F495192
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1648 | 736 | 3296 | 588 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10007030|Ga0099794_100070304 |
| Length | 659 |
| Sequence | MMSEADAAGRLAEPGLDLGATPAPRGAGYRVLARKYRPAAFEDLIGQEAMVRTLSNAFEAGRIPQAWILTGVRGVGKTTTARILARGLNYELPDGSIHAPTIRMPVLGVHCAAIMESRHMDVLEMDAASHNGVDDIRQINDAVRYAPVNARYKVYILDEVHMLSNQAFNALLKTLEEPPPHAKFIFATTEIREVPITVLSRCQRFDLRRVESDRLVSHLEGILAKEKVAAEPEALALIARAAEGSVRDSLSLLDQAISHAAGSVRAEDVRAMLGLADHSRIVELFDALMRGDITHALGELRDQYDSGADPLVVLTELAAFTHFVTRVKIVPAVAEDRALAEIERKRGRDFAAGLSMRVLSRTWQMLLKGIAEVKEAARPVAAAEMVLVRIAYAADLPSPDDVIRSLGDASQRPAAAPARPSVPSPSALAGEDRVETRPLGATPPRSFTNPPPPTEKGRAGEGREGARTSXRQALAPSXXXXMRDPVSRSAVTPAAAQLPTFARFSDLIAFVGAQRDLQLRAILERDVRLVRFEDGKLEIALEPTASRALIGDLGRRLAALTGRRWMVAVSAEAGEPTVRSQLDARREEFKRGLQAHPVVQRVLARFPGAEIVAVRQPEPEPAQPVAAVDDDELPPEMPIDDGGSAFGAHGRPDDVDDDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 121 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 153 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 154 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 155 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 156 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 159 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 250 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 255 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 259 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 260 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 266 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 267 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 270 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 271 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 275 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 282 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 286 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 292 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 299 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 300 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 303 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 304 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 305 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 309 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 314 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 317 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 320 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 321 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 322 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 323 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 324 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 325 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 326 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 327 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 402 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 410 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 411 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 412 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 413 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 414 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 415 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 416 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 417 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 418 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 419 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 420 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 475 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 477 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 480 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 481 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 482 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 483 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 488 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 491 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 492 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 494 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 495 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 497 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 499 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 502 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 504 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 506 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 507 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 508 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 509 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 510 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 511 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 512 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 513 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 514 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 515 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 516 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 517 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 518 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 519 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 520 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 521 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 522 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 523 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 524 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 525 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 526 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 527 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 528 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 529 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 530 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 531 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 532 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 533 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 534 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 535 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 536 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 537 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 538 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 539 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 540 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 541 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 542 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 543 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 544 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 545 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 546 | 2791355199 | |||
| 547 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 548 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 549 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 550 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 551 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 552 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 553 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 554 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 555 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 556 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 557 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 558 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 559 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 560 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 561 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 562 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 563 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 564 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 565 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 566 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 567 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 568 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 569 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 570 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 571 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 572 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 573 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 574 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 575 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 576 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 577 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 578 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 579 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 580 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 581 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 582 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 583 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 584 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 585 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 586 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 587 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 588 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 589 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 590 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 591 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 592 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 593 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 594 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 595 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 596 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 597 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 598 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 599 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 600 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 601 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 602 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 603 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 604 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 605 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 606 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 607 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 608 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 609 | 2904699407 | |||
| 610 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 611 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 612 | 2906610324 | |||
| 613 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 614 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 615 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 616 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 617 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 618 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 619 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 620 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 621 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 622 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 623 | 2922368715 | |||
| 624 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 625 | 2922425934 | |||
| 626 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 627 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 628 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 629 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 630 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 631 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 632 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 633 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 634 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 635 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 636 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 637 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 638 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 639 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 640 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 641 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 642 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 643 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 644 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 645 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 646 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 647 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 648 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 649 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 650 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 651 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 652 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 653 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 654 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 655 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 656 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 657 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 658 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 659 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 660 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 661 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 662 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 663 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 664 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 665 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 666 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 667 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 668 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 669 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 670 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 671 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 672 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 673 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 674 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 675 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 676 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 677 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 678 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 679 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 680 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 681 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 682 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 683 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 684 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 685 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 686 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 687 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 688 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 689 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 690 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 691 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 692 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 693 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 694 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 695 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 696 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 697 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 698 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 699 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 700 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 701 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 702 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 703 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 704 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 705 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 706 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 707 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 708 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 709 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 710 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 711 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 712 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 713 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 714 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 715 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 716 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 717 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 718 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 719 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 720 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 721 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 722 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 723 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 724 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 725 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 726 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 727 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 728 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 729 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 730 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 731 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 732 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 733 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 734 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 735 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 736 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.24 |
| Metatranscriptomes | 0 |
| Isolates | 13.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.7 |
| Nodule | 10.74 |
| Rhizoplane | 5.16 |
| Rhizosphere | 71.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099794_10007030 | 3300007265 | Bacteria | 4595 |
| 2 | 2214544925 | 2209111006 | Bacteria | 18798 |
| 3 | ARSoilYngRDRAFT_c00196 | 3300000042 | Bacteria | 10143 |
| 4 | ARcpr5yngRDRAFT_c000115 | 3300000043 | Bacteria | 12589 |
| 5 | ARSoilOldRDRAFT_c000011 | 3300000044 | Bacteria | 42914 |
| 6 | ARCol0oldRDRAFT_c00183 | 3300000045 | Bacteria | 5726 |
| 7 | ARCol0yngRDRAFT_1000146 | 3300000652 | Bacteria | 12593 |
| 8 | JGI24746J21847_1001493 | 3300001977 | Bacteria | 3720 |
| 9 | JGI24739J22299_10000724 | 3300001989 | Bacteria | 11949 |
| 10 | JGI24737J22298_10017327 | 3300001990 | Bacteria | 2321 |
| 11 | JGI24743J22301_10000145 | 3300001991 | Bacteria | 7176 |
| 12 | JGI24750J21931_1000096 | 3300002070 | Bacteria | 13445 |
| 13 | JGI24750J21931_1000628 | 3300002070 | Bacteria | 5302 |
| 14 | JGI24745J21846_1000468 | 3300002073 | Bacteria | 3588 |
| 15 | JGI24034J26672_10000231 | 3300002239 | Bacteria | 7381 |
| 16 | JGI24742J22300_10000137 | 3300002244 | Bacteria | 10780 |
| 17 | JGI24742J22300_10000225 | 3300002244 | Bacteria | 8423 |
| 18 | JGI24751J29686_10005184 | 3300002459 | Bacteria | 2652 |
| 19 | JGI25406J46586_10002038 | 3300003203 | Bacteria | 9531 |
| 20 | JGI25406J46586_10006723 | 3300003203 | Bacteria | 5284 |
| 21 | JGI25153J46596_10005134 | 3300003215 | Bacteria | 6902 |
| 22 | JGI25153J46596_10008913 | 3300003215 | Bacteria | 4734 |
| 23 | JGI25160J50197_1010421 | 3300003354 | Bacteria | 3364 |
| 24 | Ga0055524_1010431 | 3300003775 | Bacteria | 3698 |
| 25 | Ga0055531_10001561 | 3300003794 | Bacteria | 16764 |
| 26 | Ga0055543_1005034 | 3300004625 | Bacteria | 3448 |
| 27 | Ga0065165_1004017 | 3300005262 | Bacteria | 9596 |
| 28 | Ga0065165_1016982 | 3300005262 | Bacteria | 2700 |
| 29 | Ga0065712_10002828 | 3300005290 | Bacteria | 4139 |
| 30 | Ga0065712_10104129 | 3300005290 | Bacteria | 1968 |
| 31 | Ga0065715_10001079 | 3300005293 | Bacteria | 7146 |
| 32 | Ga0065715_10106350 | 3300005293 | Bacteria | 2835 |
| 33 | Ga0070676_10000506 | 3300005328 | Bacteria | 18658 |
| 34 | Ga0070683_100009453 | 3300005329 | Bacteria | 8336 |
| 35 | Ga0070683_100029992 | 3300005329 | Bacteria | 4932 |
| 36 | Ga0070683_100098852 | 3300005329 | Bacteria | 2746 |
| 37 | Ga0070690_100002629 | 3300005330 | Bacteria | 9678 |
| 38 | Ga0070690_100006878 | 3300005330 | Bacteria | 6471 |
| 39 | Ga0070690_100061831 | 3300005330 | Bacteria | 2414 |
| 40 | Ga0070690_100066516 | 3300005330 | Bacteria | 2333 |
| 41 | Ga0070670_100023715 | 3300005331 | Bacteria | 5280 |
| 42 | Ga0070677_10000227 | 3300005333 | Bacteria | 19393 |
| 43 | Ga0068869_100001832 | 3300005334 | Bacteria | 12767 |
| 44 | Ga0068869_100062645 | 3300005334 | Bacteria | 2730 |
| 45 | Ga0070666_10005187 | 3300005335 | Bacteria | 7977 |
| 46 | Ga0070680_100003424 | 3300005336 | Bacteria | 11842 |
| 47 | Ga0070680_100039841 | 3300005336 | Bacteria | 3801 |
| 48 | Ga0070680_100048147 | 3300005336 | Bacteria | 3474 |
| 49 | Ga0070680_100067147 | 3300005336 | Bacteria | 2941 |
| 50 | Ga0070680_100123735 | 3300005336 | Bacteria | 2160 |
| 51 | Ga0070680_100124176 | 3300005336 | Bacteria | 2156 |
| 52 | Ga0070682_100001699 | 3300005337 | Bacteria | 12232 |
| 53 | Ga0070682_100012002 | 3300005337 | Bacteria | 4956 |
| 54 | Ga0070682_100066044 | 3300005337 | Bacteria | 2300 |
| 55 | Ga0068868_100003128 | 3300005338 | Bacteria | 11515 |
| 56 | Ga0068868_100007757 | 3300005338 | Bacteria | 7659 |
| 57 | Ga0068868_100089723 | 3300005338 | Bacteria | 2475 |
| 58 | Ga0070660_100044302 | 3300005339 | Bacteria | 3402 |
| 59 | Ga0070660_100078764 | 3300005339 | Bacteria | 2584 |
| 60 | Ga0070689_100000668 | 3300005340 | Bacteria | 20748 |
| 61 | Ga0070689_100001841 | 3300005340 | Bacteria | 13666 |
| 62 | Ga0070689_100002942 | 3300005340 | Bacteria | 11202 |
| 63 | Ga0070689_100015324 | 3300005340 | Bacteria | 5587 |
| 64 | Ga0070689_100065179 | 3300005340 | Bacteria | 2836 |
| 65 | Ga0070691_10020196 | 3300005341 | Bacteria | 3076 |
| 66 | Ga0070691_10050495 | 3300005341 | Bacteria | 1984 |
| 67 | Ga0070687_100000527 | 3300005343 | Bacteria | 12848 |
| 68 | Ga0070661_100003238 | 3300005344 | Bacteria | 11222 |
| 69 | Ga0070692_10010704 | 3300005345 | Bacteria | 4187 |
| 70 | Ga0070692_10055383 | 3300005345 | Bacteria | 2073 |
| 71 | Ga0070668_100003117 | 3300005347 | Bacteria | 12247 |
| 72 | Ga0070669_100001315 | 3300005353 | Bacteria | 17944 |
| 73 | Ga0070669_100072348 | 3300005353 | Bacteria | 2552 |
| 74 | Ga0070669_100114625 | 3300005353 | Bacteria | 2049 |
| 75 | Ga0070675_100002954 | 3300005354 | Bacteria | 12826 |
| 76 | Ga0070675_100037764 | 3300005354 | Bacteria | 3936 |
| 77 | Ga0070675_100040190 | 3300005354 | Bacteria | 3817 |
| 78 | Ga0070675_100142502 | 3300005354 | Bacteria | 2049 |
| 79 | Ga0070671_100005343 | 3300005355 | Bacteria | 10241 |
| 80 | Ga0070671_100006990 | 3300005355 | Bacteria | 9041 |
| 81 | Ga0070671_100012266 | 3300005355 | Bacteria | 6896 |
| 82 | Ga0070671_100024307 | 3300005355 | Bacteria | 4959 |
| 83 | Ga0070671_100032237 | 3300005355 | Bacteria | 4333 |
| 84 | Ga0070671_100033261 | 3300005355 | Bacteria | 4263 |
| 85 | Ga0070674_100002968 | 3300005356 | Bacteria | 9419 |
| 86 | Ga0070674_100025125 | 3300005356 | Bacteria | 3874 |
| 87 | Ga0070673_100010750 | 3300005364 | Bacteria | 6210 |
| 88 | Ga0070673_100015906 | 3300005364 | Bacteria | 5300 |
| 89 | Ga0070673_100034527 | 3300005364 | Bacteria | 3828 |
| 90 | Ga0070688_100001124 | 3300005365 | Bacteria | 13400 |
| 91 | Ga0070688_100001239 | 3300005365 | Bacteria | 12735 |
| 92 | Ga0070688_100034220 | 3300005365 | Bacteria | 3075 |
| 93 | Ga0070688_100050115 | 3300005365 | Bacteria | 2600 |
| 94 | Ga0070659_100002622 | 3300005366 | Bacteria | 12786 |
| 95 | Ga0070659_100015601 | 3300005366 | Bacteria | 5690 |
| 96 | Ga0070659_100019333 | 3300005366 | Bacteria | 5160 |
| 97 | Ga0070667_100005188 | 3300005367 | Bacteria | 10886 |
| 98 | Ga0070703_10016096 | 3300005406 | Bacteria | 2144 |
| 99 | Ga0070709_10002507 | 3300005434 | Bacteria | 9940 |
| 100 | Ga0070709_10009423 | 3300005434 | Bacteria | 5386 |
| 101 | Ga0070709_10012754 | 3300005434 | Bacteria | 4710 |
| 102 | Ga0070709_10026735 | 3300005434 | Bacteria | 3423 |
| 103 | Ga0070709_10054804 | 3300005434 | Bacteria | 2515 |
| 104 | Ga0070714_100009155 | 3300005435 | Bacteria | 7772 |
| 105 | Ga0070714_100028781 | 3300005435 | Bacteria | 4613 |
| 106 | Ga0070714_100051704 | 3300005435 | Bacteria | 3504 |
| 107 | Ga0070714_100073185 | 3300005435 | Bacteria | 2968 |
| 108 | Ga0070714_100082668 | 3300005435 | Bacteria | 2798 |
| 109 | Ga0070710_10000903 | 3300005437 | Bacteria | 14219 |
| 110 | Ga0070710_10004937 | 3300005437 | Bacteria | 6308 |
| 111 | Ga0070710_10020747 | 3300005437 | Bacteria | 3413 |
| 112 | Ga0070710_10036876 | 3300005437 | Bacteria | 2675 |
| 113 | Ga0070701_10007244 | 3300005438 | Bacteria | 4723 |
| 114 | Ga0070701_10053875 | 3300005438 | Bacteria | 2095 |
| 115 | Ga0070711_100012263 | 3300005439 | Bacteria | 5348 |
| 116 | Ga0070711_100017211 | 3300005439 | Bacteria | 4599 |
| 117 | Ga0070711_100025613 | 3300005439 | Bacteria | 3861 |
| 118 | Ga0070711_100035725 | 3300005439 | Bacteria | 3325 |
| 119 | Ga0070711_100045660 | 3300005439 | Bacteria | 2981 |
| 120 | Ga0070705_100001458 | 3300005440 | Bacteria | 12507 |
| 121 | Ga0070700_100001211 | 3300005441 | Bacteria | 12787 |
| 122 | Ga0070700_100010023 | 3300005441 | Bacteria | 5217 |
| 123 | Ga0070700_100017124 | 3300005441 | Bacteria | 4138 |
| 124 | Ga0070694_100001764 | 3300005444 | Bacteria | 12786 |
| 125 | Ga0070663_100000761 | 3300005455 | Bacteria | 17492 |
| 126 | Ga0070663_100009537 | 3300005455 | Bacteria | 6014 |
| 127 | Ga0070663_100018311 | 3300005455 | Bacteria | 4589 |
| 128 | Ga0070663_100024383 | 3300005455 | Bacteria | 4071 |
| 129 | Ga0070678_100000525 | 3300005456 | Bacteria | 18583 |
| 130 | Ga0070678_100029237 | 3300005456 | Bacteria | 3771 |
| 131 | Ga0070678_100075040 | 3300005456 | Bacteria | 2543 |
| 132 | Ga0070662_100002656 | 3300005457 | Bacteria | 11031 |
| 133 | Ga0070662_100070763 | 3300005457 | Bacteria | 2570 |
| 134 | Ga0070662_100071322 | 3300005457 | Bacteria | 2561 |
| 135 | Ga0070662_100077875 | 3300005457 | Bacteria | 2461 |
| 136 | Ga0070681_10004977 | 3300005458 | Bacteria | 12786 |
| 137 | Ga0070681_10037132 | 3300005458 | Bacteria | 4889 |
| 138 | Ga0070681_10120278 | 3300005458 | Bacteria | 2561 |
| 139 | Ga0070681_10124495 | 3300005458 | Bacteria | 2510 |
| 140 | Ga0070681_10145457 | 3300005458 | Bacteria | 2299 |
| 141 | Ga0068867_100002950 | 3300005459 | Bacteria | 11984 |
| 142 | Ga0070685_10004716 | 3300005466 | Bacteria | 6899 |
| 143 | Ga0070685_10011159 | 3300005466 | Bacteria | 4696 |
| 144 | Ga0070699_100057122 | 3300005518 | Bacteria | 3380 |
| 145 | Ga0070679_100007748 | 3300005530 | Bacteria | 10056 |
| 146 | Ga0070679_100010782 | 3300005530 | Bacteria | 8677 |
| 147 | Ga0070679_100022232 | 3300005530 | Bacteria | 6198 |
| 148 | Ga0070679_100058286 | 3300005530 | Bacteria | 3848 |
| 149 | Ga0070679_100065645 | 3300005530 | Bacteria | 3617 |
| 150 | Ga0070679_100148160 | 3300005530 | Bacteria | 2324 |
| 151 | Ga0070684_100005941 | 3300005535 | Bacteria | 9401 |
| 152 | Ga0070684_100056781 | 3300005535 | Bacteria | 3417 |
| 153 | Ga0070684_100086347 | 3300005535 | Bacteria | 2784 |
| 154 | Ga0070684_100169813 | 3300005535 | Bacteria | 1981 |
| 155 | Ga0070697_100034721 | 3300005536 | Bacteria | 4067 |
| 156 | Ga0068853_100003070 | 3300005539 | Bacteria | 12759 |
| 157 | Ga0068853_100049207 | 3300005539 | Bacteria | 3622 |
| 158 | Ga0068853_100056561 | 3300005539 | Bacteria | 3383 |
| 159 | Ga0068853_100059817 | 3300005539 | Bacteria | 3291 |
| 160 | Ga0068853_100069156 | 3300005539 | Bacteria | 3071 |
| 161 | Ga0068853_100165439 | 3300005539 | Bacteria | 1998 |
| 162 | Ga0070672_100002960 | 3300005543 | Bacteria | 10932 |
| 163 | Ga0070672_100062100 | 3300005543 | Bacteria | 2947 |
| 164 | Ga0070672_100103387 | 3300005543 | Bacteria | 2313 |
| 165 | Ga0070686_100001573 | 3300005544 | Bacteria | 12811 |
| 166 | Ga0070686_100008515 | 3300005544 | Bacteria | 5746 |
| 167 | Ga0070695_100002369 | 3300005545 | Bacteria | 10826 |
| 168 | Ga0070696_100031689 | 3300005546 | Bacteria | 3624 |
| 169 | Ga0070693_100000880 | 3300005547 | Bacteria | 13363 |
| 170 | Ga0070693_100037923 | 3300005547 | Bacteria | 2690 |
| 171 | Ga0070693_100055925 | 3300005547 | Bacteria | 2275 |
| 172 | Ga0070665_100055045 | 3300005548 | Bacteria | 3990 |
| 173 | Ga0070665_100080377 | 3300005548 | Bacteria | 3265 |
| 174 | Ga0070665_100155774 | 3300005548 | Bacteria | 2286 |
| 175 | Ga0070665_100201318 | 3300005548 | Bacteria | 1992 |
| 176 | Ga0070704_100001917 | 3300005549 | Bacteria | 11493 |
| 177 | Ga0068855_100009051 | 3300005563 | Bacteria | 12031 |
| 178 | Ga0068855_100019978 | 3300005563 | Bacteria | 8045 |
| 179 | Ga0068855_100048708 | 3300005563 | Bacteria | 5000 |
| 180 | Ga0068855_100083697 | 3300005563 | Bacteria | 3695 |
| 181 | Ga0070664_100002660 | 3300005564 | Bacteria | 14408 |
| 182 | Ga0070664_100002934 | 3300005564 | Bacteria | 13792 |
| 183 | Ga0070664_100022881 | 3300005564 | Bacteria | 5155 |
| 184 | Ga0068857_100000358 | 3300005577 | Bacteria | 31869 |
| 185 | Ga0068857_100034853 | 3300005577 | Bacteria | 4453 |
| 186 | Ga0068857_100049440 | 3300005577 | Bacteria | 3730 |
| 187 | Ga0068854_100007075 | 3300005578 | Bacteria | 7161 |
| 188 | Ga0068854_100031509 | 3300005578 | Bacteria | 3685 |
| 189 | Ga0068854_100047206 | 3300005578 | Bacteria | 3068 |
| 190 | Ga0068854_100102802 | 3300005578 | Bacteria | 2144 |
| 191 | Ga0068856_100003436 | 3300005614 | Bacteria | 16012 |
| 192 | Ga0068856_100015293 | 3300005614 | Bacteria | 7415 |
| 193 | Ga0068856_100094517 | 3300005614 | Bacteria | 2976 |
| 194 | Ga0070702_100000526 | 3300005615 | Bacteria | 13792 |
| 195 | Ga0070702_100003230 | 3300005615 | Bacteria | 7253 |
| 196 | Ga0070702_100011165 | 3300005615 | Bacteria | 4460 |
| 197 | Ga0068852_100009893 | 3300005616 | Bacteria | 7097 |
| 198 | Ga0068852_100061935 | 3300005616 | Bacteria | 3252 |
| 199 | Ga0068859_100005591 | 3300005617 | Bacteria | 12805 |
| 200 | Ga0068859_100027680 | 3300005617 | Bacteria | 5685 |
| 201 | Ga0068864_100001988 | 3300005618 | Bacteria | 16835 |
| 202 | Ga0068866_10000916 | 3300005718 | Bacteria | 12945 |
| 203 | Ga0068861_100001805 | 3300005719 | Bacteria | 13785 |
| 204 | Ga0068861_100140817 | 3300005719 | Bacteria | 1968 |
| 205 | Ga0068851_10013003 | 3300005834 | Bacteria | 3934 |
| 206 | Ga0068851_10047779 | 3300005834 | Bacteria | 2168 |
| 207 | Ga0068870_10000025 | 3300005840 | Bacteria | 46848 |
| 208 | Ga0068863_100115350 | 3300005841 | Bacteria | 2559 |
| 209 | Ga0068863_100166408 | 3300005841 | Bacteria | 2114 |
| 210 | Ga0068858_100003227 | 3300005842 | Bacteria | 16273 |
| 211 | Ga0068858_100027064 | 3300005842 | Bacteria | 5326 |
| 212 | Ga0068860_100007120 | 3300005843 | Bacteria | 11192 |
| 213 | Ga0068860_100008962 | 3300005843 | Bacteria | 9967 |
| 214 | Ga0068860_100135000 | 3300005843 | Bacteria | 2369 |
| 215 | Ga0068862_100011988 | 3300005844 | Bacteria | 7161 |
| 216 | Ga0068862_100017821 | 3300005844 | Bacteria | 5912 |
| 217 | Ga0068862_100145990 | 3300005844 | Bacteria | 2102 |
| 218 | Ga0068862_100153724 | 3300005844 | Bacteria | 2049 |
| 219 | Ga0081455_10000276 | 3300005937 | Bacteria | 68055 |
| 220 | Ga0081455_10002463 | 3300005937 | Bacteria | 22024 |
| 221 | Ga0081455_10005910 | 3300005937 | Bacteria | 13278 |
| 222 | Ga0081455_10020788 | 3300005937 | Bacteria | 6170 |
| 223 | Ga0081455_10050490 | 3300005937 | Bacteria | 3577 |
| 224 | Ga0081455_10051347 | 3300005937 | Bacteria | 3538 |
| 225 | Ga0081455_10062051 | 3300005937 | Bacteria | 3143 |
| 226 | Ga0081538_10006470 | 3300005981 | Bacteria | 10310 |
| 227 | Ga0081538_10012206 | 3300005981 | Bacteria | 6901 |
| 228 | Ga0081540_1000075 | 3300005983 | Bacteria | 106804 |
| 229 | Ga0081540_1004394 | 3300005983 | Bacteria | 10776 |
| 230 | Ga0081540_1004944 | 3300005983 | Bacteria | 10022 |
| 231 | Ga0081540_1020408 | 3300005983 | Bacteria | 3986 |
| 232 | Ga0081540_1021191 | 3300005983 | Bacteria | 3881 |
| 233 | Ga0081540_1030810 | 3300005983 | Bacteria | 2964 |
| 234 | Ga0081540_1038950 | 3300005983 | Bacteria | 2497 |
| 235 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 236 | Ga0081539_10001975 | 3300005985 | Bacteria | 31233 |
| 237 | Ga0081539_10016429 | 3300005985 | Bacteria | 5287 |
| 238 | Ga0070717_10006939 | 3300006028 | Bacteria | 8369 |
| 239 | Ga0070717_10028486 | 3300006028 | Bacteria | 4472 |
| 240 | Ga0070717_10049387 | 3300006028 | Bacteria | 3453 |
| 241 | Ga0075365_10004228 | 3300006038 | Bacteria | 7568 |
| 242 | Ga0075365_10065035 | 3300006038 | Bacteria | 2444 |
| 243 | Ga0075368_10018327 | 3300006042 | Bacteria | 2630 |
| 244 | Ga0075363_100016540 | 3300006048 | Bacteria | 3644 |
| 245 | Ga0075363_100026212 | 3300006048 | Bacteria | 2980 |
| 246 | Ga0075364_10014353 | 3300006051 | Bacteria | 4894 |
| 247 | Ga0070715_10001500 | 3300006163 | Bacteria | 6813 |
| 248 | Ga0070715_10011258 | 3300006163 | Bacteria | 3217 |
| 249 | Ga0070712_100001447 | 3300006175 | Bacteria | 14474 |
| 250 | Ga0070712_100002943 | 3300006175 | Bacteria | 10550 |
| 251 | Ga0070712_100016890 | 3300006175 | Bacteria | 4719 |
| 252 | Ga0070712_100044119 | 3300006175 | Bacteria | 3073 |
| 253 | Ga0075362_10003665 | 3300006177 | Bacteria | 5420 |
| 254 | Ga0075367_10004928 | 3300006178 | Bacteria | 6578 |
| 255 | Ga0075367_10044929 | 3300006178 | Bacteria | 2591 |
| 256 | Ga0097621_100000456 | 3300006237 | Bacteria | 28666 |
| 257 | Ga0097621_100037561 | 3300006237 | Bacteria | 3882 |
| 258 | Ga0075370_10043991 | 3300006353 | Bacteria | 2524 |
| 259 | Ga0068871_100000269 | 3300006358 | Bacteria | 35773 |
| 260 | Ga0068871_100049393 | 3300006358 | Bacteria | 3400 |
| 261 | Ga0075428_100000690 | 3300006844 | Bacteria | 34808 |
| 262 | Ga0075428_100013445 | 3300006844 | Bacteria | 9108 |
| 263 | Ga0075428_100024912 | 3300006844 | Bacteria | 6618 |
| 264 | Ga0075428_100116778 | 3300006844 | Bacteria | 2906 |
| 265 | Ga0075430_100000092 | 3300006846 | Bacteria | 52226 |
| 266 | Ga0075430_100000094 | 3300006846 | Bacteria | 52204 |
| 267 | Ga0075430_100069749 | 3300006846 | Bacteria | 2948 |
| 268 | Ga0075431_100002169 | 3300006847 | Bacteria | 18764 |
| 269 | Ga0075431_100004121 | 3300006847 | Bacteria | 14193 |
| 270 | Ga0075431_100102463 | 3300006847 | Bacteria | 2954 |
| 271 | Ga0075433_10001242 | 3300006852 | Bacteria | 18605 |
| 272 | Ga0075433_10079040 | 3300006852 | Bacteria | 2898 |
| 273 | Ga0075434_100000299 | 3300006871 | Bacteria | 35320 |
| 274 | Ga0075434_100011399 | 3300006871 | Bacteria | 8385 |
| 275 | Ga0075434_100029399 | 3300006871 | Bacteria | 5406 |
| 276 | Ga0075434_100155179 | 3300006871 | Bacteria | 2309 |
| 277 | Ga0075429_100002930 | 3300006880 | Bacteria | 14473 |
| 278 | Ga0075429_100022441 | 3300006880 | Bacteria | 5473 |
| 279 | Ga0075429_100057386 | 3300006880 | Bacteria | 3390 |
| 280 | Ga0068865_100001731 | 3300006881 | Bacteria | 12818 |
| 281 | Ga0068865_100025293 | 3300006881 | Bacteria | 3903 |
| 282 | Ga0068865_100063086 | 3300006881 | Bacteria | 2603 |
| 283 | Ga0075436_100009525 | 3300006914 | Bacteria | 6646 |
| 284 | Ga0097620_100005590 | 3300006931 | Bacteria | 12805 |
| 285 | Ga0097620_100027680 | 3300006931 | Bacteria | 5685 |
| 286 | Ga0099824_1005597 | 3300006942 | Bacteria | 17628 |
| 287 | Ga0099822_1029915 | 3300006943 | Bacteria | 4178 |
| 288 | Ga0075435_100004453 | 3300007076 | Bacteria | 9627 |
| 289 | Ga0075435_100018551 | 3300007076 | Bacteria | 5295 |
| 290 | Ga0075435_100068134 | 3300007076 | Bacteria | 2898 |
| 291 | Ga0105251_10011399 | 3300009011 | Bacteria | 5081 |
| 292 | Ga0105240_10004679 | 3300009093 | Bacteria | 20687 |
| 293 | Ga0105240_10030589 | 3300009093 | Bacteria | 6995 |
| 294 | Ga0105240_10049444 | 3300009093 | Bacteria | 5306 |
| 295 | Ga0105240_10150088 | 3300009093 | Bacteria | 2777 |
| 296 | Ga0111539_10003217 | 3300009094 | Bacteria | 21607 |
| 297 | Ga0111539_10003331 | 3300009094 | Bacteria | 21223 |
| 298 | Ga0111539_10007321 | 3300009094 | Bacteria | 14133 |
| 299 | Ga0111539_10014441 | 3300009094 | Bacteria | 9855 |
| 300 | Ga0111539_10018158 | 3300009094 | Bacteria | 8712 |
| 301 | Ga0111539_10173984 | 3300009094 | Bacteria | 2515 |
| 302 | Ga0111539_10239665 | 3300009094 | Bacteria | 2111 |
| 303 | Ga0105245_10000183 | 3300009098 | Bacteria | 59105 |
| 304 | Ga0105245_10000837 | 3300009098 | Bacteria | 28055 |
| 305 | Ga0105245_10068437 | 3300009098 | Bacteria | 3217 |
| 306 | Ga0105245_10074891 | 3300009098 | Bacteria | 3081 |
| 307 | Ga0105247_10028634 | 3300009101 | Bacteria | 3371 |
| 308 | Ga0105247_10065605 | 3300009101 | Bacteria | 2259 |
| 309 | Ga0114129_10001218 | 3300009147 | Bacteria | 34180 |
| 310 | Ga0114129_10002246 | 3300009147 | Bacteria | 26676 |
| 311 | Ga0114129_10020755 | 3300009147 | Bacteria | 9335 |
| 312 | Ga0114129_10060727 | 3300009147 | Bacteria | 5285 |
| 313 | Ga0114129_10077847 | 3300009147 | Bacteria | 4612 |
| 314 | Ga0105243_10001561 | 3300009148 | Bacteria | 20018 |
| 315 | Ga0105243_10011635 | 3300009148 | Bacteria | 6656 |
| 316 | Ga0105243_10037604 | 3300009148 | Bacteria | 3763 |
| 317 | Ga0105243_10038555 | 3300009148 | Bacteria | 3721 |
| 318 | Ga0105243_10056281 | 3300009148 | Bacteria | 3127 |
| 319 | Ga0105241_10003567 | 3300009174 | Bacteria | 11569 |
| 320 | Ga0105241_10017304 | 3300009174 | Bacteria | 5294 |
| 321 | Ga0105241_10027426 | 3300009174 | Bacteria | 4242 |
| 322 | Ga0105242_10000701 | 3300009176 | Bacteria | 26184 |
| 323 | Ga0105242_10012638 | 3300009176 | Bacteria | 6501 |
| 324 | Ga0105242_10023312 | 3300009176 | Bacteria | 4878 |
| 325 | Ga0105248_10006263 | 3300009177 | Bacteria | 13046 |
| 326 | Ga0105248_10011058 | 3300009177 | Bacteria | 9953 |
| 327 | Ga0105248_10072442 | 3300009177 | Bacteria | 3872 |
| 328 | Ga0105248_10156269 | 3300009177 | Bacteria | 2574 |
| 329 | Ga0105237_10088204 | 3300009545 | Bacteria | 3091 |
| 330 | Ga0105237_10118300 | 3300009545 | Bacteria | 2643 |
| 331 | Ga0105237_10128712 | 3300009545 | Bacteria | 2526 |
| 332 | Ga0105237_10144832 | 3300009545 | Bacteria | 2371 |
| 333 | Ga0105238_10002649 | 3300009551 | Bacteria | 17824 |
| 334 | Ga0105238_10048497 | 3300009551 | Bacteria | 4280 |
| 335 | Ga0105238_10127490 | 3300009551 | Bacteria | 2523 |
| 336 | Ga0105249_10009795 | 3300009553 | Bacteria | 8397 |
| 337 | Ga0105249_10121261 | 3300009553 | Bacteria | 2485 |
| 338 | Ga0105239_10007315 | 3300010375 | Bacteria | 12675 |
| 339 | Ga0105239_10036529 | 3300010375 | Bacteria | 5394 |
| 340 | Ga0105239_10174368 | 3300010375 | Bacteria | 2405 |
| 341 | Ga0105246_10002447 | 3300011119 | Bacteria | 11209 |
| 342 | Ga0105246_10044208 | 3300011119 | Bacteria | 3026 |
| 343 | Ga0157373_10001725 | 3300013100 | Bacteria | 16609 |
| 344 | Ga0157373_10004265 | 3300013100 | Bacteria | 10768 |
| 345 | Ga0157373_10098846 | 3300013100 | Bacteria | 2054 |
| 346 | Ga0157371_10004441 | 3300013102 | Bacteria | 12242 |
| 347 | Ga0157370_10040794 | 3300013104 | Bacteria | 4481 |
| 348 | Ga0157370_10062026 | 3300013104 | Bacteria | 3546 |
| 349 | Ga0157370_10072847 | 3300013104 | Bacteria | 3241 |
| 350 | Ga0157370_10093233 | 3300013104 | Bacteria | 2826 |
| 351 | Ga0157370_10151965 | 3300013104 | Bacteria | 2154 |
| 352 | Ga0157369_10164915 | 3300013105 | Bacteria | 2337 |
| 353 | Ga0157374_10000463 | 3300013296 | Bacteria | 36848 |
| 354 | Ga0157374_10029135 | 3300013296 | Bacteria | 4995 |
| 355 | Ga0157374_10038879 | 3300013296 | Bacteria | 4376 |
| 356 | Ga0157378_10000613 | 3300013297 | Bacteria | 33512 |
| 357 | Ga0157378_10005022 | 3300013297 | Bacteria | 11616 |
| 358 | Ga0163162_10005908 | 3300013306 | Bacteria | 11842 |
| 359 | Ga0163162_10105052 | 3300013306 | Bacteria | 2919 |
| 360 | Ga0157375_10004786 | 3300013308 | Bacteria | 11768 |
| 361 | Ga0157375_10148713 | 3300013308 | Bacteria | 2476 |
| 362 | Ga0163163_10001239 | 3300014325 | Bacteria | 21547 |
| 363 | Ga0163163_10015456 | 3300014325 | Bacteria | 7058 |
| 364 | Ga0163163_10064891 | 3300014325 | Bacteria | 3624 |
| 365 | Ga0163163_10109370 | 3300014325 | Bacteria | 2791 |
| 366 | Ga0157380_10005539 | 3300014326 | Bacteria | 8827 |
| 367 | Ga0157380_10007021 | 3300014326 | Bacteria | 7969 |
| 368 | Ga0157379_10003902 | 3300014968 | Bacteria | 12714 |
| 369 | Ga0157379_10004696 | 3300014968 | Bacteria | 11727 |
| 370 | Ga0157379_10010527 | 3300014968 | Bacteria | 8062 |
| 371 | Ga0157376_10004121 | 3300014969 | Bacteria | 10068 |
| 372 | Ga0183365_10005 | 3300015684 | Bacteria | 249619 |
| 373 | Ga0163161_10001492 | 3300017792 | Bacteria | 17279 |
| 374 | Ga0163161_10016341 | 3300017792 | Bacteria | 5180 |
| 375 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 376 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 377 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 378 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 379 | Ga0213873_10004647 | 3300021358 | Bacteria | 2579 |
| 380 | Ga0213876_10011819 | 3300021384 | Bacteria | 4655 |
| 381 | Ga0213876_10026411 | 3300021384 | Bacteria | 3062 |
| 382 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 383 | Ga0209563_100836 | 3300025230 | Bacteria | 9161 |
| 384 | Ga0209677_100870 | 3300025253 | Bacteria | 14853 |
| 385 | Ga0209677_103014 | 3300025253 | Bacteria | 5807 |
| 386 | Ga0209148_1000819 | 3300025254 | Bacteria | 22428 |
| 387 | Ga0209148_1003093 | 3300025254 | Bacteria | 4874 |
| 388 | Ga0209233_1002233 | 3300025261 | Bacteria | 7245 |
| 389 | Ga0209233_1002460 | 3300025261 | Bacteria | 6799 |
| 390 | Ga0209673_1021407 | 3300025273 | Bacteria | 2261 |
| 391 | Ga0207673_1000039 | 3300025290 | Bacteria | 10384 |
| 392 | Ga0209564_1000842 | 3300025295 | Bacteria | 41342 |
| 393 | Ga0209564_1004040 | 3300025295 | Bacteria | 9261 |
| 394 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 395 | Ga0209758_1000161 | 3300025297 | Bacteria | 154278 |
| 396 | Ga0209758_1000798 | 3300025297 | Bacteria | 44669 |
| 397 | Ga0209758_1001478 | 3300025297 | Bacteria | 27491 |
| 398 | Ga0209758_1003077 | 3300025297 | Bacteria | 15844 |
| 399 | Ga0209758_1006528 | 3300025297 | Bacteria | 8326 |
| 400 | Ga0207426_1000186 | 3300025302 | Bacteria | 154130 |
| 401 | Ga0209257_1000983 | 3300025304 | Bacteria | 38689 |
| 402 | Ga0207697_10000763 | 3300025315 | Bacteria | 18220 |
| 403 | Ga0207656_10005224 | 3300025321 | Bacteria | 4572 |
| 404 | Ga0207653_10016374 | 3300025885 | Bacteria | 2329 |
| 405 | Ga0207682_10000062 | 3300025893 | Bacteria | 46841 |
| 406 | Ga0207692_10012844 | 3300025898 | Bacteria | 3612 |
| 407 | Ga0207642_10002857 | 3300025899 | Bacteria | 5392 |
| 408 | Ga0207710_10009862 | 3300025900 | Bacteria | 4015 |
| 409 | Ga0207710_10015503 | 3300025900 | Bacteria | 3222 |
| 410 | Ga0207688_10001992 | 3300025901 | Bacteria | 10954 |
| 411 | Ga0207688_10006793 | 3300025901 | Bacteria | 6227 |
| 412 | Ga0207680_10000740 | 3300025903 | Bacteria | 15389 |
| 413 | Ga0207647_10003504 | 3300025904 | Bacteria | 11767 |
| 414 | Ga0207647_10011763 | 3300025904 | Bacteria | 6122 |
| 415 | Ga0207647_10044532 | 3300025904 | Bacteria | 2772 |
| 416 | Ga0207647_10047561 | 3300025904 | Bacteria | 2667 |
| 417 | Ga0207685_10000809 | 3300025905 | Bacteria | 5800 |
| 418 | Ga0207699_10001144 | 3300025906 | Bacteria | 12551 |
| 419 | Ga0207699_10019708 | 3300025906 | Bacteria | 3602 |
| 420 | Ga0207645_10000248 | 3300025907 | Bacteria | 44949 |
| 421 | Ga0207645_10041103 | 3300025907 | Bacteria | 2961 |
| 422 | Ga0207643_10000064 | 3300025908 | Bacteria | 70490 |
| 423 | Ga0207643_10057354 | 3300025908 | Bacteria | 2217 |
| 424 | Ga0207654_10000874 | 3300025911 | Bacteria | 16703 |
| 425 | Ga0207654_10001623 | 3300025911 | Bacteria | 11742 |
| 426 | Ga0207707_10002084 | 3300025912 | Bacteria | 18100 |
| 427 | Ga0207707_10015886 | 3300025912 | Bacteria | 6566 |
| 428 | Ga0207707_10088287 | 3300025912 | Bacteria | 2708 |
| 429 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 430 | Ga0207695_10053399 | 3300025913 | Bacteria | 4227 |
| 431 | Ga0207695_10072745 | 3300025913 | Bacteria | 3505 |
| 432 | Ga0207695_10131584 | 3300025913 | Bacteria | 2459 |
| 433 | Ga0207671_10001082 | 3300025914 | Bacteria | 33044 |
| 434 | Ga0207671_10016546 | 3300025914 | Bacteria | 5727 |
| 435 | Ga0207671_10047462 | 3300025914 | Bacteria | 3179 |
| 436 | Ga0207693_10001801 | 3300025915 | Bacteria | 18789 |
| 437 | Ga0207693_10002520 | 3300025915 | Bacteria | 15918 |
| 438 | Ga0207693_10020205 | 3300025915 | Bacteria | 5297 |
| 439 | Ga0207693_10028189 | 3300025915 | Bacteria | 4437 |
| 440 | Ga0207693_10029262 | 3300025915 | Bacteria | 4353 |
| 441 | Ga0207693_10047590 | 3300025915 | Bacteria | 3369 |
| 442 | Ga0207693_10058667 | 3300025915 | Bacteria | 3015 |
| 443 | Ga0207693_10093764 | 3300025915 | Bacteria | 2353 |
| 444 | Ga0207663_10000260 | 3300025916 | Bacteria | 23036 |
| 445 | Ga0207663_10009733 | 3300025916 | Bacteria | 5089 |
| 446 | Ga0207663_10031931 | 3300025916 | Bacteria | 3121 |
| 447 | Ga0207660_10000194 | 3300025917 | Bacteria | 38742 |
| 448 | Ga0207660_10001899 | 3300025917 | Bacteria | 13916 |
| 449 | Ga0207660_10065909 | 3300025917 | Bacteria | 2618 |
| 450 | Ga0207662_10001637 | 3300025918 | Bacteria | 10959 |
| 451 | Ga0207662_10025322 | 3300025918 | Bacteria | 3418 |
| 452 | Ga0207662_10035289 | 3300025918 | Bacteria | 2920 |
| 453 | Ga0207657_10003965 | 3300025919 | Bacteria | 15718 |
| 454 | Ga0207657_10006919 | 3300025919 | Bacteria | 11695 |
| 455 | Ga0207657_10035372 | 3300025919 | Bacteria | 4480 |
| 456 | Ga0207649_10000234 | 3300025920 | Bacteria | 45397 |
| 457 | Ga0207649_10059410 | 3300025920 | Bacteria | 2399 |
| 458 | Ga0207652_10001613 | 3300025921 | Bacteria | 19823 |
| 459 | Ga0207652_10002210 | 3300025921 | Bacteria | 16600 |
| 460 | Ga0207652_10014326 | 3300025921 | Bacteria | 6421 |
| 461 | Ga0207652_10059725 | 3300025921 | Bacteria | 3287 |
| 462 | Ga0207681_10000794 | 3300025923 | Bacteria | 20828 |
| 463 | Ga0207694_10000306 | 3300025924 | Bacteria | 46009 |
| 464 | Ga0207650_10024593 | 3300025925 | Bacteria | 4283 |
| 465 | Ga0207650_10030481 | 3300025925 | Bacteria | 3886 |
| 466 | Ga0207659_10000172 | 3300025926 | Bacteria | 38725 |
| 467 | Ga0207659_10028313 | 3300025926 | Bacteria | 3806 |
| 468 | Ga0207659_10036392 | 3300025926 | Bacteria | 3409 |
| 469 | Ga0207659_10119127 | 3300025926 | Bacteria | 2020 |
| 470 | Ga0207687_10002217 | 3300025927 | Bacteria | 13242 |
| 471 | Ga0207700_10012823 | 3300025928 | Bacteria | 5422 |
| 472 | Ga0207700_10022444 | 3300025928 | Bacteria | 4332 |
| 473 | Ga0207700_10117488 | 3300025928 | Bacteria | 2151 |
| 474 | Ga0207664_10016500 | 3300025929 | Bacteria | 5389 |
| 475 | Ga0207664_10023534 | 3300025929 | Bacteria | 4617 |
| 476 | Ga0207644_10040591 | 3300025931 | Bacteria | 3290 |
| 477 | Ga0207644_10066567 | 3300025931 | Bacteria | 2623 |
| 478 | Ga0207690_10000796 | 3300025932 | Bacteria | 20342 |
| 479 | Ga0207690_10011303 | 3300025932 | Bacteria | 5335 |
| 480 | Ga0207690_10076263 | 3300025932 | Bacteria | 2327 |
| 481 | Ga0207706_10005059 | 3300025933 | Bacteria | 12314 |
| 482 | Ga0207706_10062109 | 3300025933 | Bacteria | 3290 |
| 483 | Ga0207706_10092551 | 3300025933 | Bacteria | 2658 |
| 484 | Ga0207686_10001093 | 3300025934 | Bacteria | 15891 |
| 485 | Ga0207709_10001438 | 3300025935 | Bacteria | 16619 |
| 486 | Ga0207709_10010457 | 3300025935 | Bacteria | 5107 |
| 487 | Ga0207709_10035895 | 3300025935 | Bacteria | 2935 |
| 488 | Ga0207709_10064502 | 3300025935 | Bacteria | 2300 |
| 489 | Ga0207670_10000608 | 3300025936 | Bacteria | 19358 |
| 490 | Ga0207670_10000807 | 3300025936 | Bacteria | 16336 |
| 491 | Ga0207670_10052583 | 3300025936 | Bacteria | 2739 |
| 492 | Ga0207669_10000141 | 3300025937 | Bacteria | 34618 |
| 493 | Ga0207669_10036469 | 3300025937 | Bacteria | 2810 |
| 494 | Ga0207704_10000755 | 3300025938 | Bacteria | 14264 |
| 495 | Ga0207704_10008791 | 3300025938 | Bacteria | 4848 |
| 496 | Ga0207665_10004374 | 3300025939 | Bacteria | 9383 |
| 497 | Ga0207665_10004936 | 3300025939 | Bacteria | 8898 |
| 498 | Ga0207665_10017370 | 3300025939 | Bacteria | 4728 |
| 499 | Ga0207691_10000720 | 3300025940 | Bacteria | 32686 |
| 500 | Ga0207691_10002355 | 3300025940 | Bacteria | 18498 |
| 501 | Ga0207691_10006997 | 3300025940 | Bacteria | 10884 |
| 502 | Ga0207691_10062352 | 3300025940 | Bacteria | 3383 |
| 503 | Ga0207691_10084978 | 3300025940 | Bacteria | 2840 |
| 504 | Ga0207711_10004836 | 3300025941 | Bacteria | 11448 |
| 505 | Ga0207711_10032056 | 3300025941 | Bacteria | 4441 |
| 506 | Ga0207711_10091468 | 3300025941 | Bacteria | 2676 |
| 507 | Ga0207711_10093668 | 3300025941 | Bacteria | 2646 |
| 508 | Ga0207689_10004430 | 3300025942 | Bacteria | 12738 |
| 509 | Ga0207689_10018680 | 3300025942 | Bacteria | 5849 |
| 510 | Ga0207661_10000098 | 3300025944 | Bacteria | 55518 |
| 511 | Ga0207661_10007875 | 3300025944 | Bacteria | 7592 |
| 512 | Ga0207679_10000174 | 3300025945 | Bacteria | 53051 |
| 513 | Ga0207679_10004250 | 3300025945 | Bacteria | 8902 |
| 514 | Ga0207679_10048313 | 3300025945 | Bacteria | 3097 |
| 515 | Ga0207667_10004743 | 3300025949 | Bacteria | 16630 |
| 516 | Ga0207667_10029793 | 3300025949 | Bacteria | 5913 |
| 517 | Ga0207667_10055800 | 3300025949 | Bacteria | 4151 |
| 518 | Ga0207667_10059856 | 3300025949 | Bacteria | 3987 |
| 519 | Ga0207651_10002999 | 3300025960 | Bacteria | 8177 |
| 520 | Ga0207651_10101017 | 3300025960 | Bacteria | 2140 |
| 521 | Ga0207712_10000659 | 3300025961 | Bacteria | 26800 |
| 522 | Ga0207668_10001107 | 3300025972 | Bacteria | 16030 |
| 523 | Ga0207668_10038300 | 3300025972 | Bacteria | 3216 |
| 524 | Ga0207640_10000846 | 3300025981 | Bacteria | 17376 |
| 525 | Ga0207640_10071028 | 3300025981 | Bacteria | 2343 |
| 526 | Ga0207658_10001843 | 3300025986 | Bacteria | 15875 |
| 527 | Ga0207658_10036240 | 3300025986 | Bacteria | 3536 |
| 528 | Ga0207677_10002504 | 3300026023 | Bacteria | 9628 |
| 529 | Ga0207677_10044516 | 3300026023 | Bacteria | 2958 |
| 530 | Ga0207703_10002433 | 3300026035 | Bacteria | 16135 |
| 531 | Ga0207703_10005387 | 3300026035 | Bacteria | 10302 |
| 532 | Ga0207703_10088155 | 3300026035 | Bacteria | 2603 |
| 533 | Ga0207639_10001774 | 3300026041 | Bacteria | 14522 |
| 534 | Ga0207639_10007131 | 3300026041 | Bacteria | 7616 |
| 535 | Ga0207639_10022198 | 3300026041 | Bacteria | 4569 |
| 536 | Ga0207678_10001059 | 3300026067 | Bacteria | 25176 |
| 537 | Ga0207678_10009212 | 3300026067 | Bacteria | 8688 |
| 538 | Ga0207678_10031363 | 3300026067 | Bacteria | 4637 |
| 539 | Ga0207678_10057982 | 3300026067 | Bacteria | 3332 |
| 540 | Ga0207678_10080115 | 3300026067 | Bacteria | 2796 |
| 541 | Ga0207708_10001417 | 3300026075 | Bacteria | 17962 |
| 542 | Ga0207708_10002793 | 3300026075 | Bacteria | 12833 |
| 543 | Ga0207708_10063316 | 3300026075 | Bacteria | 2826 |
| 544 | Ga0207702_10000122 | 3300026078 | Bacteria | 91685 |
| 545 | Ga0207702_10007668 | 3300026078 | Bacteria | 9176 |
| 546 | Ga0207702_10008899 | 3300026078 | Bacteria | 8461 |
| 547 | Ga0207702_10134619 | 3300026078 | Bacteria | 2228 |
| 548 | Ga0207641_10000622 | 3300026088 | Bacteria | 38657 |
| 549 | Ga0207641_10007557 | 3300026088 | Bacteria | 9040 |
| 550 | Ga0207648_10009300 | 3300026089 | Bacteria | 9423 |
| 551 | Ga0207676_10002696 | 3300026095 | Bacteria | 12630 |
| 552 | Ga0207676_10026665 | 3300026095 | Bacteria | 4297 |
| 553 | Ga0207674_10001342 | 3300026116 | Bacteria | 31848 |
| 554 | Ga0207674_10014657 | 3300026116 | Bacteria | 8644 |
| 555 | Ga0207674_10017155 | 3300026116 | Bacteria | 7903 |
| 556 | Ga0207674_10046931 | 3300026116 | Bacteria | 4432 |
| 557 | Ga0207674_10144681 | 3300026116 | Bacteria | 2336 |
| 558 | Ga0207675_100006706 | 3300026118 | Bacteria | 10886 |
| 559 | Ga0207675_100011711 | 3300026118 | Bacteria | 8203 |
| 560 | Ga0207683_10001193 | 3300026121 | Bacteria | 23509 |
| 561 | Ga0207683_10045199 | 3300026121 | Bacteria | 3850 |
| 562 | Ga0207683_10101830 | 3300026121 | Bacteria | 2564 |
| 563 | Ga0209389_1000328 | 3300027296 | Bacteria | 29034 |
| 564 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 565 | Ga0209589_1003134 | 3300027357 | Bacteria | 29000 |
| 566 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 567 | Ga0209489_103754 | 3300027361 | Bacteria | 29057 |
| 568 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 569 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 570 | Ga0210002_1000638 | 3300027617 | Bacteria | 4734 |
| 571 | Ga0209588_1011823 | 3300027671 | Bacteria | 2643 |
| 572 | Ga0209966_1004024 | 3300027695 | Bacteria | 2480 |
| 573 | Ga0209998_10001504 | 3300027717 | Bacteria | 5603 |
| 574 | Ga0209974_10001402 | 3300027876 | Bacteria | 8719 |
| 575 | Ga0207428_10000513 | 3300027907 | Bacteria | 46311 |
| 576 | Ga0207428_10000626 | 3300027907 | Bacteria | 41522 |
| 577 | Ga0207428_10001020 | 3300027907 | Bacteria | 31018 |
| 578 | Ga0207428_10009473 | 3300027907 | Bacteria | 8721 |
| 579 | Ga0268266_10009223 | 3300028379 | Bacteria | 8704 |
| 580 | Ga0268266_10011610 | 3300028379 | Bacteria | 7646 |
| 581 | Ga0268266_10018776 | 3300028379 | Bacteria | 5891 |
| 582 | Ga0268266_10018923 | 3300028379 | Bacteria | 5867 |
| 583 | Ga0268266_10086973 | 3300028379 | Bacteria | 2733 |
| 584 | Ga0268266_10105625 | 3300028379 | Bacteria | 2488 |
| 585 | Ga0268265_10002370 | 3300028380 | Bacteria | 14256 |
| 586 | Ga0268265_10097726 | 3300028380 | Bacteria | 2363 |
| 587 | Ga0268264_10000110 | 3300028381 | Bacteria | 206663 |
| 588 | Ga0268264_10000187 | 3300028381 | Bacteria | 129270 |
| 589 | Ga0268264_10006546 | 3300028381 | Bacteria | 9807 |
| 590 | Ga0268264_10071289 | 3300028381 | Bacteria | 2943 |
| 591 | Ga0268264_10144411 | 3300028381 | Bacteria | 2126 |
| 592 | Ga0265337_1001215 | 3300028556 | Bacteria | 13090 |
| 593 | Ga0265334_10026341 | 3300028573 | Bacteria | 2347 |
| 594 | Ga0265336_10000764 | 3300028666 | Bacteria | 17051 |
| 595 | Ga0307517_10000066 | 3300028786 | Bacteria | 141370 |
| 596 | Ga0265338_10000973 | 3300028800 | Bacteria | 48208 |
| 597 | Ga0265338_10021562 | 3300028800 | Bacteria | 6712 |
| 598 | Ga0265338_10062901 | 3300028800 | Bacteria | 3240 |
| 599 | Ga0265324_10003352 | 3300029957 | Bacteria | 7675 |
| 600 | Ga0265330_10025186 | 3300031235 | Bacteria | 2697 |
| 601 | Ga0265330_10029428 | 3300031235 | Bacteria | 2470 |
| 602 | Ga0265332_10003602 | 3300031238 | Bacteria | 7431 |
| 603 | Ga0265325_10003292 | 3300031241 | Bacteria | 10625 |
| 604 | Ga0265325_10006295 | 3300031241 | Bacteria | 7221 |
| 605 | Ga0265325_10007950 | 3300031241 | Bacteria | 6300 |
| 606 | Ga0265325_10023341 | 3300031241 | Bacteria | 3378 |
| 607 | Ga0265340_10001645 | 3300031247 | Bacteria | 12826 |
| 608 | Ga0265340_10029097 | 3300031247 | Bacteria | 2776 |
| 609 | Ga0265339_10000069 | 3300031249 | Bacteria | 90219 |
| 610 | Ga0265339_10004839 | 3300031249 | Bacteria | 9099 |
| 611 | Ga0265339_10007305 | 3300031249 | Bacteria | 7158 |
| 612 | Ga0265331_10017214 | 3300031250 | Bacteria | 3775 |
| 613 | Ga0265331_10022476 | 3300031250 | Bacteria | 3217 |
| 614 | Ga0265327_10000130 | 3300031251 | Bacteria | 165066 |
| 615 | Ga0265316_10082137 | 3300031344 | Bacteria | 2469 |
| 616 | Ga0265316_10097918 | 3300031344 | Bacteria | 2232 |
| 617 | Ga0307509_10034527 | 3300031507 | Bacteria | 5556 |
| 618 | Ga0307408_100022413 | 3300031548 | Bacteria | 4291 |
| 619 | Ga0265313_10000386 | 3300031595 | Bacteria | 47422 |
| 620 | Ga0265313_10000525 | 3300031595 | Bacteria | 40049 |
| 621 | Ga0265313_10005935 | 3300031595 | Bacteria | 8833 |
| 622 | Ga0265313_10006744 | 3300031595 | Bacteria | 8032 |
| 623 | Ga0265313_10008290 | 3300031595 | Bacteria | 6926 |
| 624 | Ga0307508_10001545 | 3300031616 | Bacteria | 25766 |
| 625 | Ga0265314_10002489 | 3300031711 | Bacteria | 18827 |
| 626 | Ga0265314_10008132 | 3300031711 | Bacteria | 9027 |
| 627 | Ga0265342_10000245 | 3300031712 | Bacteria | 60848 |
| 628 | Ga0265342_10001939 | 3300031712 | Bacteria | 18542 |
| 629 | Ga0316576_10020401 | 3300031727 | Bacteria | 4562 |
| 630 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 631 | Ga0307516_10056008 | 3300031730 | Bacteria | 3846 |
| 632 | Ga0307510_10026558 | 3300033180 | Bacteria | 6652 |
| 633 | Ga0307510_10039402 | 3300033180 | Bacteria | 5206 |
| 634 | Ga0307510_10133565 | 3300033180 | Bacteria | 2146 |
| 635 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 636 | Ga0373948_0000049 | 3300034817 | Bacteria | 12986 |
| 637 | Ga0373958_0000026 | 3300034819 | Bacteria | 16079 |
| 638 | Ga0373959_0000446 | 3300034820 | Bacteria | 7792 |
| 639 | Ga0373938_0000133 | 3300034957 | Bacteria | 10609 |
| 640 | Ga0373938_0000337 | 3300034957 | Bacteria | 7445 |
| 641 | Ga0373938_0003695 | 3300034957 | Bacteria | 2520 |
| 642 | Ga0373926_0010417 | 3300035083 | Bacteria | 3118 |
| 643 | Ga0373929_0000110 | 3300035085 | Bacteria | 13537 |
| 644 | Ga0373934_0029264 | 3300035086 | Bacteria | 2150 |
| 645 | Ga0373940_0000409 | 3300035088 | Bacteria | 6529 |
| 646 | Ga0373944_0001321 | 3300035089 | Bacteria | 6236 |
| 647 | Ga0373944_0006972 | 3300035089 | Bacteria | 3019 |
| 648 | Ga0373944_0010142 | 3300035089 | Bacteria | 2563 |
| 649 | Ga0373949_0000771 | 3300035090 | Bacteria | 10307 |
| 650 | Ga0373949_0001010 | 3300035090 | Bacteria | 8668 |
| 651 | Ga0373949_0002903 | 3300035090 | Bacteria | 4226 |
| 652 | Ga0373951_0001038 | 3300035091 | Bacteria | 7468 |
| 653 | Ga0373952_0000200 | 3300035092 | Bacteria | 9497 |
| 654 | Ga0373952_0000271 | 3300035092 | Bacteria | 8517 |
| 655 | Ga0373923_0000365 | 3300035111 | Bacteria | 10291 |
| 656 | Ga0373932_0013210 | 3300035112 | Bacteria | 2048 |
| 657 | Ga0373936_0002908 | 3300035113 | Bacteria | 6397 |
| 658 | Ga0373936_0006874 | 3300035113 | Bacteria | 4280 |
| 659 | Ga0373936_0014831 | 3300035113 | Bacteria | 2982 |
| 660 | Ga0373936_0032359 | 3300035113 | Bacteria | 2068 |
| 661 | Ga0373939_0001604 | 3300035114 | Bacteria | 5459 |
| 662 | Ga0373941_0000177 | 3300035115 | Bacteria | 11867 |
| 663 | Ga0373945_0000773 | 3300035116 | Bacteria | 9339 |
| 664 | Ga0373945_0002050 | 3300035116 | Bacteria | 6263 |
| 665 | Ga0373945_0007095 | 3300035116 | Bacteria | 3625 |
| 666 | Ga0373953_0002305 | 3300035117 | Bacteria | 5741 |
| 667 | Ga0373953_0010859 | 3300035117 | Bacteria | 3181 |
| 668 | Ga0373953_0016591 | 3300035117 | Bacteria | 2691 |
| 669 | Ga0373954_0001844 | 3300035118 | Bacteria | 8749 |
| 670 | Ga0373954_0003693 | 3300035118 | Bacteria | 6515 |
| 671 | Ga0373954_0004386 | 3300035118 | Bacteria | 6069 |
| 672 | Ga0373954_0042229 | 3300035118 | Bacteria | 2126 |
| 673 | Ga0373956_0001114 | 3300035119 | Bacteria | 11079 |
| 674 | Ga0373956_0012758 | 3300035119 | Bacteria | 3489 |
| 675 | Ga0373956_0022639 | 3300035119 | Bacteria | 2690 |
| 676 | Ga0373957_0005169 | 3300035120 | Bacteria | 4032 |
| 677 | Ga0373960_0002058 | 3300035121 | Bacteria | 4524 |
| 678 | Ga0373943_0000371 | 3300035170 | Bacteria | 19059 |
| 679 | Ga0373943_0016042 | 3300035170 | Bacteria | 3411 |
| 680 | Ga0373943_0022654 | 3300035170 | Bacteria | 2913 |
| 681 | Ga0373946_0001609 | 3300035171 | Bacteria | 7854 |
| 682 | Ga0373946_0003088 | 3300035171 | Bacteria | 5899 |
| 683 | Ga0373946_0003694 | 3300035171 | Bacteria | 5423 |
| 684 | Ga0373946_0003981 | 3300035171 | Bacteria | 5255 |
| 685 | Ga0373946_0017748 | 3300035171 | Bacteria | 2726 |
| 686 | Ga0373955_0000087 | 3300035172 | Bacteria | 37402 |
| 687 | Ga0373955_0019309 | 3300035172 | Bacteria | 3403 |
| 688 | Ga0373955_0022872 | 3300035172 | Bacteria | 3176 |
| 689 | Ga0373942_0000533 | 3300035207 | Bacteria | 10673 |
| 690 | Ga0373942_0002312 | 3300035207 | Bacteria | 4658 |
| 691 | Ga0373961_0009181 | 3300035241 | Bacteria | 2416 |
| 692 | Ga0373962_0000275 | 3300035242 | Bacteria | 11095 |
| 693 | Ga0373962_0003026 | 3300035242 | Bacteria | 4026 |
| 694 | Ga0316574_0000409 | 3300035398 | Bacteria | 16937 |
| 695 | Ga0373931_0002417 | 3300035691 | Bacteria | 8259 |
| 696 | Ga0373931_0003207 | 3300035691 | Bacteria | 7302 |
| 697 | Ga0373931_0013686 | 3300035691 | Bacteria | 3954 |
| 698 | Ga0373931_0018753 | 3300035691 | Bacteria | 3444 |
| 699 | Ga0373931_0043522 | 3300035691 | Bacteria | 2365 |
| 700 | Ga0373935_0000249 | 3300035692 | Bacteria | 26486 |
| 701 | Ga0373935_0001440 | 3300035692 | Bacteria | 13192 |
| 702 | Ga0373935_0001638 | 3300035692 | Bacteria | 12510 |
| 703 | Ga0373935_0009616 | 3300035692 | Bacteria | 5788 |
| 704 | Ga0373935_0017387 | 3300035692 | Bacteria | 4362 |
| 705 | Ga0373935_0022258 | 3300035692 | Bacteria | 3885 |
| 706 | Ga0373935_0023343 | 3300035692 | Bacteria | 3800 |
| 707 | Ga0373935_0038689 | 3300035692 | Bacteria | 2987 |
| 708 | Ga0373935_0065574 | 3300035692 | Bacteria | 2331 |
| 709 | Ga0373927_0000496 | 3300035695 | Bacteria | 29963 |
| 710 | Ga0373927_0005789 | 3300035695 | Bacteria | 8482 |
| 711 | Ga0373927_0013727 | 3300035695 | Bacteria | 5378 |
| 712 | Ga0373927_0017197 | 3300035695 | Bacteria | 4764 |
| 713 | Ga0373927_0038948 | 3300035695 | Bacteria | 3085 |
| 714 | Ga0373927_0052483 | 3300035695 | Bacteria | 2638 |
| 715 | Ga0373927_0057648 | 3300035695 | Bacteria | 2511 |
| 716 | Ga0373927_0076999 | 3300035695 | Bacteria | 2160 |
| 717 | Ga0373933_0001541 | 3300035724 | Bacteria | 13482 |
| 718 | Ga0373933_0003396 | 3300035724 | Bacteria | 8876 |
| 719 | Ga0373933_0015198 | 3300035724 | Bacteria | 4290 |
| 720 | Ga0373933_0020661 | 3300035724 | Bacteria | 3732 |
| 721 | Ga0373933_0052379 | 3300035724 | Bacteria | 2442 |
| 722 | Ga0373947_0000172 | 3300035725 | Bacteria | 35133 |
| 723 | Ga0373947_0000552 | 3300035725 | Bacteria | 21816 |
| 724 | Ga0373947_0001425 | 3300035725 | Bacteria | 14710 |
| 725 | Ga0373947_0003284 | 3300035725 | Bacteria | 9583 |
| 726 | Ga0373947_0005148 | 3300035725 | Bacteria | 7658 |
| 727 | Ga0373947_0008568 | 3300035725 | Bacteria | 5888 |
| 728 | Ga0373947_0043715 | 3300035725 | Bacteria | 2676 |
| 729 | Ga0373937_0000006 | 3300036401 | Bacteria | 194781 |
| 730 | Ga0373937_0003940 | 3300036401 | Bacteria | 12549 |
| 731 | Ga0373937_0006385 | 3300036401 | Bacteria | 10173 |
| 732 | Ga0373937_0008551 | 3300036401 | Bacteria | 8892 |
| 733 | Ga0373937_0013102 | 3300036401 | Bacteria | 7302 |
| 734 | Ga0373937_0020237 | 3300036401 | Bacteria | 5964 |
| 735 | Ga0373937_0037460 | 3300036401 | Bacteria | 4419 |
| 736 | Ga0373937_0053496 | 3300036401 | Bacteria | 3703 |
| 737 | Ga0373937_0084498 | 3300036401 | Bacteria | 2936 |
| 738 | Ga0316584_0023349 | 3300036712 | Bacteria | 4519 |
| 739 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 740 | Ga0373925_0001273 | 3300037068 | Bacteria | 22250 |
| 741 | Ga0373925_0001642 | 3300037068 | Bacteria | 18838 |
| 742 | Ga0373925_0006254 | 3300037068 | Bacteria | 8780 |
| 743 | Ga0373925_0007268 | 3300037068 | Bacteria | 8093 |
| 744 | Ga0373925_0012599 | 3300037068 | Bacteria | 6128 |
| 745 | Ga0373925_0013241 | 3300037068 | Bacteria | 5967 |
| 746 | Ga0395899_0034774 | 3300037312 | Bacteria | 3785 |
| 747 | Ga0395900_0000962 | 3300037418 | Bacteria | 37526 |
| 748 | Ga0395900_0001475 | 3300037418 | Bacteria | 28056 |
| 749 | Ga0395898_0016645 | 3300037466 | Bacteria | 7516 |
| 750 | Ga0395898_0020156 | 3300037466 | Bacteria | 6774 |
| 751 | Ga0395898_0031972 | 3300037466 | Bacteria | 5253 |
| 752 | Ga0395898_0061080 | 3300037466 | Bacteria | 3661 |
| 753 | Ga0395898_0075158 | 3300037466 | Bacteria | 3264 |
| 754 | Ga0395905_0000156 | 3300037471 | Bacteria | 112215 |
| 755 | Ga0395905_0007000 | 3300037471 | Bacteria | 11273 |
| 756 | Ga0395905_0021976 | 3300037471 | Bacteria | 6035 |
| 757 | Ga0395905_0114742 | 3300037471 | Bacteria | 2531 |
| 758 | Ga0436364_0271330 | 3300037853 | Bacteria | 2398 |
| 759 | Ga0436364_0500047 | 3300037853 | Bacteria | 2906 |
| 760 | Ga0436364_0728139 | 3300037853 | Bacteria | 64829 |
| 761 | Ga0436364_0992626 | 3300037853 | Bacteria | 2737 |
| 762 | Ga0395901_0002873 | 3300038443 | Bacteria | 17387 |
| 763 | Ga0395901_0010605 | 3300038443 | Bacteria | 9335 |
| 764 | Ga0395901_0067052 | 3300038443 | Bacteria | 3738 |
| 765 | Ga0400483_004403 | 3300039062 | Bacteria | 2791 |
| 766 | Ga0400483_116415 | 3300039062 | Bacteria | 2124 |
| 767 | Ga0400483_160454 | 3300039062 | Bacteria | 4978 |
| 768 | Ga0436365_0018961 | 3300039437 | Bacteria | 4434 |
| 769 | Ga0436365_0675935 | 3300039437 | Bacteria | 6448 |
| 770 | Ga0436365_0918738 | 3300039437 | Bacteria | 2142 |
| 771 | Ga0436365_1445082 | 3300039437 | Bacteria | 11095 |
| 772 | Ga0436365_1839688 | 3300039437 | Bacteria | 4542 |
| 773 | Ga0436361_0314376 | 3300039447 | Bacteria | 17837 |
| 774 | Ga0436363_1035293 | 3300039450 | Bacteria | 14114 |
| 775 | Ga0439460_0006942 | 3300042461 | Bacteria | 2821 |
| 776 | Ga0451577_0068027 | 3300042876 | Bacteria | 3177 |
| 777 | Ga0466969_0013555 | 3300044656 | Bacteria | 4293 |
| 778 | Ga0466972_0000048 | 3300044658 | Bacteria | 119165 |
| 779 | Ga0466972_0004536 | 3300044658 | Bacteria | 6955 |
| 780 | Ga0466966_0001825 | 3300044684 | Bacteria | 13815 |
| 781 | Ga0466966_0034354 | 3300044684 | Bacteria | 3279 |
| 782 | Ga0466961_0000010 | 3300044693 | Bacteria | 137550 |
| 783 | Ga0466963_0002918 | 3300044694 | Bacteria | 9655 |
| 784 | Ga0466963_0014154 | 3300044694 | Bacteria | 4915 |
| 785 | Ga0466968_0033848 | 3300044735 | Bacteria | 2130 |
| 786 | Ga0466959_0025251 | 3300045049 | Bacteria | 4403 |
| 787 | Ga0451576_0004729 | 3300045051 | Bacteria | 17496 |
| 788 | Ga0451576_0013587 | 3300045051 | Bacteria | 9101 |
| 789 | Ga0466967_0043269 | 3300045976 | Bacteria | 3898 |
| 790 | Ga0466967_0090501 | 3300045976 | Bacteria | 2780 |
| 791 | Ga0495617_014253 | 3300046452 | Bacteria | 2702 |
| 792 | Ga0495592_0000039 | 3300046454 | Bacteria | 124471 |
| 793 | Ga0495592_0001131 | 3300046454 | Bacteria | 18562 |
| 794 | Ga0495592_0006064 | 3300046454 | Bacteria | 8982 |
| 795 | Ga0495592_0007618 | 3300046454 | Bacteria | 8111 |
| 796 | Ga0495592_0013776 | 3300046454 | Bacteria | 6148 |
| 797 | Ga0495592_0045577 | 3300046454 | Bacteria | 3271 |
| 798 | Ga0495592_0053790 | 3300046454 | Bacteria | 2985 |
| 799 | Ga0495592_0089180 | 3300046454 | Bacteria | 2215 |
| 800 | Ga0495603_0000104 | 3300046455 | Bacteria | 39821 |
| 801 | Ga0495603_0037324 | 3300046455 | Bacteria | 2915 |
| 802 | Ga0495603_0052457 | 3300046455 | Bacteria | 2421 |
| 803 | Ga0495629_0000748 | 3300046459 | Bacteria | 26249 |
| 804 | Ga0495629_0002078 | 3300046459 | Bacteria | 15535 |
| 805 | Ga0495629_0006821 | 3300046459 | Bacteria | 8443 |
| 806 | Ga0495629_0012882 | 3300046459 | Bacteria | 6049 |
| 807 | Ga0495629_0022194 | 3300046459 | Bacteria | 4527 |
| 808 | Ga0495629_0034735 | 3300046459 | Bacteria | 3564 |
| 809 | Ga0495629_0054255 | 3300046459 | Bacteria | 2803 |
| 810 | Ga0495638_0008996 | 3300046460 | Bacteria | 7039 |
| 811 | Ga0495638_0024230 | 3300046460 | Bacteria | 3959 |
| 812 | Ga0495638_0035210 | 3300046460 | Bacteria | 3193 |
| 813 | Ga0495641_0030325 | 3300046461 | Bacteria | 2595 |
| 814 | Ga0495651_0000611 | 3300046462 | Bacteria | 27721 |
| 815 | Ga0495651_0001571 | 3300046462 | Bacteria | 17667 |
| 816 | Ga0495651_0011467 | 3300046462 | Bacteria | 6807 |
| 817 | Ga0495651_0021445 | 3300046462 | Bacteria | 5021 |
| 818 | Ga0495651_0079930 | 3300046462 | Bacteria | 2470 |
| 819 | Ga0495651_0092655 | 3300046462 | Bacteria | 2263 |
| 820 | Ga0495651_0100880 | 3300046462 | Bacteria | 2149 |
| 821 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 822 | Ga0495653_0007005 | 3300046463 | Bacteria | 9251 |
| 823 | Ga0495653_0011146 | 3300046463 | Bacteria | 7352 |
| 824 | Ga0495653_0018841 | 3300046463 | Bacteria | 5601 |
| 825 | Ga0495653_0030224 | 3300046463 | Bacteria | 4317 |
| 826 | Ga0495653_0037262 | 3300046463 | Bacteria | 3822 |
| 827 | Ga0495580_0003617 | 3300046472 | Bacteria | 13095 |
| 828 | Ga0495580_0010851 | 3300046472 | Bacteria | 7070 |
| 829 | Ga0495580_0026401 | 3300046472 | Bacteria | 4234 |
| 830 | Ga0495582_0000063 | 3300046473 | Bacteria | 54381 |
| 831 | Ga0495582_0012713 | 3300046473 | Bacteria | 4639 |
| 832 | Ga0495639_0000224 | 3300046475 | Bacteria | 28629 |
| 833 | Ga0495662_0000297 | 3300046476 | Bacteria | 21564 |
| 834 | Ga0495662_0013952 | 3300046476 | Bacteria | 3910 |
| 835 | Ga0495662_0023254 | 3300046476 | Bacteria | 2993 |
| 836 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 837 | Ga0495664_0006271 | 3300046477 | Bacteria | 6566 |
| 838 | Ga0495664_0015744 | 3300046477 | Bacteria | 4303 |
| 839 | Ga0495664_0044123 | 3300046477 | Bacteria | 2642 |
| 840 | Ga0495664_0050217 | 3300046477 | Bacteria | 2476 |
| 841 | Ga0495585_0000546 | 3300046492 | Bacteria | 35582 |
| 842 | Ga0495585_0059640 | 3300046492 | Bacteria | 2102 |
| 843 | Ga0495594_0001344 | 3300046499 | Bacteria | 12765 |
| 844 | Ga0495596_0037352 | 3300046500 | Bacteria | 1921 |
| 845 | Ga0495606_0003923 | 3300046507 | Bacteria | 15309 |
| 846 | Ga0495606_0018849 | 3300046507 | Bacteria | 5160 |
| 847 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 848 | Ga0495608_0000557 | 3300046511 | Bacteria | 25706 |
| 849 | Ga0495608_0002360 | 3300046511 | Bacteria | 13601 |
| 850 | Ga0495608_0075138 | 3300046511 | Bacteria | 2202 |
| 851 | Ga0495610_0017707 | 3300046512 | Bacteria | 4054 |
| 852 | Ga0495610_0020667 | 3300046512 | Bacteria | 3649 |
| 853 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 854 | Ga0495618_0003917 | 3300046514 | Bacteria | 9189 |
| 855 | Ga0495618_0007259 | 3300046514 | Bacteria | 6704 |
| 856 | Ga0495618_0027475 | 3300046514 | Bacteria | 3541 |
| 857 | Ga0495618_0057516 | 3300046514 | Bacteria | 2462 |
| 858 | Ga0495618_0094208 | 3300046514 | Bacteria | 1915 |
| 859 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 860 | Ga0495628_0008721 | 3300046516 | Bacteria | 8675 |
| 861 | Ga0495628_0018145 | 3300046516 | Bacteria | 5835 |
| 862 | Ga0495628_0019167 | 3300046516 | Bacteria | 5658 |
| 863 | Ga0495628_0031426 | 3300046516 | Bacteria | 4295 |
| 864 | Ga0495628_0044261 | 3300046516 | Bacteria | 3542 |
| 865 | Ga0495628_0063330 | 3300046516 | Bacteria | 2898 |
| 866 | Ga0495630_0018505 | 3300046517 | Bacteria | 5118 |
| 867 | Ga0495630_0024736 | 3300046517 | Bacteria | 4438 |
| 868 | Ga0495637_0005275 | 3300046520 | Bacteria | 6612 |
| 869 | Ga0495637_0018544 | 3300046520 | Bacteria | 3226 |
| 870 | Ga0495644_0000208 | 3300046523 | Bacteria | 27638 |
| 871 | Ga0495648_0001804 | 3300046524 | Bacteria | 20615 |
| 872 | Ga0495648_0037123 | 3300046524 | Bacteria | 3134 |
| 873 | Ga0495666_0027747 | 3300046526 | Bacteria | 2786 |
| 874 | Ga0495642_0000952 | 3300046528 | Bacteria | 13558 |
| 875 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 876 | Ga0495652_0011295 | 3300046529 | Bacteria | 8080 |
| 877 | Ga0495652_0043946 | 3300046529 | Bacteria | 3848 |
| 878 | Ga0495665_0000290 | 3300046531 | Bacteria | 25439 |
| 879 | Ga0495665_0009753 | 3300046531 | Bacteria | 5198 |
| 880 | Ga0495665_0035624 | 3300046531 | Bacteria | 2658 |
| 881 | Ga0495665_0039329 | 3300046531 | Bacteria | 2519 |
| 882 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 883 | Ga0495640_0005790 | 3300046533 | Bacteria | 9814 |
| 884 | Ga0495640_0016952 | 3300046533 | Bacteria | 5438 |
| 885 | Ga0495640_0026837 | 3300046533 | Bacteria | 4158 |
| 886 | Ga0495640_0066325 | 3300046533 | Bacteria | 2435 |
| 887 | Ga0495586_0004986 | 3300046535 | Bacteria | 7101 |
| 888 | Ga0495586_0012468 | 3300046535 | Bacteria | 4509 |
| 889 | Ga0495586_0018134 | 3300046535 | Bacteria | 3744 |
| 890 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 891 | Ga0495587_0001059 | 3300046536 | Bacteria | 18102 |
| 892 | Ga0495587_0020929 | 3300046536 | Bacteria | 4035 |
| 893 | Ga0495598_0004142 | 3300046537 | Bacteria | 3123 |
| 894 | Ga0495609_0003197 | 3300046538 | Bacteria | 9515 |
| 895 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 896 | Ga0495645_0006734 | 3300046543 | Bacteria | 7983 |
| 897 | Ga0495645_0007749 | 3300046543 | Bacteria | 7469 |
| 898 | Ga0495645_0039626 | 3300046543 | Bacteria | 3436 |
| 899 | Ga0495645_0068183 | 3300046543 | Bacteria | 2568 |
| 900 | Ga0495633_0002198 | 3300046558 | Bacteria | 13962 |
| 901 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 902 | Ga0495667_0009830 | 3300046559 | Bacteria | 6479 |
| 903 | Ga0495667_0016261 | 3300046559 | Bacteria | 5025 |
| 904 | Ga0495667_0070092 | 3300046559 | Bacteria | 2287 |
| 905 | Ga0495667_0074627 | 3300046559 | Bacteria | 2208 |
| 906 | Ga0495656_0000116 | 3300046615 | Bacteria | 31062 |
| 907 | Ga0495668_0013241 | 3300046616 | Bacteria | 4874 |
| 908 | Ga0495668_0067894 | 3300046616 | Bacteria | 1961 |
| 909 | Ga0495634_0000022 | 3300046642 | Bacteria | 118988 |
| 910 | Ga0495634_0005885 | 3300046642 | Bacteria | 9366 |
| 911 | Ga0495634_0013980 | 3300046642 | Bacteria | 5797 |
| 912 | Ga0495634_0014410 | 3300046642 | Bacteria | 5701 |
| 913 | Ga0495634_0023350 | 3300046642 | Bacteria | 4349 |
| 914 | Ga0495634_0083444 | 3300046642 | Bacteria | 2085 |
| 915 | Ga0495611_0002902 | 3300046648 | Bacteria | 7654 |
| 916 | Ga0495625_0014130 | 3300046660 | Bacteria | 6389 |
| 917 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 918 | Ga0495635_0009729 | 3300046663 | Bacteria | 6720 |
| 919 | Ga0495635_0012565 | 3300046663 | Bacteria | 5934 |
| 920 | Ga0495635_0017837 | 3300046663 | Bacteria | 4958 |
| 921 | Ga0495635_0067122 | 3300046663 | Bacteria | 2460 |
| 922 | Ga0495635_0070813 | 3300046663 | Bacteria | 2390 |
| 923 | Ga0495659_0000633 | 3300046664 | Bacteria | 12802 |
| 924 | Ga0495659_0013796 | 3300046664 | Bacteria | 2636 |
| 925 | Ga0495661_0009454 | 3300046665 | Bacteria | 6690 |
| 926 | Ga0495588_0006115 | 3300046674 | Bacteria | 5404 |
| 927 | Ga0495588_0007718 | 3300046674 | Bacteria | 4912 |
| 928 | Ga0495657_0000435 | 3300046675 | Bacteria | 38963 |
| 929 | Ga0495657_0023694 | 3300046675 | Bacteria | 4384 |
| 930 | Ga0495657_0039556 | 3300046675 | Bacteria | 3239 |
| 931 | Ga0495657_0050904 | 3300046675 | Bacteria | 2783 |
| 932 | Ga0495657_0051901 | 3300046675 | Bacteria | 2752 |
| 933 | Ga0495657_0065141 | 3300046675 | Bacteria | 2397 |
| 934 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 935 | Ga0495599_0001663 | 3300046678 | Bacteria | 12840 |
| 936 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 937 | Ga0495623_0000278 | 3300046679 | Bacteria | 33474 |
| 938 | Ga0495623_0004162 | 3300046679 | Bacteria | 9528 |
| 939 | Ga0495623_0029868 | 3300046679 | Bacteria | 3507 |
| 940 | Ga0495623_0047063 | 3300046679 | Bacteria | 2737 |
| 941 | Ga0495646_0000014 | 3300046680 | Bacteria | 143781 |
| 942 | Ga0495646_0007424 | 3300046680 | Bacteria | 6966 |
| 943 | Ga0495646_0016960 | 3300046680 | Bacteria | 4625 |
| 944 | Ga0495646_0043120 | 3300046680 | Bacteria | 2765 |
| 945 | Ga0495647_0000453 | 3300046681 | Bacteria | 11831 |
| 946 | Ga0495647_0000596 | 3300046681 | Bacteria | 10696 |
| 947 | Ga0495647_0010922 | 3300046681 | Bacteria | 3102 |
| 948 | Ga0495658_0000366 | 3300046683 | Bacteria | 25377 |
| 949 | Ga0495658_0001515 | 3300046683 | Bacteria | 12183 |
| 950 | Ga0495658_0003288 | 3300046683 | Bacteria | 8032 |
| 951 | Ga0495658_0011776 | 3300046683 | Bacteria | 4408 |
| 952 | Ga0495658_0054631 | 3300046683 | Bacteria | 2272 |
| 953 | Ga0495669_0017680 | 3300046684 | Bacteria | 3062 |
| 954 | Ga0495669_0060642 | 3300046684 | Bacteria | 1710 |
| 955 | Ga0495613_0000449 | 3300046689 | Bacteria | 35095 |
| 956 | Ga0495613_0011155 | 3300046689 | Bacteria | 6673 |
| 957 | Ga0495613_0016658 | 3300046689 | Bacteria | 5471 |
| 958 | Ga0495624_0000224 | 3300046690 | Bacteria | 44228 |
| 959 | Ga0495624_0004050 | 3300046690 | Bacteria | 10780 |
| 960 | Ga0495624_0037184 | 3300046690 | Bacteria | 3134 |
| 961 | Ga0495624_0054059 | 3300046690 | Bacteria | 2533 |
| 962 | Ga0495670_0003609 | 3300046691 | Bacteria | 7600 |
| 963 | Ga0495670_0018418 | 3300046691 | Bacteria | 3437 |
| 964 | Ga0495600_0000006 | 3300046809 | Bacteria | 151916 |
| 965 | Ga0495600_0002049 | 3300046809 | Bacteria | 11360 |
| 966 | Ga0495600_0005150 | 3300046809 | Bacteria | 7861 |
| 967 | Ga0495600_0006047 | 3300046809 | Bacteria | 7331 |
| 968 | Ga0495600_0009892 | 3300046809 | Bacteria | 5905 |
| 969 | Ga0495600_0020263 | 3300046809 | Bacteria | 4254 |
| 970 | Ga0495600_0069145 | 3300046809 | Bacteria | 2307 |
| 971 | Ga0495581_0001337 | 3300047315 | Bacteria | 13627 |
| 972 | Ga0495581_0002953 | 3300047315 | Bacteria | 9735 |
| 973 | Ga0495581_0025215 | 3300047315 | Bacteria | 3448 |
| 974 | Ga0495581_0027196 | 3300047315 | Bacteria | 3317 |
| 975 | Ga0495581_0039068 | 3300047315 | Bacteria | 2747 |
| 976 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 977 | Ga0495604_0006090 | 3300047317 | Bacteria | 9571 |
| 978 | Ga0495604_0007032 | 3300047317 | Bacteria | 8922 |
| 979 | Ga0495604_0010819 | 3300047317 | Bacteria | 7245 |
| 980 | Ga0495604_0026104 | 3300047317 | Bacteria | 4650 |
| 981 | Ga0495604_0031612 | 3300047317 | Bacteria | 4198 |
| 982 | Ga0495604_0035035 | 3300047317 | Bacteria | 3966 |
| 983 | Ga0495604_0063261 | 3300047317 | Bacteria | 2823 |
| 984 | Ga0495604_0101996 | 3300047317 | Bacteria | 2107 |
| 985 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 986 | Ga0495674_0000747 | 3300047319 | Bacteria | 30766 |
| 987 | Ga0495674_0005032 | 3300047319 | Bacteria | 12712 |
| 988 | Ga0495674_0013887 | 3300047319 | Bacteria | 7555 |
| 989 | Ga0495674_0024269 | 3300047319 | Bacteria | 5574 |
| 990 | Ga0495674_0026746 | 3300047319 | Bacteria | 5277 |
| 991 | Ga0495674_0044939 | 3300047319 | Bacteria | 3924 |
| 992 | Ga0495674_0068500 | 3300047319 | Bacteria | 3071 |
| 993 | Ga0495674_0069963 | 3300047319 | Bacteria | 3033 |
| 994 | Ga0495674_0074364 | 3300047319 | Bacteria | 2926 |
| 995 | Ga0495672_0081727 | 3300047320 | Bacteria | 1798 |
| 996 | Ga0495676_0015297 | 3300047321 | Bacteria | 6836 |
| 997 | Ga0495676_0020900 | 3300047321 | Bacteria | 5731 |
| 998 | Ga0495676_0021862 | 3300047321 | Bacteria | 5577 |
| 999 | Ga0495676_0041727 | 3300047321 | Bacteria | 3773 |
| 1000 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 1001 | Ga0495680_0003135 | 3300047322 | Bacteria | 16479 |
| 1002 | Ga0495680_0006572 | 3300047322 | Bacteria | 10788 |
| 1003 | Ga0495680_0008513 | 3300047322 | Bacteria | 9321 |
| 1004 | Ga0495680_0008658 | 3300047322 | Bacteria | 9235 |
| 1005 | Ga0495680_0012421 | 3300047322 | Bacteria | 7495 |
| 1006 | Ga0495680_0029387 | 3300047322 | Bacteria | 4501 |
| 1007 | Ga0495687_013484 | 3300047443 | Bacteria | 4261 |
| 1008 | Ga0495675_0000010 | 3300047444 | Bacteria | 153375 |
| 1009 | Ga0495675_0000740 | 3300047444 | Bacteria | 20363 |
| 1010 | Ga0495675_0003665 | 3300047444 | Bacteria | 9285 |
| 1011 | Ga0495675_0003968 | 3300047444 | Bacteria | 8969 |
| 1012 | Ga0495675_0020780 | 3300047444 | Bacteria | 4178 |
| 1013 | Ga0495684_0000028 | 3300047471 | Bacteria | 123549 |
| 1014 | Ga0495684_0000133 | 3300047471 | Bacteria | 54433 |
| 1015 | Ga0495684_0007961 | 3300047471 | Bacteria | 8191 |
| 1016 | Ga0495684_0025738 | 3300047471 | Bacteria | 4521 |
| 1017 | Ga0495684_0036720 | 3300047471 | Bacteria | 3756 |
| 1018 | Ga0495686_0011217 | 3300047472 | Bacteria | 6319 |
| 1019 | Ga0495686_0017623 | 3300047472 | Bacteria | 4805 |
| 1020 | Ga0495593_0000108 | 3300047673 | Bacteria | 38360 |
| 1021 | Ga0495593_0006553 | 3300047673 | Bacteria | 6815 |
| 1022 | Ga0495593_0006602 | 3300047673 | Bacteria | 6788 |
| 1023 | Ga0495602_0000054 | 3300048088 | Bacteria | 111411 |
| 1024 | Ga0495602_0002218 | 3300048088 | Bacteria | 19614 |
| 1025 | Ga0495602_0013696 | 3300048088 | Bacteria | 8272 |
| 1026 | Ga0495602_0032943 | 3300048088 | Bacteria | 4871 |
| 1027 | Ga0495602_0033274 | 3300048088 | Bacteria | 4838 |
| 1028 | Ga0495602_0039514 | 3300048088 | Bacteria | 4343 |
| 1029 | Ga0495602_0072271 | 3300048088 | Bacteria | 2942 |
| 1030 | Ga0495626_0006198 | 3300048091 | Bacteria | 6835 |
| 1031 | Ga0496100_0000447 | 3300048903 | Bacteria | 19924 |
| 1032 | Ga0496100_0006283 | 3300048903 | Bacteria | 6470 |
| 1033 | Ga0496100_0024645 | 3300048903 | Bacteria | 3671 |
| 1034 | Ga0496101_0001349 | 3300048904 | Bacteria | 14712 |
| 1035 | Ga0496102_0002354 | 3300048905 | Bacteria | 16125 |
| 1036 | Ga0496102_0006835 | 3300048905 | Bacteria | 9737 |
| 1037 | Ga0496102_0014185 | 3300048905 | Bacteria | 6923 |
| 1038 | Ga0496102_0030385 | 3300048905 | Bacteria | 4836 |
| 1039 | Ga0496102_0104318 | 3300048905 | Bacteria | 2637 |
| 1040 | Ga0496103_0001066 | 3300048906 | Bacteria | 19147 |
| 1041 | Ga0496103_0005364 | 3300048906 | Bacteria | 7679 |
| 1042 | Ga0496103_0008597 | 3300048906 | Bacteria | 6063 |
| 1043 | Ga0496104_0000126 | 3300048907 | Bacteria | 70488 |
| 1044 | Ga0496104_0000752 | 3300048907 | Bacteria | 27722 |
| 1045 | Ga0496104_0007793 | 3300048907 | Bacteria | 9490 |
| 1046 | Ga0496104_0010461 | 3300048907 | Bacteria | 8286 |
| 1047 | Ga0496104_0015234 | 3300048907 | Bacteria | 6960 |
| 1048 | Ga0496104_0024677 | 3300048907 | Bacteria | 5533 |
| 1049 | Ga0496104_0131979 | 3300048907 | Bacteria | 2399 |
| 1050 | Ga0496105_0000117 | 3300048908 | Bacteria | 54274 |
| 1051 | Ga0496105_0002078 | 3300048908 | Bacteria | 14498 |
| 1052 | Ga0496105_0002637 | 3300048908 | Bacteria | 13054 |
| 1053 | Ga0496105_0010940 | 3300048908 | Bacteria | 7148 |
| 1054 | Ga0496105_0031489 | 3300048908 | Bacteria | 4348 |
| 1055 | Ga0496106_0001027 | 3300048909 | Bacteria | 20532 |
| 1056 | Ga0496106_0008822 | 3300048909 | Bacteria | 7451 |
| 1057 | Ga0496106_0024431 | 3300048909 | Bacteria | 4493 |
| 1058 | Ga0496106_0037327 | 3300048909 | Bacteria | 3634 |
| 1059 | Ga0496106_0081209 | 3300048909 | Bacteria | 2491 |
| 1060 | Ga0496107_0001211 | 3300048910 | Bacteria | 15713 |
| 1061 | Ga0496107_0002063 | 3300048910 | Bacteria | 12844 |
| 1062 | Ga0496107_0002318 | 3300048910 | Bacteria | 12290 |
| 1063 | Ga0496107_0009385 | 3300048910 | Bacteria | 6784 |
| 1064 | Ga0496107_0040449 | 3300048910 | Bacteria | 3346 |
| 1065 | Ga0496107_0045302 | 3300048910 | Bacteria | 3164 |
| 1066 | Ga0496107_0068845 | 3300048910 | Bacteria | 2568 |
| 1067 | Ga0496108_0000649 | 3300048911 | Bacteria | 27099 |
| 1068 | Ga0496108_0000847 | 3300048911 | Bacteria | 23809 |
| 1069 | Ga0496108_0006065 | 3300048911 | Bacteria | 9774 |
| 1070 | Ga0496108_0010226 | 3300048911 | Bacteria | 7619 |
| 1071 | Ga0496108_0019934 | 3300048911 | Bacteria | 5508 |
| 1072 | Ga0496108_0027547 | 3300048911 | Bacteria | 4694 |
| 1073 | Ga0496108_0122908 | 3300048911 | Bacteria | 2227 |
| 1074 | Ga0496108_0131082 | 3300048911 | Bacteria | 2155 |
| 1075 | Ga0496109_0000188 | 3300048912 | Bacteria | 61633 |
| 1076 | Ga0496109_0000739 | 3300048912 | Bacteria | 27160 |
| 1077 | Ga0496109_0004864 | 3300048912 | Bacteria | 11211 |
| 1078 | Ga0496109_0010096 | 3300048912 | Bacteria | 8055 |
| 1079 | Ga0496109_0017086 | 3300048912 | Bacteria | 6349 |
| 1080 | Ga0496109_0078092 | 3300048912 | Bacteria | 3047 |
| 1081 | Ga0496109_0117865 | 3300048912 | Bacteria | 2472 |
| 1082 | Ga0496110_0002115 | 3300048913 | Bacteria | 14831 |
| 1083 | Ga0496110_0005853 | 3300048913 | Bacteria | 9666 |
| 1084 | Ga0496110_0006025 | 3300048913 | Bacteria | 9550 |
| 1085 | Ga0496110_0006959 | 3300048913 | Bacteria | 8998 |
| 1086 | Ga0496110_0060429 | 3300048913 | Bacteria | 3342 |
| 1087 | Ga0496110_0104112 | 3300048913 | Bacteria | 2546 |
| 1088 | Ga0496111_0000976 | 3300048914 | Bacteria | 15643 |
| 1089 | Ga0496111_0011620 | 3300048914 | Bacteria | 5939 |
| 1090 | Ga0496111_0015450 | 3300048914 | Bacteria | 5241 |
| 1091 | Ga0496111_0016474 | 3300048914 | Bacteria | 5092 |
| 1092 | Ga0496111_0090151 | 3300048914 | Bacteria | 2246 |
| 1093 | Ga0496112_0000051 | 3300048915 | Bacteria | 82351 |
| 1094 | Ga0496112_0001001 | 3300048915 | Bacteria | 20717 |
| 1095 | Ga0496112_0001693 | 3300048915 | Bacteria | 17188 |
| 1096 | Ga0496112_0004717 | 3300048915 | Bacteria | 11615 |
| 1097 | Ga0496112_0008518 | 3300048915 | Bacteria | 9187 |
| 1098 | Ga0496112_0021534 | 3300048915 | Bacteria | 6132 |
| 1099 | Ga0496112_0197265 | 3300048915 | Bacteria | 1973 |
| 1100 | Ga0496113_0000309 | 3300048916 | Bacteria | 23203 |
| 1101 | Ga0496113_0004222 | 3300048916 | Bacteria | 8788 |
| 1102 | Ga0496113_0019954 | 3300048916 | Bacteria | 4701 |
| 1103 | Ga0496113_0020929 | 3300048916 | Bacteria | 4608 |
| 1104 | Ga0496113_0065648 | 3300048916 | Bacteria | 2747 |
| 1105 | Ga0496113_0087786 | 3300048916 | Bacteria | 2392 |
| 1106 | Ga0496113_0101638 | 3300048916 | Bacteria | 2229 |
| 1107 | Ga0496113_0120937 | 3300048916 | Bacteria | 2047 |
| 1108 | Ga0496114_0001734 | 3300048917 | Bacteria | 16551 |
| 1109 | Ga0496115_0000592 | 3300048918 | Bacteria | 27769 |
| 1110 | Ga0496115_0013668 | 3300048918 | Bacteria | 6145 |
| 1111 | Ga0496115_0029324 | 3300048918 | Bacteria | 4321 |
| 1112 | Ga0496115_0048466 | 3300048918 | Bacteria | 3398 |
| 1113 | Ga0496115_0049277 | 3300048918 | Bacteria | 3371 |
| 1114 | Ga0496116_0053797 | 3300048919 | Bacteria | 2656 |
| 1115 | Ga0496119_0002392 | 3300048922 | Bacteria | 20610 |
| 1116 | Ga0496119_0015482 | 3300048922 | Bacteria | 5867 |
| 1117 | Ga0496121_0000144 | 3300048924 | Bacteria | 156856 |
| 1118 | Ga0496121_0000596 | 3300048924 | Bacteria | 67893 |
| 1119 | Ga0496121_0004310 | 3300048924 | Bacteria | 19264 |
| 1120 | Ga0496121_0004660 | 3300048924 | Bacteria | 18214 |
| 1121 | Ga0496121_0017154 | 3300048924 | Bacteria | 7416 |
| 1122 | Ga0496121_0032832 | 3300048924 | Bacteria | 4709 |
| 1123 | Ga0496121_0039271 | 3300048924 | Bacteria | 4174 |
| 1124 | Ga0496122_0001783 | 3300048925 | Bacteria | 33000 |
| 1125 | Ga0496123_0008945 | 3300048926 | Bacteria | 9107 |
| 1126 | Ga0496124_0002408 | 3300048927 | Bacteria | 24540 |
| 1127 | Ga0496125_0000595 | 3300048928 | Bacteria | 61641 |
| 1128 | Ga0496125_0003506 | 3300048928 | Bacteria | 18947 |
| 1129 | Ga0496125_0005815 | 3300048928 | Bacteria | 13547 |
| 1130 | Ga0496125_0028181 | 3300048928 | Bacteria | 5078 |
| 1131 | Ga0496125_0046373 | 3300048928 | Bacteria | 3646 |
| 1132 | Ga0496125_0077724 | 3300048928 | Bacteria | 2556 |
| 1133 | Ga0496125_0081619 | 3300048928 | Bacteria | 2469 |
| 1134 | Ga0496126_0003899 | 3300048929 | Bacteria | 18338 |
| 1135 | Ga0496126_0007999 | 3300048929 | Bacteria | 11480 |
| 1136 | Ga0496126_0012837 | 3300048929 | Bacteria | 8561 |
| 1137 | Ga0496126_0021036 | 3300048929 | Bacteria | 6384 |
| 1138 | Ga0496126_0030316 | 3300048929 | Bacteria | 5125 |
| 1139 | Ga0496126_0052472 | 3300048929 | Bacteria | 3705 |
| 1140 | Ga0496126_0063799 | 3300048929 | Bacteria | 3301 |
| 1141 | Ga0501031_0000377 | 3300049568 | Bacteria | 26157 |
| 1142 | Ga0501031_0012135 | 3300049568 | Bacteria | 5617 |
| 1143 | Ga0501032_0000040 | 3300049569 | Bacteria | 115662 |
| 1144 | Ga0501032_0002502 | 3300049569 | Bacteria | 14350 |
| 1145 | Ga0501032_0003836 | 3300049569 | Bacteria | 11418 |
| 1146 | Ga0501032_0013306 | 3300049569 | Bacteria | 5857 |
| 1147 | Ga0501032_0078260 | 3300049569 | Bacteria | 2201 |
| 1148 | Ga0501033_0000128 | 3300049570 | Bacteria | 73419 |
| 1149 | Ga0501033_0001178 | 3300049570 | Bacteria | 23600 |
| 1150 | Ga0501033_0011352 | 3300049570 | Bacteria | 6816 |
| 1151 | Ga0501033_0021458 | 3300049570 | Bacteria | 4872 |
| 1152 | Ga0501033_0023415 | 3300049570 | Bacteria | 4657 |
| 1153 | Ga0501033_0024205 | 3300049570 | Bacteria | 4581 |
| 1154 | Ga0501033_0080366 | 3300049570 | Bacteria | 2392 |
| 1155 | Ga0501033_0095098 | 3300049570 | Bacteria | 2177 |
| 1156 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 1157 | Ga0501034_0000139 | 3300049571 | Bacteria | 135587 |
| 1158 | Ga0501034_0000734 | 3300049571 | Bacteria | 49577 |
| 1159 | Ga0501034_0008567 | 3300049571 | Bacteria | 10794 |
| 1160 | Ga0501034_0027285 | 3300049571 | Bacteria | 5809 |
| 1161 | Ga0501034_0040597 | 3300049571 | Bacteria | 4710 |
| 1162 | Ga0501034_0050837 | 3300049571 | Bacteria | 4179 |
| 1163 | Ga0501034_0091177 | 3300049571 | Bacteria | 3045 |
| 1164 | Ga0501034_0099947 | 3300049571 | Bacteria | 2895 |
| 1165 | Ga0501034_0172222 | 3300049571 | Bacteria | 2131 |
| 1166 | Ga0501036_0000281 | 3300049572 | Bacteria | 35045 |
| 1167 | Ga0501036_0001021 | 3300049572 | Bacteria | 21132 |
| 1168 | Ga0501036_0006538 | 3300049572 | Bacteria | 9470 |
| 1169 | Ga0501036_0013510 | 3300049572 | Bacteria | 6787 |
| 1170 | Ga0501036_0037511 | 3300049572 | Bacteria | 4099 |
| 1171 | Ga0501036_0085478 | 3300049572 | Bacteria | 2666 |
| 1172 | Ga0501036_0101222 | 3300049572 | Bacteria | 2437 |
| 1173 | Ga0501037_0000041 | 3300049573 | Bacteria | 118457 |
| 1174 | Ga0501037_0007235 | 3300049573 | Bacteria | 8109 |
| 1175 | Ga0501037_0010813 | 3300049573 | Bacteria | 6705 |
| 1176 | Ga0501037_0016247 | 3300049573 | Bacteria | 5477 |
| 1177 | Ga0501037_0029550 | 3300049573 | Bacteria | 4049 |
| 1178 | Ga0501037_0035491 | 3300049573 | Bacteria | 3677 |
| 1179 | Ga0501038_0000057 | 3300049574 | Bacteria | 92766 |
| 1180 | Ga0501038_0005284 | 3300049574 | Bacteria | 12008 |
| 1181 | Ga0501038_0011176 | 3300049574 | Bacteria | 8198 |
| 1182 | Ga0501038_0011832 | 3300049574 | Bacteria | 7964 |
| 1183 | Ga0501038_0035298 | 3300049574 | Bacteria | 4390 |
| 1184 | Ga0501038_0039580 | 3300049574 | Bacteria | 4123 |
| 1185 | Ga0501038_0040069 | 3300049574 | Bacteria | 4094 |
| 1186 | Ga0501038_0047168 | 3300049574 | Bacteria | 3732 |
| 1187 | Ga0501038_0084076 | 3300049574 | Bacteria | 2678 |
| 1188 | Ga0501039_0003963 | 3300049575 | Bacteria | 11120 |
| 1189 | Ga0501039_0009975 | 3300049575 | Bacteria | 7240 |
| 1190 | Ga0501039_0040950 | 3300049575 | Bacteria | 3576 |
| 1191 | Ga0501039_0072066 | 3300049575 | Bacteria | 2685 |
| 1192 | Ga0501040_0007238 | 3300049576 | Bacteria | 7189 |
| 1193 | Ga0501042_0011820 | 3300049578 | Bacteria | 5898 |
| 1194 | Ga0501043_0005571 | 3300049579 | Bacteria | 10146 |
| 1195 | Ga0501043_0006408 | 3300049579 | Bacteria | 9455 |
| 1196 | Ga0501043_0013603 | 3300049579 | Bacteria | 6366 |
| 1197 | Ga0501043_0045583 | 3300049579 | Bacteria | 3448 |
| 1198 | Ga0501043_0049660 | 3300049579 | Bacteria | 3298 |
| 1199 | Ga0501043_0129558 | 3300049579 | Bacteria | 1977 |
| 1200 | Ga0501046_0004620 | 3300049580 | Bacteria | 12437 |
| 1201 | Ga0501046_0004930 | 3300049580 | Bacteria | 12008 |
| 1202 | Ga0501046_0023744 | 3300049580 | Bacteria | 5039 |
| 1203 | Ga0501046_0030618 | 3300049580 | Bacteria | 4366 |
| 1204 | Ga0501046_0041485 | 3300049580 | Bacteria | 3672 |
| 1205 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 1206 | Ga0501047_0000316 | 3300049581 | Bacteria | 55680 |
| 1207 | Ga0501047_0014278 | 3300049581 | Bacteria | 7552 |
| 1208 | Ga0501047_0014677 | 3300049581 | Bacteria | 7454 |
| 1209 | Ga0501047_0023190 | 3300049581 | Bacteria | 5959 |
| 1210 | Ga0501047_0033027 | 3300049581 | Bacteria | 4996 |
| 1211 | Ga0501047_0034863 | 3300049581 | Bacteria | 4858 |
| 1212 | Ga0501047_0039892 | 3300049581 | Bacteria | 4541 |
| 1213 | Ga0501047_0046028 | 3300049581 | Bacteria | 4217 |
| 1214 | Ga0501047_0062559 | 3300049581 | Bacteria | 3589 |
| 1215 | Ga0501047_0160895 | 3300049581 | Bacteria | 2117 |
| 1216 | Ga0501048_0000117 | 3300049582 | Bacteria | 45344 |
| 1217 | Ga0501048_0000150 | 3300049582 | Bacteria | 42721 |
| 1218 | Ga0501048_0096172 | 3300049582 | Bacteria | 2089 |
| 1219 | Ga0501067_0000938 | 3300049583 | Bacteria | 15626 |
| 1220 | Ga0501067_0013575 | 3300049583 | Bacteria | 4511 |
| 1221 | Ga0501068_0002415 | 3300049584 | Bacteria | 9914 |
| 1222 | Ga0501068_0003582 | 3300049584 | Bacteria | 8389 |
| 1223 | Ga0501068_0003857 | 3300049584 | Bacteria | 8138 |
| 1224 | Ga0501068_0013654 | 3300049584 | Bacteria | 4624 |
| 1225 | Ga0501068_0037876 | 3300049584 | Bacteria | 2887 |
| 1226 | Ga0501069_0003718 | 3300049585 | Bacteria | 7844 |
| 1227 | Ga0501070_0007839 | 3300049586 | Bacteria | 9050 |
| 1228 | Ga0501070_0013553 | 3300049586 | Bacteria | 6872 |
| 1229 | Ga0501070_0020893 | 3300049586 | Bacteria | 5493 |
| 1230 | Ga0501070_0021944 | 3300049586 | Bacteria | 5349 |
| 1231 | Ga0501070_0063600 | 3300049586 | Bacteria | 3056 |
| 1232 | Ga0501071_0012138 | 3300049587 | Bacteria | 5829 |
| 1233 | Ga0501072_0000156 | 3300049588 | Bacteria | 50717 |
| 1234 | Ga0501072_0024705 | 3300049588 | Bacteria | 4677 |
| 1235 | Ga0501072_0030786 | 3300049588 | Bacteria | 4198 |
| 1236 | Ga0501073_0000669 | 3300049589 | Bacteria | 24040 |
| 1237 | Ga0501073_0001123 | 3300049589 | Bacteria | 19412 |
| 1238 | Ga0501073_0012453 | 3300049589 | Bacteria | 6205 |
| 1239 | Ga0501073_0055643 | 3300049589 | Bacteria | 2767 |
| 1240 | Ga0501073_0060632 | 3300049589 | Bacteria | 2640 |
| 1241 | Ga0501073_0076230 | 3300049589 | Bacteria | 2333 |
| 1242 | Ga0501074_0000035 | 3300049590 | Bacteria | 64770 |
| 1243 | Ga0501074_0004481 | 3300049590 | Bacteria | 9996 |
| 1244 | Ga0501074_0042702 | 3300049590 | Bacteria | 3280 |
| 1245 | Ga0501074_0045884 | 3300049590 | Bacteria | 3160 |
| 1246 | Ga0501075_0011391 | 3300049591 | Bacteria | 6294 |
| 1247 | Ga0501076_0033146 | 3300049592 | Bacteria | 4033 |
| 1248 | Ga0501077_0048355 | 3300049593 | Bacteria | 2702 |
| 1249 | Ga0501079_0006733 | 3300049741 | Bacteria | 8645 |
| 1250 | Ga0501079_0012752 | 3300049741 | Bacteria | 6420 |
| 1251 | Ga0501079_0054248 | 3300049741 | Bacteria | 3091 |
| 1252 | Ga0501079_0084001 | 3300049741 | Bacteria | 2463 |
| 1253 | Ga0501080_0001372 | 3300049742 | Bacteria | 20366 |
| 1254 | Ga0501080_0005918 | 3300049742 | Bacteria | 10953 |
| 1255 | Ga0501080_0008844 | 3300049742 | Bacteria | 9155 |
| 1256 | Ga0501080_0012618 | 3300049742 | Bacteria | 7746 |
| 1257 | Ga0501080_0016712 | 3300049742 | Bacteria | 6775 |
| 1258 | Ga0501080_0025835 | 3300049742 | Bacteria | 5455 |
| 1259 | Ga0501080_0047476 | 3300049742 | Bacteria | 3997 |
| 1260 | Ga0501080_0073288 | 3300049742 | Bacteria | 3185 |
| 1261 | Ga0501080_0147701 | 3300049742 | Bacteria | 2173 |
| 1262 | Ga0501080_0227707 | 3300049742 | Bacteria | 1704 |
| 1263 | Ga0501081_0130493 | 3300049743 | Bacteria | 1795 |
| 1264 | Ga0501083_0000641 | 3300049744 | Bacteria | 22636 |
| 1265 | Ga0501083_0002096 | 3300049744 | Bacteria | 13707 |
| 1266 | Ga0501083_0025692 | 3300049744 | Bacteria | 4076 |
| 1267 | Ga0501083_0056150 | 3300049744 | Bacteria | 2639 |
| 1268 | Ga0501035_0000128 | 3300049822 | Bacteria | 92297 |
| 1269 | Ga0501035_0001398 | 3300049822 | Bacteria | 24778 |
| 1270 | Ga0501035_0001896 | 3300049822 | Bacteria | 21033 |
| 1271 | Ga0501035_0003226 | 3300049822 | Bacteria | 15629 |
| 1272 | Ga0501035_0007549 | 3300049822 | Bacteria | 10162 |
| 1273 | Ga0501035_0065467 | 3300049822 | Bacteria | 3227 |
| 1274 | Ga0501035_0120991 | 3300049822 | Bacteria | 2288 |
| 1275 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 1276 | Ga0501044_0000144 | 3300049823 | Bacteria | 87628 |
| 1277 | Ga0501044_0004517 | 3300049823 | Bacteria | 15560 |
| 1278 | Ga0501044_0006423 | 3300049823 | Bacteria | 12992 |
| 1279 | Ga0501044_0006995 | 3300049823 | Bacteria | 12411 |
| 1280 | Ga0501044_0009598 | 3300049823 | Bacteria | 10531 |
| 1281 | Ga0501044_0015426 | 3300049823 | Bacteria | 8229 |
| 1282 | Ga0501044_0016058 | 3300049823 | Bacteria | 8050 |
| 1283 | Ga0501044_0084700 | 3300049823 | Bacteria | 3203 |
| 1284 | Ga0501044_0098447 | 3300049823 | Bacteria | 2944 |
| 1285 | Ga0501044_0122369 | 3300049823 | Bacteria | 2601 |
| 1286 | Ga0501045_0002782 | 3300049824 | Bacteria | 11952 |
| 1287 | nmdc:mga03n38_3068_c1 | 3300050490 | Bacteria | 5296 |
| 1288 | nmdc:mga00v17_34356_c1 | 3300050491 | Bacteria | 3011 |
| 1289 | nmdc:mga00v17_7005_c1 | 3300050491 | Bacteria | 6001 |
| 1290 | nmdc:mga0yw44_394_c1 | 3300050492 | Bacteria | 14330 |
| 1291 | nmdc:mga0yw44_53581_c1 | 3300050492 | Bacteria | 2451 |
| 1292 | nmdc:mga06z11_17712_c1 | 3300050494 | Bacteria | 3240 |
| 1293 | nmdc:mga06z11_2169_c1 | 3300050494 | Bacteria | 7450 |
| 1294 | nmdc:mga06z11_43367_c1 | 3300050494 | Bacteria | 2263 |
| 1295 | nmdc:mga04h51_4218_c1 | 3300050495 | Bacteria | 3556 |
| 1296 | nmdc:mga05p37_1114_c1 | 3300050507 | Bacteria | 30870 |
| 1297 | nmdc:mga05p37_12753_c1 | 3300050507 | Bacteria | 10045 |
| 1298 | nmdc:mga05p37_6040_c1 | 3300050507 | Bacteria | 14258 |
| 1299 | nmdc:mga05p37_6080_c1 | 3300050507 | Bacteria | 14214 |
| 1300 | nmdc:mga09592_1302_c1 | 3300050508 | Bacteria | 20054 |
| 1301 | nmdc:mga09592_2437_c1 | 3300050508 | Bacteria | 15007 |
| 1302 | nmdc:mga0qj67_276_c1 | 3300050509 | Bacteria | 35718 |
| 1303 | nmdc:mga0qj67_3495_c1 | 3300050509 | Bacteria | 11327 |
| 1304 | nmdc:mga0qj67_55_c1 | 3300050509 | Bacteria | 83015 |
| 1305 | nmdc:mga06r32_158737_c1 | 3300050510 | Bacteria | 2243 |
| 1306 | nmdc:mga06r32_3415_c1 | 3300050510 | Bacteria | 14208 |
| 1307 | nmdc:mga06r32_3728_c1 | 3300050510 | Bacteria | 13639 |
| 1308 | nmdc:mga06r32_51211_c1 | 3300050510 | Bacteria | 3951 |
| 1309 | nmdc:mga08y16_13103_c1 | 3300050511 | Bacteria | 8722 |
| 1310 | nmdc:mga08y16_189609_c1 | 3300050511 | Bacteria | 2133 |
| 1311 | nmdc:mga08y16_25960_c1 | 3300050511 | Bacteria | 6180 |
| 1312 | nmdc:mga08y16_3668_c1 | 3300050511 | Bacteria | 15982 |
| 1313 | nmdc:mga08y16_3857_c1 | 3300050511 | Bacteria | 15589 |
| 1314 | nmdc:mga08y16_3921_c1 | 3300050511 | Bacteria | 15490 |
| 1315 | nmdc:mga0n895_17357_c1 | 3300050512 | Bacteria | 6632 |
| 1316 | nmdc:mga0n895_3698_c1 | 3300050512 | Bacteria | 12366 |
| 1317 | nmdc:mga0n895_6170_c1 | 3300050512 | Bacteria | 10131 |
| 1318 | nmdc:mga0n895_651_c1 | 3300050512 | Bacteria | 24245 |
| 1319 | nmdc:mga0n895_682_c1 | 3300050512 | Bacteria | 23848 |
| 1320 | nmdc:mga0rr50_2190_c1 | 3300050513 | Bacteria | 10950 |
| 1321 | nmdc:mga0rr50_23079_c1 | 3300050513 | Bacteria | 4283 |
| 1322 | nmdc:mga0rr50_919_c1 | 3300050513 | Bacteria | 15930 |
| 1323 | nmdc:mga0a205_1012_c1 | 3300050515 | Bacteria | 23345 |
| 1324 | nmdc:mga0a205_1633_c1 | 3300050515 | Bacteria | 19288 |
| 1325 | nmdc:mga0a205_89051_c1 | 3300050515 | Bacteria | 2983 |
| 1326 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 1327 | Ga0495601_0000128 | 3300053077 | Bacteria | 42850 |
| 1328 | Ga0495601_0001082 | 3300053077 | Bacteria | 14935 |
| 1329 | Ga0495601_0003910 | 3300053077 | Bacteria | 8565 |
| 1330 | Ga0495601_0004226 | 3300053077 | Bacteria | 8290 |
| 1331 | Ga0495601_0005377 | 3300053077 | Bacteria | 7459 |
| 1332 | Ga0495601_0006799 | 3300053077 | Bacteria | 6697 |
| 1333 | Ga0495601_0021111 | 3300053077 | Bacteria | 3985 |
| 1334 | Ga0495601_0022129 | 3300053077 | Bacteria | 3901 |
| 1335 | Ga0495601_0030518 | 3300053077 | Bacteria | 3347 |
| 1336 | Ga0495601_0053187 | 3300053077 | Bacteria | 2559 |
| 1337 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 1338 | Ga0495612_0002018 | 3300053078 | Bacteria | 8363 |
| 1339 | Ga0495612_0002324 | 3300053078 | Bacteria | 7835 |
| 1340 | Ga0495612_0004821 | 3300053078 | Bacteria | 5585 |
| 1341 | Ga0495612_0028142 | 3300053078 | Bacteria | 2262 |
| 1342 | Ga0495612_0031191 | 3300053078 | Bacteria | 2148 |
| 1343 | Ga0500635_0000853 | 3300053080 | Bacteria | 7488 |
| 1344 | Ga0495655_0001385 | 3300053083 | Bacteria | 3725 |
| 1345 | Ga0495595_0000008 | 3300053084 | Bacteria | 196206 |
| 1346 | Ga0495595_0003217 | 3300053084 | Bacteria | 6484 |
| 1347 | Ga0495595_0004385 | 3300053084 | Bacteria | 5679 |
| 1348 | Ga0495595_0006145 | 3300053084 | Bacteria | 4882 |
| 1349 | Ga0495595_0014384 | 3300053084 | Bacteria | 3356 |
| 1350 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1351 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1352 | Ga0495619_0000231 | 3300053085 | Bacteria | 40742 |
| 1353 | Ga0495619_0000252 | 3300053085 | Bacteria | 38976 |
| 1354 | Ga0495619_0000406 | 3300053085 | Bacteria | 29319 |
| 1355 | Ga0495619_0000974 | 3300053085 | Bacteria | 18750 |
| 1356 | Ga0495619_0002852 | 3300053085 | Bacteria | 11264 |
| 1357 | Ga0495619_0010526 | 3300053085 | Bacteria | 5819 |
| 1358 | Ga0495619_0014426 | 3300053085 | Bacteria | 4991 |
| 1359 | Ga0495619_0031485 | 3300053085 | Bacteria | 3437 |
| 1360 | Ga0500643_000079 | 3300053087 | Bacteria | 104107 |
| 1361 | Ga0500643_003892 | 3300053087 | Bacteria | 6935 |
| 1362 | Ga0500644_0002084 | 3300053088 | Bacteria | 5078 |
| 1363 | Ga0500651_0010373 | 3300053093 | Bacteria | 5582 |
| 1364 | Ga0500566_0002184 | 3300053094 | Bacteria | 11532 |
| 1365 | Ga0500566_0002304 | 3300053094 | Bacteria | 11295 |
| 1366 | Ga0500641_0011471 | 3300053096 | Bacteria | 3217 |
| 1367 | Ga0500650_0026000 | 3300053098 | Bacteria | 2622 |
| 1368 | Ga0500555_014708 | 3300053103 | Bacteria | 2256 |
| 1369 | Ga0500555_016186 | 3300053103 | Bacteria | 2149 |
| 1370 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 1371 | Ga0500556_0000250 | 3300053104 | Bacteria | 43584 |
| 1372 | Ga0500556_0008341 | 3300053104 | Bacteria | 2986 |
| 1373 | Ga0500557_000100 | 3300053105 | Bacteria | 26874 |
| 1374 | Ga0500562_000167 | 3300053108 | Bacteria | 18265 |
| 1375 | Ga0500562_014811 | 3300053108 | Bacteria | 1998 |
| 1376 | Ga0500572_001778 | 3300053111 | Bacteria | 5539 |
| 1377 | Ga0500592_000696 | 3300053116 | Bacteria | 5534 |
| 1378 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1379 | Ga0500595_003306 | 3300053119 | Bacteria | 7587 |
| 1380 | Ga0500595_003815 | 3300053119 | Bacteria | 6930 |
| 1381 | Ga0500595_004235 | 3300053119 | Bacteria | 6481 |
| 1382 | Ga0500595_006137 | 3300053119 | Bacteria | 5144 |
| 1383 | Ga0500595_022046 | 3300053119 | Bacteria | 2263 |
| 1384 | Ga0500608_000199 | 3300053122 | Bacteria | 23889 |
| 1385 | Ga0500608_000330 | 3300053122 | Bacteria | 18247 |
| 1386 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 1387 | Ga0500642_0000562 | 3300053130 | Bacteria | 11248 |
| 1388 | Ga0500642_0039030 | 3300053130 | Bacteria | 2039 |
| 1389 | Ga0500559_0000696 | 3300053136 | Bacteria | 22137 |
| 1390 | Ga0500559_0001190 | 3300053136 | Bacteria | 15467 |
| 1391 | Ga0500573_0013027 | 3300053140 | Bacteria | 4678 |
| 1392 | Ga0500586_000887 | 3300053145 | Bacteria | 6169 |
| 1393 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1394 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 1395 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1396 | Ga0500616_0024308 | 3300053153 | Bacteria | 3369 |
| 1397 | Ga0500620_001131 | 3300053155 | Bacteria | 4734 |
| 1398 | Ga0500622_0003335 | 3300053156 | Bacteria | 10828 |
| 1399 | Ga0500638_001356 | 3300053162 | Bacteria | 7566 |
| 1400 | Ga0500639_029084 | 3300053163 | Bacteria | 2919 |
| 1401 | Ga0500636_0000407 | 3300053177 | Bacteria | 23672 |
| 1402 | Ga0500636_0004693 | 3300053177 | Bacteria | 7757 |
| 1403 | Ga0500637_0000366 | 3300053178 | Bacteria | 17135 |
| 1404 | Ga0500576_024767 | 3300053725 | Bacteria | 2736 |
| 1405 | Ga0500645_002629 | 3300053730 | Bacteria | 7863 |
| 1406 | Ga0500599_002488 | 3300053736 | Bacteria | 2211 |
| 1407 | Ga0501084_0002007 | 3300054114 | Bacteria | 16265 |
| 1408 | Ga0501084_0011232 | 3300054114 | Bacteria | 7414 |
| 1409 | Ga0500661_004901 | 3300055283 | Bacteria | 2504 |
| 1410 | Ga0501082_0000002 | 3300060353 | Bacteria | 186546 |
| 1411 | Ga0501082_0002249 | 3300060353 | Bacteria | 16902 |
| 1412 | Ga0501082_0014678 | 3300060353 | Bacteria | 6750 |
| 1413 | Ga0501082_0050425 | 3300060353 | Bacteria | 3589 |
| 1414 | Ga0501082_0058902 | 3300060353 | Bacteria | 3309 |
| 1415 | Ga0501082_0062334 | 3300060353 | Bacteria | 3210 |
| 1416 | Ga0501082_0120978 | 3300060353 | Bacteria | 2269 |
| 1417 | Ga0466962_0031646 | 3300061719 | Bacteria | 2533 |
| 1418 | 2507504659 | 2507262055 | Bacteria | 8048963 |
| 1419 | 2508539620 | 2508501009 | Bacteria | 7784016 |
| 1420 | 2508694936 | 2508501042 | Bacteria | 8719808 |
| 1421 | 2508727710 | 2508501050 | Bacteria | 9633614 |
| 1422 | 2509077605 | 2508501114 | Bacteria | 7082538 |
| 1423 | 2509149897 | 2508501128 | Bacteria | 8613869 |
| 1424 | 2513590572 | 2513237087 | Bacteria | 5817514 |
| 1425 | 2513627007 | 2513237092 | Bacteria | 8341956 |
| 1426 | 2513638542 | 2513237094 | Bacteria | 8789602 |
| 1427 | 2513653109 | 2513237095 | Bacteria | 8976980 |
| 1428 | 2513658971 | 2513237096 | Bacteria | 8722461 |
| 1429 | 2513698962 | 2513237101 | Bacteria | 7952346 |
| 1430 | 2513699150 | 2513237102 | Bacteria | 7703324 |
| 1431 | 2513714858 | 2513237104 | Bacteria | 10034502 |
| 1432 | 2513863890 | 2513237137 | Bacteria | 9558895 |
| 1433 | 2513875656 | 2513237139 | Bacteria | 8737671 |
| 1434 | 2513889635 | 2513237141 | Bacteria | 8496279 |
| 1435 | 2513921235 | 2513237145 | Bacteria | 8979722 |
| 1436 | 2514016324 | 2513237161 | Bacteria | 8871253 |
| 1437 | 2515624125 | 2515154112 | Bacteria | 8294334 |
| 1438 | 2517105836 | 2517093001 | Bacteria | 9002274 |
| 1439 | 2517889334 | 2517572143 | Bacteria | 9484767 |
| 1440 | 2524438627 | 2524023205 | Bacteria | 8918781 |
| 1441 | 2524540382 | 2524023228 | Bacteria | 10118060 |
| 1442 | 2528851479 | 2528768022 | Bacteria | 10457665 |
| 1443 | 2603857933 | 2602042107 | Bacteria | 6226103 |
| 1444 | 2617347489 | 2617270735 | Bacteria | 9163226 |
| 1445 | 2617377108 | 2617270741 | Bacteria | 8201522 |
| 1446 | 2643758733 | 2643221547 | Bacteria | 4740017 |
| 1447 | 2644290592 | 2643221651 | Bacteria | 4798932 |
| 1448 | 2671121381 | 2667528175 | Bacteria | 7532676 |
| 1449 | 2715501514 | 2713897090 | Bacteria | 3353799 |
| 1450 | 2723849158 | 2721755755 | Bacteria | 8322773 |
| 1451 | 2728754266 | 2728368998 | Bacteria | 8720350 |
| 1452 | 2739792036 | 2739367756 | Bacteria | 4553612 |
| 1453 | 2745077656 | 2744054633 | Bacteria | 8678936 |
| 1454 | 2774869106 | 2773857925 | Bacteria | 6472445 |
| 1455 | 2776258439 | 2775506901 | Bacteria | 9631051 |
| 1456 | 2793063267 | 2791355196 | Bacteria | 7323613 |
| 1457 | 2793070999 | 2791355197 | Bacteria | 8420563 |
| 1458 | 2793078485 | |||
| 1459 | 2805919332 | 2802429603 | Bacteria | 8777136 |
| 1460 | 2818243395 | 2816332527 | Bacteria | 8933356 |
| 1461 | 2824622538 | 2824617872 | Bacteria | 8814715 |
| 1462 | 2824633899 | 2824626560 | Bacteria | 8813858 |
| 1463 | 2824674711 | 2824671348 | Bacteria | 8369588 |
| 1464 | 2824684144 | 2824679649 | Bacteria | 8248951 |
| 1465 | 2824752539 | 2824746037 | Bacteria | 7911610 |
| 1466 | 2824770620 | 2824763712 | Bacteria | 9792355 |
| 1467 | 2824780169 | 2824773399 | Bacteria | 8360218 |
| 1468 | 2828309284 | 2828305725 | Bacteria | 4916900 |
| 1469 | 2835319702 | 2835312727 | Bacteria | 7413381 |
| 1470 | 2838130268 | 2838122688 | Bacteria | 8803140 |
| 1471 | 2840882151 | 2840878972 | Bacteria | 5483153 |
| 1472 | 2841944289 | 2841941048 | Bacteria | 8688029 |
| 1473 | 2841954534 | 2841949485 | Bacteria | 8680857 |
| 1474 | 2841963417 | 2841957949 | Bacteria | 8652217 |
| 1475 | 2841969066 | 2841966195 | Bacteria | 8673214 |
| 1476 | 2841979840 | 2841974524 | Bacteria | 8931498 |
| 1477 | 2841989562 | 2841983080 | Bacteria | 8395090 |
| 1478 | 2842044067 | 2842038055 | Bacteria | 8002051 |
| 1479 | 2842051944 | 2842045827 | Bacteria | 8006841 |
| 1480 | 2844316036 | 2844315083 | Bacteria | 8138177 |
| 1481 | 2847931523 | 2847930680 | Bacteria | 9342022 |
| 1482 | 2847941583 | 2847939898 | Bacteria | 8606328 |
| 1483 | 2849082506 | 2849076700 | Bacteria | 7039503 |
| 1484 | 2854682524 | 2854681122 | Bacteria | 4548679 |
| 1485 | 2857515803 | 2857509624 | Bacteria | 7472071 |
| 1486 | 2857527308 | 2857524615 | Bacteria | 6615449 |
| 1487 | 2874593152 | 2874590934 | Bacteria | 8299676 |
| 1488 | 2874606904 | 2874604998 | Bacteria | 7834745 |
| 1489 | 2874620262 | 2874612657 | Bacteria | 8252029 |
| 1490 | 2874634319 | 2874628541 | Bacteria | 8630250 |
| 1491 | 2874645726 | 2874645413 | Bacteria | 8214782 |
| 1492 | 2876763384 | 2876761206 | Bacteria | 10111113 |
| 1493 | 2876773192 | 2876771140 | Bacteria | 8287509 |
| 1494 | 2876810693 | 2876808645 | Bacteria | 8824342 |
| 1495 | 2876820499 | 2876818435 | Bacteria | 8274608 |
| 1496 | 2879076862 | 2879074833 | Bacteria | 8279565 |
| 1497 | 2879091353 | 2879083081 | Bacteria | 8587928 |
| 1498 | 2879100198 | 2879099564 | Bacteria | 10442239 |
| 1499 | 2879112586 | 2879110137 | Bacteria | 8907982 |
| 1500 | 2879131049 | 2879127579 | Bacteria | 8294491 |
| 1501 | 2879150256 | 2879142872 | Bacteria | 8267021 |
| 1502 | 2881364926 | 2881364244 | Bacteria | 7710352 |
| 1503 | 2881673181 | 2881665667 | Bacteria | 8175609 |
| 1504 | 2882461321 | 2882456835 | Bacteria | 6863978 |
| 1505 | 2883579066 | 2883577096 | Bacteria | 4709178 |
| 1506 | 2884301165 | 2884298095 | Bacteria | 3823049 |
| 1507 | 2885368169 | 2885366525 | Bacteria | 8326213 |
| 1508 | 2885377768 | 2885374607 | Bacteria | 8927485 |
| 1509 | 2885413754 | 2885409591 | Bacteria | 9235467 |
| 1510 | 2888378828 | 2888378607 | Bacteria | 9652610 |
| 1511 | 2888391194 | 2888388044 | Bacteria | 7304136 |
| 1512 | 2888427253 | 2888419890 | Bacteria | 7857137 |
| 1513 | 2889036148 | 2889033259 | Bacteria | 9099371 |
| 1514 | 2893071848 | 2893066018 | Bacteria | 6158120 |
| 1515 | 2894242173 | 2894232714 | Bacteria | 8834183 |
| 1516 | 2898796745 | 2898795034 | Bacteria | 4294459 |
| 1517 | 2899261333 | 2899259804 | Bacteria | 3320927 |
| 1518 | 2903729568 | 2903727486 | Bacteria | 8281579 |
| 1519 | 2903752982 | 2903748898 | Bacteria | 9972761 |
| 1520 | 2904692460 | 2904690495 | Bacteria | 9412302 |
| 1521 | 2904709209 | |||
| 1522 | 2904719866 | 2904711408 | Bacteria | 9771557 |
| 1523 | 2906606073 | 2906602504 | Bacteria | 8295279 |
| 1524 | 2906613186 | |||
| 1525 | 2906635069 | 2906626472 | Bacteria | 8826946 |
| 1526 | 2906645643 | 2906643746 | Bacteria | 8722424 |
| 1527 | 2906668658 | 2906660503 | Bacteria | 8595048 |
| 1528 | 2908747943 | 2908739725 | Bacteria | 8628932 |
| 1529 | 2908764386 | 2908756301 | Bacteria | 8864324 |
| 1530 | 2908783020 | 2908775508 | Bacteria | 8092255 |
| 1531 | 2919078424 | 2919073203 | Bacteria | 6531949 |
| 1532 | 2919454756 | 2919450847 | Bacteria | 5631160 |
| 1533 | 2919679194 | 2919679072 | Bacteria | 4629602 |
| 1534 | 2922364526 | 2922361189 | Bacteria | 7436256 |
| 1535 | 2922378532 | |||
| 1536 | 2922400950 | 2922393267 | Bacteria | 8285685 |
| 1537 | 2922433685 | |||
| 1538 | 2929623662 | 2929615660 | Bacteria | 9193770 |
| 1539 | 2929632870 | 2929624759 | Bacteria | 9339455 |
| 1540 | 2932786153 | 2932784394 | Bacteria | 9704911 |
| 1541 | 2932799521 | 2932794094 | Bacteria | 7915132 |
| 1542 | 2932805173 | 2932801729 | Bacteria | 7987968 |
| 1543 | 2932816886 | 2932809354 | Bacteria | 9135765 |
| 1544 | 2932826026 | 2932818245 | Bacteria | 9955613 |
| 1545 | 2932829416 | 2932828146 | Bacteria | 9745859 |
| 1546 | 2933585565 | 2933577622 | Bacteria | 9116884 |
| 1547 | 2935615149 | 2935608549 | Bacteria | 8203142 |
| 1548 | 2935617849 | 2935616580 | Bacteria | 9032984 |
| 1549 | 2935634729 | 2935630451 | Bacteria | 8169952 |
| 1550 | 2935647822 | 2935638405 | Bacteria | 10015038 |
| 1551 | 2935651494 | 2935648319 | Bacteria | 8801166 |
| 1552 | 2935659738 | 2935656913 | Bacteria | 8965014 |
| 1553 | 2935674765 | 2935665750 | Bacteria | 9571747 |
| 1554 | 2935678127 | 2935675223 | Bacteria | 9928132 |
| 1555 | 2935692415 | 2935684952 | Bacteria | 9590419 |
| 1556 | 2935699367 | 2935694250 | Bacteria | 9291695 |
| 1557 | 2935707098 | 2935703347 | Bacteria | 10242284 |
| 1558 | 2935721033 | 2935713505 | Bacteria | 9608509 |
| 1559 | 2935722858 | 2935722832 | Bacteria | 9608746 |
| 1560 | 2935739722 | 2935732158 | Bacteria | 9706831 |
| 1561 | 2935748760 | 2935741537 | Bacteria | 9707219 |
| 1562 | 2935758630 | 2935750917 | Bacteria | 9590372 |
| 1563 | 2935764610 | 2935760218 | Bacteria | 9817913 |
| 1564 | 2935775507 | 2935769743 | Bacteria | 7878163 |
| 1565 | 2935790003 | 2935785616 | Bacteria | 7962367 |
| 1566 | 2935798432 | 2935793552 | Bacteria | 8012592 |
| 1567 | 2935806660 | 2935801545 | Bacteria | 9301974 |
| 1568 | 2935819079 | 2935810662 | Bacteria | 9401221 |
| 1569 | 2935825814 | 2935819856 | Bacteria | 8261050 |
| 1570 | 2935837306 | 2935827899 | Bacteria | 10038562 |
| 1571 | 2935842007 | 2935837841 | Bacteria | 9454360 |
| 1572 | 2935851433 | 2935847175 | Bacteria | 8228321 |
| 1573 | 2935856652 | 2935855204 | Bacteria | 9035059 |
| 1574 | 2935872940 | 2935864058 | Bacteria | 9784707 |
| 1575 | 2935874383 | 2935873716 | Bacteria | 9632195 |
| 1576 | 2935887737 | 2935883170 | Bacteria | 7964738 |
| 1577 | 2935910540 | 2935908558 | Bacteria | 8568796 |
| 1578 | 2935918056 | 2935916978 | Bacteria | 9113783 |
| 1579 | 2935927549 | 2935926038 | Bacteria | 8601059 |
| 1580 | 2935936579 | 2935934488 | Bacteria | 8602579 |
| 1581 | 2935943868 | 2935942939 | Bacteria | 8599779 |
| 1582 | 2935952305 | 2935951376 | Bacteria | 8602333 |
| 1583 | 2935967315 | 2935959822 | Bacteria | 7869783 |
| 1584 | 2935969145 | 2935967501 | Bacteria | 8603075 |
| 1585 | 2935982317 | 2935975950 | Bacteria | 8347125 |
| 1586 | 2935984596 | 2935984226 | Bacteria | 8302647 |
| 1587 | 2936001097 | 2935992306 | Bacteria | 9802711 |
| 1588 | 2936010751 | 2936002035 | Bacteria | 9362176 |
| 1589 | 2936014154 | 2936011229 | Bacteria | 8801034 |
| 1590 | 2936022937 | 2936019824 | Bacteria | 8804134 |
| 1591 | 2936031073 | 2936028420 | Bacteria | 8965941 |
| 1592 | 2936045770 | 2936037263 | Bacteria | 9446081 |
| 1593 | 2936049195 | 2936046547 | Bacteria | 8903709 |
| 1594 | 2936055641 | 2936055302 | Bacteria | 8785755 |
| 1595 | 2940564780 | 2940556831 | Bacteria | 9590747 |
| 1596 | 2941511941 | 2941507105 | Bacteria | 8166816 |
| 1597 | 2941519643 | 2941515067 | Bacteria | 8166720 |
| 1598 | 2941527665 | 2941523033 | Bacteria | 8169134 |
| 1599 | 2941535897 | 2941531003 | Bacteria | 7653939 |
| 1600 | 2941547058 | 2941538514 | Bacteria | 9402094 |
| 1601 | 3000019575 | 3000017691 | Bacteria | 3772574 |
| 1602 | 3000405688 | 3000405567 | Bacteria | 3779330 |
| 1603 | 3005483340 | 3005474847 | Bacteria | 9259049 |
| 1604 | 3005490497 | 3005483717 | Bacteria | 7877331 |
| 1605 | 3005509709 | 3005506211 | Bacteria | 6943378 |
| 1606 | 3005591200 | 3005587118 | Bacteria | 7794411 |
| 1607 | 3005595628 | 3005594810 | Bacteria | 8716512 |
| 1608 | 3005711619 | 3005710791 | Bacteria | 7622528 |
| 1609 | 3005718869 | 3005718088 | Bacteria | 8283608 |
| 1610 | 8001850365 | 8001845381 | Bacteria | 5804942 |
| 1611 | 8006930317 | 8006926726 | Bacteria | 6749210 |
| 1612 | 8006935716 | 8006933436 | Bacteria | 10410654 |
| 1613 | 8006967698 | 8006964411 | Bacteria | 8966052 |
| 1614 | 8006975637 | 8006973647 | Bacteria | 10679141 |
| 1615 | 8006992647 | 8006984368 | Bacteria | 9651211 |
| 1616 | 8006998366 | 8006994254 | Bacteria | 8309700 |
| 1617 | 8016518819 | 8016511872 | Bacteria | 9921665 |
| 1618 | 8016525626 | 8016522445 | Bacteria | 8156687 |
| 1619 | 8016539219 | 8016530956 | Bacteria | 8155261 |
| 1620 | 8016549787 | 8016548790 | Bacteria | 8155074 |
| 1621 | 8016558201 | 8016557553 | Bacteria | 8154380 |
| 1622 | 8016568909 | 8016566248 | Bacteria | 8158151 |
| 1623 | 8016581557 | 8016575299 | Bacteria | 8154085 |
| 1624 | 8016587087 | 8016583857 | Bacteria | 10421953 |
| 1625 | 8016596201 | 8016595262 | Bacteria | 8149947 |
| 1626 | 8016607104 | 8016603502 | Bacteria | 8731218 |
| 1627 | 8016619002 | 8016613128 | Bacteria | 8794220 |
| 1628 | 8016630583 | 8016622563 | Bacteria | 7999408 |
| 1629 | 8016636507 | 8016630954 | Bacteria | 9217207 |
| 1630 | 8019549536 | 8019547302 | Bacteria | 7996444 |
| 1631 | 8019563075 | 8019555841 | Bacteria | 9642137 |
| 1632 | 8019573156 | 8019565922 | Bacteria | 9639779 |
| 1633 | 8019577866 | 8019576017 | Bacteria | 10049540 |
| 1634 | 8019595969 | 8019586578 | Bacteria | 10212056 |
| 1635 | 8019605787 | 8019597564 | Bacteria | 10041141 |
| 1636 | 8019623481 | 8019619141 | Bacteria | 9218857 |
| 1637 | 8019638661 | 8019629233 | Bacteria | 8687553 |
| 1638 | 8019641077 | 8019638758 | Bacteria | 9062356 |
| 1639 | 8019653180 | 8019648815 | Bacteria | 10014479 |
| 1640 | 8019666462 | 8019659431 | Bacteria | 8577854 |
| 1641 | 8019679861 | 8019678201 | Bacteria | 8863603 |
| 1642 | 8019696897 | 8019687851 | Bacteria | 8712826 |
| 1643 | 8045866173 | 8045864390 | Bacteria | 5043873 |
| 1644 | 8055750831 | 8055742211 | Bacteria | 9226248 |
| 1645 | 8056678404 | 8056673599 | Bacteria | 7871253 |
| 1646 | 8056694081 | 8056689827 | Bacteria | 6712655 |
| 1647 | 8056970655 | 8056967851 | Bacteria | 9038162 |
| 1648 | 8057136868 | 8057132660 | Bacteria | 4061191 |
| 1649 | Ga0099794_10007030 | |||
| 1650 | 2214544925 | |||
| 1651 | ARSoilYngRDRAFT_c00196 | |||
| 1652 | ARcpr5yngRDRAFT_c000115 | |||
| 1653 | ARSoilOldRDRAFT_c000011 | |||
| 1654 | ARCol0oldRDRAFT_c00183 | |||
| 1655 | ARCol0yngRDRAFT_1000146 | |||
| 1656 | JGI24746J21847_1001493 | |||
| 1657 | JGI24739J22299_10000724 | |||
| 1658 | JGI24737J22298_10017327 | |||
| 1659 | JGI24743J22301_10000145 | |||
| 1660 | JGI24750J21931_1000096 | |||
| 1661 | JGI24750J21931_1000628 | |||
| 1662 | JGI24745J21846_1000468 | |||
| 1663 | JGI24034J26672_10000231 | |||
| 1664 | JGI24742J22300_10000137 | |||
| 1665 | JGI24742J22300_10000225 | |||
| 1666 | JGI24751J29686_10005184 | |||
| 1667 | JGI25406J46586_10002038 | |||
| 1668 | JGI25406J46586_10006723 | |||
| 1669 | JGI25153J46596_10005134 | |||
| 1670 | JGI25153J46596_10008913 | |||
| 1671 | JGI25160J50197_1010421 | |||
| 1672 | Ga0055524_1010431 | |||
| 1673 | Ga0055531_10001561 | |||
| 1674 | Ga0055543_1005034 | |||
| 1675 | Ga0065165_1004017 | |||
| 1676 | Ga0065165_1016982 | |||
| 1677 | Ga0065712_10002828 | |||
| 1678 | Ga0065712_10104129 | |||
| 1679 | Ga0065715_10001079 | |||
| 1680 | Ga0065715_10106350 | |||
| 1681 | Ga0070676_10000506 | |||
| 1682 | Ga0070683_100009453 | |||
| 1683 | Ga0070683_100029992 | |||
| 1684 | Ga0070683_100098852 | |||
| 1685 | Ga0070690_100002629 | |||
| 1686 | Ga0070690_100006878 | |||
| 1687 | Ga0070690_100061831 | |||
| 1688 | Ga0070690_100066516 | |||
| 1689 | Ga0070670_100023715 | |||
| 1690 | Ga0070677_10000227 | |||
| 1691 | Ga0068869_100001832 | |||
| 1692 | Ga0068869_100062645 | |||
| 1693 | Ga0070666_10005187 | |||
| 1694 | Ga0070680_100003424 | |||
| 1695 | Ga0070680_100039841 | |||
| 1696 | Ga0070680_100048147 | |||
| 1697 | Ga0070680_100067147 | |||
| 1698 | Ga0070680_100123735 | |||
| 1699 | Ga0070680_100124176 | |||
| 1700 | Ga0070682_100001699 | |||
| 1701 | Ga0070682_100012002 | |||
| 1702 | Ga0070682_100066044 | |||
| 1703 | Ga0068868_100003128 | |||
| 1704 | Ga0068868_100007757 | |||
| 1705 | Ga0068868_100089723 | |||
| 1706 | Ga0070660_100044302 | |||
| 1707 | Ga0070660_100078764 | |||
| 1708 | Ga0070689_100000668 | |||
| 1709 | Ga0070689_100001841 | |||
| 1710 | Ga0070689_100002942 | |||
| 1711 | Ga0070689_100015324 | |||
| 1712 | Ga0070689_100065179 | |||
| 1713 | Ga0070691_10020196 | |||
| 1714 | Ga0070691_10050495 | |||
| 1715 | Ga0070687_100000527 | |||
| 1716 | Ga0070661_100003238 | |||
| 1717 | Ga0070692_10010704 | |||
| 1718 | Ga0070692_10055383 | |||
| 1719 | Ga0070668_100003117 | |||
| 1720 | Ga0070669_100001315 | |||
| 1721 | Ga0070669_100072348 | |||
| 1722 | Ga0070669_100114625 | |||
| 1723 | Ga0070675_100002954 | |||
| 1724 | Ga0070675_100037764 | |||
| 1725 | Ga0070675_100040190 | |||
| 1726 | Ga0070675_100142502 | |||
| 1727 | Ga0070671_100005343 | |||
| 1728 | Ga0070671_100006990 | |||
| 1729 | Ga0070671_100012266 | |||
| 1730 | Ga0070671_100024307 | |||
| 1731 | Ga0070671_100032237 | |||
| 1732 | Ga0070671_100033261 | |||
| 1733 | Ga0070674_100002968 | |||
| 1734 | Ga0070674_100025125 | |||
| 1735 | Ga0070673_100010750 | |||
| 1736 | Ga0070673_100015906 | |||
| 1737 | Ga0070673_100034527 | |||
| 1738 | Ga0070688_100001124 | |||
| 1739 | Ga0070688_100001239 | |||
| 1740 | Ga0070688_100034220 | |||
| 1741 | Ga0070688_100050115 | |||
| 1742 | Ga0070659_100002622 | |||
| 1743 | Ga0070659_100015601 | |||
| 1744 | Ga0070659_100019333 | |||
| 1745 | Ga0070667_100005188 | |||
| 1746 | Ga0070703_10016096 | |||
| 1747 | Ga0070709_10002507 | |||
| 1748 | Ga0070709_10009423 | |||
| 1749 | Ga0070709_10012754 | |||
| 1750 | Ga0070709_10026735 | |||
| 1751 | Ga0070709_10054804 | |||
| 1752 | Ga0070714_100009155 | |||
| 1753 | Ga0070714_100028781 | |||
| 1754 | Ga0070714_100051704 | |||
| 1755 | Ga0070714_100073185 | |||
| 1756 | Ga0070714_100082668 | |||
| 1757 | Ga0070710_10000903 | |||
| 1758 | Ga0070710_10004937 | |||
| 1759 | Ga0070710_10020747 | |||
| 1760 | Ga0070710_10036876 | |||
| 1761 | Ga0070701_10007244 | |||
| 1762 | Ga0070701_10053875 | |||
| 1763 | Ga0070711_100012263 | |||
| 1764 | Ga0070711_100017211 | |||
| 1765 | Ga0070711_100025613 | |||
| 1766 | Ga0070711_100035725 | |||
| 1767 | Ga0070711_100045660 | |||
| 1768 | Ga0070705_100001458 | |||
| 1769 | Ga0070700_100001211 | |||
| 1770 | Ga0070700_100010023 | |||
| 1771 | Ga0070700_100017124 | |||
| 1772 | Ga0070694_100001764 | |||
| 1773 | Ga0070663_100000761 | |||
| 1774 | Ga0070663_100009537 | |||
| 1775 | Ga0070663_100018311 | |||
| 1776 | Ga0070663_100024383 | |||
| 1777 | Ga0070678_100000525 | |||
| 1778 | Ga0070678_100029237 | |||
| 1779 | Ga0070678_100075040 | |||
| 1780 | Ga0070662_100002656 | |||
| 1781 | Ga0070662_100070763 | |||
| 1782 | Ga0070662_100071322 | |||
| 1783 | Ga0070662_100077875 | |||
| 1784 | Ga0070681_10004977 | |||
| 1785 | Ga0070681_10037132 | |||
| 1786 | Ga0070681_10120278 | |||
| 1787 | Ga0070681_10124495 | |||
| 1788 | Ga0070681_10145457 | |||
| 1789 | Ga0068867_100002950 | |||
| 1790 | Ga0070685_10004716 | |||
| 1791 | Ga0070685_10011159 | |||
| 1792 | Ga0070699_100057122 | |||
| 1793 | Ga0070679_100007748 | |||
| 1794 | Ga0070679_100010782 | |||
| 1795 | Ga0070679_100022232 | |||
| 1796 | Ga0070679_100058286 | |||
| 1797 | Ga0070679_100065645 | |||
| 1798 | Ga0070679_100148160 | |||
| 1799 | Ga0070684_100005941 | |||
| 1800 | Ga0070684_100056781 | |||
| 1801 | Ga0070684_100086347 | |||
| 1802 | Ga0070684_100169813 | |||
| 1803 | Ga0070697_100034721 | |||
| 1804 | Ga0068853_100003070 | |||
| 1805 | Ga0068853_100049207 | |||
| 1806 | Ga0068853_100056561 | |||
| 1807 | Ga0068853_100059817 | |||
| 1808 | Ga0068853_100069156 | |||
| 1809 | Ga0068853_100165439 | |||
| 1810 | Ga0070672_100002960 | |||
| 1811 | Ga0070672_100062100 | |||
| 1812 | Ga0070672_100103387 | |||
| 1813 | Ga0070686_100001573 | |||
| 1814 | Ga0070686_100008515 | |||
| 1815 | Ga0070695_100002369 | |||
| 1816 | Ga0070696_100031689 | |||
| 1817 | Ga0070693_100000880 | |||
| 1818 | Ga0070693_100037923 | |||
| 1819 | Ga0070693_100055925 | |||
| 1820 | Ga0070665_100055045 | |||
| 1821 | Ga0070665_100080377 | |||
| 1822 | Ga0070665_100155774 | |||
| 1823 | Ga0070665_100201318 | |||
| 1824 | Ga0070704_100001917 | |||
| 1825 | Ga0068855_100009051 | |||
| 1826 | Ga0068855_100019978 | |||
| 1827 | Ga0068855_100048708 | |||
| 1828 | Ga0068855_100083697 | |||
| 1829 | Ga0070664_100002660 | |||
| 1830 | Ga0070664_100002934 | |||
| 1831 | Ga0070664_100022881 | |||
| 1832 | Ga0068857_100000358 | |||
| 1833 | Ga0068857_100034853 | |||
| 1834 | Ga0068857_100049440 | |||
| 1835 | Ga0068854_100007075 | |||
| 1836 | Ga0068854_100031509 | |||
| 1837 | Ga0068854_100047206 | |||
| 1838 | Ga0068854_100102802 | |||
| 1839 | Ga0068856_100003436 | |||
| 1840 | Ga0068856_100015293 | |||
| 1841 | Ga0068856_100094517 | |||
| 1842 | Ga0070702_100000526 | |||
| 1843 | Ga0070702_100003230 | |||
| 1844 | Ga0070702_100011165 | |||
| 1845 | Ga0068852_100009893 | |||
| 1846 | Ga0068852_100061935 | |||
| 1847 | Ga0068859_100005591 | |||
| 1848 | Ga0068859_100027680 | |||
| 1849 | Ga0068864_100001988 | |||
| 1850 | Ga0068866_10000916 | |||
| 1851 | Ga0068861_100001805 | |||
| 1852 | Ga0068861_100140817 | |||
| 1853 | Ga0068851_10013003 | |||
| 1854 | Ga0068851_10047779 | |||
| 1855 | Ga0068870_10000025 | |||
| 1856 | Ga0068863_100115350 | |||
| 1857 | Ga0068863_100166408 | |||
| 1858 | Ga0068858_100003227 | |||
| 1859 | Ga0068858_100027064 | |||
| 1860 | Ga0068860_100007120 | |||
| 1861 | Ga0068860_100008962 | |||
| 1862 | Ga0068860_100135000 | |||
| 1863 | Ga0068862_100011988 | |||
| 1864 | Ga0068862_100017821 | |||
| 1865 | Ga0068862_100145990 | |||
| 1866 | Ga0068862_100153724 | |||
| 1867 | Ga0081455_10000276 | |||
| 1868 | Ga0081455_10002463 | |||
| 1869 | Ga0081455_10005910 | |||
| 1870 | Ga0081455_10020788 | |||
| 1871 | Ga0081455_10050490 | |||
| 1872 | Ga0081455_10051347 | |||
| 1873 | Ga0081455_10062051 | |||
| 1874 | Ga0081538_10006470 | |||
| 1875 | Ga0081538_10012206 | |||
| 1876 | Ga0081540_1000075 | |||
| 1877 | Ga0081540_1004394 | |||
| 1878 | Ga0081540_1004944 | |||
| 1879 | Ga0081540_1020408 | |||
| 1880 | Ga0081540_1021191 | |||
| 1881 | Ga0081540_1030810 | |||
| 1882 | Ga0081540_1038950 | |||
| 1883 | Ga0081539_10000040 | |||
| 1884 | Ga0081539_10001975 | |||
| 1885 | Ga0081539_10016429 | |||
| 1886 | Ga0070717_10006939 | |||
| 1887 | Ga0070717_10028486 | |||
| 1888 | Ga0070717_10049387 | |||
| 1889 | Ga0075365_10004228 | |||
| 1890 | Ga0075365_10065035 | |||
| 1891 | Ga0075368_10018327 | |||
| 1892 | Ga0075363_100016540 | |||
| 1893 | Ga0075363_100026212 | |||
| 1894 | Ga0075364_10014353 | |||
| 1895 | Ga0070715_10001500 | |||
| 1896 | Ga0070715_10011258 | |||
| 1897 | Ga0070712_100001447 | |||
| 1898 | Ga0070712_100002943 | |||
| 1899 | Ga0070712_100016890 | |||
| 1900 | Ga0070712_100044119 | |||
| 1901 | Ga0075362_10003665 | |||
| 1902 | Ga0075367_10004928 | |||
| 1903 | Ga0075367_10044929 | |||
| 1904 | Ga0097621_100000456 | |||
| 1905 | Ga0097621_100037561 | |||
| 1906 | Ga0075370_10043991 | |||
| 1907 | Ga0068871_100000269 | |||
| 1908 | Ga0068871_100049393 | |||
| 1909 | Ga0075428_100000690 | |||
| 1910 | Ga0075428_100013445 | |||
| 1911 | Ga0075428_100024912 | |||
| 1912 | Ga0075428_100116778 | |||
| 1913 | Ga0075430_100000092 | |||
| 1914 | Ga0075430_100000094 | |||
| 1915 | Ga0075430_100069749 | |||
| 1916 | Ga0075431_100002169 | |||
| 1917 | Ga0075431_100004121 | |||
| 1918 | Ga0075431_100102463 | |||
| 1919 | Ga0075433_10001242 | |||
| 1920 | Ga0075433_10079040 | |||
| 1921 | Ga0075434_100000299 | |||
| 1922 | Ga0075434_100011399 | |||
| 1923 | Ga0075434_100029399 | |||
| 1924 | Ga0075434_100155179 | |||
| 1925 | Ga0075429_100002930 | |||
| 1926 | Ga0075429_100022441 | |||
| 1927 | Ga0075429_100057386 | |||
| 1928 | Ga0068865_100001731 | |||
| 1929 | Ga0068865_100025293 | |||
| 1930 | Ga0068865_100063086 | |||
| 1931 | Ga0075436_100009525 | |||
| 1932 | Ga0097620_100005590 | |||
| 1933 | Ga0097620_100027680 | |||
| 1934 | Ga0099824_1005597 | |||
| 1935 | Ga0099822_1029915 | |||
| 1936 | Ga0075435_100004453 | |||
| 1937 | Ga0075435_100018551 | |||
| 1938 | Ga0075435_100068134 | |||
| 1939 | Ga0105251_10011399 | |||
| 1940 | Ga0105240_10004679 | |||
| 1941 | Ga0105240_10030589 | |||
| 1942 | Ga0105240_10049444 | |||
| 1943 | Ga0105240_10150088 | |||
| 1944 | Ga0111539_10003217 | |||
| 1945 | Ga0111539_10003331 | |||
| 1946 | Ga0111539_10007321 | |||
| 1947 | Ga0111539_10014441 | |||
| 1948 | Ga0111539_10018158 | |||
| 1949 | Ga0111539_10173984 | |||
| 1950 | Ga0111539_10239665 | |||
| 1951 | Ga0105245_10000183 | |||
| 1952 | Ga0105245_10000837 | |||
| 1953 | Ga0105245_10068437 | |||
| 1954 | Ga0105245_10074891 | |||
| 1955 | Ga0105247_10028634 | |||
| 1956 | Ga0105247_10065605 | |||
| 1957 | Ga0114129_10001218 | |||
| 1958 | Ga0114129_10002246 | |||
| 1959 | Ga0114129_10020755 | |||
| 1960 | Ga0114129_10060727 | |||
| 1961 | Ga0114129_10077847 | |||
| 1962 | Ga0105243_10001561 | |||
| 1963 | Ga0105243_10011635 | |||
| 1964 | Ga0105243_10037604 | |||
| 1965 | Ga0105243_10038555 | |||
| 1966 | Ga0105243_10056281 | |||
| 1967 | Ga0105241_10003567 | |||
| 1968 | Ga0105241_10017304 | |||
| 1969 | Ga0105241_10027426 | |||
| 1970 | Ga0105242_10000701 | |||
| 1971 | Ga0105242_10012638 | |||
| 1972 | Ga0105242_10023312 | |||
| 1973 | Ga0105248_10006263 | |||
| 1974 | Ga0105248_10011058 | |||
| 1975 | Ga0105248_10072442 | |||
| 1976 | Ga0105248_10156269 | |||
| 1977 | Ga0105237_10088204 | |||
| 1978 | Ga0105237_10118300 | |||
| 1979 | Ga0105237_10128712 | |||
| 1980 | Ga0105237_10144832 | |||
| 1981 | Ga0105238_10002649 | |||
| 1982 | Ga0105238_10048497 | |||
| 1983 | Ga0105238_10127490 | |||
| 1984 | Ga0105249_10009795 | |||
| 1985 | Ga0105249_10121261 | |||
| 1986 | Ga0105239_10007315 | |||
| 1987 | Ga0105239_10036529 | |||
| 1988 | Ga0105239_10174368 | |||
| 1989 | Ga0105246_10002447 | |||
| 1990 | Ga0105246_10044208 | |||
| 1991 | Ga0157373_10001725 | |||
| 1992 | Ga0157373_10004265 | |||
| 1993 | Ga0157373_10098846 | |||
| 1994 | Ga0157371_10004441 | |||
| 1995 | Ga0157370_10040794 | |||
| 1996 | Ga0157370_10062026 | |||
| 1997 | Ga0157370_10072847 | |||
| 1998 | Ga0157370_10093233 | |||
| 1999 | Ga0157370_10151965 | |||
| 2000 | Ga0157369_10164915 | |||
| 2001 | Ga0157374_10000463 | |||
| 2002 | Ga0157374_10029135 | |||
| 2003 | Ga0157374_10038879 | |||
| 2004 | Ga0157378_10000613 | |||
| 2005 | Ga0157378_10005022 | |||
| 2006 | Ga0163162_10005908 | |||
| 2007 | Ga0163162_10105052 | |||
| 2008 | Ga0157375_10004786 | |||
| 2009 | Ga0157375_10148713 | |||
| 2010 | Ga0163163_10001239 | |||
| 2011 | Ga0163163_10015456 | |||
| 2012 | Ga0163163_10064891 | |||
| 2013 | Ga0163163_10109370 | |||
| 2014 | Ga0157380_10005539 | |||
| 2015 | Ga0157380_10007021 | |||
| 2016 | Ga0157379_10003902 | |||
| 2017 | Ga0157379_10004696 | |||
| 2018 | Ga0157379_10010527 | |||
| 2019 | Ga0157376_10004121 | |||
| 2020 | Ga0183365_10005 | |||
| 2021 | Ga0163161_10001492 | |||
| 2022 | Ga0163161_10016341 | |||
| 2023 | Ga0214544_1000007 | |||
| 2024 | Ga0214542_1000007 | |||
| 2025 | Ga0214545_1000006 | |||
| 2026 | Ga0214543_1000009 | |||
| 2027 | Ga0213873_10004647 | |||
| 2028 | Ga0213876_10011819 | |||
| 2029 | Ga0213876_10026411 | |||
| 2030 | Ga0213875_10000011 | |||
| 2031 | Ga0209563_100836 | |||
| 2032 | Ga0209677_100870 | |||
| 2033 | Ga0209677_103014 | |||
| 2034 | Ga0209148_1000819 | |||
| 2035 | Ga0209148_1003093 | |||
| 2036 | Ga0209233_1002233 | |||
| 2037 | Ga0209233_1002460 | |||
| 2038 | Ga0209673_1021407 | |||
| 2039 | Ga0207673_1000039 | |||
| 2040 | Ga0209564_1000842 | |||
| 2041 | Ga0209564_1004040 | |||
| 2042 | Ga0209758_1000015 | |||
| 2043 | Ga0209758_1000161 | |||
| 2044 | Ga0209758_1000798 | |||
| 2045 | Ga0209758_1001478 | |||
| 2046 | Ga0209758_1003077 | |||
| 2047 | Ga0209758_1006528 | |||
| 2048 | Ga0207426_1000186 | |||
| 2049 | Ga0209257_1000983 | |||
| 2050 | Ga0207697_10000763 | |||
| 2051 | Ga0207656_10005224 | |||
| 2052 | Ga0207653_10016374 | |||
| 2053 | Ga0207682_10000062 | |||
| 2054 | Ga0207692_10012844 | |||
| 2055 | Ga0207642_10002857 | |||
| 2056 | Ga0207710_10009862 | |||
| 2057 | Ga0207710_10015503 | |||
| 2058 | Ga0207688_10001992 | |||
| 2059 | Ga0207688_10006793 | |||
| 2060 | Ga0207680_10000740 | |||
| 2061 | Ga0207647_10003504 | |||
| 2062 | Ga0207647_10011763 | |||
| 2063 | Ga0207647_10044532 | |||
| 2064 | Ga0207647_10047561 | |||
| 2065 | Ga0207685_10000809 | |||
| 2066 | Ga0207699_10001144 | |||
| 2067 | Ga0207699_10019708 | |||
| 2068 | Ga0207645_10000248 | |||
| 2069 | Ga0207645_10041103 | |||
| 2070 | Ga0207643_10000064 | |||
| 2071 | Ga0207643_10057354 | |||
| 2072 | Ga0207654_10000874 | |||
| 2073 | Ga0207654_10001623 | |||
| 2074 | Ga0207707_10002084 | |||
| 2075 | Ga0207707_10015886 | |||
| 2076 | Ga0207707_10088287 | |||
| 2077 | Ga0207695_10000006 | |||
| 2078 | Ga0207695_10053399 | |||
| 2079 | Ga0207695_10072745 | |||
| 2080 | Ga0207695_10131584 | |||
| 2081 | Ga0207671_10001082 | |||
| 2082 | Ga0207671_10016546 | |||
| 2083 | Ga0207671_10047462 | |||
| 2084 | Ga0207693_10001801 | |||
| 2085 | Ga0207693_10002520 | |||
| 2086 | Ga0207693_10020205 | |||
| 2087 | Ga0207693_10028189 | |||
| 2088 | Ga0207693_10029262 | |||
| 2089 | Ga0207693_10047590 | |||
| 2090 | Ga0207693_10058667 | |||
| 2091 | Ga0207693_10093764 | |||
| 2092 | Ga0207663_10000260 | |||
| 2093 | Ga0207663_10009733 | |||
| 2094 | Ga0207663_10031931 | |||
| 2095 | Ga0207660_10000194 | |||
| 2096 | Ga0207660_10001899 | |||
| 2097 | Ga0207660_10065909 | |||
| 2098 | Ga0207662_10001637 | |||
| 2099 | Ga0207662_10025322 | |||
| 2100 | Ga0207662_10035289 | |||
| 2101 | Ga0207657_10003965 | |||
| 2102 | Ga0207657_10006919 | |||
| 2103 | Ga0207657_10035372 | |||
| 2104 | Ga0207649_10000234 | |||
| 2105 | Ga0207649_10059410 | |||
| 2106 | Ga0207652_10001613 | |||
| 2107 | Ga0207652_10002210 | |||
| 2108 | Ga0207652_10014326 | |||
| 2109 | Ga0207652_10059725 | |||
| 2110 | Ga0207681_10000794 | |||
| 2111 | Ga0207694_10000306 | |||
| 2112 | Ga0207650_10024593 | |||
| 2113 | Ga0207650_10030481 | |||
| 2114 | Ga0207659_10000172 | |||
| 2115 | Ga0207659_10028313 | |||
| 2116 | Ga0207659_10036392 | |||
| 2117 | Ga0207659_10119127 | |||
| 2118 | Ga0207687_10002217 | |||
| 2119 | Ga0207700_10012823 | |||
| 2120 | Ga0207700_10022444 | |||
| 2121 | Ga0207700_10117488 | |||
| 2122 | Ga0207664_10016500 | |||
| 2123 | Ga0207664_10023534 | |||
| 2124 | Ga0207644_10040591 | |||
| 2125 | Ga0207644_10066567 | |||
| 2126 | Ga0207690_10000796 | |||
| 2127 | Ga0207690_10011303 | |||
| 2128 | Ga0207690_10076263 | |||
| 2129 | Ga0207706_10005059 | |||
| 2130 | Ga0207706_10062109 | |||
| 2131 | Ga0207706_10092551 | |||
| 2132 | Ga0207686_10001093 | |||
| 2133 | Ga0207709_10001438 | |||
| 2134 | Ga0207709_10010457 | |||
| 2135 | Ga0207709_10035895 | |||
| 2136 | Ga0207709_10064502 | |||
| 2137 | Ga0207670_10000608 | |||
| 2138 | Ga0207670_10000807 | |||
| 2139 | Ga0207670_10052583 | |||
| 2140 | Ga0207669_10000141 | |||
| 2141 | Ga0207669_10036469 | |||
| 2142 | Ga0207704_10000755 | |||
| 2143 | Ga0207704_10008791 | |||
| 2144 | Ga0207665_10004374 | |||
| 2145 | Ga0207665_10004936 | |||
| 2146 | Ga0207665_10017370 | |||
| 2147 | Ga0207691_10000720 | |||
| 2148 | Ga0207691_10002355 | |||
| 2149 | Ga0207691_10006997 | |||
| 2150 | Ga0207691_10062352 | |||
| 2151 | Ga0207691_10084978 | |||
| 2152 | Ga0207711_10004836 | |||
| 2153 | Ga0207711_10032056 | |||
| 2154 | Ga0207711_10091468 | |||
| 2155 | Ga0207711_10093668 | |||
| 2156 | Ga0207689_10004430 | |||
| 2157 | Ga0207689_10018680 | |||
| 2158 | Ga0207661_10000098 | |||
| 2159 | Ga0207661_10007875 | |||
| 2160 | Ga0207679_10000174 | |||
| 2161 | Ga0207679_10004250 | |||
| 2162 | Ga0207679_10048313 | |||
| 2163 | Ga0207667_10004743 | |||
| 2164 | Ga0207667_10029793 | |||
| 2165 | Ga0207667_10055800 | |||
| 2166 | Ga0207667_10059856 | |||
| 2167 | Ga0207651_10002999 | |||
| 2168 | Ga0207651_10101017 | |||
| 2169 | Ga0207712_10000659 | |||
| 2170 | Ga0207668_10001107 | |||
| 2171 | Ga0207668_10038300 | |||
| 2172 | Ga0207640_10000846 | |||
| 2173 | Ga0207640_10071028 | |||
| 2174 | Ga0207658_10001843 | |||
| 2175 | Ga0207658_10036240 | |||
| 2176 | Ga0207677_10002504 | |||
| 2177 | Ga0207677_10044516 | |||
| 2178 | Ga0207703_10002433 | |||
| 2179 | Ga0207703_10005387 | |||
| 2180 | Ga0207703_10088155 | |||
| 2181 | Ga0207639_10001774 | |||
| 2182 | Ga0207639_10007131 | |||
| 2183 | Ga0207639_10022198 | |||
| 2184 | Ga0207678_10001059 | |||
| 2185 | Ga0207678_10009212 | |||
| 2186 | Ga0207678_10031363 | |||
| 2187 | Ga0207678_10057982 | |||
| 2188 | Ga0207678_10080115 | |||
| 2189 | Ga0207708_10001417 | |||
| 2190 | Ga0207708_10002793 | |||
| 2191 | Ga0207708_10063316 | |||
| 2192 | Ga0207702_10000122 | |||
| 2193 | Ga0207702_10007668 | |||
| 2194 | Ga0207702_10008899 | |||
| 2195 | Ga0207702_10134619 | |||
| 2196 | Ga0207641_10000622 | |||
| 2197 | Ga0207641_10007557 | |||
| 2198 | Ga0207648_10009300 | |||
| 2199 | Ga0207676_10002696 | |||
| 2200 | Ga0207676_10026665 | |||
| 2201 | Ga0207674_10001342 | |||
| 2202 | Ga0207674_10014657 | |||
| 2203 | Ga0207674_10017155 | |||
| 2204 | Ga0207674_10046931 | |||
| 2205 | Ga0207674_10144681 | |||
| 2206 | Ga0207675_100006706 | |||
| 2207 | Ga0207675_100011711 | |||
| 2208 | Ga0207683_10001193 | |||
| 2209 | Ga0207683_10045199 | |||
| 2210 | Ga0207683_10101830 | |||
| 2211 | Ga0209389_1000328 | |||
| 2212 | Ga0209589_1000017 | |||
| 2213 | Ga0209589_1003134 | |||
| 2214 | Ga0209489_100018 | |||
| 2215 | Ga0209489_103754 | |||
| 2216 | Ga0209700_100014 | |||
| 2217 | Ga0209700_100028 | |||
| 2218 | Ga0210002_1000638 | |||
| 2219 | Ga0209588_1011823 | |||
| 2220 | Ga0209966_1004024 | |||
| 2221 | Ga0209998_10001504 | |||
| 2222 | Ga0209974_10001402 | |||
| 2223 | Ga0207428_10000513 | |||
| 2224 | Ga0207428_10000626 | |||
| 2225 | Ga0207428_10001020 | |||
| 2226 | Ga0207428_10009473 | |||
| 2227 | Ga0268266_10009223 | |||
| 2228 | Ga0268266_10011610 | |||
| 2229 | Ga0268266_10018776 | |||
| 2230 | Ga0268266_10018923 | |||
| 2231 | Ga0268266_10086973 | |||
| 2232 | Ga0268266_10105625 | |||
| 2233 | Ga0268265_10002370 | |||
| 2234 | Ga0268265_10097726 | |||
| 2235 | Ga0268264_10000110 | |||
| 2236 | Ga0268264_10000187 | |||
| 2237 | Ga0268264_10006546 | |||
| 2238 | Ga0268264_10071289 | |||
| 2239 | Ga0268264_10144411 | |||
| 2240 | Ga0265337_1001215 | |||
| 2241 | Ga0265334_10026341 | |||
| 2242 | Ga0265336_10000764 | |||
| 2243 | Ga0307517_10000066 | |||
| 2244 | Ga0265338_10000973 | |||
| 2245 | Ga0265338_10021562 | |||
| 2246 | Ga0265338_10062901 | |||
| 2247 | Ga0265324_10003352 | |||
| 2248 | Ga0265330_10025186 | |||
| 2249 | Ga0265330_10029428 | |||
| 2250 | Ga0265332_10003602 | |||
| 2251 | Ga0265325_10003292 | |||
| 2252 | Ga0265325_10006295 | |||
| 2253 | Ga0265325_10007950 | |||
| 2254 | Ga0265325_10023341 | |||
| 2255 | Ga0265340_10001645 | |||
| 2256 | Ga0265340_10029097 | |||
| 2257 | Ga0265339_10000069 | |||
| 2258 | Ga0265339_10004839 | |||
| 2259 | Ga0265339_10007305 | |||
| 2260 | Ga0265331_10017214 | |||
| 2261 | Ga0265331_10022476 | |||
| 2262 | Ga0265327_10000130 | |||
| 2263 | Ga0265316_10082137 | |||
| 2264 | Ga0265316_10097918 | |||
| 2265 | Ga0307509_10034527 | |||
| 2266 | Ga0307408_100022413 | |||
| 2267 | Ga0265313_10000386 | |||
| 2268 | Ga0265313_10000525 | |||
| 2269 | Ga0265313_10005935 | |||
| 2270 | Ga0265313_10006744 | |||
| 2271 | Ga0265313_10008290 | |||
| 2272 | Ga0307508_10001545 | |||
| 2273 | Ga0265314_10002489 | |||
| 2274 | Ga0265314_10008132 | |||
| 2275 | Ga0265342_10000245 | |||
| 2276 | Ga0265342_10001939 | |||
| 2277 | Ga0316576_10020401 | |||
| 2278 | Ga0307516_10000001 | |||
| 2279 | Ga0307516_10056008 | |||
| 2280 | Ga0307510_10026558 | |||
| 2281 | Ga0307510_10039402 | |||
| 2282 | Ga0307510_10133565 | |||
| 2283 | Ga0315911_1000033 | |||
| 2284 | Ga0373948_0000049 | |||
| 2285 | Ga0373958_0000026 | |||
| 2286 | Ga0373959_0000446 | |||
| 2287 | Ga0373938_0000133 | |||
| 2288 | Ga0373938_0000337 | |||
| 2289 | Ga0373938_0003695 | |||
| 2290 | Ga0373926_0010417 | |||
| 2291 | Ga0373929_0000110 | |||
| 2292 | Ga0373934_0029264 | |||
| 2293 | Ga0373940_0000409 | |||
| 2294 | Ga0373944_0001321 | |||
| 2295 | Ga0373944_0006972 | |||
| 2296 | Ga0373944_0010142 | |||
| 2297 | Ga0373949_0000771 | |||
| 2298 | Ga0373949_0001010 | |||
| 2299 | Ga0373949_0002903 | |||
| 2300 | Ga0373951_0001038 | |||
| 2301 | Ga0373952_0000200 | |||
| 2302 | Ga0373952_0000271 | |||
| 2303 | Ga0373923_0000365 | |||
| 2304 | Ga0373932_0013210 | |||
| 2305 | Ga0373936_0002908 | |||
| 2306 | Ga0373936_0006874 | |||
| 2307 | Ga0373936_0014831 | |||
| 2308 | Ga0373936_0032359 | |||
| 2309 | Ga0373939_0001604 | |||
| 2310 | Ga0373941_0000177 | |||
| 2311 | Ga0373945_0000773 | |||
| 2312 | Ga0373945_0002050 | |||
| 2313 | Ga0373945_0007095 | |||
| 2314 | Ga0373953_0002305 | |||
| 2315 | Ga0373953_0010859 | |||
| 2316 | Ga0373953_0016591 | |||
| 2317 | Ga0373954_0001844 | |||
| 2318 | Ga0373954_0003693 | |||
| 2319 | Ga0373954_0004386 | |||
| 2320 | Ga0373954_0042229 | |||
| 2321 | Ga0373956_0001114 | |||
| 2322 | Ga0373956_0012758 | |||
| 2323 | Ga0373956_0022639 | |||
| 2324 | Ga0373957_0005169 | |||
| 2325 | Ga0373960_0002058 | |||
| 2326 | Ga0373943_0000371 | |||
| 2327 | Ga0373943_0016042 | |||
| 2328 | Ga0373943_0022654 | |||
| 2329 | Ga0373946_0001609 | |||
| 2330 | Ga0373946_0003088 | |||
| 2331 | Ga0373946_0003694 | |||
| 2332 | Ga0373946_0003981 | |||
| 2333 | Ga0373946_0017748 | |||
| 2334 | Ga0373955_0000087 | |||
| 2335 | Ga0373955_0019309 | |||
| 2336 | Ga0373955_0022872 | |||
| 2337 | Ga0373942_0000533 | |||
| 2338 | Ga0373942_0002312 | |||
| 2339 | Ga0373961_0009181 | |||
| 2340 | Ga0373962_0000275 | |||
| 2341 | Ga0373962_0003026 | |||
| 2342 | Ga0316574_0000409 | |||
| 2343 | Ga0373931_0002417 | |||
| 2344 | Ga0373931_0003207 | |||
| 2345 | Ga0373931_0013686 | |||
| 2346 | Ga0373931_0018753 | |||
| 2347 | Ga0373931_0043522 | |||
| 2348 | Ga0373935_0000249 | |||
| 2349 | Ga0373935_0001440 | |||
| 2350 | Ga0373935_0001638 | |||
| 2351 | Ga0373935_0009616 | |||
| 2352 | Ga0373935_0017387 | |||
| 2353 | Ga0373935_0022258 | |||
| 2354 | Ga0373935_0023343 | |||
| 2355 | Ga0373935_0038689 | |||
| 2356 | Ga0373935_0065574 | |||
| 2357 | Ga0373927_0000496 | |||
| 2358 | Ga0373927_0005789 | |||
| 2359 | Ga0373927_0013727 | |||
| 2360 | Ga0373927_0017197 | |||
| 2361 | Ga0373927_0038948 | |||
| 2362 | Ga0373927_0052483 | |||
| 2363 | Ga0373927_0057648 | |||
| 2364 | Ga0373927_0076999 | |||
| 2365 | Ga0373933_0001541 | |||
| 2366 | Ga0373933_0003396 | |||
| 2367 | Ga0373933_0015198 | |||
| 2368 | Ga0373933_0020661 | |||
| 2369 | Ga0373933_0052379 | |||
| 2370 | Ga0373947_0000172 | |||
| 2371 | Ga0373947_0000552 | |||
| 2372 | Ga0373947_0001425 | |||
| 2373 | Ga0373947_0003284 | |||
| 2374 | Ga0373947_0005148 | |||
| 2375 | Ga0373947_0008568 | |||
| 2376 | Ga0373947_0043715 | |||
| 2377 | Ga0373937_0000006 | |||
| 2378 | Ga0373937_0003940 | |||
| 2379 | Ga0373937_0006385 | |||
| 2380 | Ga0373937_0008551 | |||
| 2381 | Ga0373937_0013102 | |||
| 2382 | Ga0373937_0020237 | |||
| 2383 | Ga0373937_0037460 | |||
| 2384 | Ga0373937_0053496 | |||
| 2385 | Ga0373937_0084498 | |||
| 2386 | Ga0316584_0023349 | |||
| 2387 | Ga0373925_0000002 | |||
| 2388 | Ga0373925_0001273 | |||
| 2389 | Ga0373925_0001642 | |||
| 2390 | Ga0373925_0006254 | |||
| 2391 | Ga0373925_0007268 | |||
| 2392 | Ga0373925_0012599 | |||
| 2393 | Ga0373925_0013241 | |||
| 2394 | Ga0395899_0034774 | |||
| 2395 | Ga0395900_0000962 | |||
| 2396 | Ga0395900_0001475 | |||
| 2397 | Ga0395898_0016645 | |||
| 2398 | Ga0395898_0020156 | |||
| 2399 | Ga0395898_0031972 | |||
| 2400 | Ga0395898_0061080 | |||
| 2401 | Ga0395898_0075158 | |||
| 2402 | Ga0395905_0000156 | |||
| 2403 | Ga0395905_0007000 | |||
| 2404 | Ga0395905_0021976 | |||
| 2405 | Ga0395905_0114742 | |||
| 2406 | Ga0436364_0271330 | |||
| 2407 | Ga0436364_0500047 | |||
| 2408 | Ga0436364_0728139 | |||
| 2409 | Ga0436364_0992626 | |||
| 2410 | Ga0395901_0002873 | |||
| 2411 | Ga0395901_0010605 | |||
| 2412 | Ga0395901_0067052 | |||
| 2413 | Ga0400483_004403 | |||
| 2414 | Ga0400483_116415 | |||
| 2415 | Ga0400483_160454 | |||
| 2416 | Ga0436365_0018961 | |||
| 2417 | Ga0436365_0675935 | |||
| 2418 | Ga0436365_0918738 | |||
| 2419 | Ga0436365_1445082 | |||
| 2420 | Ga0436365_1839688 | |||
| 2421 | Ga0436361_0314376 | |||
| 2422 | Ga0436363_1035293 | |||
| 2423 | Ga0439460_0006942 | |||
| 2424 | Ga0451577_0068027 | |||
| 2425 | Ga0466969_0013555 | |||
| 2426 | Ga0466972_0000048 | |||
| 2427 | Ga0466972_0004536 | |||
| 2428 | Ga0466966_0001825 | |||
| 2429 | Ga0466966_0034354 | |||
| 2430 | Ga0466961_0000010 | |||
| 2431 | Ga0466963_0002918 | |||
| 2432 | Ga0466963_0014154 | |||
| 2433 | Ga0466968_0033848 | |||
| 2434 | Ga0466959_0025251 | |||
| 2435 | Ga0451576_0004729 | |||
| 2436 | Ga0451576_0013587 | |||
| 2437 | Ga0466967_0043269 | |||
| 2438 | Ga0466967_0090501 | |||
| 2439 | Ga0495617_014253 | |||
| 2440 | Ga0495592_0000039 | |||
| 2441 | Ga0495592_0001131 | |||
| 2442 | Ga0495592_0006064 | |||
| 2443 | Ga0495592_0007618 | |||
| 2444 | Ga0495592_0013776 | |||
| 2445 | Ga0495592_0045577 | |||
| 2446 | Ga0495592_0053790 | |||
| 2447 | Ga0495592_0089180 | |||
| 2448 | Ga0495603_0000104 | |||
| 2449 | Ga0495603_0037324 | |||
| 2450 | Ga0495603_0052457 | |||
| 2451 | Ga0495629_0000748 | |||
| 2452 | Ga0495629_0002078 | |||
| 2453 | Ga0495629_0006821 | |||
| 2454 | Ga0495629_0012882 | |||
| 2455 | Ga0495629_0022194 | |||
| 2456 | Ga0495629_0034735 | |||
| 2457 | Ga0495629_0054255 | |||
| 2458 | Ga0495638_0008996 | |||
| 2459 | Ga0495638_0024230 | |||
| 2460 | Ga0495638_0035210 | |||
| 2461 | Ga0495641_0030325 | |||
| 2462 | Ga0495651_0000611 | |||
| 2463 | Ga0495651_0001571 | |||
| 2464 | Ga0495651_0011467 | |||
| 2465 | Ga0495651_0021445 | |||
| 2466 | Ga0495651_0079930 | |||
| 2467 | Ga0495651_0092655 | |||
| 2468 | Ga0495651_0100880 | |||
| 2469 | Ga0495653_0000006 | |||
| 2470 | Ga0495653_0007005 | |||
| 2471 | Ga0495653_0011146 | |||
| 2472 | Ga0495653_0018841 | |||
| 2473 | Ga0495653_0030224 | |||
| 2474 | Ga0495653_0037262 | |||
| 2475 | Ga0495580_0003617 | |||
| 2476 | Ga0495580_0010851 | |||
| 2477 | Ga0495580_0026401 | |||
| 2478 | Ga0495582_0000063 | |||
| 2479 | Ga0495582_0012713 | |||
| 2480 | Ga0495639_0000224 | |||
| 2481 | Ga0495662_0000297 | |||
| 2482 | Ga0495662_0013952 | |||
| 2483 | Ga0495662_0023254 | |||
| 2484 | Ga0495664_0000002 | |||
| 2485 | Ga0495664_0006271 | |||
| 2486 | Ga0495664_0015744 | |||
| 2487 | Ga0495664_0044123 | |||
| 2488 | Ga0495664_0050217 | |||
| 2489 | Ga0495585_0000546 | |||
| 2490 | Ga0495585_0059640 | |||
| 2491 | Ga0495594_0001344 | |||
| 2492 | Ga0495596_0037352 | |||
| 2493 | Ga0495606_0003923 | |||
| 2494 | Ga0495606_0018849 | |||
| 2495 | Ga0495608_0000009 | |||
| 2496 | Ga0495608_0000557 | |||
| 2497 | Ga0495608_0002360 | |||
| 2498 | Ga0495608_0075138 | |||
| 2499 | Ga0495610_0017707 | |||
| 2500 | Ga0495610_0020667 | |||
| 2501 | Ga0495618_0000005 | |||
| 2502 | Ga0495618_0003917 | |||
| 2503 | Ga0495618_0007259 | |||
| 2504 | Ga0495618_0027475 | |||
| 2505 | Ga0495618_0057516 | |||
| 2506 | Ga0495618_0094208 | |||
| 2507 | Ga0495628_0000002 | |||
| 2508 | Ga0495628_0008721 | |||
| 2509 | Ga0495628_0018145 | |||
| 2510 | Ga0495628_0019167 | |||
| 2511 | Ga0495628_0031426 | |||
| 2512 | Ga0495628_0044261 | |||
| 2513 | Ga0495628_0063330 | |||
| 2514 | Ga0495630_0018505 | |||
| 2515 | Ga0495630_0024736 | |||
| 2516 | Ga0495637_0005275 | |||
| 2517 | Ga0495637_0018544 | |||
| 2518 | Ga0495644_0000208 | |||
| 2519 | Ga0495648_0001804 | |||
| 2520 | Ga0495648_0037123 | |||
| 2521 | Ga0495666_0027747 | |||
| 2522 | Ga0495642_0000952 | |||
| 2523 | Ga0495652_0000004 | |||
| 2524 | Ga0495652_0011295 | |||
| 2525 | Ga0495652_0043946 | |||
| 2526 | Ga0495665_0000290 | |||
| 2527 | Ga0495665_0009753 | |||
| 2528 | Ga0495665_0035624 | |||
| 2529 | Ga0495665_0039329 | |||
| 2530 | Ga0495640_0000005 | |||
| 2531 | Ga0495640_0005790 | |||
| 2532 | Ga0495640_0016952 | |||
| 2533 | Ga0495640_0026837 | |||
| 2534 | Ga0495640_0066325 | |||
| 2535 | Ga0495586_0004986 | |||
| 2536 | Ga0495586_0012468 | |||
| 2537 | Ga0495586_0018134 | |||
| 2538 | Ga0495587_0000007 | |||
| 2539 | Ga0495587_0001059 | |||
| 2540 | Ga0495587_0020929 | |||
| 2541 | Ga0495598_0004142 | |||
| 2542 | Ga0495609_0003197 | |||
| 2543 | Ga0495645_0000003 | |||
| 2544 | Ga0495645_0006734 | |||
| 2545 | Ga0495645_0007749 | |||
| 2546 | Ga0495645_0039626 | |||
| 2547 | Ga0495645_0068183 | |||
| 2548 | Ga0495633_0002198 | |||
| 2549 | Ga0495667_0000002 | |||
| 2550 | Ga0495667_0009830 | |||
| 2551 | Ga0495667_0016261 | |||
| 2552 | Ga0495667_0070092 | |||
| 2553 | Ga0495667_0074627 | |||
| 2554 | Ga0495656_0000116 | |||
| 2555 | Ga0495668_0013241 | |||
| 2556 | Ga0495668_0067894 | |||
| 2557 | Ga0495634_0000022 | |||
| 2558 | Ga0495634_0005885 | |||
| 2559 | Ga0495634_0013980 | |||
| 2560 | Ga0495634_0014410 | |||
| 2561 | Ga0495634_0023350 | |||
| 2562 | Ga0495634_0083444 | |||
| 2563 | Ga0495611_0002902 | |||
| 2564 | Ga0495625_0014130 | |||
| 2565 | Ga0495635_0000020 | |||
| 2566 | Ga0495635_0009729 | |||
| 2567 | Ga0495635_0012565 | |||
| 2568 | Ga0495635_0017837 | |||
| 2569 | Ga0495635_0067122 | |||
| 2570 | Ga0495635_0070813 | |||
| 2571 | Ga0495659_0000633 | |||
| 2572 | Ga0495659_0013796 | |||
| 2573 | Ga0495661_0009454 | |||
| 2574 | Ga0495588_0006115 | |||
| 2575 | Ga0495588_0007718 | |||
| 2576 | Ga0495657_0000435 | |||
| 2577 | Ga0495657_0023694 | |||
| 2578 | Ga0495657_0039556 | |||
| 2579 | Ga0495657_0050904 | |||
| 2580 | Ga0495657_0051901 | |||
| 2581 | Ga0495657_0065141 | |||
| 2582 | Ga0495599_0000001 | |||
| 2583 | Ga0495599_0001663 | |||
| 2584 | Ga0495623_0000001 | |||
| 2585 | Ga0495623_0000278 | |||
| 2586 | Ga0495623_0004162 | |||
| 2587 | Ga0495623_0029868 | |||
| 2588 | Ga0495623_0047063 | |||
| 2589 | Ga0495646_0000014 | |||
| 2590 | Ga0495646_0007424 | |||
| 2591 | Ga0495646_0016960 | |||
| 2592 | Ga0495646_0043120 | |||
| 2593 | Ga0495647_0000453 | |||
| 2594 | Ga0495647_0000596 | |||
| 2595 | Ga0495647_0010922 | |||
| 2596 | Ga0495658_0000366 | |||
| 2597 | Ga0495658_0001515 | |||
| 2598 | Ga0495658_0003288 | |||
| 2599 | Ga0495658_0011776 | |||
| 2600 | Ga0495658_0054631 | |||
| 2601 | Ga0495669_0017680 | |||
| 2602 | Ga0495669_0060642 | |||
| 2603 | Ga0495613_0000449 | |||
| 2604 | Ga0495613_0011155 | |||
| 2605 | Ga0495613_0016658 | |||
| 2606 | Ga0495624_0000224 | |||
| 2607 | Ga0495624_0004050 | |||
| 2608 | Ga0495624_0037184 | |||
| 2609 | Ga0495624_0054059 | |||
| 2610 | Ga0495670_0003609 | |||
| 2611 | Ga0495670_0018418 | |||
| 2612 | Ga0495600_0000006 | |||
| 2613 | Ga0495600_0002049 | |||
| 2614 | Ga0495600_0005150 | |||
| 2615 | Ga0495600_0006047 | |||
| 2616 | Ga0495600_0009892 | |||
| 2617 | Ga0495600_0020263 | |||
| 2618 | Ga0495600_0069145 | |||
| 2619 | Ga0495581_0001337 | |||
| 2620 | Ga0495581_0002953 | |||
| 2621 | Ga0495581_0025215 | |||
| 2622 | Ga0495581_0027196 | |||
| 2623 | Ga0495581_0039068 | |||
| 2624 | Ga0495604_0000005 | |||
| 2625 | Ga0495604_0006090 | |||
| 2626 | Ga0495604_0007032 | |||
| 2627 | Ga0495604_0010819 | |||
| 2628 | Ga0495604_0026104 | |||
| 2629 | Ga0495604_0031612 | |||
| 2630 | Ga0495604_0035035 | |||
| 2631 | Ga0495604_0063261 | |||
| 2632 | Ga0495604_0101996 | |||
| 2633 | Ga0495674_0000003 | |||
| 2634 | Ga0495674_0000747 | |||
| 2635 | Ga0495674_0005032 | |||
| 2636 | Ga0495674_0013887 | |||
| 2637 | Ga0495674_0024269 | |||
| 2638 | Ga0495674_0026746 | |||
| 2639 | Ga0495674_0044939 | |||
| 2640 | Ga0495674_0068500 | |||
| 2641 | Ga0495674_0069963 | |||
| 2642 | Ga0495674_0074364 | |||
| 2643 | Ga0495672_0081727 | |||
| 2644 | Ga0495676_0015297 | |||
| 2645 | Ga0495676_0020900 | |||
| 2646 | Ga0495676_0021862 | |||
| 2647 | Ga0495676_0041727 | |||
| 2648 | Ga0495680_0000002 | |||
| 2649 | Ga0495680_0003135 | |||
| 2650 | Ga0495680_0006572 | |||
| 2651 | Ga0495680_0008513 | |||
| 2652 | Ga0495680_0008658 | |||
| 2653 | Ga0495680_0012421 | |||
| 2654 | Ga0495680_0029387 | |||
| 2655 | Ga0495687_013484 | |||
| 2656 | Ga0495675_0000010 | |||
| 2657 | Ga0495675_0000740 | |||
| 2658 | Ga0495675_0003665 | |||
| 2659 | Ga0495675_0003968 | |||
| 2660 | Ga0495675_0020780 | |||
| 2661 | Ga0495684_0000028 | |||
| 2662 | Ga0495684_0000133 | |||
| 2663 | Ga0495684_0007961 | |||
| 2664 | Ga0495684_0025738 | |||
| 2665 | Ga0495684_0036720 | |||
| 2666 | Ga0495686_0011217 | |||
| 2667 | Ga0495686_0017623 | |||
| 2668 | Ga0495593_0000108 | |||
| 2669 | Ga0495593_0006553 | |||
| 2670 | Ga0495593_0006602 | |||
| 2671 | Ga0495602_0000054 | |||
| 2672 | Ga0495602_0002218 | |||
| 2673 | Ga0495602_0013696 | |||
| 2674 | Ga0495602_0032943 | |||
| 2675 | Ga0495602_0033274 | |||
| 2676 | Ga0495602_0039514 | |||
| 2677 | Ga0495602_0072271 | |||
| 2678 | Ga0495626_0006198 | |||
| 2679 | Ga0496100_0000447 | |||
| 2680 | Ga0496100_0006283 | |||
| 2681 | Ga0496100_0024645 | |||
| 2682 | Ga0496101_0001349 | |||
| 2683 | Ga0496102_0002354 | |||
| 2684 | Ga0496102_0006835 | |||
| 2685 | Ga0496102_0014185 | |||
| 2686 | Ga0496102_0030385 | |||
| 2687 | Ga0496102_0104318 | |||
| 2688 | Ga0496103_0001066 | |||
| 2689 | Ga0496103_0005364 | |||
| 2690 | Ga0496103_0008597 | |||
| 2691 | Ga0496104_0000126 | |||
| 2692 | Ga0496104_0000752 | |||
| 2693 | Ga0496104_0007793 | |||
| 2694 | Ga0496104_0010461 | |||
| 2695 | Ga0496104_0015234 | |||
| 2696 | Ga0496104_0024677 | |||
| 2697 | Ga0496104_0131979 | |||
| 2698 | Ga0496105_0000117 | |||
| 2699 | Ga0496105_0002078 | |||
| 2700 | Ga0496105_0002637 | |||
| 2701 | Ga0496105_0010940 | |||
| 2702 | Ga0496105_0031489 | |||
| 2703 | Ga0496106_0001027 | |||
| 2704 | Ga0496106_0008822 | |||
| 2705 | Ga0496106_0024431 | |||
| 2706 | Ga0496106_0037327 | |||
| 2707 | Ga0496106_0081209 | |||
| 2708 | Ga0496107_0001211 | |||
| 2709 | Ga0496107_0002063 | |||
| 2710 | Ga0496107_0002318 | |||
| 2711 | Ga0496107_0009385 | |||
| 2712 | Ga0496107_0040449 | |||
| 2713 | Ga0496107_0045302 | |||
| 2714 | Ga0496107_0068845 | |||
| 2715 | Ga0496108_0000649 | |||
| 2716 | Ga0496108_0000847 | |||
| 2717 | Ga0496108_0006065 | |||
| 2718 | Ga0496108_0010226 | |||
| 2719 | Ga0496108_0019934 | |||
| 2720 | Ga0496108_0027547 | |||
| 2721 | Ga0496108_0122908 | |||
| 2722 | Ga0496108_0131082 | |||
| 2723 | Ga0496109_0000188 | |||
| 2724 | Ga0496109_0000739 | |||
| 2725 | Ga0496109_0004864 | |||
| 2726 | Ga0496109_0010096 | |||
| 2727 | Ga0496109_0017086 | |||
| 2728 | Ga0496109_0078092 | |||
| 2729 | Ga0496109_0117865 | |||
| 2730 | Ga0496110_0002115 | |||
| 2731 | Ga0496110_0005853 | |||
| 2732 | Ga0496110_0006025 | |||
| 2733 | Ga0496110_0006959 | |||
| 2734 | Ga0496110_0060429 | |||
| 2735 | Ga0496110_0104112 | |||
| 2736 | Ga0496111_0000976 | |||
| 2737 | Ga0496111_0011620 | |||
| 2738 | Ga0496111_0015450 | |||
| 2739 | Ga0496111_0016474 | |||
| 2740 | Ga0496111_0090151 | |||
| 2741 | Ga0496112_0000051 | |||
| 2742 | Ga0496112_0001001 | |||
| 2743 | Ga0496112_0001693 | |||
| 2744 | Ga0496112_0004717 | |||
| 2745 | Ga0496112_0008518 | |||
| 2746 | Ga0496112_0021534 | |||
| 2747 | Ga0496112_0197265 | |||
| 2748 | Ga0496113_0000309 | |||
| 2749 | Ga0496113_0004222 | |||
| 2750 | Ga0496113_0019954 | |||
| 2751 | Ga0496113_0020929 | |||
| 2752 | Ga0496113_0065648 | |||
| 2753 | Ga0496113_0087786 | |||
| 2754 | Ga0496113_0101638 | |||
| 2755 | Ga0496113_0120937 | |||
| 2756 | Ga0496114_0001734 | |||
| 2757 | Ga0496115_0000592 | |||
| 2758 | Ga0496115_0013668 | |||
| 2759 | Ga0496115_0029324 | |||
| 2760 | Ga0496115_0048466 | |||
| 2761 | Ga0496115_0049277 | |||
| 2762 | Ga0496116_0053797 | |||
| 2763 | Ga0496119_0002392 | |||
| 2764 | Ga0496119_0015482 | |||
| 2765 | Ga0496121_0000144 | |||
| 2766 | Ga0496121_0000596 | |||
| 2767 | Ga0496121_0004310 | |||
| 2768 | Ga0496121_0004660 | |||
| 2769 | Ga0496121_0017154 | |||
| 2770 | Ga0496121_0032832 | |||
| 2771 | Ga0496121_0039271 | |||
| 2772 | Ga0496122_0001783 | |||
| 2773 | Ga0496123_0008945 | |||
| 2774 | Ga0496124_0002408 | |||
| 2775 | Ga0496125_0000595 | |||
| 2776 | Ga0496125_0003506 | |||
| 2777 | Ga0496125_0005815 | |||
| 2778 | Ga0496125_0028181 | |||
| 2779 | Ga0496125_0046373 | |||
| 2780 | Ga0496125_0077724 | |||
| 2781 | Ga0496125_0081619 | |||
| 2782 | Ga0496126_0003899 | |||
| 2783 | Ga0496126_0007999 | |||
| 2784 | Ga0496126_0012837 | |||
| 2785 | Ga0496126_0021036 | |||
| 2786 | Ga0496126_0030316 | |||
| 2787 | Ga0496126_0052472 | |||
| 2788 | Ga0496126_0063799 | |||
| 2789 | Ga0501031_0000377 | |||
| 2790 | Ga0501031_0012135 | |||
| 2791 | Ga0501032_0000040 | |||
| 2792 | Ga0501032_0002502 | |||
| 2793 | Ga0501032_0003836 | |||
| 2794 | Ga0501032_0013306 | |||
| 2795 | Ga0501032_0078260 | |||
| 2796 | Ga0501033_0000128 | |||
| 2797 | Ga0501033_0001178 | |||
| 2798 | Ga0501033_0011352 | |||
| 2799 | Ga0501033_0021458 | |||
| 2800 | Ga0501033_0023415 | |||
| 2801 | Ga0501033_0024205 | |||
| 2802 | Ga0501033_0080366 | |||
| 2803 | Ga0501033_0095098 | |||
| 2804 | Ga0501034_0000113 | |||
| 2805 | Ga0501034_0000139 | |||
| 2806 | Ga0501034_0000734 | |||
| 2807 | Ga0501034_0008567 | |||
| 2808 | Ga0501034_0027285 | |||
| 2809 | Ga0501034_0040597 | |||
| 2810 | Ga0501034_0050837 | |||
| 2811 | Ga0501034_0091177 | |||
| 2812 | Ga0501034_0099947 | |||
| 2813 | Ga0501034_0172222 | |||
| 2814 | Ga0501036_0000281 | |||
| 2815 | Ga0501036_0001021 | |||
| 2816 | Ga0501036_0006538 | |||
| 2817 | Ga0501036_0013510 | |||
| 2818 | Ga0501036_0037511 | |||
| 2819 | Ga0501036_0085478 | |||
| 2820 | Ga0501036_0101222 | |||
| 2821 | Ga0501037_0000041 | |||
| 2822 | Ga0501037_0007235 | |||
| 2823 | Ga0501037_0010813 | |||
| 2824 | Ga0501037_0016247 | |||
| 2825 | Ga0501037_0029550 | |||
| 2826 | Ga0501037_0035491 | |||
| 2827 | Ga0501038_0000057 | |||
| 2828 | Ga0501038_0005284 | |||
| 2829 | Ga0501038_0011176 | |||
| 2830 | Ga0501038_0011832 | |||
| 2831 | Ga0501038_0035298 | |||
| 2832 | Ga0501038_0039580 | |||
| 2833 | Ga0501038_0040069 | |||
| 2834 | Ga0501038_0047168 | |||
| 2835 | Ga0501038_0084076 | |||
| 2836 | Ga0501039_0003963 | |||
| 2837 | Ga0501039_0009975 | |||
| 2838 | Ga0501039_0040950 | |||
| 2839 | Ga0501039_0072066 | |||
| 2840 | Ga0501040_0007238 | |||
| 2841 | Ga0501042_0011820 | |||
| 2842 | Ga0501043_0005571 | |||
| 2843 | Ga0501043_0006408 | |||
| 2844 | Ga0501043_0013603 | |||
| 2845 | Ga0501043_0045583 | |||
| 2846 | Ga0501043_0049660 | |||
| 2847 | Ga0501043_0129558 | |||
| 2848 | Ga0501046_0004620 | |||
| 2849 | Ga0501046_0004930 | |||
| 2850 | Ga0501046_0023744 | |||
| 2851 | Ga0501046_0030618 | |||
| 2852 | Ga0501046_0041485 | |||
| 2853 | Ga0501047_0000044 | |||
| 2854 | Ga0501047_0000316 | |||
| 2855 | Ga0501047_0014278 | |||
| 2856 | Ga0501047_0014677 | |||
| 2857 | Ga0501047_0023190 | |||
| 2858 | Ga0501047_0033027 | |||
| 2859 | Ga0501047_0034863 | |||
| 2860 | Ga0501047_0039892 | |||
| 2861 | Ga0501047_0046028 | |||
| 2862 | Ga0501047_0062559 | |||
| 2863 | Ga0501047_0160895 | |||
| 2864 | Ga0501048_0000117 | |||
| 2865 | Ga0501048_0000150 | |||
| 2866 | Ga0501048_0096172 | |||
| 2867 | Ga0501067_0000938 | |||
| 2868 | Ga0501067_0013575 | |||
| 2869 | Ga0501068_0002415 | |||
| 2870 | Ga0501068_0003582 | |||
| 2871 | Ga0501068_0003857 | |||
| 2872 | Ga0501068_0013654 | |||
| 2873 | Ga0501068_0037876 | |||
| 2874 | Ga0501069_0003718 | |||
| 2875 | Ga0501070_0007839 | |||
| 2876 | Ga0501070_0013553 | |||
| 2877 | Ga0501070_0020893 | |||
| 2878 | Ga0501070_0021944 | |||
| 2879 | Ga0501070_0063600 | |||
| 2880 | Ga0501071_0012138 | |||
| 2881 | Ga0501072_0000156 | |||
| 2882 | Ga0501072_0024705 | |||
| 2883 | Ga0501072_0030786 | |||
| 2884 | Ga0501073_0000669 | |||
| 2885 | Ga0501073_0001123 | |||
| 2886 | Ga0501073_0012453 | |||
| 2887 | Ga0501073_0055643 | |||
| 2888 | Ga0501073_0060632 | |||
| 2889 | Ga0501073_0076230 | |||
| 2890 | Ga0501074_0000035 | |||
| 2891 | Ga0501074_0004481 | |||
| 2892 | Ga0501074_0042702 | |||
| 2893 | Ga0501074_0045884 | |||
| 2894 | Ga0501075_0011391 | |||
| 2895 | Ga0501076_0033146 | |||
| 2896 | Ga0501077_0048355 | |||
| 2897 | Ga0501079_0006733 | |||
| 2898 | Ga0501079_0012752 | |||
| 2899 | Ga0501079_0054248 | |||
| 2900 | Ga0501079_0084001 | |||
| 2901 | Ga0501080_0001372 | |||
| 2902 | Ga0501080_0005918 | |||
| 2903 | Ga0501080_0008844 | |||
| 2904 | Ga0501080_0012618 | |||
| 2905 | Ga0501080_0016712 | |||
| 2906 | Ga0501080_0025835 | |||
| 2907 | Ga0501080_0047476 | |||
| 2908 | Ga0501080_0073288 | |||
| 2909 | Ga0501080_0147701 | |||
| 2910 | Ga0501080_0227707 | |||
| 2911 | Ga0501081_0130493 | |||
| 2912 | Ga0501083_0000641 | |||
| 2913 | Ga0501083_0002096 | |||
| 2914 | Ga0501083_0025692 | |||
| 2915 | Ga0501083_0056150 | |||
| 2916 | Ga0501035_0000128 | |||
| 2917 | Ga0501035_0001398 | |||
| 2918 | Ga0501035_0001896 | |||
| 2919 | Ga0501035_0003226 | |||
| 2920 | Ga0501035_0007549 | |||
| 2921 | Ga0501035_0065467 | |||
| 2922 | Ga0501035_0120991 | |||
| 2923 | Ga0501044_0000108 | |||
| 2924 | Ga0501044_0000144 | |||
| 2925 | Ga0501044_0004517 | |||
| 2926 | Ga0501044_0006423 | |||
| 2927 | Ga0501044_0006995 | |||
| 2928 | Ga0501044_0009598 | |||
| 2929 | Ga0501044_0015426 | |||
| 2930 | Ga0501044_0016058 | |||
| 2931 | Ga0501044_0084700 | |||
| 2932 | Ga0501044_0098447 | |||
| 2933 | Ga0501044_0122369 | |||
| 2934 | Ga0501045_0002782 | |||
| 2935 | nmdc:mga03n38_3068_c1 | |||
| 2936 | nmdc:mga00v17_34356_c1 | |||
| 2937 | nmdc:mga00v17_7005_c1 | |||
| 2938 | nmdc:mga0yw44_394_c1 | |||
| 2939 | nmdc:mga0yw44_53581_c1 | |||
| 2940 | nmdc:mga06z11_17712_c1 | |||
| 2941 | nmdc:mga06z11_2169_c1 | |||
| 2942 | nmdc:mga06z11_43367_c1 | |||
| 2943 | nmdc:mga04h51_4218_c1 | |||
| 2944 | nmdc:mga05p37_1114_c1 | |||
| 2945 | nmdc:mga05p37_12753_c1 | |||
| 2946 | nmdc:mga05p37_6040_c1 | |||
| 2947 | nmdc:mga05p37_6080_c1 | |||
| 2948 | nmdc:mga09592_1302_c1 | |||
| 2949 | nmdc:mga09592_2437_c1 | |||
| 2950 | nmdc:mga0qj67_276_c1 | |||
| 2951 | nmdc:mga0qj67_3495_c1 | |||
| 2952 | nmdc:mga0qj67_55_c1 | |||
| 2953 | nmdc:mga06r32_158737_c1 | |||
| 2954 | nmdc:mga06r32_3415_c1 | |||
| 2955 | nmdc:mga06r32_3728_c1 | |||
| 2956 | nmdc:mga06r32_51211_c1 | |||
| 2957 | nmdc:mga08y16_13103_c1 | |||
| 2958 | nmdc:mga08y16_189609_c1 | |||
| 2959 | nmdc:mga08y16_25960_c1 | |||
| 2960 | nmdc:mga08y16_3668_c1 | |||
| 2961 | nmdc:mga08y16_3857_c1 | |||
| 2962 | nmdc:mga08y16_3921_c1 | |||
| 2963 | nmdc:mga0n895_17357_c1 | |||
| 2964 | nmdc:mga0n895_3698_c1 | |||
| 2965 | nmdc:mga0n895_6170_c1 | |||
| 2966 | nmdc:mga0n895_651_c1 | |||
| 2967 | nmdc:mga0n895_682_c1 | |||
| 2968 | nmdc:mga0rr50_2190_c1 | |||
| 2969 | nmdc:mga0rr50_23079_c1 | |||
| 2970 | nmdc:mga0rr50_919_c1 | |||
| 2971 | nmdc:mga0a205_1012_c1 | |||
| 2972 | nmdc:mga0a205_1633_c1 | |||
| 2973 | nmdc:mga0a205_89051_c1 | |||
| 2974 | Ga0495601_0000008 | |||
| 2975 | Ga0495601_0000128 | |||
| 2976 | Ga0495601_0001082 | |||
| 2977 | Ga0495601_0003910 | |||
| 2978 | Ga0495601_0004226 | |||
| 2979 | Ga0495601_0005377 | |||
| 2980 | Ga0495601_0006799 | |||
| 2981 | Ga0495601_0021111 | |||
| 2982 | Ga0495601_0022129 | |||
| 2983 | Ga0495601_0030518 | |||
| 2984 | Ga0495601_0053187 | |||
| 2985 | Ga0495612_0000002 | |||
| 2986 | Ga0495612_0002018 | |||
| 2987 | Ga0495612_0002324 | |||
| 2988 | Ga0495612_0004821 | |||
| 2989 | Ga0495612_0028142 | |||
| 2990 | Ga0495612_0031191 | |||
| 2991 | Ga0500635_0000853 | |||
| 2992 | Ga0495655_0001385 | |||
| 2993 | Ga0495595_0000008 | |||
| 2994 | Ga0495595_0003217 | |||
| 2995 | Ga0495595_0004385 | |||
| 2996 | Ga0495595_0006145 | |||
| 2997 | Ga0495595_0014384 | |||
| 2998 | Ga0495619_0000002 | |||
| 2999 | Ga0495619_0000016 | |||
| 3000 | Ga0495619_0000231 | |||
| 3001 | Ga0495619_0000252 | |||
| 3002 | Ga0495619_0000406 | |||
| 3003 | Ga0495619_0000974 | |||
| 3004 | Ga0495619_0002852 | |||
| 3005 | Ga0495619_0010526 | |||
| 3006 | Ga0495619_0014426 | |||
| 3007 | Ga0495619_0031485 | |||
| 3008 | Ga0500643_000079 | |||
| 3009 | Ga0500643_003892 | |||
| 3010 | Ga0500644_0002084 | |||
| 3011 | Ga0500651_0010373 | |||
| 3012 | Ga0500566_0002184 | |||
| 3013 | Ga0500566_0002304 | |||
| 3014 | Ga0500641_0011471 | |||
| 3015 | Ga0500650_0026000 | |||
| 3016 | Ga0500555_014708 | |||
| 3017 | Ga0500555_016186 | |||
| 3018 | Ga0500556_0000005 | |||
| 3019 | Ga0500556_0000250 | |||
| 3020 | Ga0500556_0008341 | |||
| 3021 | Ga0500557_000100 | |||
| 3022 | Ga0500562_000167 | |||
| 3023 | Ga0500562_014811 | |||
| 3024 | Ga0500572_001778 | |||
| 3025 | Ga0500592_000696 | |||
| 3026 | Ga0500595_000010 | |||
| 3027 | Ga0500595_003306 | |||
| 3028 | Ga0500595_003815 | |||
| 3029 | Ga0500595_004235 | |||
| 3030 | Ga0500595_006137 | |||
| 3031 | Ga0500595_022046 | |||
| 3032 | Ga0500608_000199 | |||
| 3033 | Ga0500608_000330 | |||
| 3034 | Ga0500642_0000009 | |||
| 3035 | Ga0500642_0000562 | |||
| 3036 | Ga0500642_0039030 | |||
| 3037 | Ga0500559_0000696 | |||
| 3038 | Ga0500559_0001190 | |||
| 3039 | Ga0500573_0013027 | |||
| 3040 | Ga0500586_000887 | |||
| 3041 | Ga0500616_0000001 | |||
| 3042 | Ga0500616_0000035 | |||
| 3043 | Ga0500616_0000038 | |||
| 3044 | Ga0500616_0024308 | |||
| 3045 | Ga0500620_001131 | |||
| 3046 | Ga0500622_0003335 | |||
| 3047 | Ga0500638_001356 | |||
| 3048 | Ga0500639_029084 | |||
| 3049 | Ga0500636_0000407 | |||
| 3050 | Ga0500636_0004693 | |||
| 3051 | Ga0500637_0000366 | |||
| 3052 | Ga0500576_024767 | |||
| 3053 | Ga0500645_002629 | |||
| 3054 | Ga0500599_002488 | |||
| 3055 | Ga0501084_0002007 | |||
| 3056 | Ga0501084_0011232 | |||
| 3057 | Ga0500661_004901 | |||
| 3058 | Ga0501082_0000002 | |||
| 3059 | Ga0501082_0002249 | |||
| 3060 | Ga0501082_0014678 | |||
| 3061 | Ga0501082_0050425 | |||
| 3062 | Ga0501082_0058902 | |||
| 3063 | Ga0501082_0062334 | |||
| 3064 | Ga0501082_0120978 | |||
| 3065 | Ga0466962_0031646 | |||
| 3066 | 2507504659 | |||
| 3067 | 2508539620 | |||
| 3068 | 2508694936 | |||
| 3069 | 2508727710 | |||
| 3070 | 2509077605 | |||
| 3071 | 2509149897 | |||
| 3072 | 2513590572 | |||
| 3073 | 2513627007 | |||
| 3074 | 2513638542 | |||
| 3075 | 2513653109 | |||
| 3076 | 2513658971 | |||
| 3077 | 2513698962 | |||
| 3078 | 2513699150 | |||
| 3079 | 2513714858 | |||
| 3080 | 2513863890 | |||
| 3081 | 2513875656 | |||
| 3082 | 2513889635 | |||
| 3083 | 2513921235 | |||
| 3084 | 2514016324 | |||
| 3085 | 2515624125 | |||
| 3086 | 2517105836 | |||
| 3087 | 2517889334 | |||
| 3088 | 2524438627 | |||
| 3089 | 2524540382 | |||
| 3090 | 2528851479 | |||
| 3091 | 2603857933 | |||
| 3092 | 2617347489 | |||
| 3093 | 2617377108 | |||
| 3094 | 2643758733 | |||
| 3095 | 2644290592 | |||
| 3096 | 2671121381 | |||
| 3097 | 2715501514 | |||
| 3098 | 2723849158 | |||
| 3099 | 2728754266 | |||
| 3100 | 2739792036 | |||
| 3101 | 2745077656 | |||
| 3102 | 2774869106 | |||
| 3103 | 2776258439 | |||
| 3104 | 2793063267 | |||
| 3105 | 2793070999 | |||
| 3106 | 2793078485 | |||
| 3107 | 2805919332 | |||
| 3108 | 2818243395 | |||
| 3109 | 2824622538 | |||
| 3110 | 2824633899 | |||
| 3111 | 2824674711 | |||
| 3112 | 2824684144 | |||
| 3113 | 2824752539 | |||
| 3114 | 2824770620 | |||
| 3115 | 2824780169 | |||
| 3116 | 2828309284 | |||
| 3117 | 2835319702 | |||
| 3118 | 2838130268 | |||
| 3119 | 2840882151 | |||
| 3120 | 2841944289 | |||
| 3121 | 2841954534 | |||
| 3122 | 2841963417 | |||
| 3123 | 2841969066 | |||
| 3124 | 2841979840 | |||
| 3125 | 2841989562 | |||
| 3126 | 2842044067 | |||
| 3127 | 2842051944 | |||
| 3128 | 2844316036 | |||
| 3129 | 2847931523 | |||
| 3130 | 2847941583 | |||
| 3131 | 2849082506 | |||
| 3132 | 2854682524 | |||
| 3133 | 2857515803 | |||
| 3134 | 2857527308 | |||
| 3135 | 2874593152 | |||
| 3136 | 2874606904 | |||
| 3137 | 2874620262 | |||
| 3138 | 2874634319 | |||
| 3139 | 2874645726 | |||
| 3140 | 2876763384 | |||
| 3141 | 2876773192 | |||
| 3142 | 2876810693 | |||
| 3143 | 2876820499 | |||
| 3144 | 2879076862 | |||
| 3145 | 2879091353 | |||
| 3146 | 2879100198 | |||
| 3147 | 2879112586 | |||
| 3148 | 2879131049 | |||
| 3149 | 2879150256 | |||
| 3150 | 2881364926 | |||
| 3151 | 2881673181 | |||
| 3152 | 2882461321 | |||
| 3153 | 2883579066 | |||
| 3154 | 2884301165 | |||
| 3155 | 2885368169 | |||
| 3156 | 2885377768 | |||
| 3157 | 2885413754 | |||
| 3158 | 2888378828 | |||
| 3159 | 2888391194 | |||
| 3160 | 2888427253 | |||
| 3161 | 2889036148 | |||
| 3162 | 2893071848 | |||
| 3163 | 2894242173 | |||
| 3164 | 2898796745 | |||
| 3165 | 2899261333 | |||
| 3166 | 2903729568 | |||
| 3167 | 2903752982 | |||
| 3168 | 2904692460 | |||
| 3169 | 2904709209 | |||
| 3170 | 2904719866 | |||
| 3171 | 2906606073 | |||
| 3172 | 2906613186 | |||
| 3173 | 2906635069 | |||
| 3174 | 2906645643 | |||
| 3175 | 2906668658 | |||
| 3176 | 2908747943 | |||
| 3177 | 2908764386 | |||
| 3178 | 2908783020 | |||
| 3179 | 2919078424 | |||
| 3180 | 2919454756 | |||
| 3181 | 2919679194 | |||
| 3182 | 2922364526 | |||
| 3183 | 2922378532 | |||
| 3184 | 2922400950 | |||
| 3185 | 2922433685 | |||
| 3186 | 2929623662 | |||
| 3187 | 2929632870 | |||
| 3188 | 2932786153 | |||
| 3189 | 2932799521 | |||
| 3190 | 2932805173 | |||
| 3191 | 2932816886 | |||
| 3192 | 2932826026 | |||
| 3193 | 2932829416 | |||
| 3194 | 2933585565 | |||
| 3195 | 2935615149 | |||
| 3196 | 2935617849 | |||
| 3197 | 2935634729 | |||
| 3198 | 2935647822 | |||
| 3199 | 2935651494 | |||
| 3200 | 2935659738 | |||
| 3201 | 2935674765 | |||
| 3202 | 2935678127 | |||
| 3203 | 2935692415 | |||
| 3204 | 2935699367 | |||
| 3205 | 2935707098 | |||
| 3206 | 2935721033 | |||
| 3207 | 2935722858 | |||
| 3208 | 2935739722 | |||
| 3209 | 2935748760 | |||
| 3210 | 2935758630 | |||
| 3211 | 2935764610 | |||
| 3212 | 2935775507 | |||
| 3213 | 2935790003 | |||
| 3214 | 2935798432 | |||
| 3215 | 2935806660 | |||
| 3216 | 2935819079 | |||
| 3217 | 2935825814 | |||
| 3218 | 2935837306 | |||
| 3219 | 2935842007 | |||
| 3220 | 2935851433 | |||
| 3221 | 2935856652 | |||
| 3222 | 2935872940 | |||
| 3223 | 2935874383 | |||
| 3224 | 2935887737 | |||
| 3225 | 2935910540 | |||
| 3226 | 2935918056 | |||
| 3227 | 2935927549 | |||
| 3228 | 2935936579 | |||
| 3229 | 2935943868 | |||
| 3230 | 2935952305 | |||
| 3231 | 2935967315 | |||
| 3232 | 2935969145 | |||
| 3233 | 2935982317 | |||
| 3234 | 2935984596 | |||
| 3235 | 2936001097 | |||
| 3236 | 2936010751 | |||
| 3237 | 2936014154 | |||
| 3238 | 2936022937 | |||
| 3239 | 2936031073 | |||
| 3240 | 2936045770 | |||
| 3241 | 2936049195 | |||
| 3242 | 2936055641 | |||
| 3243 | 2940564780 | |||
| 3244 | 2941511941 | |||
| 3245 | 2941519643 | |||
| 3246 | 2941527665 | |||
| 3247 | 2941535897 | |||
| 3248 | 2941547058 | |||
| 3249 | 3000019575 | |||
| 3250 | 3000405688 | |||
| 3251 | 3005483340 | |||
| 3252 | 3005490497 | |||
| 3253 | 3005509709 | |||
| 3254 | 3005591200 | |||
| 3255 | 3005595628 | |||
| 3256 | 3005711619 | |||
| 3257 | 3005718869 | |||
| 3258 | 8001850365 | |||
| 3259 | 8006930317 | |||
| 3260 | 8006935716 | |||
| 3261 | 8006967698 | |||
| 3262 | 8006975637 | |||
| 3263 | 8006992647 | |||
| 3264 | 8006998366 | |||
| 3265 | 8016518819 | |||
| 3266 | 8016525626 | |||
| 3267 | 8016539219 | |||
| 3268 | 8016549787 | |||
| 3269 | 8016558201 | |||
| 3270 | 8016568909 | |||
| 3271 | 8016581557 | |||
| 3272 | 8016587087 | |||
| 3273 | 8016596201 | |||
| 3274 | 8016607104 | |||
| 3275 | 8016619002 | |||
| 3276 | 8016630583 | |||
| 3277 | 8016636507 | |||
| 3278 | 8019549536 | |||
| 3279 | 8019563075 | |||
| 3280 | 8019573156 | |||
| 3281 | 8019577866 | |||
| 3282 | 8019595969 | |||
| 3283 | 8019605787 | |||
| 3284 | 8019623481 | |||
| 3285 | 8019638661 | |||
| 3286 | 8019641077 | |||
| 3287 | 8019653180 | |||
| 3288 | 8019666462 | |||
| 3289 | 8019679861 | |||
| 3290 | 8019696897 | |||
| 3291 | 8045866173 | |||
| 3292 | 8055750831 | |||
| 3293 | 8056678404 | |||
| 3294 | 8056694081 | |||
| 3295 | 8056970655 | |||
| 3296 | 8057136868 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1njf-assembly4.cif.gz_D | nucleotide bound form of an isolated e. coli clamp loader gamma subunit | 0.8668 | 24 | 267 |
| 1njf-assembly4.cif.gz_D | nucleotide bound form of an isolated e. coli clamp loader gamma subunit | 0.8602 | 24 | 267 |
| 3glg-assembly2.cif.gz_H | crystal structure of a mutant (gammat157a) e. coli clamp loader bound to primer-template dna | 0.8484 | 23 | 383 |
| 3glg-assembly2.cif.gz_H | crystal structure of a mutant (gammat157a) e. coli clamp loader bound to primer-template dna | 0.821 | 23 | 383 |
| 1sxj-assembly1.cif.gz_B | crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna) | 0.8119 | 29 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54BN3_188_243_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9763 | 204 | 251 | 1.10.8.60 |
| 1njfD02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9758 | 204 | 267 | 1.10.8.60 |
| 1njfB02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9754 | 204 | 266 | 1.10.8.60 |
| 1njgA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9689 | 204 | 267 | 1.10.8.60 |
| 1jr3A03 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9676 | 204 | 265 | 1.10.8.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527GZE9-F1-model_v4 | DNA polymerase III subunit gamma/tau (EC 2.7.7.7) | 0.979 | 27 | 197 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 |
| AF-A0A3C1BVL6-F1-model_v4 | DNA polymerase III subunit gamma/tau | 0.9737 | 118 | 204 |
GO:0006261
|
| AF-A0A527GZE9-F1-model_v4 | DNA polymerase III subunit gamma/tau (EC 2.7.7.7) | 0.9734 | 27 | 197 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 |
| AF-A0A3D2EAB2-F1-model_v4 | deleted | 0.9502 | 93 | 238 |
|
| AF-A0A3C1BVL6-F1-model_v4 | DNA polymerase III subunit gamma/tau | 0.9419 | 118 | 204 |
GO:0006261
|