 2919078424 2919073203 Bacteria 6531949
1532 2919454756 2919450847 Bacteria 5631160
1533 2919679194 2919679072 Bacteria 4629602
1534 2922364526 2922361189 Bacteria 7436256
1535 2922378532
1536 2922400950 2922393267 Bacteria 8285685
1537 2922433685
1538 2929623662 2929615660 Bacteria 9193770
1539 2929632870 2929624759 Bacteria 9339455
1540 2932786153 2932784394 Bacteria 9704911
1541 2932799521 2932794094 Bacteria 7915132
1542 2932805173 2932801729 Bacteria 7987968
1543 2932816886 2932809354 Bacteria 9135765
1544 2932826026 2932818245 Bacteria 9955613
1545 2932829416 2932828146 Bacteria 9745859
1546 2933585565 2933577622 Bacteria 9116884
1547 2935615149 2935608549 Bacteria 8203142
1548 2935617849 2935616580 Bacteria 9032984
1549 2935634729 2935630451 Bacteria 8169952
1550 2935647822 2935638405 Bacteria 10015038
1551 2935651494 2935648319 Bacteria 8801166
1552 2935659738 2935656913 Bacteria 8965014
1553 2935674765 2935665750 Bacteria 9571747
1554 2935678127 2935675223 Bacteria 9928132
1555 2935692415 2935684952 Bacteria 9590419
1556 2935699367 2935694250 Bacteria 9291695
1557 2935707098 2935703347 Bacteria 10242284
1558 2935721033 2935713505 Bacteria 9608509
1559 2935722858 2935722832 Bacteria 9608746
1560 2935739722 2935732158 Bacteria 9706831
1561 2935748760 2935741537 Bacteria 9707219
1562 2935758630 2935750917 Bacteria 9590372
1563 2935764610 2935760218 Bacteria 9817913
1564 2935775507 2935769743 Bacteria 7878163
1565 2935790003 2935785616 Bacteria 7962367
1566 2935798432 2935793552 Bacteria 8012592
1567 2935806660 2935801545 Bacteria 9301974
1568 2935819079 2935810662 Bacteria 9401221
1569 2935825814 2935819856 Bacteria 8261050
1570 2935837306 2935827899 Bacteria 10038562
1571 2935842007 2935837841 Bacteria 9454360
1572 2935851433 2935847175 Bacteria 8228321
1573 2935856652 2935855204 Bacteria 9035059
1574 2935872940 2935864058 Bacteria 9784707
1575 2935874383 2935873716 Bacteria 9632195
1576 2935887737 2935883170 Bacteria 7964738
1577 2935910540 2935908558 Bacteria 8568796
1578 2935918056 2935916978 Bacteria 9113783
1579 2935927549 2935926038 Bacteria 8601059
1580 2935936579 2935934488 Bacteria 8602579
1581 2935943868 2935942939 Bacteria 8599779
1582 2935952305 2935951376 Bacteria 8602333
1583 2935967315 2935959822 Bacteria 7869783
1584 2935969145 2935967501 Bacteria 8603075
1585 2935982317 2935975950 Bacteria 8347125
1586 2935984596 2935984226 Bacteria 8302647
1587 2936001097 2935992306 Bacteria 9802711
1588 2936010751 2936002035 Bacteria 9362176
1589 2936014154 2936011229 Bacteria 8801034
1590 2936022937 2936019824 Bacteria 8804134
1591 2936031073 2936028420 Bacteria 8965941
1592 2936045770 2936037263 Bacteria 9446081
1593 2936049195 2936046547 Bacteria 8903709
1594 2936055641 2936055302 Bacteria 8785755
1595 2940564780 2940556831 Bacteria 9590747
1596 2941511941 2941507105 Bacteria 8166816
1597 2941519643 2941515067 Bacteria 8166720
1598 2941527665 2941523033 Bacteria 8169134
1599 2941535897 2941531003 Bacteria 7653939
1600 2941547058 2941538514 Bacteria 9402094
1601 3000019575 3000017691 Bacteria 3772574
1602 3000405688 3000405567 Bacteria 3779330
1603 3005483340 3005474847 Bacteria 9259049
1604 3005490497 3005483717 Bacteria 7877331
1605 3005509709 3005506211 Bacteria 6943378
1606 3005591200 3005587118 Bacteria 7794411
1607 3005595628 3005594810 Bacteria 8716512
1608 3005711619 3005710791 Bacteria 7622528
1609 3005718869 3005718088 Bacteria 8283608
1610 8001850365 8001845381 Bacteria 5804942
1611 8006930317 8006926726 Bacteria 6749210
1612 8006935716 8006933436 Bacteria 10410654
1613 8006967698 8006964411 Bacteria 8966052
1614 8006975637 8006973647 Bacteria 10679141
1615 8006992647 8006984368 Bacteria 9651211
1616 8006998366 8006994254 Bacteria 8309700
1617 8016518819 8016511872 Bacteria 9921665
1618 8016525626 8016522445 Bacteria 8156687
1619 8016539219 8016530956 Bacteria 8155261
1620 8016549787 8016548790 Bacteria 8155074
1621 8016558201 8016557553 Bacteria 8154380
1622 8016568909 8016566248 Bacteria 8158151
1623 8016581557 8016575299 Bacteria 8154085
1624 8016587087 8016583857 Bacteria 10421953
1625 8016596201 8016595262 Bacteria 8149947
1626 8016607104 8016603502 Bacteria 8731218
1627 8016619002 8016613128 Bacteria 8794220
1628 8016630583 8016622563 Bacteria 7999408
1629 8016636507 8016630954 Bacteria 9217207
1630 8019549536 8019547302 Bacteria 7996444
1631 8019563075 8019555841 Bacteria 9642137
1632 8019573156 8019565922 Bacteria 9639779
1633 8019577866 8019576017 Bacteria 10049540
1634 8019595969 8019586578 Bacteria 10212056
1635 8019605787 8019597564 Bacteria 10041141
1636 8019623481 8019619141 Bacteria 9218857
1637 8019638661 8019629233 Bacteria 8687553
1638 8019641077 8019638758 Bacteria 9062356
1639 8019653180 8019648815 Bacteria 10014479
1640 8019666462 8019659431 Bacteria 8577854
1641 8019679861 8019678201 Bacteria 8863603
1642 8019696897 8019687851 Bacteria 8712826
1643 8045866173 8045864390 Bacteria 5043873
1644 8055750831 8055742211 Bacteria 9226248
1645 8056678404 8056673599 Bacteria 7871253
1646 8056694081 8056689827 Bacteria 6712655
1647 8056970655 8056967851 Bacteria 9038162
1648 8057136868 8057132660 Bacteria 4061191
1649 Ga0099794_10007030
1650 2214544925
1651 ARSoilYngRDRAFT_c00196
1652 ARcpr5yngRDRAFT_c000115
1653 ARSoilOldRDRAFT_c000011
1654 ARCol0oldRDRAFT_c00183
1655 ARCol0yngRDRAFT_1000146
1656 JGI24746J21847_1001493
1657 JGI24739J22299_10000724
1658 JGI24737J22298_10017327
1659 JGI24743J22301_10000145
1660 JGI24750J21931_1000096
1661 JGI24750J21931_1000628
1662 JGI24745J21846_1000468
1663 JGI24034J26672_10000231
1664 JGI24742J22300_10000137
1665 JGI24742J22300_10000225
1666 JGI24751J29686_10005184
1667 JGI25406J46586_10002038
1668 JGI25406J46586_10006723
1669 JGI25153J46596_10005134
1670 JGI25153J46596_10008913
1671 JGI25160J50197_1010421
1672 Ga0055524_1010431
1673 Ga0055531_10001561
1674 Ga0055543_1005034
1675 Ga0065165_1004017
1676 Ga0065165_1016982
1677 Ga0065712_10002828
1678 Ga0065712_10104129
1679 Ga0065715_10001079
1680 Ga0065715_10106350
1681 Ga0070676_10000506
1682 Ga0070683_100009453
1683 Ga0070683_100029992
1684 Ga0070683_100098852
1685 Ga0070690_100002629
1686 Ga0070690_100006878
1687 Ga0070690_100061831
1688 Ga0070690_100066516
1689 Ga0070670_100023715
1690 Ga0070677_10000227
1691 Ga0068869_100001832
1692 Ga0068869_100062645
1693 Ga0070666_10005187
1694 Ga0070680_100003424
1695 Ga0070680_100039841
1696 Ga0070680_100048147
1697 Ga0070680_100067147
1698 Ga0070680_100123735
1699 Ga0070680_100124176
1700 Ga0070682_100001699
1701 Ga0070682_100012002
1702 Ga0070682_100066044
1703 Ga0068868_100003128
1704 Ga0068868_100007757
1705 Ga0068868_100089723
1706 Ga0070660_100044302
1707 Ga0070660_100078764
1708 Ga0070689_100000668
1709 Ga0070689_100001841
1710 Ga0070689_100002942
1711 Ga0070689_100015324
1712 Ga0070689_100065179
1713 Ga0070691_10020196
1714 Ga0070691_10050495
1715 Ga0070687_100000527
1716 Ga0070661_100003238
1717 Ga0070692_10010704
1718 Ga0070692_10055383
1719 Ga0070668_100003117
1720 Ga0070669_100001315
1721 Ga0070669_100072348
1722 Ga0070669_100114625
1723 Ga0070675_100002954
1724 Ga0070675_100037764
1725 Ga0070675_100040190
1726 Ga0070675_100142502
1727 Ga0070671_100005343
1728 Ga0070671_100006990
1729 Ga0070671_100012266
1730 Ga0070671_100024307
1731 Ga0070671_100032237
1732 Ga0070671_100033261
1733 Ga0070674_100002968
1734 Ga0070674_100025125
1735 Ga0070673_100010750
1736 Ga0070673_100015906
1737 Ga0070673_100034527
1738 Ga0070688_100001124
1739 Ga0070688_100001239
1740 Ga0070688_100034220
1741 Ga0070688_100050115
1742 Ga0070659_100002622
1743 Ga0070659_100015601
1744 Ga0070659_100019333
1745 Ga0070667_100005188
1746 Ga0070703_10016096
1747 Ga0070709_10002507
1748 Ga0070709_10009423
1749 Ga0070709_10012754
1750 Ga0070709_10026735
1751 Ga0070709_10054804
1752 Ga0070714_100009155
1753 Ga0070714_100028781
1754 Ga0070714_100051704
1755 Ga0070714_100073185
1756 Ga0070714_100082668
1757 Ga0070710_10000903
1758 Ga0070710_10004937
1759 Ga0070710_10020747
1760 Ga0070710_10036876
1761 Ga0070701_10007244
1762 Ga0070701_10053875
1763 Ga0070711_100012263
1764 Ga0070711_100017211
1765 Ga0070711_100025613
1766 Ga0070711_100035725
1767 Ga0070711_100045660
1768 Ga0070705_100001458
1769 Ga0070700_100001211
1770 Ga0070700_100010023
1771 Ga0070700_100017124
1772 Ga0070694_100001764
1773 Ga0070663_100000761
1774 Ga0070663_100009537
1775 Ga0070663_100018311
1776 Ga0070663_100024383
1777 Ga0070678_100000525
1778 Ga0070678_100029237
1779 Ga0070678_100075040
1780 Ga0070662_100002656
1781 Ga0070662_100070763
1782 Ga0070662_100071322
1783 Ga0070662_100077875
1784 Ga0070681_10004977
1785 Ga0070681_10037132
1786 Ga0070681_10120278
1787 Ga0070681_10124495
1788 Ga0070681_10145457
1789 Ga0068867_100002950
1790 Ga0070685_10004716
1791 Ga0070685_10011159
1792 Ga0070699_100057122
1793 Ga0070679_100007748
1794 Ga0070679_100010782
1795 Ga0070679_100022232
1796 Ga0070679_100058286
1797 Ga0070679_100065645
1798 Ga0070679_100148160
1799 Ga0070684_100005941
1800 Ga0070684_100056781
1801 Ga0070684_100086347
1802 Ga0070684_100169813
1803 Ga0070697_100034721
1804 Ga0068853_100003070
1805 Ga0068853_100049207
1806 Ga0068853_100056561
1807 Ga0068853_100059817
1808 Ga0068853_100069156
1809 Ga0068853_100165439
1810 Ga0070672_100002960
1811 Ga0070672_100062100
1812 Ga0070672_100103387
1813 Ga0070686_100001573
1814 Ga0070686_100008515
1815 Ga0070695_100002369
1816 Ga0070696_100031689
1817 Ga0070693_100000880
1818 Ga0070693_100037923
1819 Ga0070693_100055925
1820 Ga0070665_100055045
1821 Ga0070665_100080377
1822 Ga0070665_100155774
1823 Ga0070665_100201318
1824 Ga0070704_100001917
1825 Ga0068855_100009051
1826 Ga0068855_100019978
1827 Ga0068855_100048708
1828 Ga0068855_100083697
1829 Ga0070664_100002660
1830 Ga0070664_100002934
1831 Ga0070664_100022881
1832 Ga0068857_100000358
1833 Ga0068857_100034853
1834 Ga0068857_100049440
1835 Ga0068854_100007075
1836 Ga0068854_100031509
1837 Ga0068854_100047206
1838 Ga0068854_100102802
1839 Ga0068856_100003436
1840 Ga0068856_100015293
1841 Ga0068856_100094517
1842 Ga0070702_100000526
1843 Ga0070702_100003230
1844 Ga0070702_100011165
1845 Ga0068852_100009893
1846 Ga0068852_100061935
1847 Ga0068859_100005591
1848 Ga0068859_100027680
1849 Ga0068864_100001988
1850 Ga0068866_10000916
1851 Ga0068861_100001805
1852 Ga0068861_100140817
1853 Ga0068851_10013003
1854 Ga0068851_10047779
1855 Ga0068870_10000025
1856 Ga0068863_100115350
1857 Ga0068863_100166408
1858 Ga0068858_100003227
1859 Ga0068858_100027064
1860 Ga0068860_100007120
1861 Ga0068860_100008962
1862 Ga0068860_100135000
1863 Ga0068862_100011988
1864 Ga0068862_100017821
1865 Ga0068862_100145990
1866 Ga0068862_100153724
1867 Ga0081455_10000276
1868 Ga0081455_10002463
1869 Ga0081455_10005910
1870 Ga0081455_10020788
1871 Ga0081455_10050490
1872 Ga0081455_10051347
1873 Ga0081455_10062051
1874 Ga0081538_10006470
1875 Ga0081538_10012206
1876 Ga0081540_1000075
1877 Ga0081540_1004394
1878 Ga0081540_1004944
1879 Ga0081540_1020408
1880 Ga0081540_1021191
1881 Ga0081540_1030810
1882 Ga0081540_1038950
1883 Ga0081539_10000040
1884 Ga0081539_10001975
1885 Ga0081539_10016429
1886 Ga0070717_10006939
1887 Ga0070717_10028486
1888 Ga0070717_10049387
1889 Ga0075365_10004228
1890 Ga0075365_10065035
1891 Ga0075368_10018327
1892 Ga0075363_100016540
1893 Ga0075363_100026212
1894 Ga0075364_10014353
1895 Ga0070715_10001500
1896 Ga0070715_10011258
1897 Ga0070712_100001447
1898 Ga0070712_100002943
1899 Ga0070712_100016890
1900 Ga0070712_100044119
1901 Ga0075362_10003665
1902 Ga0075367_10004928
1903 Ga0075367_10044929
1904 Ga0097621_100000456
1905 Ga0097621_100037561
1906 Ga0075370_10043991
1907 Ga0068871_100000269
1908 Ga0068871_100049393
1909 Ga0075428_100000690
1910 Ga0075428_100013445
1911 Ga0075428_100024912
1912 Ga0075428_100116778
1913 Ga0075430_100000092
1914 Ga0075430_100000094
1915 Ga0075430_100069749
1916 Ga0075431_100002169
1917 Ga0075431_100004121
1918 Ga0075431_100102463
1919 Ga0075433_10001242
1920 Ga0075433_10079040
1921 Ga0075434_100000299
1922 Ga0075434_100011399
1923 Ga0075434_100029399
1924 Ga0075434_100155179
1925 Ga0075429_100002930
1926 Ga0075429_100022441
1927 Ga0075429_100057386
1928 Ga0068865_100001731
1929 Ga0068865_100025293
1930 Ga0068865_100063086
1931 Ga0075436_100009525
1932 Ga0097620_100005590
1933 Ga0097620_100027680
1934 Ga0099824_1005597
1935 Ga0099822_1029915
1936 Ga0075435_100004453
1937 Ga0075435_100018551
1938 Ga0075435_100068134
1939 Ga0105251_10011399
1940 Ga0105240_10004679
1941 Ga0105240_10030589
1942 Ga0105240_10049444
1943 Ga0105240_10150088
1944 Ga0111539_10003217
1945 Ga0111539_10003331
1946 Ga0111539_10007321
1947 Ga0111539_10014441
1948 Ga0111539_10018158
1949 Ga0111539_10173984
1950 Ga0111539_10239665
1951 Ga0105245_10000183
1952 Ga0105245_10000837
1953 Ga0105245_10068437
1954 Ga0105245_10074891
1955 Ga0105247_10028634
1956 Ga0105247_10065605
1957 Ga0114129_10001218
1958 Ga0114129_10002246
1959 Ga0114129_10020755
1960 Ga0114129_10060727
1961 Ga0114129_10077847
1962 Ga0105243_10001561
1963 Ga0105243_10011635
1964 Ga0105243_10037604
1965 Ga0105243_10038555
1966 Ga0105243_10056281
1967 Ga0105241_10003567
1968 Ga0105241_10017304
1969 Ga0105241_10027426
1970 Ga0105242_10000701
1971 Ga0105242_10012638
1972 Ga0105242_10023312
1973 Ga0105248_10006263
1974 Ga0105248_10011058
1975 Ga0105248_10072442
1976 Ga0105248_10156269
1977 Ga0105237_10088204
1978 Ga0105237_10118300
1979 Ga0105237_10128712
1980 Ga0105237_10144832
1981 Ga0105238_10002649
1982 Ga0105238_10048497
1983 Ga0105238_10127490
1984 Ga0105249_10009795
1985 Ga0105249_10121261
1986 Ga0105239_10007315
1987 Ga0105239_10036529
1988 Ga0105239_10174368
1989 Ga0105246_10002447
1990 Ga0105246_10044208
1991 Ga0157373_10001725
1992 Ga0157373_10004265
1993 Ga0157373_10098846
1994 Ga0157371_10004441
1995 Ga0157370_10040794
1996 Ga0157370_10062026
1997 Ga0157370_10072847
1998 Ga0157370_10093233
1999 Ga0157370_10151965
2000 Ga0157369_10164915
2001 Ga0157374_10000463
2002 Ga0157374_10029135
2003 Ga0157374_10038879
2004 Ga0157378_10000613
2005 Ga0157378_10005022
2006 Ga0163162_10005908
2007 Ga0163162_10105052
2008 Ga0157375_10004786
2009 Ga0157375_10148713
2010 Ga0163163_10001239
2011 Ga0163163_10015456
2012 Ga0163163_10064891
2013 Ga0163163_10109370
2014 Ga0157380_10005539
2015 Ga0157380_10007021
2016 Ga0157379_10003902
2017 Ga0157379_10004696
2018 Ga0157379_10010527
2019 Ga0157376_10004121
2020 Ga0183365_10005
2021 Ga0163161_10001492
2022 Ga0163161_10016341
2023 Ga0214544_1000007
2024 Ga0214542_1000007
2025 Ga0214545_1000006
2026 Ga0214543_1000009
2027 Ga0213873_10004647
2028 Ga0213876_10011819
2029 Ga0213876_10026411
2030 Ga0213875_10000011
2031 Ga0209563_100836
2032 Ga0209677_100870
2033 Ga0209677_103014
2034 Ga0209148_1000819
2035 Ga0209148_1003093
2036 Ga0209233_1002233
2037 Ga0209233_1002460
2038 Ga0209673_1021407
2039 Ga0207673_1000039
2040 Ga0209564_1000842
2041 Ga0209564_1004040
2042 Ga0209758_1000015
2043 Ga0209758_1000161
2044 Ga0209758_1000798
2045 Ga0209758_1001478
2046 Ga0209758_1003077
2047 Ga0209758_1006528
2048 Ga0207426_1000186
2049 Ga0209257_1000983
2050 Ga0207697_10000763
2051 Ga0207656_10005224
2052 Ga0207653_10016374
2053 Ga0207682_10000062
2054 Ga0207692_10012844
2055 Ga0207642_10002857
2056 Ga0207710_10009862
2057 Ga0207710_10015503
2058 Ga0207688_10001992
2059 Ga0207688_10006793
2060 Ga0207680_10000740
2061 Ga0207647_10003504
2062 Ga0207647_10011763
2063 Ga0207647_10044532
2064 Ga0207647_10047561
2065 Ga0207685_10000809
2066 Ga0207699_10001144
2067 Ga0207699_10019708
2068 Ga0207645_10000248
2069 Ga0207645_10041103
2070 Ga0207643_10000064
2071 Ga0207643_10057354
2072 Ga0207654_10000874
2073 Ga0207654_10001623
2074 Ga0207707_10002084
2075 Ga0207707_10015886
2076 Ga0207707_10088287
2077 Ga0207695_10000006
2078 Ga0207695_10053399
2079 Ga0207695_10072745
2080 Ga0207695_10131584
2081 Ga0207671_10001082
2082 Ga0207671_10016546
2083 Ga0207671_10047462
2084 Ga0207693_10001801
2085 Ga0207693_10002520
2086 Ga0207693_10020205
2087 Ga0207693_10028189
2088 Ga0207693_10029262
2089 Ga0207693_10047590
2090 Ga0207693_10058667
2091 Ga0207693_10093764
2092 Ga0207663_10000260
2093 Ga0207663_10009733
2094 Ga0207663_10031931
2095 Ga0207660_10000194
2096 Ga0207660_10001899
2097 Ga0207660_10065909
2098 Ga0207662_10001637
2099 Ga0207662_10025322
2100 Ga0207662_10035289
2101 Ga0207657_10003965
2102 Ga0207657_10006919
2103 Ga0207657_10035372
2104 Ga0207649_10000234
2105 Ga0207649_10059410
2106 Ga0207652_10001613
2107 Ga0207652_10002210
2108 Ga0207652_10014326
2109 Ga0207652_10059725
2110 Ga0207681_10000794
2111 Ga0207694_10000306
2112 Ga0207650_10024593
2113 Ga0207650_10030481
2114 Ga0207659_10000172
2115 Ga0207659_10028313
2116 Ga0207659_10036392
2117 Ga0207659_10119127
2118 Ga0207687_10002217
2119 Ga0207700_10012823
2120 Ga0207700_10022444
2121 Ga0207700_10117488
2122 Ga0207664_10016500
2123 Ga0207664_10023534
2124 Ga0207644_10040591
2125 Ga0207644_10066567
2126 Ga0207690_10000796
2127 Ga0207690_10011303
2128 Ga0207690_10076263
2129 Ga0207706_10005059
2130 Ga0207706_10062109
2131 Ga0207706_10092551
2132 Ga0207686_10001093
2133 Ga0207709_10001438
2134 Ga0207709_10010457
2135 Ga0207709_10035895
2136 Ga0207709_10064502
2137 Ga0207670_10000608
2138 Ga0207670_10000807
2139 Ga0207670_10052583
2140 Ga0207669_10000141
2141 Ga0207669_10036469
2142 Ga0207704_10000755
2143 Ga0207704_10008791
2144 Ga0207665_10004374
2145 Ga0207665_10004936
2146 Ga0207665_10017370
2147 Ga0207691_10000720
2148 Ga0207691_10002355
2149 Ga0207691_10006997
2150 Ga0207691_10062352
2151 Ga0207691_10084978
2152 Ga0207711_10004836
2153 Ga0207711_10032056
2154 Ga0207711_10091468
2155 Ga0207711_10093668
2156 Ga0207689_10004430
2157 Ga0207689_10018680
2158 Ga0207661_10000098
2159 Ga0207661_10007875
2160 Ga0207679_10000174
2161 Ga0207679_10004250
2162 Ga0207679_10048313
2163 Ga0207667_10004743
2164 Ga0207667_10029793
2165 Ga0207667_10055800
2166 Ga0207667_10059856
2167 Ga0207651_10002999
2168 Ga0207651_10101017
2169 Ga0207712_10000659
2170 Ga0207668_10001107
2171 Ga0207668_10038300
2172 Ga0207640_10000846
2173 Ga0207640_10071028
2174 Ga0207658_10001843
2175 Ga0207658_10036240
2176 Ga0207677_10002504
2177 Ga0207677_10044516
2178 Ga0207703_10002433
2179 Ga0207703_10005387
2180 Ga0207703_10088155
2181 Ga0207639_10001774
2182 Ga0207639_10007131
2183 Ga0207639_10022198
2184 Ga0207678_10001059
2185 Ga0207678_10009212
2186 Ga0207678_10031363
2187 Ga0207678_10057982
2188 Ga0207678_10080115
2189 Ga0207708_10001417
2190 Ga0207708_10002793
2191 Ga0207708_10063316
2192 Ga0207702_10000122
2193 Ga0207702_10007668
2194 Ga0207702_10008899
2195 Ga0207702_10134619
2196 Ga0207641_10000622
2197 Ga0207641_10007557
2198 Ga0207648_10009300
2199 Ga0207676_10002696
2200 Ga0207676_10026665
2201 Ga0207674_10001342
2202 Ga0207674_10014657
2203 Ga0207674_10017155
2204 Ga0207674_10046931
2205 Ga0207674_10144681
2206 Ga0207675_100006706
2207 Ga0207675_100011711
2208 Ga0207683_10001193
2209 Ga0207683_10045199
2210 Ga0207683_10101830
2211 Ga0209389_1000328
2212 Ga0209589_1000017
2213 Ga0209589_1003134
2214 Ga0209489_100018
2215 Ga0209489_103754
2216 Ga0209700_100014
2217 Ga0209700_100028
2218 Ga0210002_1000638
2219 Ga0209588_1011823
2220 Ga0209966_1004024
2221 Ga0209998_10001504
2222 Ga0209974_10001402
2223 Ga0207428_10000513
2224 Ga0207428_10000626
2225 Ga0207428_10001020
2226 Ga0207428_10009473
2227 Ga0268266_10009223
2228 Ga0268266_10011610
2229 Ga0268266_10018776
2230 Ga0268266_10018923
2231 Ga0268266_10086973
2232 Ga0268266_10105625
2233 Ga0268265_10002370
2234 Ga0268265_10097726
2235 Ga0268264_10000110
2236 Ga0268264_10000187
2237 Ga0268264_10006546
2238 Ga0268264_10071289
2239 Ga0268264_10144411
2240 Ga0265337_1001215
2241 Ga0265334_10026341
2242 Ga0265336_10000764
2243 Ga0307517_10000066
2244 Ga0265338_10000973
2245 Ga0265338_10021562
2246 Ga0265338_10062901
2247 Ga0265324_10003352
2248 Ga0265330_10025186
2249 Ga0265330_10029428
2250 Ga0265332_10003602
2251 Ga0265325_10003292
2252 Ga0265325_10006295
2253 Ga0265325_10007950
2254 Ga0265325_10023341
2255 Ga0265340_10001645
2256 Ga0265340_10029097
2257 Ga0265339_10000069
2258 Ga0265339_10004839
2259 Ga0265339_10007305
2260 Ga0265331_10017214
2261 Ga0265331_10022476
2262 Ga0265327_10000130
2263 Ga0265316_10082137
2264 Ga0265316_10097918
2265 Ga0307509_10034527
2266 Ga0307408_100022413
2267 Ga0265313_10000386
2268 Ga0265313_10000525
2269 Ga0265313_10005935
2270 Ga0265313_10006744
2271 Ga0265313_10008290
2272 Ga0307508_10001545
2273 Ga0265314_10002489
2274 Ga0265314_10008132
2275 Ga0265342_10000245
2276 Ga0265342_10001939
2277 Ga0316576_10020401
2278 Ga0307516_10000001
2279 Ga0307516_10056008
2280 Ga0307510_10026558
2281 Ga0307510_10039402
2282 Ga0307510_10133565
2283 Ga0315911_1000033
2284 Ga0373948_0000049
2285 Ga0373958_0000026
2286 Ga0373959_0000446
2287 Ga0373938_0000133
2288 Ga0373938_0000337
2289 Ga0373938_0003695
2290 Ga0373926_0010417
2291 Ga0373929_0000110
2292 Ga0373934_0029264
2293 Ga0373940_0000409
2294 Ga0373944_0001321
2295 Ga0373944_0006972
2296 Ga0373944_0010142
2297 Ga0373949_0000771
2298 Ga0373949_0001010
2299 Ga0373949_0002903
2300 Ga0373951_0001038
2301 Ga0373952_0000200
2302 Ga0373952_0000271
2303 Ga0373923_0000365
2304 Ga0373932_0013210
2305 Ga0373936_0002908
2306 Ga0373936_0006874
2307 Ga0373936_0014831
2308 Ga0373936_0032359
2309 Ga0373939_0001604
2310 Ga0373941_0000177
2311 Ga0373945_0000773
2312 Ga0373945_0002050
2313 Ga0373945_0007095
2314 Ga0373953_0002305
2315 Ga0373953_0010859
2316 Ga0373953_0016591
2317 Ga0373954_0001844
2318 Ga0373954_0003693
2319 Ga0373954_0004386
2320 Ga0373954_0042229
2321 Ga0373956_0001114
2322 Ga0373956_0012758
2323 Ga0373956_0022639
2324 Ga0373957_0005169
2325 Ga0373960_0002058
2326 Ga0373943_0000371
2327 Ga0373943_0016042
2328 Ga0373943_0022654
2329 Ga0373946_0001609
2330 Ga0373946_0003088
2331 Ga0373946_0003694
2332 Ga0373946_0003981
2333 Ga0373946_0017748
2334 Ga0373955_0000087
2335 Ga0373955_0019309
2336 Ga0373955_0022872
2337 Ga0373942_0000533
2338 Ga0373942_0002312
2339 Ga0373961_0009181
2340 Ga0373962_0000275
2341 Ga0373962_0003026
2342 Ga0316574_0000409
2343 Ga0373931_0002417
2344 Ga0373931_0003207
2345 Ga0373931_0013686
2346 Ga0373931_0018753
2347 Ga0373931_0043522
2348 Ga0373935_0000249
2349 Ga0373935_0001440
2350 Ga0373935_0001638
2351 Ga0373935_0009616
2352 Ga0373935_0017387
2353 Ga0373935_0022258
2354 Ga0373935_0023343
2355 Ga0373935_0038689
2356 Ga0373935_0065574
2357 Ga0373927_0000496
2358 Ga0373927_0005789
2359 Ga0373927_0013727
2360 Ga0373927_0017197
2361 Ga0373927_0038948
2362 Ga0373927_0052483
2363 Ga0373927_0057648
2364 Ga0373927_0076999
2365 Ga0373933_0001541
2366 Ga0373933_0003396
2367 Ga0373933_0015198
2368 Ga0373933_0020661
2369 Ga0373933_0052379
2370 Ga0373947_0000172
2371 Ga0373947_0000552
2372 Ga0373947_0001425
2373 Ga0373947_0003284
2374 Ga0373947_0005148
2375 Ga0373947_0008568
2376 Ga0373947_0043715
2377 Ga0373937_0000006
2378 Ga0373937_0003940
2379 Ga0373937_0006385
2380 Ga0373937_0008551
2381 Ga0373937_0013102
2382 Ga0373937_0020237
2383 Ga0373937_0037460
2384 Ga0373937_0053496
2385 Ga0373937_0084498
2386 Ga0316584_0023349
2387 Ga0373925_0000002
2388 Ga0373925_0001273
2389 Ga0373925_0001642
2390 Ga0373925_0006254
2391 Ga0373925_0007268
2392 Ga0373925_0012599
2393 Ga0373925_0013241
2394 Ga0395899_0034774
2395 Ga0395900_0000962
2396 Ga0395900_0001475
2397 Ga0395898_0016645
2398 Ga0395898_0020156
2399 Ga0395898_0031972
2400 Ga0395898_0061080
2401 Ga0395898_0075158
2402 Ga0395905_0000156
2403 Ga0395905_0007000
2404 Ga0395905_0021976
2405 Ga0395905_0114742
2406 Ga0436364_0271330
2407 Ga0436364_0500047
2408 Ga0436364_0728139
2409 Ga0436364_0992626
2410 Ga0395901_0002873
2411 Ga0395901_0010605
2412 Ga0395901_0067052
2413 Ga0400483_004403
2414 Ga0400483_116415
2415 Ga0400483_160454
2416 Ga0436365_0018961
2417 Ga0436365_0675935
2418 Ga0436365_0918738
2419 Ga0436365_1445082
2420 Ga0436365_1839688
2421 Ga0436361_0314376
2422 Ga0436363_1035293
2423 Ga0439460_0006942
2424 Ga0451577_0068027
2425 Ga0466969_0013555
2426 Ga0466972_0000048
2427 Ga0466972_0004536
2428 Ga0466966_0001825
2429 Ga0466966_0034354
2430 Ga0466961_0000010
2431 Ga0466963_0002918
2432 Ga0466963_0014154
2433 Ga0466968_0033848
2434 Ga0466959_0025251
2435 Ga0451576_0004729
2436 Ga0451576_0013587
2437 Ga0466967_0043269
2438 Ga0466967_0090501
2439 Ga0495617_014253
2440 Ga0495592_0000039
2441 Ga0495592_0001131
2442 Ga0495592_0006064
2443 Ga0495592_0007618
2444 Ga0495592_0013776
2445 Ga0495592_0045577
2446 Ga0495592_0053790
2447 Ga0495592_0089180
2448 Ga0495603_0000104
2449 Ga0495603_0037324
2450 Ga0495603_0052457
2451 Ga0495629_0000748
2452 Ga0495629_0002078
2453 Ga0495629_0006821
2454 Ga0495629_0012882
2455 Ga0495629_0022194
2456 Ga0495629_0034735
2457 Ga0495629_0054255
2458 Ga0495638_0008996
2459 Ga0495638_0024230
2460 Ga0495638_0035210
2461 Ga0495641_0030325
2462 Ga0495651_0000611
2463 Ga0495651_0001571
2464 Ga0495651_0011467
2465 Ga0495651_0021445
2466 Ga0495651_0079930
2467 Ga0495651_0092655
2468 Ga0495651_0100880
2469 Ga0495653_0000006
2470 Ga0495653_0007005
2471 Ga0495653_0011146
2472 Ga0495653_0018841
2473 Ga0495653_0030224
2474 Ga0495653_0037262
2475 Ga0495580_0003617
2476 Ga0495580_0010851
2477 Ga0495580_0026401
2478 Ga0495582_0000063
2479 Ga0495582_0012713
2480 Ga0495639_0000224
2481 Ga0495662_0000297
2482 Ga0495662_0013952
2483 Ga0495662_0023254
2484 Ga0495664_0000002
2485 Ga0495664_0006271
2486 Ga0495664_0015744
2487 Ga0495664_0044123
2488 Ga0495664_0050217
2489 Ga0495585_0000546
2490 Ga0495585_0059640
2491 Ga0495594_0001344
2492 Ga0495596_0037352
2493 Ga0495606_0003923
2494 Ga0495606_0018849
2495 Ga0495608_0000009
2496 Ga0495608_0000557
2497 Ga0495608_0002360
2498 Ga0495608_0075138
2499 Ga0495610_0017707
2500 Ga0495610_0020667
2501 Ga0495618_0000005
2502 Ga0495618_0003917
2503 Ga0495618_0007259
2504 Ga0495618_0027475
2505 Ga0495618_0057516
2506 Ga0495618_0094208
2507 Ga0495628_0000002
2508 Ga0495628_0008721
2509 Ga0495628_0018145
2510 Ga0495628_0019167
2511 Ga0495628_0031426
2512 Ga0495628_0044261
2513 Ga0495628_0063330
2514 Ga0495630_0018505
2515 Ga0495630_0024736
2516 Ga0495637_0005275
2517 Ga0495637_0018544
2518 Ga0495644_0000208
2519 Ga0495648_0001804
2520 Ga0495648_0037123
2521 Ga0495666_0027747
2522 Ga0495642_0000952
2523 Ga0495652_0000004
2524 Ga0495652_0011295
2525 Ga0495652_0043946
2526 Ga0495665_0000290
2527 Ga0495665_0009753
2528 Ga0495665_0035624
2529 Ga0495665_0039329
2530 Ga0495640_0000005
2531 Ga0495640_0005790
2532 Ga0495640_0016952
2533 Ga0495640_0026837
2534 Ga0495640_0066325
2535 Ga0495586_0004986
2536 Ga0495586_0012468
2537 Ga0495586_0018134
2538 Ga0495587_0000007
2539 Ga0495587_0001059
2540 Ga0495587_0020929
2541 Ga0495598_0004142
2542 Ga0495609_0003197
2543 Ga0495645_0000003
2544 Ga0495645_0006734
2545 Ga0495645_0007749
2546 Ga0495645_0039626
2547 Ga0495645_0068183
2548 Ga0495633_0002198
2549 Ga0495667_0000002
2550 Ga0495667_0009830
2551 Ga0495667_0016261
2552 Ga0495667_0070092
2553 Ga0495667_0074627
2554 Ga0495656_0000116
2555 Ga0495668_0013241
2556 Ga0495668_0067894
2557 Ga0495634_0000022
2558 Ga0495634_0005885
2559 Ga0495634_0013980
2560 Ga0495634_0014410
2561 Ga0495634_0023350
2562 Ga0495634_0083444
2563 Ga0495611_0002902
2564 Ga0495625_0014130
2565 Ga0495635_0000020
2566 Ga0495635_0009729
2567 Ga0495635_0012565
2568 Ga0495635_0017837
2569 Ga0495635_0067122
2570 Ga0495635_0070813
2571 Ga0495659_0000633
2572 Ga0495659_0013796
2573 Ga0495661_0009454
2574 Ga0495588_0006115
2575 Ga0495588_0007718
2576 Ga0495657_0000435
2577 Ga0495657_0023694
2578 Ga0495657_0039556
2579 Ga0495657_0050904
2580 Ga0495657_0051901
2581 Ga0495657_0065141
2582 Ga0495599_0000001
2583 Ga0495599_0001663
2584 Ga0495623_0000001
2585 Ga0495623_0000278
2586 Ga0495623_0004162
2587 Ga0495623_0029868
2588 Ga0495623_0047063
2589 Ga0495646_0000014
2590 Ga0495646_0007424
2591 Ga0495646_0016960
2592 Ga0495646_0043120
2593 Ga0495647_0000453
2594 Ga0495647_0000596
2595 Ga0495647_0010922
2596 Ga0495658_0000366
2597 Ga0495658_0001515
2598 Ga0495658_0003288
2599 Ga0495658_0011776
2600 Ga0495658_0054631
2601 Ga0495669_0017680
2602 Ga0495669_0060642
2603 Ga0495613_0000449
2604 Ga0495613_0011155
2605 Ga0495613_0016658
2606 Ga0495624_0000224
2607 Ga0495624_0004050
2608 Ga0495624_0037184
2609 Ga0495624_0054059
2610 Ga0495670_0003609
2611 Ga0495670_0018418
2612 Ga0495600_0000006
2613 Ga0495600_0002049
2614 Ga0495600_0005150
2615 Ga0495600_0006047
2616 Ga0495600_0009892
2617 Ga0495600_0020263
2618 Ga0495600_0069145
2619 Ga0495581_0001337
2620 Ga0495581_0002953
2621 Ga0495581_0025215
2622 Ga0495581_0027196
2623 Ga0495581_0039068
2624 Ga0495604_0000005
2625 Ga0495604_0006090
2626 Ga0495604_0007032
2627 Ga0495604_0010819
2628 Ga0495604_0026104
2629 Ga0495604_0031612
2630 Ga0495604_0035035
2631 Ga0495604_0063261
2632 Ga0495604_0101996
2633 Ga0495674_0000003
2634 Ga0495674_0000747
2635 Ga0495674_0005032
2636 Ga0495674_0013887
2637 Ga0495674_0024269
2638 Ga0495674_0026746
2639 Ga0495674_0044939
2640 Ga0495674_0068500
2641 Ga0495674_0069963
2642 Ga0495674_0074364
2643 Ga0495672_0081727
2644 Ga0495676_0015297
2645 Ga0495676_0020900
2646 Ga0495676_0021862
2647 Ga0495676_0041727
2648 Ga0495680_0000002
2649 Ga0495680_0003135
2650 Ga0495680_0006572
2651 Ga0495680_0008513
2652 Ga0495680_0008658
2653 Ga0495680_0012421
2654 Ga0495680_0029387
2655 Ga0495687_013484
2656 Ga0495675_0000010
2657 Ga0495675_0000740
2658 Ga0495675_0003665
2659 Ga0495675_0003968
2660 Ga0495675_0020780
2661 Ga0495684_0000028
2662 Ga0495684_0000133
2663 Ga0495684_0007961
2664 Ga0495684_0025738
2665 Ga0495684_0036720
2666 Ga0495686_0011217
2667 Ga0495686_0017623
2668 Ga0495593_0000108
2669 Ga0495593_0006553
2670 Ga0495593_0006602
2671 Ga0495602_0000054
2672 Ga0495602_0002218
2673 Ga0495602_0013696
2674 Ga0495602_0032943
2675 Ga0495602_0033274
2676 Ga0495602_0039514
2677 Ga0495602_0072271
2678 Ga0495626_0006198
2679 Ga0496100_0000447
2680 Ga0496100_0006283
2681 Ga0496100_0024645
2682 Ga0496101_0001349
2683 Ga0496102_0002354
2684 Ga0496102_0006835
2685 Ga0496102_0014185
2686 Ga0496102_0030385
2687 Ga0496102_0104318
2688 Ga0496103_0001066
2689 Ga0496103_0005364
2690 Ga0496103_0008597
2691 Ga0496104_0000126
2692 Ga0496104_0000752
2693 Ga0496104_0007793
2694 Ga0496104_0010461
2695 Ga0496104_0015234
2696 Ga0496104_0024677
2697 Ga0496104_0131979
2698 Ga0496105_0000117
2699 Ga0496105_0002078
2700 Ga0496105_0002637
2701 Ga0496105_0010940
2702 Ga0496105_0031489
2703 Ga0496106_0001027
2704 Ga0496106_0008822
2705 Ga0496106_0024431
2706 Ga0496106_0037327
2707 Ga0496106_0081209
2708 Ga0496107_0001211
2709 Ga0496107_0002063
2710 Ga0496107_0002318
2711 Ga0496107_0009385
2712 Ga0496107_0040449
2713 Ga0496107_0045302
2714 Ga0496107_0068845
2715 Ga0496108_0000649
2716 Ga0496108_0000847
2717 Ga0496108_0006065
2718 Ga0496108_0010226
2719 Ga0496108_0019934
2720 Ga0496108_0027547
2721 Ga0496108_0122908
2722 Ga0496108_0131082
2723 Ga0496109_0000188
2724 Ga0496109_0000739
2725 Ga0496109_0004864
2726 Ga0496109_0010096
2727 Ga0496109_0017086
2728 Ga0496109_0078092
2729 Ga0496109_0117865
2730 Ga0496110_0002115
2731 Ga0496110_0005853
2732 Ga0496110_0006025
2733 Ga0496110_0006959
2734 Ga0496110_0060429
2735 Ga0496110_0104112
2736 Ga0496111_0000976
2737 Ga0496111_0011620
2738 Ga0496111_0015450
2739 Ga0496111_0016474
2740 Ga0496111_0090151
2741 Ga0496112_0000051
2742 Ga0496112_0001001
2743 Ga0496112_0001693
2744 Ga0496112_0004717
2745 Ga0496112_0008518
2746 Ga0496112_0021534
2747 Ga0496112_0197265
2748 Ga0496113_0000309
2749 Ga0496113_0004222
2750 Ga0496113_0019954
2751 Ga0496113_0020929
2752 Ga0496113_0065648
2753 Ga0496113_0087786
2754 Ga0496113_0101638
2755 Ga0496113_0120937
2756 Ga0496114_0001734
2757 Ga0496115_0000592
2758 Ga0496115_0013668
2759 Ga0496115_0029324
2760 Ga0496115_0048466
2761 Ga0496115_0049277
2762 Ga0496116_0053797
2763 Ga0496119_0002392
2764 Ga0496119_0015482
2765 Ga0496121_0000144
2766 Ga0496121_0000596
2767 Ga0496121_0004310
2768 Ga0496121_0004660
2769 Ga0496121_0017154
2770 Ga0496121_0032832
2771 Ga0496121_0039271
2772 Ga0496122_0001783
2773 Ga0496123_0008945
2774 Ga0496124_0002408
2775 Ga0496125_0000595
2776 Ga0496125_0003506
2777 Ga0496125_0005815
2778 Ga0496125_0028181
2779 Ga0496125_0046373
2780 Ga0496125_0077724
2781 Ga0496125_0081619
2782 Ga0496126_0003899
2783 Ga0496126_0007999
2784 Ga0496126_0012837
2785 Ga0496126_0021036
2786 Ga0496126_0030316
2787 Ga0496126_0052472
2788 Ga0496126_0063799
2789 Ga0501031_0000377
2790 Ga0501031_0012135
2791 Ga0501032_0000040
2792 Ga0501032_0002502
2793 Ga0501032_0003836
2794 Ga0501032_0013306
2795 Ga0501032_0078260
2796 Ga0501033_0000128
2797 Ga0501033_0001178
2798 Ga0501033_0011352
2799 Ga0501033_0021458
2800 Ga0501033_0023415
2801 Ga0501033_0024205
2802 Ga0501033_0080366
2803 Ga0501033_0095098
2804 Ga0501034_0000113
2805 Ga0501034_0000139
2806 Ga0501034_0000734
2807 Ga0501034_0008567
2808 Ga0501034_0027285
2809 Ga0501034_0040597
2810 Ga0501034_0050837
2811 Ga0501034_0091177
2812 Ga0501034_0099947
2813 Ga0501034_0172222
2814 Ga0501036_0000281
2815 Ga0501036_0001021
2816 Ga0501036_0006538
2817 Ga0501036_0013510
2818 Ga0501036_0037511
2819 Ga0501036_0085478
2820 Ga0501036_0101222
2821 Ga0501037_0000041
2822 Ga0501037_0007235
2823 Ga0501037_0010813
2824 Ga0501037_0016247
2825 Ga0501037_0029550
2826 Ga0501037_0035491
2827 Ga0501038_0000057
2828 Ga0501038_0005284
2829 Ga0501038_0011176
2830 Ga0501038_0011832
2831 Ga0501038_0035298
2832 Ga0501038_0039580
2833 Ga0501038_0040069
2834 Ga0501038_0047168
2835 Ga0501038_0084076
2836 Ga0501039_0003963
2837 Ga0501039_0009975
2838 Ga0501039_0040950
2839 Ga0501039_0072066
2840 Ga0501040_0007238
2841 Ga0501042_0011820
2842 Ga0501043_0005571
2843 Ga0501043_0006408
2844 Ga0501043_0013603
2845 Ga0501043_0045583
2846 Ga0501043_0049660
2847 Ga0501043_0129558
2848 Ga0501046_0004620
2849 Ga0501046_0004930
2850 Ga0501046_0023744
2851 Ga0501046_0030618
2852 Ga0501046_0041485
2853 Ga0501047_0000044
2854 Ga0501047_0000316
2855 Ga0501047_0014278
2856 Ga0501047_0014677
2857 Ga0501047_0023190
2858 Ga0501047_0033027
2859 Ga0501047_0034863
2860 Ga0501047_0039892
2861 Ga0501047_0046028
2862 Ga0501047_0062559
2863 Ga0501047_0160895
2864 Ga0501048_0000117
2865 Ga0501048_0000150
2866 Ga0501048_0096172
2867 Ga0501067_0000938
2868 Ga0501067_0013575
2869 Ga0501068_0002415
2870 Ga0501068_0003582
2871 Ga0501068_0003857
2872 Ga0501068_0013654
2873 Ga0501068_0037876
2874 Ga0501069_0003718
2875 Ga0501070_0007839
2876 Ga0501070_0013553
2877 Ga0501070_0020893
2878 Ga0501070_0021944
2879 Ga0501070_0063600
2880 Ga0501071_0012138
2881 Ga0501072_0000156
2882 Ga0501072_0024705
2883 Ga0501072_0030786
2884 Ga0501073_0000669
2885 Ga0501073_0001123
2886 Ga0501073_0012453
2887 Ga0501073_0055643
2888 Ga0501073_0060632
2889 Ga0501073_0076230
2890 Ga0501074_0000035
2891 Ga0501074_0004481
2892 Ga0501074_0042702
2893 Ga0501074_0045884
2894 Ga0501075_0011391
2895 Ga0501076_0033146
2896 Ga0501077_0048355
2897 Ga0501079_0006733
2898 Ga0501079_0012752
2899 Ga0501079_0054248
2900 Ga0501079_0084001
2901 Ga0501080_0001372
2902 Ga0501080_0005918
2903 Ga0501080_0008844
2904 Ga0501080_0012618
2905 Ga0501080_0016712
2906 Ga0501080_0025835
2907 Ga0501080_0047476
2908 Ga0501080_0073288
2909 Ga0501080_0147701
2910 Ga0501080_0227707
2911 Ga0501081_0130493
2912 Ga0501083_0000641
2913 Ga0501083_0002096
2914 Ga0501083_0025692
2915 Ga0501083_0056150
2916 Ga0501035_0000128
2917 Ga0501035_0001398
2918 Ga0501035_0001896
2919 Ga0501035_0003226
2920 Ga0501035_0007549
2921 Ga0501035_0065467
2922 Ga0501035_0120991
2923 Ga0501044_0000108
2924 Ga0501044_0000144
2925 Ga0501044_0004517
2926 Ga0501044_0006423
2927 Ga0501044_0006995
2928 Ga0501044_0009598
2929 Ga0501044_0015426
2930 Ga0501044_0016058
2931 Ga0501044_0084700
2932 Ga0501044_0098447
2933 Ga0501044_0122369
2934 Ga0501045_0002782
2935 nmdc:mga03n38_3068_c1
2936 nmdc:mga00v17_34356_c1
2937 nmdc:mga00v17_7005_c1
2938 nmdc:mga0yw44_394_c1
2939 nmdc:mga0yw44_53581_c1
2940 nmdc:mga06z11_17712_c1
2941 nmdc:mga06z11_2169_c1
2942 nmdc:mga06z11_43367_c1
2943 nmdc:mga04h51_4218_c1
2944 nmdc:mga05p37_1114_c1
2945 nmdc:mga05p37_12753_c1
2946 nmdc:mga05p37_6040_c1
2947 nmdc:mga05p37_6080_c1
2948 nmdc:mga09592_1302_c1
2949 nmdc:mga09592_2437_c1
2950 nmdc:mga0qj67_276_c1
2951 nmdc:mga0qj67_3495_c1
2952 nmdc:mga0qj67_55_c1
2953 nmdc:mga06r32_158737_c1
2954 nmdc:mga06r32_3415_c1
2955 nmdc:mga06r32_3728_c1
2956 nmdc:mga06r32_51211_c1
2957 nmdc:mga08y16_13103_c1
2958 nmdc:mga08y16_189609_c1
2959 nmdc:mga08y16_25960_c1
2960 nmdc:mga08y16_3668_c1
2961 nmdc:mga08y16_3857_c1
2962 nmdc:mga08y16_3921_c1
2963 nmdc:mga0n895_17357_c1
2964 nmdc:mga0n895_3698_c1
2965 nmdc:mga0n895_6170_c1
2966 nmdc:mga0n895_651_c1
2967 nmdc:mga0n895_682_c1
2968 nmdc:mga0rr50_2190_c1
2969 nmdc:mga0rr50_23079_c1
2970 nmdc:mga0rr50_919_c1
2971 nmdc:mga0a205_1012_c1
2972 nmdc:mga0a205_1633_c1
2973 nmdc:mga0a205_89051_c1
2974 Ga0495601_0000008
2975 Ga0495601_0000128
2976 Ga0495601_0001082
2977 Ga0495601_0003910
2978 Ga0495601_0004226
2979 Ga0495601_0005377
2980 Ga0495601_0006799
2981 Ga0495601_0021111
2982 Ga0495601_0022129
2983 Ga0495601_0030518
2984 Ga0495601_0053187
2985 Ga0495612_0000002
2986 Ga0495612_0002018
2987 Ga0495612_0002324
2988 Ga0495612_0004821
2989 Ga0495612_0028142
2990 Ga0495612_0031191
2991 Ga0500635_0000853
2992 Ga0495655_0001385
2993 Ga0495595_0000008
2994 Ga0495595_0003217
2995 Ga0495595_0004385
2996 Ga0495595_0006145
2997 Ga0495595_0014384
2998 Ga0495619_0000002
2999 Ga0495619_0000016
3000 Ga0495619_0000231
3001 Ga0495619_0000252
3002 Ga0495619_0000406
3003 Ga0495619_0000974
3004 Ga0495619_0002852
3005 Ga0495619_0010526
3006 Ga0495619_0014426
3007 Ga0495619_0031485
3008 Ga0500643_000079
3009 Ga0500643_003892
3010 Ga0500644_0002084
3011 Ga0500651_0010373
3012 Ga0500566_0002184
3013 Ga0500566_0002304
3014 Ga0500641_0011471
3015 Ga0500650_0026000
3016 Ga0500555_014708
3017 Ga0500555_016186
3018 Ga0500556_0000005
3019 Ga0500556_0000250
3020 Ga0500556_0008341
3021 Ga0500557_000100
3022 Ga0500562_000167
3023 Ga0500562_014811
3024 Ga0500572_001778
3025 Ga0500592_000696
3026 Ga0500595_000010
3027 Ga0500595_003306
3028 Ga0500595_003815
3029 Ga0500595_004235
3030 Ga0500595_006137
3031 Ga0500595_022046
3032 Ga0500608_000199
3033 Ga0500608_000330
3034 Ga0500642_0000009
3035 Ga0500642_0000562
3036 Ga0500642_0039030
3037 Ga0500559_0000696
3038 Ga0500559_0001190
3039 Ga0500573_0013027
3040 Ga0500586_000887
3041 Ga0500616_0000001
3042 Ga0500616_0000035
3043 Ga0500616_0000038
3044 Ga0500616_0024308
3045 Ga0500620_001131
3046 Ga0500622_0003335
3047 Ga0500638_001356
3048 Ga0500639_029084
3049 Ga0500636_0000407
3050 Ga0500636_0004693
3051 Ga0500637_0000366
3052 Ga0500576_024767
3053 Ga0500645_002629
3054 Ga0500599_002488
3055 Ga0501084_0002007
3056 Ga0501084_0011232
3057 Ga0500661_004901
3058 Ga0501082_0000002
3059 Ga0501082_0002249
3060 Ga0501082_0014678
3061 Ga0501082_0050425
3062 Ga0501082_0058902
3063 Ga0501082_0062334
3064 Ga0501082_0120978
3065 Ga0466962_0031646
3066 2507504659
3067 2508539620
3068 2508694936
3069 2508727710
3070 2509077605
3071 2509149897
3072 2513590572
3073 2513627007
3074 2513638542
3075 2513653109
3076 2513658971
3077 2513698962
3078 2513699150
3079 2513714858
3080 2513863890
3081 2513875656
3082 2513889635
3083 2513921235
3084 2514016324
3085 2515624125
3086 2517105836
3087 2517889334
3088 2524438627
3089 2524540382
3090 2528851479
3091 2603857933
3092 2617347489
3093 2617377108
3094 2643758733
3095 2644290592
3096 2671121381
3097 2715501514
3098 2723849158
3099 2728754266
3100 2739792036
3101 2745077656
3102 2774869106
3103 2776258439
3104 2793063267
3105 2793070999
3106 2793078485
3107 2805919332
3108 2818243395
3109 2824622538
3110 2824633899
3111 2824674711
3112 2824684144
3113 2824752539
3114 2824770620
3115 2824780169
3116 2828309284
3117 2835319702
3118 2838130268
3119 2840882151
3120 2841944289
3121 2841954534
3122 2841963417
3123 2841969066
3124 2841979840
3125 2841989562
3126 2842044067
3127 2842051944
3128 2844316036
3129 2847931523
3130 2847941583
3131 2849082506
3132 2854682524
3133 2857515803
3134 2857527308
3135 2874593152
3136 2874606904
3137 2874620262
3138 2874634319
3139 2874645726
3140 2876763384
3141 2876773192
3142 2876810693
3143 2876820499
3144 2879076862
3145 2879091353
3146 2879100198
3147 2879112586
3148 2879131049
3149 2879150256
3150 2881364926
3151 2881673181
3152 2882461321
3153 2883579066
3154 2884301165
3155 2885368169
3156 2885377768
3157 2885413754
3158 2888378828
3159 2888391194
3160 2888427253
3161 2889036148
3162 2893071848
3163 2894242173
3164 2898796745
3165 2899261333
3166 2903729568
3167 2903752982
3168 2904692460
3169 2904709209
3170 2904719866
3171 2906606073
3172 2906613186
3173 2906635069
3174 2906645643
3175 2906668658
3176 2908747943
3177 2908764386
3178 2908783020
3179 2919078424
3180 2919454756
3181 2919679194
3182 2922364526
3183 2922378532
3184 2922400950
3185 2922433685
3186 2929623662
3187 2929632870
3188 2932786153
3189 2932799521
3190 2932805173
3191 2932816886
3192 2932826026
3193 2932829416
3194 2933585565
3195 2935615149
3196 2935617849
3197 2935634729
3198 2935647822
3199 2935651494
3200 2935659738
3201 2935674765
3202 2935678127
3203 2935692415
3204 2935699367
3205 2935707098
3206 2935721033
3207 2935722858
3208 2935739722
3209 2935748760
3210 2935758630
3211 2935764610
3212 2935775507
3213 2935790003
3214 2935798432
3215 2935806660
3216 2935819079
3217 2935825814
3218 2935837306
3219 2935842007
3220 2935851433
3221 2935856652
3222 2935872940
3223 2935874383
3224 2935887737
3225 2935910540
3226 2935918056
3227 2935927549
3228 2935936579
3229 2935943868
3230 2935952305
3231 2935967315
3232 2935969145
3233 2935982317
3234 2935984596
3235 2936001097
3236 2936010751
3237 2936014154
3238 2936022937
3239 2936031073
3240 2936045770
3241 2936049195
3242 2936055641
3243 2940564780
3244 2941511941
3245 2941519643
3246 2941527665
3247 2941535897
3248 2941547058
3249 3000019575
3250 3000405688
3251 3005483340
3252 3005490497
3253 3005509709
3254 3005591200
3255 3005595628
3256 3005711619
3257 3005718869
3258 8001850365
3259 8006930317
3260 8006935716
3261 8006967698
3262 8006975637
3263 8006992647
3264 8006998366
3265 8016518819
3266 8016525626
3267 8016539219
3268 8016549787
3269 8016558201
3270 8016568909
3271 8016581557
3272 8016587087
3273 8016596201
3274 8016607104
3275 8016619002
3276 8016630583
3277 8016636507
3278 8019549536
3279 8019563075
3280 8019573156
3281 8019577866
3282 8019595969
3283 8019605787
3284 8019623481
3285 8019638661
3286 8019641077
3287 8019653180
3288 8019666462
3289 8019679861
3290 8019696897
3291 8045866173
3292 8055750831
3293 8056678404
3294 8056694081
3295 8056970655
3296 8057136868

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12169

DNA_pol3_gamma3

DNA polymerase III subunits gamma and tau domain III

264

406

0.99

PF12362

DUF3646

DNA polymerase III gamma and tau subunits C terminal

501

614

0.99

PF22608

DNAX_ATPase_lid

DNA polymerase III clamp loader subunit, ATPase lid domain

214

262

0.96

PF13177

DNA_pol3_delta2

DNA polymerase III, delta subunit

46

211

0.91

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

67

210

0.71

PF13401

AAA_22

AAA domain

64

194

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1njf-assembly4.cif.gz_D nucleotide bound form of an isolated e. coli clamp loader gamma subunit 0.8668 24 267
1njf-assembly4.cif.gz_D nucleotide bound form of an isolated e. coli clamp loader gamma subunit 0.8602 24 267
3glg-assembly2.cif.gz_H crystal structure of a mutant (gammat157a) e. coli clamp loader bound to primer-template dna 0.8484 23 383
3glg-assembly2.cif.gz_H crystal structure of a mutant (gammat157a) e. coli clamp loader bound to primer-template dna 0.821 23 383
1sxj-assembly1.cif.gz_B crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna) 0.8119 29 388
ID Description Score Start End Superfamily
af_Q54BN3_188_243_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9763 204 251 1.10.8.60
1njfD02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9758 204 267 1.10.8.60
1njfB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9754 204 266 1.10.8.60
1njgA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9689 204 267 1.10.8.60
1jr3A03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9676 204 265 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A527GZE9-F1-model_v4 DNA polymerase III subunit gamma/tau (EC 2.7.7.7) 0.979 27 197 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
AF-A0A3C1BVL6-F1-model_v4 DNA polymerase III subunit gamma/tau 0.9737 118 204 GO:0006261
AF-A0A527GZE9-F1-model_v4 DNA polymerase III subunit gamma/tau (EC 2.7.7.7) 0.9734 27 197 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
AF-A0A3D2EAB2-F1-model_v4 deleted 0.9502 93 238
AF-A0A3C1BVL6-F1-model_v4 DNA polymerase III subunit gamma/tau 0.9419 118 204 GO:0006261

Map