metagRoot

F495196

General Info

Members	Datasets	Scaffolds	Average Seq Length
1648	962	3296	325

Family's Representative Sequence

Representative Sequence	3300039453\|Ga0436362_0413279\|Ga0436362_0413279_2592_3674
Length	360
Sequence	MITSFRGAQSANPEPRDSGLDAAHRPGMTGGNPMPIPKHVFDPPFNIIRCSHAVLDVTDLKLSREFYETTVGLHVEDADDSAVYLRASEEHQHHSLVLRRADVAACNRLGFKVGNDSDLDKAAAFFSENGIPYAFAEQPFQGRTLHFTDPFGYRIELYARMDKRPHLLRRYDLYKGCHPQRLDHFNVFAAEVQDTMDFYVRLGFRLTEYAEEDGPNGRIAAAWLHRKGNVHDFALTNGKGPRLHHVAYWTPTAMNIIHLCDVMASSGYLKNIERGPGRHGISNAFFLYIRDPDGHRLELYTSDYFTGDHDHEPLRWSLRDPRRQTLWGAPAPRSWFEQGSPFTGQQVREPQFVADVTVAD

Samples

	Sample ID	Description	Type	Environment
1	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
2	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
3	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
4	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
5	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
6	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
7	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
8	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
9	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
10	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
11	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
12	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
13	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
14	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
15	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
16	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
17	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
18	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
19	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
20	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
21	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
22	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
23	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
24	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
25	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
26	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
27	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
28	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
29	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
30	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
31	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
32	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
33	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
34	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
35	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
36	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
37	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
41	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
42	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
43	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
44	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
45	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
46	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
47	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
48	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
49	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
50	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
51	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
52	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
53	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
54	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
55	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
56	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
57	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
58	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
59	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
60	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
61	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
62	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
63	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
64	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
65	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
66	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
67	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
68	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
69	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
70	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
71	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
72	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
73	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
74	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
75	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
76	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
77	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
78	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
79	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
80	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
81	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
82	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
83	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
84	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
85	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
87	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
88	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
89	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
90	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
91	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
92	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
94	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
95	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
96	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
97	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
98	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
99	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
100	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
101	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
102	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
103	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
104	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
105	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
106	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
107	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
108	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
109	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
110	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
111	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
112	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
113	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
114	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
115	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
116	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
117	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
118	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
119	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
120	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
121	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
122	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
123	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
124	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
125	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
126	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
127	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
128	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
129	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
130	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
131	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
132	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
136	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
137	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
140	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
142	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
144	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
148	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
151	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
152	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
208	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
209	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
210	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
211	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
214	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
218	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
219	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
220	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
221	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
222	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
223	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
224	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
225	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
226	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
227	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
228	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
229	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
230	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
231	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
232	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
233	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
234	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
235	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
236	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
237	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
238	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
239	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
240	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
241	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
242	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
243	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
244	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
245	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
246	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
247	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
248	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
249	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
250	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
251	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
252	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
253	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
254	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
255	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
256	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
257	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
258	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
259	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
260	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
261	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
262	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
263	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
264	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
265	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
266	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
267	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
268	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
269	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
270	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
271	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
272	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
273	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
274	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
275	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
276	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
277	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
278	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
279	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
280	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
281	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
282	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
283	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
284	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
285	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
286	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
287	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
288	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
289	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
290	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
291	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
292	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
293	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
294	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
295	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
296	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
297	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
298	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
299	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
300	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
301	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
302	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
303	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
304	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
305	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
306	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
307	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
308	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
309	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
310	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
311	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
312	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
313	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
314	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
315	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
316	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
317	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
318	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
319	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
320	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
321	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
322	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
323	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
324	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
325	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
326	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
327	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
328	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
329	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
330	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
331	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
332	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
333	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
334	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
335	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
336	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
337	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
338	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
339	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
340	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
341	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
342	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
343	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
344	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
345	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
346	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
347	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
348	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
349	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
350	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
351	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
352	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
353	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
354	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
355	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
356	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
357	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
358	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
359	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
360	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
361	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
362	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
363	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
364	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
365	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
366	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
367	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
368	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
369	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
370	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
371	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
372	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
373	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
374	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
375	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
376	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
377	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
378	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
379	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
380	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
381	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
382	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
383	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
384	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
385	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
386	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
387	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
388	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
389	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
390	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
391	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
392	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
393	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
394	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
395	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
396	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
397	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
398	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
399	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
400	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
401	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
402	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
403	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
404	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
405	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
406	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
407	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
408	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
409	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
410	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
411	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
412	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
413	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
414	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
415	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
416	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
417	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
418	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
419	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
420	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
421	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
422	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
423	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
424	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
425	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
426	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
427	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
428	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
429	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
430	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
431	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
432	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
433	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
434	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
435	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
436	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
437	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
438	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
439	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
440	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
441	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
442	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
443	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
444	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
445	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
446	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
447	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
448	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
449	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
450	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
451	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
452	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
453	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
454	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
455	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
456	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
457	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
458	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
459	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
460	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
461	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
462	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
463	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
464	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
465	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
466	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
467	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
468	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
469	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
470	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
471	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
472	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
473	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
474	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
475	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
476	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
477	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
478	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
479	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
480	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
481	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
482	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
483	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
484	2512875024
485	2513237090	Mesorhizobium sp. WSM3224	Isolate	Nodule
486	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
487	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
488	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
489	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
490	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
491	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
492	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
493	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
494	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
495	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
496	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
497	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
498	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
499	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
500	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
501	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
502	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
503	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
504	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
505	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
506	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
507	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
508	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
509	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
510	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
511	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
512	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
513	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
514	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
515	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
516	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
517	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
518	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
519	2599185301	Mesorhizobium sp. NFR06	Isolate	Rhizoplane
520	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
521	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
522	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
523	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
524	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
525	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
526	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
527	2643221557	Ensifer sp. Root558	Isolate	Unclassified
528	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
529	2643221610	Ensifer sp. Root74	Isolate	Unclassified
530	2643221618	Ensifer sp. Root231	Isolate	Unclassified
531	2643221626	Ensifer sp. Root31	Isolate	Unclassified
532	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
533	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
534	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
535	2643221659	Ensifer sp. Root127	Isolate	Unclassified
536	2643221668	Ensifer sp. Root423	Isolate	Unclassified
537	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
538	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
539	2643221698	Ensifer sp. Root142	Isolate	Unclassified
540	2643221712	Ensifer sp. Root258	Isolate	Unclassified
541	2643221723	Ensifer sp. Root278	Isolate	Unclassified
542	2643221726	Ensifer sp. Root954	Isolate	Unclassified
543	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
544	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
545	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
546	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
547	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
548	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
549	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
550	2718217927	Rhizobium sp. N324	Isolate	Nodule
551	2718218423	Rhizobium sp. N941	Isolate	Nodule
552	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
553	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
554	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
555	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
556	2721755809	Rhizobium sp. N541	Isolate	Nodule
557	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
558	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
559	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
560	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
561	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
562	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
563	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
564	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
565	2791355199
566	2791355261	Rhizobium sp. J15	Isolate	Nodule
567	2791355263	Rhizobium chutanense C5	Isolate	Nodule
568	2791355266	Rhizobium sp. L43	Isolate	Nodule
569	2791355267	Rhizobium sp. L18	Isolate	Nodule
570	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
571	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
572	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
573	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
574	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
575	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
576	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
577	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
578	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
579	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
580	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
581	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
582	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
583	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
584	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
585	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
586	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
587	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
588	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
589	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
590	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
591	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
592	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
593	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
594	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
595	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
596	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
597	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
598	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
599	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
600	2841760612	Bosea sp. Tri-49	Isolate	Nodule
601	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
602	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
603	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
604	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
605	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
606	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
607	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
608	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
609	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
610	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
611	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
612	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
613	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
614	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
615	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
616	2844104063	Bosea sp. Tri-39	Isolate	Nodule
617	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
618	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
619	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
620	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
621	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
622	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
623	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
624	2851182111	Bosea sp. Tri-44	Isolate	Nodule
625	2851246043	Bosea sp. Tri-54	Isolate	Nodule
626	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
627	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
628	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
629	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
630	2856364286	Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1	Isolate	Nodule
631	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
632	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
633	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
634	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
635	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
636	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
637	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
638	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
639	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
640	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
641	2869285874	Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1	Isolate	Nodule
642	2871429161	Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1	Isolate	Nodule
643	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
644	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
645	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
646	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
647	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
648	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
649	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
650	2874146452	Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1	Isolate	Nodule
651	2874155637	Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1	Isolate	Nodule
652	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
653	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
654	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
655	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
656	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
657	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
658	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
659	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
660	2876369609	Mesorhizobium sp. USDA-HM6	Isolate	Unclassified
661	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
662	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
663	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
664	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
665	2876413966	Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1	Isolate	Nodule
666	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
667	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
668	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
669	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
670	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
671	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
672	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
673	2878745973	Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1	Isolate	Nodule
674	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
675	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
676	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
677	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
678	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
679	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
680	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
681	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
682	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
683	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
684	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
685	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
686	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
687	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
688	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
689	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
690	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
691	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
692	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
693	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
694	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
695	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
696	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
697	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
698	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
699	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
700	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
701	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
702	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
703	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
704	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
705	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
706	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
707	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
708	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
709	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
710	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
711	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
712	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
713	2904699407
714	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
715	2906308376	Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1	Isolate	Nodule
716	2906321335	Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1	Isolate	Nodule
717	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
718	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
719	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
720	2906427513	Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1	Isolate	Nodule
721	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
722	2906610324
723	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
724	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
725	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
726	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
727	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
728	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
729	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
730	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
731	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
732	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
733	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
734	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
735	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
736	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
737	2922368715
738	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
739	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
740	2922425934
741	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
742	2924718760	Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1	Isolate	Nodule
743	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
744	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
745	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
746	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
747	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
748	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
749	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
750	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
751	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
752	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
753	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
754	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
755	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
756	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
757	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
758	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
759	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
760	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
761	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
762	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
763	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
764	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
765	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
766	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
767	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
768	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
769	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
770	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
771	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
772	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
773	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
774	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
775	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
776	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
777	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
778	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
779	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
780	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
781	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
782	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
783	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
784	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
785	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
786	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
787	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
788	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
789	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
790	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
791	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
792	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
793	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
794	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
795	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
796	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
797	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
798	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
799	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
800	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
801	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
802	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
803	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
804	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
805	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
806	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
807	2937813078	Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1	Isolate	Nodule
808	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
809	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
810	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
811	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
812	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
813	2937980651	Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1	Isolate	Nodule
814	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
815	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
816	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
817	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
818	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
819	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
820	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
821	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
822	2952252522	Salinicola sp. DM10	Isolate	Unclassified
823	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
824	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
825	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
826	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
827	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
828	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
829	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
830	2958130278	Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1	Isolate	Nodule
831	2958137437	Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1	Isolate	Nodule
832	2958144490	Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1	Isolate	Nodule
833	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
834	2958179912	Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1	Isolate	Nodule
835	2961077736	Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1	Isolate	Nodule
836	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
837	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
838	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
839	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
840	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
841	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
842	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
843	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
844	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
845	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
846	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
847	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
848	2968117919	Mesorhizobium atlanticum CNPSo 3140	Isolate	Unclassified
849	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
850	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
851	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
852	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
853	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
854	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
855	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
856	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
857	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
858	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
859	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
860	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
861	2977843712	Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1	Isolate	Nodule
862	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
863	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
864	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
865	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
866	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
867	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
868	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
869	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
870	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
871	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
872	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
873	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
874	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
875	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
876	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
877	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
878	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
879	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
880	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
881	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
882	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
883	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
884	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
885	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
886	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
887	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
888	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
889	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
890	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
891	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
892	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
893	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
894	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
895	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
896	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
897	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
898	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
899	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
900	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
901	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
902	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
903	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
904	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
905	8004387939	Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1	Isolate	Nodule
906	8004640170	Mesorhizobium sp. GbtcB19	Isolate	Unclassified
907	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
908	8004714634	Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1	Isolate	Nodule
909	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
910	8005258706	Rhizobium sp. R693	Isolate	Nodule
911	8005275841	Rhizobium sp. N4311	Isolate	Nodule
912	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
913	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
914	8005382845	Rhizobium sp. R634	Isolate	Nodule
915	8005395548	Rhizobium sp. R339	Isolate	Nodule
916	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
917	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
918	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
919	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
920	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
921	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
922	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
923	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
924	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
925	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
926	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
927	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
928	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
929	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
930	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
931	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
932	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
933	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
934	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
935	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
936	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
937	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
938	8018176218	Rhizobium sp. N122	Isolate	Nodule
939	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
940	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
941	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
942	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
943	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
944	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
945	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
946	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
947	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
948	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
949	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
950	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
951	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
952	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
953	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
954	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
955	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
956	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
957	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
958	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
959	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
960	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule
961	8057160832	Larsenimonas rhizosphaerae GH2-1	Isolate	Rhizosphere
962	8057529695	Bosea vestrisii A18/4-2	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	70.05
Metatranscriptomes	0
Isolates	29.95

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.71
Nodule	24.03
Rhizoplane	4.79
Rhizosphere	45.39
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0436362_0413279	3300039453	Bacteria	4306
2	JGI24740J21852_10008285	3300001979	Bacteria	4151
3	JGI25155J39150_1000046	3300002704	Bacteria	80685
4	JGI25156J39149_1000070	3300002705	Bacteria	80840
5	JGI25156J39149_1009007	3300002705	Bacteria	2461
6	JGI25162J39368_1000247	3300002737	Bacteria	54064
7	JGI25162J39368_1000735	3300002737	Bacteria	22503
8	JGI25154J39366_1000092	3300002738	Bacteria	80685
9	JGI25157J39369_1000087	3300002741	Bacteria	80840
10	JGI25157J39369_1000175	3300002741	Bacteria	54070
11	JGI25159J45721_1000030	3300002987	Bacteria	102429
12	JGI25151J46595_10048693	3300003187	Bacteria	1462
13	JGI25406J46586_10000214	3300003203	Bacteria	25609
14	JGI25165J46597_1000020	3300003214	Bacteria	370477
15	JGI25165J46597_1000237	3300003214	Bacteria	75663
16	JGI25165J46597_1000412	3300003214	Bacteria	44966
17	JGI25165J46597_1005141	3300003214	Bacteria	2592
18	JGI25153J46596_10000151	3300003215	Bacteria	70139
19	JGI25153J46596_10003908	3300003215	Bacteria	8174
20	JGI25153J46596_10005616	3300003215	Bacteria	6556
21	JGI25160J50197_1000075	3300003354	Bacteria	102429
22	JGI25160J50197_1003595	3300003354	Bacteria	6881
23	JGI25160J50197_1024708	3300003354	Bacteria	1699
24	JGI25160J50197_1025086	3300003354	Bacteria	1676
25	JGI25161J50226_1000316	3300003374	Bacteria	26515
26	JGI25404J52841_10002699	3300003659	Bacteria	3396
27	Ga0055539_1008676	3300003752	Bacteria	1269
28	Ga0055542_1000841	3300003762	Bacteria	21767
29	Ga0055529_1007252	3300003763	Bacteria	1515
30	Ga0055526_1005688	3300003771	Bacteria	7073
31	Ga0055526_1029564	3300003771	Bacteria	1623
32	Ga0055524_1000960	3300003775	Bacteria	18186
33	Ga0055536_1003695	3300003781	Bacteria	8124
34	Ga0055540_1000131	3300003792	Bacteria	75615
35	Ga0055531_10014237	3300003794	Bacteria	3599
36	Ga0055543_1003338	3300004625	Bacteria	4791
37	Ga0065165_1000048	3300005262	Bacteria	196539
38	Ga0065165_1000206	3300005262	Bacteria	102467
39	Ga0065165_1000582	3300005262	Bacteria	53862
40	Ga0065165_1002074	3300005262	Bacteria	18412
41	Ga0065165_1002220	3300005262	Bacteria	17337
42	Ga0065165_1005485	3300005262	Bacteria	7101
43	Ga0065712_10099907	3300005290	Bacteria	2077
44	Ga0070683_100052860	3300005329	Bacteria	3764
45	Ga0070690_100103442	3300005330	Bacteria	1891
46	Ga0070690_100212356	3300005330	Bacteria	1352
47	Ga0068869_100129353	3300005334	Bacteria	1939
48	Ga0070680_100052018	3300005336	Bacteria	3343
49	Ga0070680_100075104	3300005336	Bacteria	2782
50	Ga0070680_100131570	3300005336	Bacteria	2094
51	Ga0070682_100409483	3300005337	Bacteria	1028
52	Ga0070660_100051646	3300005339	Bacteria	3167
53	Ga0070660_100206106	3300005339	Bacteria	1596
54	Ga0070661_100232344	3300005344	Bacteria	1418
55	Ga0070668_100151197	3300005347	Bacteria	1877
56	Ga0070671_100068387	3300005355	Bacteria	2962
57	Ga0070674_100027518	3300005356	Bacteria	3727
58	Ga0070674_100086602	3300005356	Bacteria	2250
59	Ga0070674_100201329	3300005356	Bacteria	1538
60	Ga0070688_100060270	3300005365	Bacteria	2396
61	Ga0070659_100012688	3300005366	Bacteria	6251
62	Ga0070659_100053918	3300005366	Bacteria	3166
63	Ga0070667_100188613	3300005367	Bacteria	1826
64	Ga0070709_10000203	3300005434	Bacteria	38151
65	Ga0070709_10004227	3300005434	Bacteria	7743
66	Ga0070709_10004390	3300005434	Bacteria	7605
67	Ga0070709_10065310	3300005434	Bacteria	2330
68	Ga0070714_100065966	3300005435	Bacteria	3119
69	Ga0070714_100149564	3300005435	Bacteria	2103
70	Ga0070713_100001761	3300005436	Bacteria	13967
71	Ga0070713_100010384	3300005436	Bacteria	6727
72	Ga0070713_100016592	3300005436	Bacteria	5539
73	Ga0070713_100183503	3300005436	Bacteria	1881
74	Ga0070710_10002045	3300005437	Bacteria	9560
75	Ga0070711_100001730	3300005439	Bacteria	12117
76	Ga0070711_100006659	3300005439	Bacteria	6985
77	Ga0070711_100011938	3300005439	Bacteria	5407
78	Ga0070711_100014917	3300005439	Bacteria	4908
79	Ga0070711_100019115	3300005439	Bacteria	4390
80	Ga0070708_100109740	3300005445	Bacteria	2535
81	Ga0070663_100076740	3300005455	Bacteria	2444
82	Ga0070662_100365092	3300005457	Bacteria	1185
83	Ga0070681_10003273	3300005458	Bacteria	15113
84	Ga0070681_10025087	3300005458	Bacteria	6000
85	Ga0070681_10065024	3300005458	Bacteria	3617
86	Ga0070706_100156571	3300005467	Bacteria	2127
87	Ga0070707_100176291	3300005468	Bacteria	2084
88	Ga0070679_100017482	3300005530	Bacteria	6941
89	Ga0070679_100024100	3300005530	Bacteria	5962
90	Ga0070679_100174677	3300005530	Bacteria	2121
91	Ga0070684_100013567	3300005535	Bacteria	6575
92	Ga0070684_100089906	3300005535	Bacteria	2729
93	Ga0070684_100094373	3300005535	Bacteria	2665
94	Ga0070684_100285812	3300005535	Bacteria	1512
95	Ga0070697_100106656	3300005536	Bacteria	2331
96	Ga0068853_100009540	3300005539	Bacteria	7820
97	Ga0068853_100040363	3300005539	Bacteria	3982
98	Ga0068853_100416381	3300005539	Bacteria	1259
99	Ga0070665_100014994	3300005548	Bacteria	7779
100	Ga0070665_100552780	3300005548	Bacteria	1163
101	Ga0068855_100018899	3300005563	Bacteria	8282
102	Ga0068855_100067952	3300005563	Bacteria	4150
103	Ga0068855_100114327	3300005563	Bacteria	3095
104	Ga0068855_100151551	3300005563	Bacteria	2636
105	Ga0068855_100184319	3300005563	Bacteria	2359
106	Ga0068855_100386568	3300005563	Bacteria	1536
107	Ga0068855_100419655	3300005563	Bacteria	1464
108	Ga0068855_100480299	3300005563	Bacteria	1353
109	Ga0070664_100283719	3300005564	Bacteria	1494
110	Ga0068857_100016047	3300005577	Bacteria	6562
111	Ga0068854_100192480	3300005578	Bacteria	1599
112	Ga0068854_100207275	3300005578	Bacteria	1544
113	Ga0068856_100003888	3300005614	Bacteria	14981
114	Ga0068856_100055216	3300005614	Bacteria	3919
115	Ga0068856_100068625	3300005614	Bacteria	3505
116	Ga0068856_100230817	3300005614	Bacteria	1866
117	Ga0070702_100045764	3300005615	Bacteria	2477
118	Ga0068852_100011984	3300005616	Bacteria	6558
119	Ga0068852_100032466	3300005616	Bacteria	4323
120	Ga0068852_100213007	3300005616	Bacteria	1834
121	Ga0068859_100160460	3300005617	Bacteria	2327
122	Ga0068859_100163980	3300005617	Bacteria	2301
123	Ga0068864_100384391	3300005618	Bacteria	1331
124	Ga0068864_100544067	3300005618	Bacteria	1121
125	Ga0068851_10004825	3300005834	Bacteria	6103
126	Ga0068863_100315590	3300005841	Bacteria	1518
127	Ga0068858_100228037	3300005842	Bacteria	1765
128	Ga0068860_100000081	3300005843	Bacteria	170066
129	Ga0068860_100081543	3300005843	Bacteria	3076
130	Ga0068860_100100065	3300005843	Bacteria	2765
131	Ga0068860_100134124	3300005843	Bacteria	2377
132	Ga0068862_100103763	3300005844	Bacteria	2490
133	Ga0068862_100213910	3300005844	Bacteria	1742
134	Ga0081455_10001734	3300005937	Bacteria	26379
135	Ga0081455_10013417	3300005937	Bacteria	8100
136	Ga0081455_10015026	3300005937	Bacteria	7541
137	Ga0081455_10028177	3300005937	Bacteria	5135
138	Ga0081455_10056973	3300005937	Bacteria	3315
139	Ga0081455_10120310	3300005937	Bacteria	2070
140	Ga0081540_1003965	3300005983	Bacteria	11501
141	Ga0081540_1006422	3300005983	Bacteria	8558
142	Ga0081540_1007697	3300005983	Bacteria	7637
143	Ga0081540_1011844	3300005983	Bacteria	5796
144	Ga0081540_1012349	3300005983	Bacteria	5635
145	Ga0081540_1013491	3300005983	Bacteria	5308
146	Ga0081540_1014236	3300005983	Bacteria	5110
147	Ga0081540_1018818	3300005983	Bacteria	4222
148	Ga0081539_10000768	3300005985	Bacteria	63055
149	Ga0081539_10001470	3300005985	Bacteria	39952
150	Ga0070717_10001267	3300006028	Bacteria	17258
151	Ga0070717_10106472	3300006028	Bacteria	2388
152	Ga0070717_10115762	3300006028	Bacteria	2291
153	Ga0075365_10086145	3300006038	Bacteria	2135
154	Ga0075365_10103698	3300006038	Bacteria	1949
155	Ga0075368_10001363	3300006042	Bacteria	7775
156	Ga0075368_10021695	3300006042	Bacteria	2441
157	Ga0075368_10057252	3300006042	Bacteria	1556
158	Ga0075363_100013881	3300006048	Bacteria	3920
159	Ga0075363_100067582	3300006048	Bacteria	1937
160	Ga0075363_100077073	3300006048	Bacteria	1819
161	Ga0075364_10060783	3300006051	Bacteria	2477
162	Ga0075364_10145166	3300006051	Bacteria	1597
163	Ga0075364_10251643	3300006051	Bacteria	1201
164	Ga0070715_10005933	3300006163	Bacteria	4117
165	Ga0070715_10121468	3300006163	Bacteria	1246
166	Ga0070716_100002732	3300006173	Bacteria	8182
167	Ga0070712_100006733	3300006175	Bacteria	7144
168	Ga0070712_100055550	3300006175	Bacteria	2774
169	Ga0070712_100074402	3300006175	Bacteria	2440
170	Ga0070712_100085459	3300006175	Bacteria	2297
171	Ga0070712_100200603	3300006175	Bacteria	1567
172	Ga0075362_10024903	3300006177	Bacteria	2541
173	Ga0075362_10040701	3300006177	Bacteria	2047
174	Ga0075362_10056901	3300006177	Bacteria	1761
175	Ga0075362_10065700	3300006177	Bacteria	1647
176	Ga0075367_10007415	3300006178	Bacteria	5612
177	Ga0075367_10081807	3300006178	Bacteria	1954
178	Ga0075369_10035267	3300006186	Bacteria	2126
179	Ga0075369_10055915	3300006186	Bacteria	1715
180	Ga0075369_10080657	3300006186	Bacteria	1443
181	Ga0075366_10072981	3300006195	Bacteria	2045
182	Ga0097621_100315787	3300006237	Bacteria	1383
183	Ga0075370_10013567	3300006353	Bacteria	4335
184	Ga0075370_10109286	3300006353	Bacteria	1604
185	Ga0075428_100424997	3300006844	Bacteria	1424
186	Ga0075431_100002184	3300006847	Bacteria	18706
187	Ga0075434_100066744	3300006871	Bacteria	3584
188	Ga0075429_100020728	3300006880	Bacteria	5706
189	Ga0075436_100101586	3300006914	Bacteria	2003
190	Ga0097620_100160446	3300006931	Bacteria	2327
191	Ga0097620_100163987	3300006931	Bacteria	2301
192	Ga0099825_1032134	3300006941	Bacteria	2158
193	Ga0099824_1007408	3300006942	Bacteria	14551
194	Ga0099824_1023175	3300006942	Bacteria	3914
195	Ga0099822_1018218	3300006943	Bacteria	7346
196	Ga0099823_1024506	3300006944	Bacteria	5452
197	Ga0075435_100249788	3300007076	Bacteria	1510
198	Ga0099795_10047078	3300007788	Bacteria	1557
199	Ga0105240_10008768	3300009093	Bacteria	14409
200	Ga0105240_10034221	3300009093	Bacteria	6557
201	Ga0105240_10076136	3300009093	Bacteria	4137
202	Ga0105240_10120101	3300009093	Bacteria	3165
203	Ga0105240_10129667	3300009093	Bacteria	3026
204	Ga0105240_10206609	3300009093	Bacteria	2298
205	Ga0105240_10255829	3300009093	Bacteria	2022
206	Ga0105245_10063788	3300009098	Bacteria	3328
207	Ga0105245_10098072	3300009098	Bacteria	2707
208	Ga0105247_10026143	3300009101	Bacteria	3524
209	Ga0105247_10091007	3300009101	Bacteria	1936
210	Ga0105247_10116887	3300009101	Bacteria	1723
211	Ga0114129_10069546	3300009147	Bacteria	4907
212	Ga0105241_10028779	3300009174	Bacteria	4140
213	Ga0105241_10035078	3300009174	Bacteria	3773
214	Ga0105241_10265431	3300009174	Bacteria	1460
215	Ga0105242_10262412	3300009176	Bacteria	1561
216	Ga0105248_10374305	3300009177	Bacteria	1603
217	Ga0105237_10004427	3300009545	Bacteria	16284
218	Ga0105237_10047513	3300009545	Bacteria	4315
219	Ga0105237_10133855	3300009545	Bacteria	2473
220	Ga0105237_10263849	3300009545	Bacteria	1725
221	Ga0105237_10388095	3300009545	Bacteria	1401
222	Ga0105237_10389256	3300009545	Bacteria	1399
223	Ga0105237_10510928	3300009545	Bacteria	1208
224	Ga0105238_10017402	3300009551	Bacteria	7303
225	Ga0105238_10081432	3300009551	Bacteria	3227
226	Ga0105238_10105713	3300009551	Bacteria	2796
227	Ga0105238_10193087	3300009551	Bacteria	2012
228	Ga0105249_10206780	3300009553	Bacteria	1924
229	Ga0099796_10014810	3300010159	Bacteria	2263
230	Ga0105239_10017021	3300010375	Bacteria	8036
231	Ga0105239_10063018	3300010375	Bacteria	4070
232	Ga0105239_10083385	3300010375	Bacteria	3520
233	Ga0105239_10092409	3300010375	Bacteria	3340
234	Ga0105239_10132432	3300010375	Bacteria	2774
235	Ga0105239_10139240	3300010375	Bacteria	2703
236	Ga0105239_10684333	3300010375	Bacteria	1172
237	Ga0105246_10132761	3300011119	Bacteria	1862
238	Ga0105246_10202766	3300011119	Bacteria	1543
239	Ga0105246_10224999	3300011119	Bacteria	1473
240	Ga0105246_10270163	3300011119	Bacteria	1359
241	Ga0157371_10075245	3300013102	Bacteria	2391
242	Ga0157370_10014947	3300013104	Bacteria	7918
243	Ga0157370_10025078	3300013104	Bacteria	5903
244	Ga0157369_10012270	3300013105	Bacteria	9731
245	Ga0157369_10021190	3300013105	Bacteria	7267
246	Ga0157369_10151314	3300013105	Bacteria	2452
247	Ga0157369_10187272	3300013105	Bacteria	2176
248	Ga0157369_10227813	3300013105	Bacteria	1949
249	Ga0157374_10200703	3300013296	Bacteria	1953
250	Ga0157378_10009041	3300013297	Bacteria	8671
251	Ga0157378_10345420	3300013297	Bacteria	1452
252	Ga0163162_10088250	3300013306	Bacteria	3181
253	Ga0163162_10317092	3300013306	Bacteria	1692
254	Ga0157375_10047518	3300013308	Bacteria	4192
255	Ga0157375_10189822	3300013308	Bacteria	2209
256	Ga0157375_10197290	3300013308	Bacteria	2168
257	Ga0163163_10008215	3300014325	Bacteria	9260
258	Ga0163163_10011315	3300014325	Bacteria	8088
259	Ga0163163_10179953	3300014325	Bacteria	2161
260	Ga0163163_10232184	3300014325	Bacteria	1894
261	Ga0163163_10414029	3300014325	Bacteria	1407
262	Ga0157380_10141045	3300014326	Bacteria	2071
263	Ga0182008_10006828	3300014497	Bacteria	6350
264	Ga0157377_10191485	3300014745	Bacteria	1293
265	Ga0157379_10100048	3300014968	Bacteria	2603
266	Ga0157376_10347565	3300014969	Bacteria	1418
267	Ga0163161_10149601	3300017792	Bacteria	1774
268	Ga0163161_10196512	3300017792	Bacteria	1553
269	Ga0163161_10205589	3300017792	Bacteria	1519
270	Ga0214544_1001813	3300021320	Bacteria	44864
271	Ga0214544_1032568	3300021320	Bacteria	1615
272	Ga0214542_1001236	3300021321	Bacteria	51849
273	Ga0214542_1028629	3300021321	Bacteria	2383
274	Ga0214542_1039400	3300021321	Bacteria	1254
275	Ga0214545_1000924	3300021324	Bacteria	51830
276	Ga0214545_1023651	3300021324	Bacteria	3988
277	Ga0214545_1027979	3300021324	Bacteria	2781
278	Ga0214543_1003531	3300021327	Bacteria	30263
279	Ga0214543_1024471	3300021327	Bacteria	3724
280	Ga0214543_1034461	3300021327	Bacteria	1731
281	Ga0214543_1035893	3300021327	Bacteria	1583
282	Ga0213876_10000520	3300021384	Bacteria	29496
283	Ga0213876_10001886	3300021384	Bacteria	12605
284	Ga0213876_10008410	3300021384	Bacteria	5584
285	Ga0213876_10020027	3300021384	Bacteria	3534
286	Ga0213876_10089360	3300021384	Bacteria	1632
287	Ga0209435_100059	3300025206	Bacteria	80744
288	Ga0209436_100823	3300025208	Bacteria	12589
289	Ga0209563_101384	3300025230	Bacteria	6524
290	Ga0209563_102893	3300025230	Bacteria	3718
291	Ga0209437_100042	3300025233	Bacteria	444095
292	Ga0209437_100062	3300025233	Bacteria	336900
293	Ga0209646_1000179	3300025246	Bacteria	80892
294	Ga0209646_1011629	3300025246	Bacteria	1360
295	Ga0209026_1000005	3300025250	Bacteria	731387
296	Ga0209026_1000212	3300025250	Bacteria	80892
297	Ga0209677_106293	3300025253	Bacteria	2846
298	Ga0209148_1000136	3300025254	Bacteria	169088
299	Ga0209148_1000180	3300025254	Bacteria	124830
300	Ga0209759_1000111	3300025256	Bacteria	143545
301	Ga0209759_1000246	3300025256	Bacteria	80892
302	Ga0209233_1000047	3300025261	Bacteria	459614
303	Ga0209233_1000054	3300025261	Bacteria	439669
304	Ga0209233_1000082	3300025261	Bacteria	336320
305	Ga0209233_1010707	3300025261	Bacteria	2732
306	Ga0209565_1009385	3300025263	Bacteria	2488
307	Ga0209455_1000170	3300025272	Bacteria	110681
308	Ga0209455_1003748	3300025272	Bacteria	5242
309	Ga0209673_1000642	3300025273	Bacteria	52672
310	Ga0209130_1000071	3300025284	Bacteria	178273
311	Ga0209130_1000154	3300025284	Bacteria	102645
312	Ga0209676_1004026	3300025292	Bacteria	8461
313	Ga0209025_1000032	3300025294	Bacteria	416141
314	Ga0209025_1002646	3300025294	Bacteria	18319
315	Ga0209564_1000025	3300025295	Bacteria	520535
316	Ga0209564_1000385	3300025295	Bacteria	80273
317	Ga0209564_1017303	3300025295	Bacteria	2818
318	Ga0209564_1023087	3300025295	Bacteria	2174
319	Ga0209758_1000011	3300025297	Bacteria	1049685
320	Ga0209758_1000120	3300025297	Bacteria	192212
321	Ga0209758_1001210	3300025297	Bacteria	32486
322	Ga0209758_1004569	3300025297	Bacteria	11413
323	Ga0209758_1008059	3300025297	Bacteria	6953
324	Ga0209758_1015568	3300025297	Bacteria	3925
325	Ga0209758_1029522	3300025297	Bacteria	2290
326	Ga0209050_1005957	3300025298	Bacteria	7411
327	Ga0209256_1000073	3300025299	Bacteria	237553
328	Ga0209256_1000907	3300025299	Bacteria	36321
329	Ga0209256_1005155	3300025299	Bacteria	7715
330	Ga0207426_1000286	3300025302	Bacteria	102853
331	Ga0207426_1000572	3300025302	Bacteria	49561
332	Ga0207426_1001763	3300025302	Bacteria	16381
333	Ga0207426_1039826	3300025302	Bacteria	1468
334	Ga0209051_1000038	3300025303	Bacteria	320926
335	Ga0209051_1002477	3300025303	Bacteria	13187
336	Ga0209257_1003099	3300025304	Bacteria	14900
337	Ga0209257_1009764	3300025304	Bacteria	5037
338	Ga0209257_1013498	3300025304	Bacteria	3624
339	Ga0209257_1035619	3300025304	Bacteria	1538
340	Ga0207692_10058851	3300025898	Bacteria	1981
341	Ga0207692_10065222	3300025898	Bacteria	1899
342	Ga0207642_10105860	3300025899	Bacteria	1422
343	Ga0207710_10014873	3300025900	Bacteria	3287
344	Ga0207710_10016392	3300025900	Bacteria	3134
345	Ga0207688_10021360	3300025901	Bacteria	3536
346	Ga0207647_10035646	3300025904	Bacteria	3169
347	Ga0207699_10002275	3300025906	Bacteria	9062
348	Ga0207699_10008564	3300025906	Bacteria	5056
349	Ga0207699_10056061	3300025906	Bacteria	2347
350	Ga0207699_10167145	3300025906	Bacteria	1469
351	Ga0207705_10191644	3300025909	Bacteria	1546
352	Ga0207684_10294696	3300025910	Bacteria	1399
353	Ga0207684_10302188	3300025910	Bacteria	1380
354	Ga0207654_10033726	3300025911	Bacteria	2840
355	Ga0207654_10036096	3300025911	Bacteria	2759
356	Ga0207654_10086640	3300025911	Bacteria	1899
357	Ga0207707_10000419	3300025912	Bacteria	44410
358	Ga0207707_10002705	3300025912	Bacteria	15850
359	Ga0207707_10002868	3300025912	Bacteria	15401
360	Ga0207707_10045918	3300025912	Bacteria	3804
361	Ga0207695_10000008	3300025913	Bacteria	1058268
362	Ga0207695_10152018	3300025913	Bacteria	2253
363	Ga0207695_10180414	3300025913	Bacteria	2032
364	Ga0207671_10008982	3300025914	Bacteria	8407
365	Ga0207671_10034078	3300025914	Bacteria	3785
366	Ga0207671_10059255	3300025914	Bacteria	2839
367	Ga0207671_10061259	3300025914	Bacteria	2792
368	Ga0207671_10088306	3300025914	Bacteria	2332
369	Ga0207671_10156832	3300025914	Bacteria	1761
370	Ga0207671_10170665	3300025914	Bacteria	1689
371	Ga0207693_10013446	3300025915	Bacteria	6599
372	Ga0207693_10019720	3300025915	Bacteria	5362
373	Ga0207693_10033602	3300025915	Bacteria	4046
374	Ga0207693_10188687	3300025915	Bacteria	1622
375	Ga0207693_10228159	3300025915	Bacteria	1462
376	Ga0207663_10000249	3300025916	Bacteria	23744
377	Ga0207663_10002050	3300025916	Bacteria	9597
378	Ga0207663_10007087	3300025916	Bacteria	5789
379	Ga0207663_10067281	3300025916	Bacteria	2297
380	Ga0207660_10106711	3300025917	Bacteria	2100
381	Ga0207657_10026743	3300025919	Bacteria	5295
382	Ga0207657_10188524	3300025919	Bacteria	1665
383	Ga0207657_10262314	3300025919	Bacteria	1375
384	Ga0207649_10039488	3300025920	Bacteria	2862
385	Ga0207649_10084927	3300025920	Bacteria	2059
386	Ga0207649_10151437	3300025920	Bacteria	1598
387	Ga0207652_10001690	3300025921	Bacteria	19300
388	Ga0207652_10011695	3300025921	Bacteria	7082
389	Ga0207652_10048077	3300025921	Bacteria	3646
390	Ga0207646_10238573	3300025922	Bacteria	1643
391	Ga0207694_10027290	3300025924	Bacteria	4347
392	Ga0207694_10068409	3300025924	Bacteria	2773
393	Ga0207694_10191173	3300025924	Bacteria	1663
394	Ga0207694_10245057	3300025924	Bacteria	1465
395	Ga0207694_10324959	3300025924	Bacteria	1270
396	Ga0207694_10327683	3300025924	Bacteria	1265
397	Ga0207650_10303663	3300025925	Bacteria	1304
398	Ga0207659_10098980	3300025926	Bacteria	2194
399	Ga0207700_10035637	3300025928	Bacteria	3586
400	Ga0207700_10047104	3300025928	Bacteria	3193
401	Ga0207700_10136610	3300025928	Bacteria	2009
402	Ga0207664_10029904	3300025929	Bacteria	4155
403	Ga0207664_10071647	3300025929	Bacteria	2792
404	Ga0207690_10030753	3300025932	Bacteria	3428
405	Ga0207706_10275897	3300025933	Bacteria	1467
406	Ga0207709_10074401	3300025935	Bacteria	2167
407	Ga0207670_10053842	3300025936	Bacteria	2713
408	Ga0207670_10420066	3300025936	Bacteria	1073
409	Ga0207669_10183380	3300025937	Bacteria	1503
410	Ga0207704_10175967	3300025938	Bacteria	1541
411	Ga0207665_10001320	3300025939	Bacteria	16732
412	Ga0207665_10001972	3300025939	Bacteria	13825
413	Ga0207711_10043240	3300025941	Bacteria	3841
414	Ga0207689_10044019	3300025942	Bacteria	3690
415	Ga0207689_10088660	3300025942	Bacteria	2541
416	Ga0207661_10001270	3300025944	Bacteria	16867
417	Ga0207661_10008213	3300025944	Bacteria	7451
418	Ga0207661_10264831	3300025944	Bacteria	1532
419	Ga0207679_10069235	3300025945	Bacteria	2654
420	Ga0207679_10286765	3300025945	Bacteria	1414
421	Ga0207667_10002017	3300025949	Bacteria	25487
422	Ga0207667_10124956	3300025949	Bacteria	2650
423	Ga0207667_10134592	3300025949	Bacteria	2545
424	Ga0207667_10209954	3300025949	Bacteria	1995
425	Ga0207651_10125014	3300025960	Bacteria	1958
426	Ga0207712_10312704	3300025961	Bacteria	1293
427	Ga0207668_10050204	3300025972	Bacteria	2873
428	Ga0207668_10245334	3300025972	Bacteria	1451
429	Ga0207640_10148313	3300025981	Bacteria	1720
430	Ga0207640_10189558	3300025981	Bacteria	1549
431	Ga0207640_10274661	3300025981	Bacteria	1320
432	Ga0207658_10150957	3300025986	Bacteria	1893
433	Ga0207658_10211814	3300025986	Bacteria	1625
434	Ga0207658_10218779	3300025986	Bacteria	1601
435	Ga0207677_10073275	3300026023	Bacteria	2424
436	Ga0207703_10136925	3300026035	Bacteria	2121
437	Ga0207639_10006277	3300026041	Bacteria	8071
438	Ga0207639_10035603	3300026041	Bacteria	3685
439	Ga0207639_10379100	3300026041	Bacteria	1270
440	Ga0207678_10060137	3300026067	Bacteria	3268
441	Ga0207678_10061454	3300026067	Bacteria	3231
442	Ga0207678_10067879	3300026067	Bacteria	3060
443	Ga0207678_10072014	3300026067	Bacteria	2962
444	Ga0207708_10115077	3300026075	Bacteria	2091
445	Ga0207702_10000548	3300026078	Bacteria	41978
446	Ga0207702_10019097	3300026078	Bacteria	5673
447	Ga0207702_10049458	3300026078	Bacteria	3548
448	Ga0207702_10098547	3300026078	Bacteria	2575
449	Ga0207702_10248491	3300026078	Bacteria	1669
450	Ga0207641_10036305	3300026088	Bacteria	4114
451	Ga0207676_10271343	3300026095	Bacteria	1536
452	Ga0207674_10010575	3300026116	Bacteria	10440
453	Ga0207674_10226613	3300026116	Bacteria	1817
454	Ga0207675_100112829	3300026118	Bacteria	2566
455	Ga0207675_100114354	3300026118	Bacteria	2549
456	Ga0207675_100130814	3300026118	Bacteria	2380
457	Ga0207675_100218893	3300026118	Bacteria	1834
458	Ga0207683_10021694	3300026121	Bacteria	5504
459	Ga0207683_10033936	3300026121	Bacteria	4434
460	Ga0207683_10040045	3300026121	Bacteria	4087
461	Ga0207683_10124367	3300026121	Bacteria	2317
462	Ga0207683_10222480	3300026121	Bacteria	1720
463	Ga0207698_10012367	3300026142	Bacteria	5581
464	Ga0207698_10034409	3300026142	Bacteria	3693
465	Ga0207698_10071611	3300026142	Bacteria	2751
466	Ga0207698_10288218	3300026142	Bacteria	1522
467	Ga0207698_10326389	3300026142	Bacteria	1440
468	Ga0209389_1000080	3300027296	Bacteria	89649
469	Ga0209389_1000115	3300027296	Bacteria	71798
470	Ga0209589_1000014	3300027357	Bacteria	227996
471	Ga0209589_1000033	3300027357	Bacteria	140561
472	Ga0209489_100014	3300027361	Bacteria	227996
473	Ga0209489_100027	3300027361	Bacteria	188074
474	Ga0209489_100040	3300027361	Bacteria	164986
475	Ga0209700_100022	3300027363	Bacteria	229977
476	Ga0209700_100024	3300027363	Bacteria	227996
477	Ga0209179_1013166	3300027512	Bacteria	1498
478	Ga0209588_1009865	3300027671	Bacteria	2862
479	Ga0209813_10000555	3300027866	Bacteria	8806
480	Ga0268266_10011262	3300028379	Bacteria	7784
481	Ga0268266_10162564	3300028379	Bacteria	2021
482	Ga0268266_10173266	3300028379	Bacteria	1959
483	Ga0268266_10207318	3300028379	Bacteria	1796
484	Ga0268266_10222593	3300028379	Bacteria	1735
485	Ga0268266_10290155	3300028379	Bacteria	1523
486	Ga0268265_10063828	3300028380	Bacteria	2835
487	Ga0268265_10110095	3300028380	Bacteria	2246
488	Ga0268265_10319263	3300028380	Bacteria	1406
489	Ga0268265_10460809	3300028380	Bacteria	1189
490	Ga0268264_10000048	3300028381	Bacteria	334457
491	Ga0268264_10140130	3300028381	Bacteria	2155
492	Ga0265318_10021190	3300028577	Bacteria	2613
493	Ga0307517_10000634	3300028786	Bacteria	60194
494	Ga0307517_10039620	3300028786	Bacteria	5167
495	Ga0307515_10000130	3300028794	Bacteria	179263
496	Ga0307515_10000375	3300028794	Bacteria	109285
497	Ga0307515_10006012	3300028794	Bacteria	24419
498	Ga0307515_10011208	3300028794	Bacteria	17036
499	Ga0265332_10072944	3300031238	Bacteria	1461
500	Ga0265329_10010852	3300031242	Bacteria	3331
501	Ga0265340_10000942	3300031247	Bacteria	16552
502	Ga0265340_10062324	3300031247	Bacteria	1781
503	Ga0265339_10003224	3300031249	Bacteria	11450
504	Ga0265339_10004321	3300031249	Bacteria	9716
505	Ga0265339_10139606	3300031249	Bacteria	1234
506	Ga0265331_10005402	3300031250	Bacteria	7726
507	Ga0265331_10008950	3300031250	Bacteria	5658
508	Ga0307513_10000335	3300031456	Bacteria	67961
509	Ga0307513_10020103	3300031456	Bacteria	7925
510	Ga0307509_10005537	3300031507	Bacteria	17522
511	Ga0307508_10000032	3300031616	Bacteria	163293
512	Ga0316575_10027004	3300031665	Bacteria	2233
513	Ga0265314_10004266	3300031711	Bacteria	13380
514	Ga0265314_10070042	3300031711	Bacteria	2351
515	Ga0265314_10206222	3300031711	Bacteria	1158
516	Ga0265342_10000245	3300031712	Bacteria	60848
517	Ga0265342_10042218	3300031712	Bacteria	2756
518	Ga0307516_10005934	3300031730	Bacteria	14450
519	Ga0307516_10010247	3300031730	Bacteria	10328
520	Ga0307516_10039539	3300031730	Bacteria	4700
521	Ga0307516_10107771	3300031730	Bacteria	2594
522	Ga0307516_10290617	3300031730	Bacteria	1313
523	Ga0307405_10124851	3300031731	Bacteria	1768
524	Ga0307407_10110918	3300031903	Bacteria	1722
525	Ga0307412_10148803	3300031911	Bacteria	1725
526	Ga0307409_100018896	3300031995	Bacteria	4650
527	Ga0307414_10015462	3300032004	Bacteria	4607
528	Ga0307415_100080075	3300032126	Bacteria	2329
529	Ga0307415_100154121	3300032126	Bacteria	1772
530	Ga0316583_10000299	3300032133	Bacteria	13887
531	Ga0307507_10011278	3300033179	Bacteria	11327
532	Ga0307510_10016157	3300033180	Bacteria	8816
533	Ga0307510_10033062	3300033180	Bacteria	5817
534	Ga0307510_10079195	3300033180	Bacteria	3206
535	Ga0307510_10192031	3300033180	Bacteria	1589
536	Ga0315911_1000002	3300033442	Bacteria	926833
537	Ga0373950_0007558	3300034818	Bacteria	1690
538	Ga0373923_0018497	3300035111	Bacteria	2683
539	Ga0373923_0023017	3300035111	Bacteria	2447
540	Ga0373945_0007554	3300035116	Bacteria	3526
541	Ga0373954_0000645	3300035118	Bacteria	13339
542	Ga0373954_0089346	3300035118	Bacteria	1478
543	Ga0373956_0005180	3300035119	Bacteria	5219
544	Ga0373957_0001340	3300035120	Bacteria	6621
545	Ga0373957_0074282	3300035120	Bacteria	1334
546	Ga0373943_0044140	3300035170	Bacteria	2169
547	Ga0373943_0046304	3300035170	Bacteria	2122
548	Ga0373946_0017066	3300035171	Bacteria	2773
549	Ga0373946_0024016	3300035171	Bacteria	2386
550	Ga0373946_0137953	3300035171	Bacteria	1128
551	Ga0373955_0114878	3300035172	Bacteria	1559
552	Ga0373924_0073578	3300035410	Bacteria	1444
553	Ga0373924_0076719	3300035410	Bacteria	1416
554	Ga0373931_0002187	3300035691	Bacteria	8629
555	Ga0373935_0012923	3300035692	Bacteria	5031
556	Ga0373935_0054823	3300035692	Bacteria	2540
557	Ga0373935_0063455	3300035692	Bacteria	2368
558	Ga0373927_0000177	3300035695	Bacteria	50406
559	Ga0373927_0013220	3300035695	Bacteria	5489
560	Ga0373927_0017091	3300035695	Bacteria	4780
561	Ga0373933_0000182	3300035724	Bacteria	41434
562	Ga0373933_0003690	3300035724	Bacteria	8470
563	Ga0373933_0112009	3300035724	Bacteria	1703
564	Ga0373947_0025283	3300035725	Bacteria	3462
565	Ga0373947_0028707	3300035725	Bacteria	3263
566	Ga0373947_0057990	3300035725	Bacteria	2345
567	Ga0373947_0071426	3300035725	Bacteria	2129
568	Ga0373947_0103986	3300035725	Bacteria	1787
569	Ga0373937_0013771	3300036401	Bacteria	7126
570	Ga0373937_0028281	3300036401	Bacteria	5072
571	Ga0373937_0033145	3300036401	Bacteria	4689
572	Ga0373925_0000912	3300037068	Bacteria	26965
573	Ga0373925_0021953	3300037068	Bacteria	4653
574	Ga0373925_0108321	3300037068	Bacteria	2144
575	Ga0395899_0038352	3300037312	Bacteria	3589
576	Ga0395899_0083732	3300037312	Bacteria	2319
577	Ga0395900_0001029	3300037418	Bacteria	35765
578	Ga0395900_0004780	3300037418	Bacteria	14275
579	Ga0395900_0017080	3300037418	Bacteria	7408
580	Ga0395898_0002778	3300037466	Bacteria	20117
581	Ga0395898_0022553	3300037466	Bacteria	6376
582	Ga0395898_0169433	3300037466	Bacteria	2087
583	Ga0395898_0179146	3300037466	Bacteria	2025
584	Ga0395898_0211039	3300037466	Bacteria	1852
585	Ga0395905_0002254	3300037471	Bacteria	21651
586	Ga0395905_0006562	3300037471	Bacteria	11688
587	Ga0395905_0136044	3300037471	Bacteria	2311
588	Ga0395905_0198854	3300037471	Bacteria	1879
589	Ga0395905_0229979	3300037471	Bacteria	1734
590	Ga0436364_0341704	3300037853	Bacteria	12661
591	Ga0395901_0014425	3300038443	Bacteria	8041
592	Ga0395901_0031413	3300038443	Bacteria	5477
593	Ga0395901_0044477	3300038443	Bacteria	4606
594	Ga0395901_0052460	3300038443	Bacteria	4239
595	Ga0395901_0158660	3300038443	Bacteria	2376
596	Ga0395901_0386583	3300038443	Bacteria	1439
597	Ga0395901_0548932	3300038443	Bacteria	1171
598	Ga0400483_059947	3300039062	Bacteria	2407
599	Ga0400483_121196	3300039062	Bacteria	2271
600	Ga0400483_179252	3300039062	Bacteria	3054
601	Ga0400483_189090	3300039062	Bacteria	1650
602	Ga0400483_225275	3300039062	Bacteria	2254
603	Ga0400483_291972	3300039062	Bacteria	2334
604	Ga0436365_0229539	3300039437	Bacteria	3406
605	Ga0436365_0459631	3300039437	Bacteria	25364
606	Ga0436365_0745092	3300039437	Bacteria	1475
607	Ga0436365_0982014	3300039437	Bacteria	2305
608	Ga0436365_1142591	3300039437	Bacteria	1157
609	Ga0436365_1590122	3300039437	Bacteria	23962
610	Ga0436360_0768015	3300039438	Bacteria	1096
611	Ga0436360_1204026	3300039438	Bacteria	1212
612	Ga0436361_0665242	3300039447	Bacteria	3058
613	Ga0436363_0725193	3300039450	Bacteria	1644
614	Ga0436363_1172772	3300039450	Bacteria	18869
615	Ga0436362_1155470	3300039453	Bacteria	10535
616	Ga0451807_1061003	3300041486	Bacteria	1313
617	Ga0451833_0369965	3300041491	Bacteria	43703
618	Ga0451837_0964406	3300041494	Bacteria	15188
619	Ga0451839_0063950	3300041496	Bacteria	43670
620	Ga0451845_0249129	3300041501	Bacteria	20670
621	Ga0451847_0341155	3300041503	Bacteria	20211
622	Ga0451851_1180298	3300041507	Bacteria	43516
623	Ga0451855_0392051	3300041511	Bacteria	3102
624	Ga0451853_2474193	3300041512	Bacteria	23134
625	Ga0439458_0013895	3300042157	Bacteria	1815
626	Ga0466972_0000172	3300044658	Bacteria	50564
627	Ga0466965_0005988	3300044683	Bacteria	5494
628	Ga0466966_0000128	3300044684	Bacteria	48511
629	Ga0466966_0074228	3300044684	Bacteria	2126
630	Ga0466966_0103222	3300044684	Bacteria	1762
631	Ga0466961_0000236	3300044693	Bacteria	37237
632	Ga0466963_0000255	3300044694	Bacteria	23380
633	Ga0466963_0200354	3300044694	Bacteria	1396
634	Ga0466968_0010295	3300044735	Bacteria	3623
635	Ga0466970_0000134	3300044765	Bacteria	33918
636	Ga0466970_0088464	3300044765	Bacteria	1680
637	Ga0466967_0091577	3300045976	Bacteria	2764
638	Ga0466967_0099398	3300045976	Bacteria	2657
639	Ga0466967_0132211	3300045976	Bacteria	2318
640	Ga0466967_0211131	3300045976	Bacteria	1841
641	Ga0495592_0039287	3300046454	Bacteria	3556
642	Ga0495592_0072650	3300046454	Bacteria	2502
643	Ga0495603_0000217	3300046455	Bacteria	29788
644	Ga0495603_0039310	3300046455	Bacteria	2835
645	Ga0495603_0050966	3300046455	Bacteria	2460
646	Ga0495590_0050349	3300046457	Bacteria	1454
647	Ga0495629_0000373	3300046459	Bacteria	37733
648	Ga0495629_0000862	3300046459	Bacteria	24478
649	Ga0495629_0021438	3300046459	Bacteria	4611
650	Ga0495629_0179830	3300046459	Bacteria	1466
651	Ga0495638_0004887	3300046460	Bacteria	10075
652	Ga0495638_0005277	3300046460	Bacteria	9656
653	Ga0495638_0007591	3300046460	Bacteria	7759
654	Ga0495638_0031312	3300046460	Bacteria	3419
655	Ga0495638_0035964	3300046460	Bacteria	3155
656	Ga0495638_0036703	3300046460	Bacteria	3121
657	Ga0495638_0041257	3300046460	Bacteria	2921
658	Ga0495641_0019640	3300046461	Bacteria	3450
659	Ga0495641_0048799	3300046461	Bacteria	1940
660	Ga0495651_0007091	3300046462	Bacteria	8568
661	Ga0495651_0019146	3300046462	Bacteria	5304
662	Ga0495653_0218377	3300046463	Bacteria	1283
663	Ga0495653_0255541	3300046463	Bacteria	1161
664	Ga0495653_0270068	3300046463	Bacteria	1120
665	Ga0495580_0006588	3300046472	Bacteria	9437
666	Ga0495580_0059540	3300046472	Bacteria	2684
667	Ga0495582_0006572	3300046473	Bacteria	6452
668	Ga0495582_0036743	3300046473	Bacteria	2694
669	Ga0495605_0046230	3300046474	Bacteria	2141
670	Ga0495639_0000544	3300046475	Bacteria	17562
671	Ga0495639_0038283	3300046475	Bacteria	2153
672	Ga0495639_0059296	3300046475	Bacteria	1752
673	Ga0495662_0045498	3300046476	Bacteria	2119
674	Ga0495662_0083343	3300046476	Bacteria	1556
675	Ga0495662_0123647	3300046476	Bacteria	1271
676	Ga0495664_0001505	3300046477	Bacteria	12344
677	Ga0495664_0019029	3300046477	Bacteria	3944
678	Ga0495664_0034156	3300046477	Bacteria	2991
679	Ga0495664_0039921	3300046477	Bacteria	2774
680	Ga0495664_0089999	3300046477	Bacteria	1845
681	Ga0495664_0098203	3300046477	Bacteria	1763
682	Ga0495584_0124283	3300046491	Bacteria	1307
683	Ga0495585_0033769	3300046492	Bacteria	2894
684	Ga0495606_0043636	3300046507	Bacteria	2988
685	Ga0495608_0002876	3300046511	Bacteria	12326
686	Ga0495608_0046266	3300046511	Bacteria	2896
687	Ga0495608_0224764	3300046511	Bacteria	1177
688	Ga0495610_0050549	3300046512	Bacteria	2029
689	Ga0495618_0009642	3300046514	Bacteria	5830
690	Ga0495618_0035976	3300046514	Bacteria	3107
691	Ga0495618_0066415	3300046514	Bacteria	2293
692	Ga0495628_0009755	3300046516	Bacteria	8185
693	Ga0495630_0026624	3300046517	Bacteria	4283
694	Ga0495630_0060767	3300046517	Bacteria	2837
695	Ga0495631_0005680	3300046518	Bacteria	6509
696	Ga0495632_0015036	3300046519	Bacteria	4354
697	Ga0495648_0001373	3300046524	Bacteria	23995
698	Ga0495648_0042914	3300046524	Bacteria	2841
699	Ga0495648_0071291	3300046524	Bacteria	2015
700	Ga0495663_0032864	3300046525	Bacteria	1547
701	Ga0495666_0067701	3300046526	Bacteria	1701
702	Ga0495652_0076709	3300046529	Bacteria	2772
703	Ga0495652_0090139	3300046529	Bacteria	2509
704	Ga0495652_0104274	3300046529	Bacteria	2294
705	Ga0495652_0158158	3300046529	Bacteria	1762
706	Ga0495654_0048470	3300046530	Bacteria	2084
707	Ga0495665_0006186	3300046531	Bacteria	6465
708	Ga0495665_0131920	3300046531	Bacteria	1308
709	Ga0495640_0002595	3300046533	Bacteria	14526
710	Ga0495586_0079707	3300046535	Bacteria	1798
711	Ga0495587_0197223	3300046536	Bacteria	1139
712	Ga0495597_0103842	3300046542	Bacteria	1196
713	Ga0495622_0034428	3300046557	Bacteria	2362
714	Ga0495622_0132899	3300046557	Bacteria	1132
715	Ga0495667_0034851	3300046559	Bacteria	3366
716	Ga0495668_0022434	3300046616	Bacteria	3608
717	Ga0495634_0001583	3300046642	Bacteria	19998
718	Ga0495634_0061661	3300046642	Bacteria	2492
719	Ga0495625_0069908	3300046660	Bacteria	2466
720	Ga0495625_0127525	3300046660	Bacteria	1726
721	Ga0495625_0145977	3300046660	Bacteria	1593
722	Ga0495625_0150911	3300046660	Bacteria	1562
723	Ga0495625_0205758	3300046660	Bacteria	1296
724	Ga0495635_0000436	3300046663	Bacteria	26341
725	Ga0495635_0051959	3300046663	Bacteria	2823
726	Ga0495635_0224503	3300046663	Bacteria	1270
727	Ga0495635_0229304	3300046663	Bacteria	1255
728	Ga0495635_0272705	3300046663	Bacteria	1137
729	Ga0495661_0020469	3300046665	Bacteria	4318
730	Ga0495588_0183087	3300046674	Bacteria	1107
731	Ga0495657_0028186	3300046675	Bacteria	3953
732	Ga0495657_0053230	3300046675	Bacteria	2709
733	Ga0495657_0058184	3300046675	Bacteria	2567
734	Ga0495657_0193184	3300046675	Bacteria	1243
735	Ga0495599_0042775	3300046678	Bacteria	2843
736	Ga0495599_0209926	3300046678	Bacteria	1194
737	Ga0495623_0056660	3300046679	Bacteria	2467
738	Ga0495623_0097772	3300046679	Bacteria	1793
739	Ga0495623_0184015	3300046679	Bacteria	1211
740	Ga0495646_0005491	3300046680	Bacteria	8015
741	Ga0495647_0011285	3300046681	Bacteria	3060
742	Ga0495658_0003203	3300046683	Bacteria	8153
743	Ga0495669_0000650	3300046684	Bacteria	15146
744	Ga0495613_0007707	3300046689	Bacteria	8008
745	Ga0495613_0332423	3300046689	Bacteria	1047
746	Ga0495624_0023168	3300046690	Bacteria	4096
747	Ga0495624_0040628	3300046690	Bacteria	2978
748	Ga0495624_0082181	3300046690	Bacteria	1994
749	Ga0495649_0036062	3300046694	Bacteria	2718
750	Ga0495581_0003127	3300047315	Bacteria	9472
751	Ga0495581_0019323	3300047315	Bacteria	3954
752	Ga0495604_0006866	3300047317	Bacteria	9024
753	Ga0495604_0025855	3300047317	Bacteria	4675
754	Ga0495604_0027516	3300047317	Bacteria	4521
755	Ga0495604_0290784	3300047317	Bacteria	1100
756	Ga0495674_0008459	3300047319	Bacteria	9804
757	Ga0495674_0069954	3300047319	Bacteria	3034
758	Ga0495674_0093019	3300047319	Bacteria	2573
759	Ga0495674_0208714	3300047319	Bacteria	1618
760	Ga0495672_0133076	3300047320	Bacteria	1306
761	Ga0495672_0137431	3300047320	Bacteria	1280
762	Ga0495676_0027208	3300047321	Bacteria	4908
763	Ga0495676_0146496	3300047321	Bacteria	1686
764	Ga0495680_0001711	3300047322	Bacteria	23324
765	Ga0495680_0009863	3300047322	Bacteria	8560
766	Ga0495687_024676	3300047443	Bacteria	2854
767	Ga0495687_080788	3300047443	Bacteria	1274
768	Ga0495675_0005291	3300047444	Bacteria	7859
769	Ga0495675_0148817	3300047444	Bacteria	1447
770	Ga0495675_0267562	3300047444	Bacteria	1022
771	Ga0495673_0051615	3300047469	Bacteria	1800
772	Ga0495673_0079470	3300047469	Bacteria	1361
773	Ga0495681_0001771	3300047470	Bacteria	15902
774	Ga0495686_0015184	3300047472	Bacteria	5273
775	Ga0495686_0046169	3300047472	Bacteria	2755
776	Ga0495686_0060792	3300047472	Bacteria	2348
777	Ga0495686_0215198	3300047472	Bacteria	1096
778	Ga0495593_0000439	3300047673	Bacteria	23237
779	Ga0495593_0011115	3300047673	Bacteria	5179
780	Ga0495602_0009113	3300048088	Bacteria	10332
781	Ga0495602_0112361	3300048088	Bacteria	2211
782	Ga0496100_0239829	3300048903	Bacteria	1337
783	Ga0496100_0361047	3300048903	Bacteria	1099
784	Ga0496101_0230194	3300048904	Bacteria	1440
785	Ga0496101_0389923	3300048904	Bacteria	1096
786	Ga0496102_0001771	3300048905	Bacteria	18745
787	Ga0496102_0236815	3300048905	Bacteria	1721
788	Ga0496103_0110315	3300048906	Bacteria	1747
789	Ga0496104_0009950	3300048907	Bacteria	8486
790	Ga0496104_0020613	3300048907	Bacteria	6045
791	Ga0496104_0048391	3300048907	Bacteria	4009
792	Ga0496104_0136187	3300048907	Bacteria	2360
793	Ga0496104_0183454	3300048907	Bacteria	2003
794	Ga0496105_0009060	3300048908	Bacteria	7765
795	Ga0496105_0011039	3300048908	Bacteria	7120
796	Ga0496105_0030405	3300048908	Bacteria	4425
797	Ga0496105_0050186	3300048908	Bacteria	3446
798	Ga0496105_0078455	3300048908	Bacteria	2726
799	Ga0496105_0265527	3300048908	Bacteria	1387
800	Ga0496106_0009997	3300048909	Bacteria	7007
801	Ga0496106_0024362	3300048909	Bacteria	4499
802	Ga0496106_0075303	3300048909	Bacteria	2585
803	Ga0496106_0080447	3300048909	Bacteria	2502
804	Ga0496106_0144906	3300048909	Bacteria	1870
805	Ga0496107_0036192	3300048910	Bacteria	3540
806	Ga0496107_0081293	3300048910	Bacteria	2363
807	Ga0496107_0087790	3300048910	Bacteria	2270
808	Ga0496107_0156403	3300048910	Bacteria	1688
809	Ga0496107_0250797	3300048910	Bacteria	1317
810	Ga0496107_0295121	3300048910	Bacteria	1206
811	Ga0496107_0360167	3300048910	Bacteria	1082
812	Ga0496108_0006149	3300048911	Bacteria	9711
813	Ga0496108_0052308	3300048911	Bacteria	3422
814	Ga0496108_0066703	3300048911	Bacteria	3035
815	Ga0496108_0171015	3300048911	Bacteria	1880
816	Ga0496108_0460371	3300048911	Bacteria	1111
817	Ga0496109_0003373	3300048912	Bacteria	13363
818	Ga0496109_0031880	3300048912	Bacteria	4734
819	Ga0496109_0067050	3300048912	Bacteria	3287
820	Ga0496109_0328347	3300048912	Bacteria	1444
821	Ga0496110_0004493	3300048913	Bacteria	10817
822	Ga0496110_0055465	3300048913	Bacteria	3487
823	Ga0496110_0060878	3300048913	Bacteria	3331
824	Ga0496110_0111575	3300048913	Bacteria	2458
825	Ga0496110_0229981	3300048913	Bacteria	1686
826	Ga0496110_0266126	3300048913	Bacteria	1560
827	Ga0496110_0349744	3300048913	Bacteria	1346
828	Ga0496111_0029145	3300048914	Bacteria	3919
829	Ga0496111_0039869	3300048914	Bacteria	3370
830	Ga0496111_0108886	3300048914	Bacteria	2040
831	Ga0496111_0239188	3300048914	Bacteria	1348
832	Ga0496111_0251845	3300048914	Bacteria	1311
833	Ga0496112_0000017	3300048915	Bacteria	191284
834	Ga0496112_0013582	3300048915	Bacteria	7524
835	Ga0496112_0017643	3300048915	Bacteria	6713
836	Ga0496112_0019263	3300048915	Bacteria	6437
837	Ga0496112_0023520	3300048915	Bacteria	5888
838	Ga0496112_0137365	3300048915	Bacteria	2414
839	Ga0496112_0258947	3300048915	Bacteria	1689
840	Ga0496113_0011007	3300048916	Bacteria	6011
841	Ga0496113_0031143	3300048916	Bacteria	3868
842	Ga0496113_0071067	3300048916	Bacteria	2647
843	Ga0496113_0098584	3300048916	Bacteria	2262
844	Ga0496113_0111346	3300048916	Bacteria	2131
845	Ga0496113_0117920	3300048916	Bacteria	2073
846	Ga0496114_0011547	3300048917	Bacteria	7058
847	Ga0496114_0075593	3300048917	Bacteria	2837
848	Ga0496114_0266637	3300048917	Bacteria	1509
849	Ga0496115_0000535	3300048918	Bacteria	29580
850	Ga0496115_0002841	3300048918	Bacteria	12459
851	Ga0496115_0019252	3300048918	Bacteria	5251
852	Ga0496115_0034965	3300048918	Bacteria	3973
853	Ga0496115_0281783	3300048918	Bacteria	1364
854	Ga0496115_0323774	3300048918	Bacteria	1260
855	Ga0496116_0003125	3300048919	Bacteria	16633
856	Ga0496116_0040044	3300048919	Bacteria	3231
857	Ga0496117_0030138	3300048920	Bacteria	4169
858	Ga0496117_0035196	3300048920	Bacteria	3762
859	Ga0496117_0040628	3300048920	Bacteria	3418
860	Ga0496117_0118917	3300048920	Bacteria	1628
861	Ga0496117_0208330	3300048920	Bacteria	1098
862	Ga0496118_0003407	3300048921	Bacteria	20095
863	Ga0496118_0046295	3300048921	Bacteria	3386
864	Ga0496118_0069280	3300048921	Bacteria	2556
865	Ga0496118_0088763	3300048921	Bacteria	2137
866	Ga0496119_0001101	3300048922	Bacteria	34050
867	Ga0496119_0007752	3300048922	Bacteria	9586
868	Ga0496119_0008841	3300048922	Bacteria	8759
869	Ga0496119_0103668	3300048922	Bacteria	1593
870	Ga0496119_0117286	3300048922	Bacteria	1468
871	Ga0496119_0167292	3300048922	Bacteria	1164
872	Ga0496119_0177755	3300048922	Bacteria	1119
873	Ga0496120_0001458	3300048923	Bacteria	28286
874	Ga0496120_0009210	3300048923	Bacteria	7032
875	Ga0496120_0073827	3300048923	Bacteria	1865
876	Ga0496120_0138924	3300048923	Bacteria	1235
877	Ga0496121_0000230	3300048924	Bacteria	120616
878	Ga0496121_0004694	3300048924	Bacteria	18101
879	Ga0496121_0017764	3300048924	Bacteria	7233
880	Ga0496121_0024355	3300048924	Bacteria	5791
881	Ga0496121_0041666	3300048924	Bacteria	4010
882	Ga0496121_0080840	3300048924	Bacteria	2574
883	Ga0496121_0091769	3300048924	Bacteria	2370
884	Ga0496121_0125237	3300048924	Bacteria	1933
885	Ga0496121_0169240	3300048924	Bacteria	1589
886	Ga0496121_0192443	3300048924	Bacteria	1461
887	Ga0496122_0030277	3300048925	Bacteria	4540
888	Ga0496122_0038492	3300048925	Bacteria	3831
889	Ga0496122_0073006	3300048925	Bacteria	2436
890	Ga0496122_0125370	3300048925	Bacteria	1645
891	Ga0496123_0037892	3300048926	Bacteria	3398
892	Ga0496123_0041691	3300048926	Bacteria	3177
893	Ga0496124_0025798	3300048927	Bacteria	5313
894	Ga0496124_0027163	3300048927	Bacteria	5143
895	Ga0496124_0133515	3300048927	Bacteria	1968
896	Ga0496125_0000040	3300048928	Bacteria	314478
897	Ga0496125_0004755	3300048928	Bacteria	15477
898	Ga0496125_0022192	3300048928	Bacteria	5899
899	Ga0496125_0070258	3300048928	Bacteria	2742
900	Ga0496125_0089522	3300048928	Bacteria	2314
901	Ga0496125_0165961	3300048928	Bacteria	1492
902	Ga0496125_0197085	3300048928	Bacteria	1323
903	Ga0496125_0252256	3300048928	Bacteria	1112
904	Ga0496126_0002483	3300048929	Bacteria	24817
905	Ga0496126_0005712	3300048929	Bacteria	14100
906	Ga0496126_0012513	3300048929	Bacteria	8686
907	Ga0496126_0019903	3300048929	Bacteria	6598
908	Ga0496126_0024496	3300048929	Bacteria	5826
909	Ga0496126_0026298	3300048929	Bacteria	5582
910	Ga0496126_0037757	3300048929	Bacteria	4503
911	Ga0496126_0082588	3300048929	Bacteria	2838
912	Ga0496126_0102216	3300048929	Bacteria	2506
913	Ga0496126_0113178	3300048929	Bacteria	2362
914	Ga0496126_0209858	3300048929	Bacteria	1640
915	Ga0495682_0026404	3300049460	Bacteria	2156
916	Ga0495682_0046817	3300049460	Bacteria	1578
917	Ga0501031_0000007	3300049568	Bacteria	166008
918	Ga0501031_0008668	3300049568	Bacteria	6613
919	Ga0501031_0029381	3300049568	Bacteria	3585
920	Ga0501031_0153083	3300049568	Bacteria	1507
921	Ga0501032_0000007	3300049569	Bacteria	253881
922	Ga0501032_0000107	3300049569	Bacteria	71122
923	Ga0501032_0003811	3300049569	Bacteria	11447
924	Ga0501032_0256784	3300049569	Bacteria	1134
925	Ga0501033_0000040	3300049570	Bacteria	142586
926	Ga0501033_0000144	3300049570	Bacteria	68553
927	Ga0501033_0000311	3300049570	Bacteria	46039
928	Ga0501033_0000377	3300049570	Bacteria	42799
929	Ga0501033_0009009	3300049570	Bacteria	7699
930	Ga0501033_0024192	3300049570	Bacteria	4582
931	Ga0501033_0123389	3300049570	Bacteria	1878
932	Ga0501033_0240288	3300049570	Bacteria	1285
933	Ga0501033_0258130	3300049570	Bacteria	1234
934	Ga0501034_0000029	3300049571	Bacteria	253881
935	Ga0501034_0000039	3300049571	Bacteria	237357
936	Ga0501034_0000340	3300049571	Bacteria	81287
937	Ga0501034_0000412	3300049571	Bacteria	71925
938	Ga0501034_0042626	3300049571	Bacteria	4594
939	Ga0501034_0056930	3300049571	Bacteria	3932
940	Ga0501034_0062003	3300049571	Bacteria	3754
941	Ga0501034_0083900	3300049571	Bacteria	3188
942	Ga0501034_0159669	3300049571	Bacteria	2226
943	Ga0501034_0224874	3300049571	Bacteria	1828
944	Ga0501034_0260170	3300049571	Bacteria	1678
945	Ga0501036_0000004	3300049572	Bacteria	253881
946	Ga0501036_0000007	3300049572	Bacteria	240500
947	Ga0501036_0000127	3300049572	Bacteria	48559
948	Ga0501036_0017468	3300049572	Bacteria	5998
949	Ga0501037_0000004	3300049573	Bacteria	253989
950	Ga0501037_0000025	3300049573	Bacteria	143276
951	Ga0501037_0000066	3300049573	Bacteria	96723
952	Ga0501037_0000198	3300049573	Bacteria	54028
953	Ga0501037_0178247	3300049573	Bacteria	1509
954	Ga0501038_0000005	3300049574	Bacteria	253881
955	Ga0501038_0000026	3300049574	Bacteria	146493
956	Ga0501038_0000342	3300049574	Bacteria	40148
957	Ga0501038_0048255	3300049574	Bacteria	3685
958	Ga0501039_0000005	3300049575	Bacteria	295471
959	Ga0501039_0000009	3300049575	Bacteria	253881
960	Ga0501039_0000840	3300049575	Bacteria	22181
961	Ga0501039_0128660	3300049575	Bacteria	1987
962	Ga0501039_0205172	3300049575	Bacteria	1550
963	Ga0501040_0000754	3300049576	Bacteria	20093
964	Ga0501043_0000036	3300049579	Bacteria	132959
965	Ga0501043_0000100	3300049579	Bacteria	79167
966	Ga0501043_0000120	3300049579	Bacteria	72670
967	Ga0501043_0000836	3300049579	Bacteria	27366
968	Ga0501043_0050992	3300049579	Bacteria	3253
969	Ga0501043_0056514	3300049579	Bacteria	3083
970	Ga0501043_0141832	3300049579	Bacteria	1881
971	Ga0501046_0000359	3300049580	Bacteria	45929
972	Ga0501046_0002399	3300049580	Bacteria	17586
973	Ga0501046_0062699	3300049580	Bacteria	2904
974	Ga0501046_0164346	3300049580	Bacteria	1668
975	Ga0501047_0000209	3300049581	Bacteria	70658
976	Ga0501047_0000379	3300049581	Bacteria	50147
977	Ga0501047_0000895	3300049581	Bacteria	30440
978	Ga0501047_0007647	3300049581	Bacteria	10175
979	Ga0501047_0022062	3300049581	Bacteria	6116
980	Ga0501047_0117808	3300049581	Bacteria	2537
981	Ga0501047_0209162	3300049581	Bacteria	1810
982	Ga0501048_0000352	3300049582	Bacteria	31854
983	Ga0501048_0004356	3300049582	Bacteria	10775
984	Ga0501067_0000025	3300049583	Bacteria	91481
985	Ga0501067_0048682	3300049583	Bacteria	2350
986	Ga0501067_0160307	3300049583	Bacteria	1253
987	Ga0501068_0000801	3300049584	Bacteria	16289
988	Ga0501068_0001230	3300049584	Bacteria	13601
989	Ga0501068_0024081	3300049584	Bacteria	3573
990	Ga0501069_0000020	3300049585	Bacteria	122595
991	Ga0501069_0001694	3300049585	Bacteria	10972
992	Ga0501069_0016353	3300049585	Bacteria	3984
993	Ga0501070_0000174	3300049586	Bacteria	59663
994	Ga0501070_0002185	3300049586	Bacteria	17207
995	Ga0501070_0005683	3300049586	Bacteria	10634
996	Ga0501070_0011186	3300049586	Bacteria	7576
997	Ga0501070_0069472	3300049586	Bacteria	2916
998	Ga0501070_0135263	3300049586	Bacteria	2035
999	Ga0501070_0176217	3300049586	Bacteria	1760
1000	Ga0501071_0017012	3300049587	Bacteria	5007
1001	Ga0501072_0149146	3300049588	Bacteria	1865
1002	Ga0501073_0000070	3300049589	Bacteria	63026
1003	Ga0501073_0000091	3300049589	Bacteria	57029
1004	Ga0501073_0015856	3300049589	Bacteria	5461
1005	Ga0501073_0021242	3300049589	Bacteria	4679
1006	Ga0501073_0035474	3300049589	Bacteria	3545
1007	Ga0501074_0000015	3300049590	Bacteria	79939
1008	Ga0501074_0000489	3300049590	Bacteria	24170
1009	Ga0501074_0001218	3300049590	Bacteria	16946
1010	Ga0501074_0120763	3300049590	Bacteria	1874
1011	Ga0501075_0045965	3300049591	Bacteria	3279
1012	Ga0501076_0118741	3300049592	Bacteria	2141
1013	Ga0501079_0096719	3300049741	Bacteria	2289
1014	Ga0501080_0000132	3300049742	Bacteria	52967
1015	Ga0501080_0000321	3300049742	Bacteria	36637
1016	Ga0501080_0026275	3300049742	Bacteria	5410
1017	Ga0501080_0080954	3300049742	Bacteria	3018
1018	Ga0501080_0118362	3300049742	Bacteria	2456
1019	Ga0501080_0146807	3300049742	Bacteria	2180
1020	Ga0501080_0252213	3300049742	Bacteria	1609
1021	Ga0501081_0124769	3300049743	Bacteria	1836
1022	Ga0501083_0000284	3300049744	Bacteria	32169
1023	Ga0501083_0151276	3300049744	Bacteria	1519
1024	Ga0501083_0193412	3300049744	Bacteria	1328
1025	Ga0501035_0000014	3300049822	Bacteria	253874
1026	Ga0501035_0000016	3300049822	Bacteria	243412
1027	Ga0501035_0000070	3300049822	Bacteria	127442
1028	Ga0501035_0000346	3300049822	Bacteria	53542
1029	Ga0501035_0001251	3300049822	Bacteria	26410
1030	Ga0501035_0001605	3300049822	Bacteria	22866
1031	Ga0501035_0011180	3300049822	Bacteria	8313
1032	Ga0501035_0025723	3300049822	Bacteria	5395
1033	Ga0501035_0225697	3300049822	Bacteria	1598
1034	Ga0501035_0361460	3300049822	Bacteria	1213
1035	Ga0501044_0000012	3300049823	Bacteria	253881
1036	Ga0501044_0000037	3300049823	Bacteria	161924
1037	Ga0501044_0000274	3300049823	Bacteria	65668
1038	Ga0501044_0000383	3300049823	Bacteria	54973
1039	Ga0501044_0024200	3300049823	Bacteria	6451
1040	Ga0501044_0057358	3300049823	Bacteria	3996
1041	Ga0501044_0066220	3300049823	Bacteria	3684
1042	Ga0501044_0090497	3300049823	Bacteria	3087
1043	Ga0501044_0102592	3300049823	Bacteria	2876
1044	Ga0501044_0158683	3300049823	Bacteria	2240
1045	Ga0501044_0202591	3300049823	Bacteria	1942
1046	Ga0501045_0020164	3300049824	Bacteria	4760
1047	nmdc:mga03683_19105_c1	3300050489	Bacteria	2612
1048	nmdc:mga03683_48412_c1	3300050489	Bacteria	1766
1049	nmdc:mga03n38_121304_c1	3300050490	Bacteria	1285
1050	nmdc:mga03n38_2341_c1	3300050490	Bacteria	5824
1051	nmdc:mga03n38_84717_c1	3300050490	Bacteria	1497
1052	nmdc:mga00v17_29763_c1	3300050491	Bacteria	3206
1053	nmdc:mga00v17_60502_c1	3300050491	Bacteria	2326
1054	nmdc:mga0yw44_247562_c1	3300050492	Bacteria	1186
1055	nmdc:mga0yw44_72110_c1	3300050492	Bacteria	2146
1056	nmdc:mga06z11_101586_c1	3300050494	Bacteria	1579
1057	nmdc:mga06z11_119861_c1	3300050494	Bacteria	1467
1058	nmdc:mga06z11_246042_c1	3300050494	Bacteria	1052
1059	nmdc:mga06z11_4265_c1	3300050494	Bacteria	5612
1060	nmdc:mga06z11_78986_c2	3300050494	Bacteria	1425
1061	nmdc:mga04h51_1143_c1	3300050495	Bacteria	6129
1062	nmdc:mga07m45_38017_c1	3300050496	Bacteria	2685
1063	nmdc:mga07m45_745_c1	3300050496	Bacteria	13914
1064	nmdc:mga05p37_196560_c1	3300050507	Bacteria	2445
1065	nmdc:mga09592_18338_c1	3300050508	Bacteria	5739
1066	nmdc:mga0qj67_76787_c1	3300050509	Bacteria	2672
1067	nmdc:mga06r32_1860_c1	3300050510	Bacteria	18800
1068	nmdc:mga0n895_44891_c1	3300050512	Bacteria	4310
1069	nmdc:mga0rr50_459721_c1	3300050513	Bacteria	1079
1070	nmdc:mga08x19_102727_c1	3300050514	Bacteria	1898
1071	nmdc:mga0sz30_1713_c1	3300050516	Bacteria	7785
1072	nmdc:mga0sz30_23321_c1	3300050516	Bacteria	2516
1073	nmdc:mga0sz30_24928_c1	3300050516	Bacteria	2444
1074	nmdc:mga0sz30_45346_c1	3300050516	Bacteria	1854
1075	Ga0495601_0158215	3300053077	Bacteria	1480
1076	Ga0495601_0256864	3300053077	Bacteria	1141
1077	Ga0500635_0075124	3300053080	Bacteria	1205
1078	Ga0495595_0006301	3300053084	Bacteria	4832
1079	Ga0495595_0053818	3300053084	Bacteria	1870
1080	Ga0500578_0168169	3300053086	Bacteria	1357
1081	Ga0500643_000456	3300053087	Bacteria	30270
1082	Ga0500646_0008495	3300053090	Bacteria	2626
1083	Ga0500651_0069381	3300053093	Bacteria	2194
1084	Ga0500566_0000370	3300053094	Bacteria	24642
1085	Ga0500566_0006011	3300053094	Bacteria	7218
1086	Ga0500566_0006917	3300053094	Bacteria	6718
1087	Ga0500566_0040773	3300053094	Bacteria	2684
1088	Ga0500640_013671	3300053095	Bacteria	3364
1089	Ga0500641_0002674	3300053096	Bacteria	6295
1090	Ga0500641_0027454	3300053096	Bacteria	2216
1091	Ga0500650_0000365	3300053098	Bacteria	10988
1092	Ga0500650_0036142	3300053098	Bacteria	2266
1093	Ga0500554_004225	3300053102	Bacteria	3024
1094	Ga0500555_003144	3300053103	Bacteria	4710
1095	Ga0500556_0044111	3300053104	Bacteria	1586
1096	Ga0500557_000003	3300053105	Bacteria	228429
1097	Ga0500569_021582	3300053109	Bacteria	1704
1098	Ga0500572_000024	3300053111	Bacteria	47391
1099	Ga0500595_000537	3300053119	Bacteria	22809
1100	Ga0500595_003301	3300053119	Bacteria	7598
1101	Ga0500595_009837	3300053119	Bacteria	3838
1102	Ga0500595_016895	3300053119	Bacteria	2708
1103	Ga0500595_022156	3300053119	Bacteria	2255
1104	Ga0500608_000807	3300053122	Bacteria	11372
1105	Ga0500608_001300	3300053122	Bacteria	8888
1106	Ga0500608_099345	3300053122	Bacteria	1350
1107	Ga0500618_000334	3300053125	Bacteria	33962
1108	Ga0500642_0000019	3300053130	Bacteria	159944
1109	Ga0500642_0000252	3300053130	Bacteria	20158
1110	Ga0500655_005108	3300053133	Bacteria	2364
1111	Ga0500559_0001011	3300053136	Bacteria	17309
1112	Ga0500559_0003877	3300053136	Bacteria	7232
1113	Ga0500568_0001665	3300053139	Bacteria	13926
1114	Ga0500577_0000833	3300053142	Bacteria	7986
1115	Ga0500586_000414	3300053145	Bacteria	8543
1116	Ga0500590_000050	3300053148	Bacteria	28213
1117	Ga0500590_017662	3300053148	Bacteria	3688
1118	Ga0500590_047558	3300053148	Bacteria	2189
1119	Ga0500603_000391	3300053150	Bacteria	11472
1120	Ga0500603_000801	3300053150	Bacteria	7516
1121	Ga0500604_0001275	3300053151	Bacteria	7050
1122	Ga0500604_0059581	3300053151	Bacteria	1196
1123	Ga0500616_0000041	3300053153	Bacteria	359328
1124	Ga0500616_0000210	3300053153	Bacteria	94120
1125	Ga0500616_0046158	3300053153	Bacteria	2317
1126	Ga0500620_000042	3300053155	Bacteria	23446
1127	Ga0500622_0002498	3300053156	Bacteria	13232
1128	Ga0500627_0029367	3300053158	Bacteria	2293
1129	Ga0500627_0069753	3300053158	Bacteria	1556
1130	Ga0500630_000112	3300053159	Bacteria	26672
1131	Ga0500634_0033049	3300053161	Bacteria	2820
1132	Ga0500638_047219	3300053162	Bacteria	2085
1133	Ga0500638_068958	3300053162	Bacteria	1692
1134	Ga0500639_000040	3300053163	Bacteria	63516
1135	Ga0500636_0000365	3300053177	Bacteria	24884
1136	Ga0500636_0012982	3300053177	Bacteria	4887
1137	Ga0500636_0036809	3300053177	Bacteria	2895
1138	Ga0500636_0064889	3300053177	Bacteria	2126
1139	Ga0500637_0000042	3300053178	Bacteria	46215
1140	Ga0500637_0002167	3300053178	Bacteria	8637
1141	Ga0500570_082598	3300053724	Bacteria	1439
1142	Ga0500625_009292	3300053729	Bacteria	4380
1143	Ga0500645_039063	3300053730	Bacteria	1407
1144	Ga0500596_000794	3300053735	Bacteria	6229
1145	Ga0500599_007283	3300053736	Bacteria	1421
1146	Ga0500601_000203	3300053737	Bacteria	12048
1147	Ga0501084_0104186	3300054114	Bacteria	2383
1148	Ga0500661_000056	3300055283	Bacteria	17736
1149	Ga0500661_015268	3300055283	Bacteria	1378
1150	Ga0501082_0040063	3300060353	Bacteria	4042
1151	Ga0530510_0057533	3300061734	Bacteria	2809
1152	2503198697	2503198000	Bacteria	6884444
1153	2507507680	2507262055	Bacteria	8048963
1154	2508541796	2508501009	Bacteria	7784016
1155	2508692656	2508501042	Bacteria	8719808
1156	2509111107	2508501122	Bacteria	6292184
1157	2509149317	2508501128	Bacteria	8613869
1158	2510315015	2510065059	Bacteria	6847884
1159	2511197977	2510917030	Bacteria	7460662
1160	2511400924	2511231028	Bacteria	8046582
1161	2512962102	2512875024	Bacteria	7195110
1162	2513607902	2513237090	Bacteria	7096802
1163	2513628413	2513237092	Bacteria	8341956
1164	2513642969	2513237094	Bacteria	8789602
1165	2513647497	2513237095	Bacteria	8976980
1166	2513654072	2513237096	Bacteria	8722461
1167	2513679253	2513237098	Bacteria	9902361
1168	2513698087	2513237101	Bacteria	7952346
1169	2513705469	2513237102	Bacteria	7703324
1170	2513719465	2513237104	Bacteria	10034502
1171	2513856824	2513237137	Bacteria	9558895
1172	2513878505	2513237139	Bacteria	8737671
1173	2513891269	2513237141	Bacteria	8496279
1174	2513918412	2513237145	Bacteria	8979722
1175	2514009448	2513237161	Bacteria	8871253
1176	2514024326	2513237162	Bacteria	7468464
1177	2514037202	2513237164	Bacteria	7563725
1178	2514421707	2513237305	Bacteria	7293571
1179	2515626062	2515154112	Bacteria	8294334
1180	2515646152	2515154114	Bacteria	7848616
1181	2515654730	2515154116	Bacteria	7552979
1182	2517040513	2516653077	Bacteria	7555578
1183	2517104141	2517093001	Bacteria	9002274
1184	2517411265	2517287029	Bacteria	6905599
1185	2517891354	2517572143	Bacteria	9484767
1186	2520378830	2519899620	Bacteria	6499161
1187	2524436294	2524023205	Bacteria	8918781
1188	2524468463	2524023210	Bacteria	9029266
1189	2524538460	2524023228	Bacteria	10118060
1190	2528848998	2528768022	Bacteria	10457665
1191	2558861119	2558860100	Bacteria	8458965
1192	2585332647	2582581316	Bacteria	7774528
1193	2585394946	2582581866	Bacteria	6859583
1194	2585824976	2585427590	Bacteria	6824633
1195	2585993168	2585427633	Bacteria	6413184
1196	2599939489	2599185301	Bacteria	6161860
1197	2600193850	2599185352	Bacteria	7228948
1198	2603860915	2602042107	Bacteria	6226103
1199	2616552956	2615840698	Bacteria	7319877
1200	2617346782	2617270735	Bacteria	9163226
1201	2617372711	2617270741	Bacteria	8201522
1202	2617381272	2617270742	Bacteria	6808054
1203	2643757944	2643221547	Bacteria	4740017
1204	2643805291	2643221557	Bacteria	7184309
1205	2644005370	2643221599	Bacteria	6292121
1206	2644064135	2643221610	Bacteria	7480339
1207	2644105330	2643221618	Bacteria	7717186
1208	2644147297	2643221626	Bacteria	8069654
1209	2644200670	2643221636	Bacteria	6583769
1210	2644291297	2643221651	Bacteria	4798932
1211	2644309817	2643221655	Bacteria	7722067
1212	2644333332	2643221659	Bacteria	7890716
1213	2644375741	2643221668	Bacteria	7306521
1214	2644415967	2643221675	Bacteria	7473456
1215	2644449008	2643221680	Bacteria	7473610
1216	2644543475	2643221698	Bacteria	7756764
1217	2644614390	2643221712	Bacteria	7729434
1218	2644674214	2643221723	Bacteria	7095460
1219	2644686468	2643221726	Bacteria	7455827
1220	2657685568	2657244999	Bacteria	5946535
1221	2671114629	2667528174	Bacteria	6435400
1222	2671118866	2667528175	Bacteria	7532676
1223	2688595985	2687453392	Bacteria	6880454
1224	2692319262	2690316117	Bacteria	6800650
1225	2694632799	2693429783	Bacteria	7019804
1226	2694639472	2693429784	Bacteria	7241525
1227	2719389855	2718217927	Bacteria	6972593
1228	2721403494	2718218423	Bacteria	6438183
1229	2723030455	2721755556	Bacteria	6745503
1230	2723564817	2721755684	Bacteria	6859907
1231	2723578132	2721755686	Bacteria	7343952
1232	2723843701	2721755755	Bacteria	8322773
1233	2724035070	2721755809	Bacteria	6438790
1234	2728750066	2728368998	Bacteria	8720350
1235	2728754014	2728368998	Bacteria	8720350
1236	2730110988	2728369352	Bacteria	6745171
1237	2739305594	2738543024	Bacteria	5603683
1238	2745080751	2744054633	Bacteria	8678936
1239	2745082613	2744054633	Bacteria	8678936
1240	2778174592	2775507266	Bacteria	7392367
1241	2792747194	2791355123	Bacteria	8049106
1242	2793065225	2791355196	Bacteria	7323613
1243	2793066722	2791355197	Bacteria	8420563
1244	2793080654
1245	2793331291	2791355261	Bacteria	6661293
1246	2793344447	2791355263	Bacteria	6872478
1247	2793360053	2791355266	Bacteria	7116587
1248	2793367392	2791355267	Bacteria	7222458
1249	2804755187	2802429268	Bacteria	6094027
1250	2805919071	2802429603	Bacteria	8777136
1251	2806055854	2802429634	Bacteria	7083200
1252	2806061302	2802429635	Bacteria	7650140
1253	2806065765	2802429636	Bacteria	7597525
1254	2818236534	2816332527	Bacteria	8933356
1255	2824605713	2824600985	Bacteria	8488197
1256	2824611724	2824609381	Bacteria	8672835
1257	2824620392	2824617872	Bacteria	8814715
1258	2824628560	2824626560	Bacteria	8813858
1259	2824639088	2824635225	Bacteria	8785348
1260	2824649553	2824644064	Bacteria	8743947
1261	2824658215	2824653114	Bacteria	8493680
1262	2824666470	2824661429	Bacteria	9877870
1263	2824674137	2824671348	Bacteria	8369588
1264	2824685665	2824679649	Bacteria	8248951
1265	2824691978	2824687955	Bacteria	8360029
1266	2824701126	2824696289	Bacteria	8335049
1267	2824710247	2824704595	Bacteria	9667483
1268	2824720680	2824714736	Bacteria	8717648
1269	2824730942	2824723954	Bacteria	8758240
1270	2824735842	2824732956	Bacteria	7810675
1271	2824750089	2824746037	Bacteria	7911610
1272	2824755965	2824753945	Bacteria	9787441
1273	2824767503	2824763712	Bacteria	9792355
1274	2824775142	2824773399	Bacteria	8360218
1275	2838032564	2838029111	Bacteria	6603031
1276	2838047581	2838042994	Bacteria	6046894
1277	2838128809	2838122688	Bacteria	8803140
1278	2840881695	2840878972	Bacteria	5483153
1279	2841766398	2841760612	Bacteria	6454112
1280	2841945039	2841941048	Bacteria	8688029
1281	2841953460	2841949485	Bacteria	8680857
1282	2841959708	2841957949	Bacteria	8652217
1283	2841972063	2841966195	Bacteria	8673214
1284	2841978189	2841974524	Bacteria	8931498
1285	2841986184	2841983080	Bacteria	8395090
1286	2842040907	2842038055	Bacteria	8002051
1287	2842046148	2842045827	Bacteria	8006841
1288	2842345732	2842341865	Bacteria	7003929
1289	2842479296	2842475841	Bacteria	6603183
1290	2842485625	2842482326	Bacteria	7212537
1291	2842506545	2842502639	Bacteria	6604161
1292	2842515068	2842509118	Bacteria	6850950
1293	2844008707	2844002411	Bacteria	7168230
1294	2844010811	2844009547	Bacteria	6728125
1295	2844106165	2844104063	Bacteria	6440972
1296	2844166537	2844163670	Bacteria	7266046
1297	2844320005	2844315083	Bacteria	8138177
1298	2847422229	2847417321	Bacteria	6913799
1299	2847938317	2847930680	Bacteria	9342022
1300	2847947723	2847939898	Bacteria	8606328
1301	2848998272	2848992105	Bacteria	6810864
1302	2849078416	2849076700	Bacteria	7039503
1303	2851186666	2851182111	Bacteria	6047226
1304	2851246521	2851246043	Bacteria	6439203
1305	2856322160	2856320880	Bacteria	7263508
1306	2856332531	2856328259	Bacteria	6528202
1307	2856338463	2856334872	Bacteria	7037011
1308	2856355114	2856349417	Bacteria	6230045
1309	2856365541	2856364286	Bacteria	6939991
1310	2857369761	2857367948	Bacteria	6965560
1311	2857511302	2857509624	Bacteria	7472071
1312	2857523887	2857516855	Bacteria	7787325
1313	2857524633	2857524615	Bacteria	6615449
1314	2869170494	2869169390	Bacteria	6659796
1315	2869239438	2869234852	Bacteria	6654993
1316	2869249464	2869242130	Bacteria	6609239
1317	2869262908	2869256925	Bacteria	6981691
1318	2869277225	2869271264	Bacteria	6908218
1319	2869279018	2869278585	Bacteria	7077053
1320	2869284744	2869278585	Bacteria	7077053
1321	2869287016	2869285874	Bacteria	6901219
1322	2871434322	2871429161	Bacteria	6547891
1323	2871437928	2871435913	Bacteria	6880295
1324	2871454338	2871451962	Bacteria	7336357
1325	2871486562	2871481445	Bacteria	6700002
1326	2871492547	2871488783	Bacteria	6929816
1327	2874111300	2874109183	Bacteria	6517025
1328	2874119132	2874116593	Bacteria	6674494
1329	2874142935	2874139085	Bacteria	7021506
1330	2874147457	2874146452	Bacteria	7533118
1331	2874156463	2874155637	Bacteria	6724144
1332	2874165913	2874162495	Bacteria	6174670
1333	2874172453	2874168670	Bacteria	8062617
1334	2874598790	2874590934	Bacteria	8299676
1335	2874607390	2874604998	Bacteria	7834745
1336	2874614590	2874612657	Bacteria	8252029
1337	2874628346	2874620515	Bacteria	8290088
1338	2874635023	2874628541	Bacteria	8630250
1339	2874652246	2874645413	Bacteria	8214782
1340	2876371235	2876369609	Bacteria	6807521
1341	2876381839	2876377896	Bacteria	6565995
1342	2876390242	2876386047	Bacteria	6698674
1343	2876400112	2876399893	Bacteria	6927900
1344	2876407709	2876406927	Bacteria	6191900
1345	2876414651	2876413966	Bacteria	6831344
1346	2876427681	2876420981	Bacteria	6687741
1347	2876765276	2876761206	Bacteria	10111113
1348	2876766224	2876761206	Bacteria	10111113
1349	2876778829	2876771140	Bacteria	8287509
1350	2876814619	2876808645	Bacteria	8824342
1351	2876824276	2876818435	Bacteria	8274608
1352	2878732153	2878730984	Bacteria	6380721
1353	2878740995	2878738818	Bacteria	7136951
1354	2878745848	2878738818	Bacteria	7136951
1355	2878747197	2878745973	Bacteria	6867388
1356	2878758429	2878753008	Bacteria	6922523
1357	2878774470	2878774303	Bacteria	6108671
1358	2878784650	2878781027	Bacteria	6834456
1359	2879082622	2879074833	Bacteria	8279565
1360	2879086097	2879083081	Bacteria	8587928
1361	2879107115	2879099564	Bacteria	10442239
1362	2879114700	2879110137	Bacteria	8907982
1363	2879131539	2879127579	Bacteria	8294491
1364	2879147985	2879142872	Bacteria	8267021
1365	2881154226	2881147464	Bacteria	7779814
1366	2881158008	2881155292	Bacteria	6461656
1367	2881163294	2881161766	Bacteria	7127907
1368	2881371477	2881364244	Bacteria	7710352
1369	2881666560	2881665667	Bacteria	8175609
1370	2881850983	2881845957	Bacteria	6611900
1371	2881856911	2881853255	Bacteria	6698367
1372	2881866803	2881861095	Bacteria	7128710
1373	2882912913	2882912400	Bacteria	6801539
1374	2885323745	2885318864	Bacteria	6729568
1375	2885350578	2885342637	Bacteria	7011821
1376	2885351991	2885350715	Bacteria	6787678
1377	2885370233	2885366525	Bacteria	8326213
1378	2885374991	2885374607	Bacteria	8927485
1379	2885384044	2885383462	Bacteria	9473874
1380	2885410280	2885409591	Bacteria	9235467
1381	2888343400	2888337043	Bacteria	6629336
1382	2888385434	2888378607	Bacteria	9652610
1383	2888392799	2888388044	Bacteria	7304136
1384	2888425868	2888419890	Bacteria	7857137
1385	2889038033	2889033259	Bacteria	9099371
1386	2893069154	2893066018	Bacteria	6158120
1387	2898795429	2898795034	Bacteria	4294459
1388	2903496722	2903492973	Bacteria	13473544
1389	2903519249	2903513507	Bacteria	6344008
1390	2903730320	2903727486	Bacteria	8281579
1391	2903755315	2903748898	Bacteria	9972761
1392	2903769712	2903768456	Bacteria	9749579
1393	2904674035	2904666416	Bacteria	8226587
1394	2904691222	2904690495	Bacteria	9412302
1395	2904701308
1396	2904711990	2904711408	Bacteria	9771557
1397	2906309369	2906308376	Bacteria	6841989
1398	2906327019	2906321335	Bacteria	6579571
1399	2906390459	2906386501	Bacteria	5977019
1400	2906405745	2906401398	Bacteria	6693206
1401	2906412546	2906408224	Bacteria	6162342
1402	2906433675	2906427513	Bacteria	6375796
1403	2906604745	2906602504	Bacteria	8295279
1404	2906616540
1405	2906627327	2906626472	Bacteria	8826946
1406	2906635313	2906635258	Bacteria	8601019
1407	2906648862	2906643746	Bacteria	8722424
1408	2906666858	2906660503	Bacteria	8595048
1409	2908741708	2908739725	Bacteria	8628932
1410	2908759137	2908756301	Bacteria	8864324
1411	2908781154	2908775508	Bacteria	8092255
1412	2913299984	2913295892	Bacteria	6333755
1413	2919078515	2919073203	Bacteria	6531949
1414	2919413356	2919408235	Bacteria	6149349
1415	2922156921	2922151315	Bacteria	6902399
1416	2922175696	2922172374	Bacteria	6167644
1417	2922181182	2922178524	Bacteria	6025201
1418	2922366032	2922361189	Bacteria	7436256
1419	2922372424
1420	2922387367	2922386360	Bacteria	7017218
1421	2922397088	2922393267	Bacteria	8285685
1422	2922431440
1423	2924714927	2924710171	Bacteria	6752351
1424	2924723530	2924718760	Bacteria	6331356
1425	2924734817	2924733363	Bacteria	7574837
1426	2924742272	2924741084	Bacteria	6661321
1427	2924748904	2924748358	Bacteria	6154725
1428	2924778596	2924776078	Bacteria	7492003
1429	2924784247	2924776078	Bacteria	7492003
1430	2924784526	2924784321	Bacteria	7416538
1431	2929621006	2929615660	Bacteria	9193770
1432	2929626163	2929624759	Bacteria	9339455
1433	2932784958	2932784394	Bacteria	9704911
1434	2932795164	2932794094	Bacteria	7915132
1435	2932805692	2932801729	Bacteria	7987968
1436	2932809990	2932809354	Bacteria	9135765
1437	2932818267	2932818245	Bacteria	9955613
1438	2932828795	2932828146	Bacteria	9745859
1439	2933583124	2933577622	Bacteria	9116884
1440	2935609810	2935608549	Bacteria	8203142
1441	2935619785	2935616580	Bacteria	9032984
1442	2935634036	2935630451	Bacteria	8169952
1443	2935638766	2935638405	Bacteria	10015038
1444	2935652160	2935648319	Bacteria	8801166
1445	2935659867	2935656913	Bacteria	8965014
1446	2935666383	2935665750	Bacteria	9571747
1447	2935676571	2935675223	Bacteria	9928132
1448	2935684954	2935684952	Bacteria	9590419
1449	2935694651	2935694250	Bacteria	9291695
1450	2935703772	2935703347	Bacteria	10242284
1451	2935713507	2935713505	Bacteria	9608509
1452	2935724127	2935722832	Bacteria	9608746
1453	2935733515	2935732158	Bacteria	9706831
1454	2935742894	2935741537	Bacteria	9707219
1455	2935750919	2935750917	Bacteria	9590372
1456	2935760550	2935760218	Bacteria	9817913
1457	2935771960	2935769743	Bacteria	7878163
1458	2935784324	2935777560	Bacteria	8077691
1459	2935787652	2935785616	Bacteria	7962367
1460	2935796284	2935793552	Bacteria	8012592
1461	2935801909	2935801545	Bacteria	9301974
1462	2935810680	2935810662	Bacteria	9401221
1463	2935822971	2935819856	Bacteria	8261050
1464	2935828260	2935827899	Bacteria	10038562
1465	2935842464	2935837841	Bacteria	9454360
1466	2935848553	2935847175	Bacteria	8228321
1467	2935857900	2935855204	Bacteria	9035059
1468	2935868758	2935864058	Bacteria	9784707
1469	2935874173	2935873716	Bacteria	9632195
1470	2935883938	2935883170	Bacteria	7964738
1471	2935909639	2935908558	Bacteria	8568796
1472	2935917364	2935916978	Bacteria	9113783
1473	2935927120	2935926038	Bacteria	8601059
1474	2935937036	2935934488	Bacteria	8602579
1475	2935944661	2935942939	Bacteria	8599779
1476	2935953098	2935951376	Bacteria	8602333
1477	2935966599	2935959822	Bacteria	7869783
1478	2935969938	2935967501	Bacteria	8603075
1479	2935980229	2935975950	Bacteria	8347125
1480	2935987011	2935984226	Bacteria	8302647
1481	2935992902	2935992306	Bacteria	9802711
1482	2936002815	2936002035	Bacteria	9362176
1483	2936014283	2936011229	Bacteria	8801034
1484	2936023877	2936019824	Bacteria	8804134
1485	2936031520	2936028420	Bacteria	8965941
1486	2936037900	2936037263	Bacteria	9446081
1487	2936049389	2936046547	Bacteria	8903709
1488	2936062139	2936055302	Bacteria	8785755
1489	2936384463	2936381700	Bacteria	7006523
1490	2937813728	2937813078	Bacteria	7783518
1491	2937845035	2937843397	Bacteria	5256375
1492	2937848839	2937848649	Bacteria	6983481
1493	2937867764	2937861824	Bacteria	6660327
1494	2937878769	2937877337	Bacteria	7246526
1495	2937974450	2937972304	Bacteria	7532020
1496	2937983285	2937980651	Bacteria	6517427
1497	2938022336	2938014810	Bacteria	6700592
1498	2940558278	2940556831	Bacteria	9590747
1499	2941502592	2941499720	Bacteria	7599444
1500	2941510661	2941507105	Bacteria	8166816
1501	2941518045	2941515067	Bacteria	8166720
1502	2941527084	2941523033	Bacteria	8169134
1503	2941531190	2941531003	Bacteria	7653939
1504	2941542513	2941538514	Bacteria	9402094
1505	2952255351	2952252522	Bacteria	4171745
1506	2958041401	2958034702	Bacteria	6989922
1507	2958042375	2958041894	Bacteria	13082850
1508	2958048520	2958041894	Bacteria	13082850
1509	2958058275	2958041894	Bacteria	13082850
1510	2958065222	2958064165	Bacteria	7158582
1511	2958085920	2958084443	Bacteria	7312792
1512	2958097307	2958092219	Bacteria	6861151
1513	2958111820	2958108152	Bacteria	6681128
1514	2958124033	2958122699	Bacteria	7280457
1515	2958131415	2958130278	Bacteria	6897202
1516	2958139621	2958137437	Bacteria	6050276
1517	2958146972	2958144490	Bacteria	6677056
1518	2958158804	2958158011	Bacteria	6058449
1519	2958181240	2958179912	Bacteria	6874908
1520	2961079078	2961077736	Bacteria	7079850
1521	2961133613	2961127735	Bacteria	7196641
1522	2961137375	2961136820	Bacteria	6775228
1523	2961173378	2961170736	Bacteria	7072258
1524	2961184251	2961183825	Bacteria	6688536
1525	2965029979	2965025482	Bacteria	6532201
1526	2965037083	2965032056	Bacteria	6887443
1527	2965054627	2965047637	Bacteria	6623551
1528	2965103158	2965102966	Bacteria	6800987
1529	2965111365	2965110997	Bacteria	6693150
1530	2967998548	2967996073	Bacteria	6787468
1531	2968006026	2968003550	Bacteria	6929263
1532	2968022921	2968016561	Bacteria	7022047
1533	2968121655	2968117919	Bacteria	6536078
1534	2968142659	2968138860	Bacteria	6605449
1535	2970475506	2970469710	Bacteria	6969209
1536	2970492047	2970489779	Bacteria	6517260
1537	2970505971	2970503327	Bacteria	7099517
1538	2970513165	2970510686	Bacteria	7006402
1539	2970534378	2970532167	Bacteria	6553173
1540	2970553279	2970547951	Bacteria	6931819
1541	2970593612	2970593180	Bacteria	7073582
1542	2970599355	2970593180	Bacteria	7073582
1543	2970625486	2970619444	Bacteria	6986144
1544	2970632670	2970627176	Bacteria	6680862
1545	2977826962	2977821940	Bacteria	6906439
1546	2977836884	2977828996	Bacteria	7007971
1547	2977843880	2977843712	Bacteria	6753583
1548	2977856713	2977851361	Bacteria	6694324
1549	2977867751	2977864932	Bacteria	7534097
1550	2977876633	2977872689	Bacteria	7270173
1551	2977904206	2977898635	Bacteria	6675551
1552	2977907989	2977907340	Bacteria	6577984
1553	2977925469	2977922695	Bacteria	6956781
1554	2977941098	2977935797	Bacteria	6252826
1555	2977960594	2977957713	Bacteria	6877875
1556	2979767002	2979764755	Bacteria	6610066
1557	2979775848	2979772303	Bacteria	6618277
1558	2979794610	2979793036	Bacteria	6808957
1559	2979810692	2979808191	Bacteria	7179355
1560	2987646222	2987645492	Bacteria	6117018
1561	2987677341	2987673487	Bacteria	6884027
1562	2989354481	2989349275	Bacteria	6349068
1563	2996355884	2996348954	Bacteria	7239054
1564	2996387051	2996386984	Bacteria	6978667
1565	3000137352	3000135777	Bacteria	6891109
1566	3004173259	3004167301	Bacteria	8330599
1567	3004217003	3004211236	Bacteria	7417683
1568	3004225404	3004218560	Bacteria	7421728
1569	3004235065	3004232784	Bacteria	6662140
1570	3004242256	3004239961	Bacteria	6892290
1571	3004253673	3004248173	Bacteria	6563236
1572	3004271785	3004268573	Bacteria	7043476
1573	3004282310	3004275668	Bacteria	7114440
1574	3004293706	3004289098	Bacteria	6135450
1575	3004337292	3004334049	Bacteria	8449246
1576	3005457599	3005452660	Bacteria	5889319
1577	3005481233	3005474847	Bacteria	9259049
1578	3005484812	3005483717	Bacteria	7877331
1579	3005508450	3005506211	Bacteria	6943378
1580	3005588047	3005587118	Bacteria	7794411
1581	3005600296	3005594810	Bacteria	8716512
1582	3005715790	3005710791	Bacteria	7622528
1583	3005723146	3005718088	Bacteria	8283608
1584	643823865	643692032	Bacteria	6891900
1585	649870553	649633066	Bacteria	6690028
1586	8002289714	8002285264	Bacteria	6717907
1587	8003574891	8003570095	Bacteria	5747666
1588	8004301825	8004300914	Bacteria	6132239
1589	8004319500	8004312739	Bacteria	7444653
1590	8004379945	8004374579	Bacteria	6898112
1591	8004390434	8004387939	Bacteria	7049250
1592	8004642558	8004640170	Bacteria	6723001
1593	8004696347	8004695233	Bacteria	6731676
1594	8004715627	8004714634	Bacteria	6776161
1595	8004727872	8004727605	Bacteria	6643904
1596	8005260488	8005258706	Bacteria	6184835
1597	8005275978	8005275841	Bacteria	6929066
1598	8005286279	8005282627	Bacteria	6675747
1599	8005301696	8005301065	Bacteria	6614431
1600	8005383353	8005382845	Bacteria	6732062
1601	8005398947	8005395548	Bacteria	6806915
1602	8005683620	8005682033	Bacteria	6726518
1603	8005695441	8005695170	Bacteria	6912330
1604	8006927959	8006926726	Bacteria	6749210
1605	8006939476	8006933436	Bacteria	10410654
1606	8006972134	8006964411	Bacteria	8966052
1607	8006979226	8006973647	Bacteria	10679141
1608	8006984411	8006984368	Bacteria	9651211
1609	8007001345	8006994254	Bacteria	8309700
1610	8016520679	8016511872	Bacteria	9921665
1611	8016528704	8016522445	Bacteria	8156687
1612	8016533885	8016530956	Bacteria	8155261
1613	8016547107	8016539877	Bacteria	8155419
1614	8016555014	8016548790	Bacteria	8155074
1615	8016563383	8016557553	Bacteria	8154380
1616	8016572221	8016566248	Bacteria	8158151
1617	8016576410	8016575299	Bacteria	8154085
1618	8016594315	8016583857	Bacteria	10421953
1619	8016601134	8016595262	Bacteria	8149947
1620	8016615590	8016613128	Bacteria	8794220
1621	8017064904	8017057580	Bacteria	10023680
1622	8018128504	8018127388	Bacteria	7351159
1623	8018163385	8018163183	Bacteria	7277977
1624	8018180862	8018176218	Bacteria	6896178
1625	8019533654	8019530166	Bacteria	8155624
1626	8019546011	8019538911	Bacteria	7872763
1627	8019552709	8019547302	Bacteria	7996444
1628	8019565355	8019555841	Bacteria	9642137
1629	8019575454	8019565922	Bacteria	9639779
1630	8019584280	8019576017	Bacteria	10049540
1631	8019592048	8019586578	Bacteria	10212056
1632	8019599235	8019597564	Bacteria	10041141
1633	8019609123	8019608314	Bacteria	10042931
1634	8019619796	8019619141	Bacteria	9218857
1635	8019633319	8019629233	Bacteria	8687553
1636	8019649351	8019648815	Bacteria	10014479
1637	8019661193	8019659431	Bacteria	8577854
1638	8019670744	8019668869	Bacteria	8791617
1639	8019685460	8019678201	Bacteria	8863603
1640	8019691049	8019687851	Bacteria	8712826
1641	8055745131	8055742211	Bacteria	9226248
1642	8056381797	8056375014	Bacteria	7006639
1643	8056681089	8056673599	Bacteria	7871253
1644	8056684736	8056681323	Bacteria	8472857
1645	8056693080	8056689827	Bacteria	6712655
1646	8056975088	8056967851	Bacteria	9038162
1647	8057163668	8057160832	Bacteria	3268302
1648	8057531285	8057529695	Bacteria	6306553
1649	Ga0436362_0413279
1650	JGI24740J21852_10008285
1651	JGI25155J39150_1000046
1652	JGI25156J39149_1000070
1653	JGI25156J39149_1009007
1654	JGI25162J39368_1000247
1655	JGI25162J39368_1000735
1656	JGI25154J39366_1000092
1657	JGI25157J39369_1000087
1658	JGI25157J39369_1000175
1659	JGI25159J45721_1000030
1660	JGI25151J46595_10048693
1661	JGI25406J46586_10000214
1662	JGI25165J46597_1000020
1663	JGI25165J46597_1000237
1664	JGI25165J46597_1000412
1665	JGI25165J46597_1005141
1666	JGI25153J46596_10000151
1667	JGI25153J46596_10003908
1668	JGI25153J46596_10005616
1669	JGI25160J50197_1000075
1670	JGI25160J50197_1003595
1671	JGI25160J50197_1024708
1672	JGI25160J50197_1025086
1673	JGI25161J50226_1000316
1674	JGI25404J52841_10002699
1675	Ga0055539_1008676
1676	Ga0055542_1000841
1677	Ga0055529_1007252
1678	Ga0055526_1005688
1679	Ga0055526_1029564
1680	Ga0055524_1000960
1681	Ga0055536_1003695
1682	Ga0055540_1000131
1683	Ga0055531_10014237
1684	Ga0055543_1003338
1685	Ga0065165_1000048
1686	Ga0065165_1000206
1687	Ga0065165_1000582
1688	Ga0065165_1002074
1689	Ga0065165_1002220
1690	Ga0065165_1005485
1691	Ga0065712_10099907
1692	Ga0070683_100052860
1693	Ga0070690_100103442
1694	Ga0070690_100212356
1695	Ga0068869_100129353
1696	Ga0070680_100052018
1697	Ga0070680_100075104
1698	Ga0070680_100131570
1699	Ga0070682_100409483
1700	Ga0070660_100051646
1701	Ga0070660_100206106
1702	Ga0070661_100232344
1703	Ga0070668_100151197
1704	Ga0070671_100068387
1705	Ga0070674_100027518
1706	Ga0070674_100086602
1707	Ga0070674_100201329
1708	Ga0070688_100060270
1709	Ga0070659_100012688
1710	Ga0070659_100053918
1711	Ga0070667_100188613
1712	Ga0070709_10000203
1713	Ga0070709_10004227
1714	Ga0070709_10004390
1715	Ga0070709_10065310
1716	Ga0070714_100065966
1717	Ga0070714_100149564
1718	Ga0070713_100001761
1719	Ga0070713_100010384
1720	Ga0070713_100016592
1721	Ga0070713_100183503
1722	Ga0070710_10002045
1723	Ga0070711_100001730
1724	Ga0070711_100006659
1725	Ga0070711_100011938
1726	Ga0070711_100014917
1727	Ga0070711_100019115
1728	Ga0070708_100109740
1729	Ga0070663_100076740
1730	Ga0070662_100365092
1731	Ga0070681_10003273
1732	Ga0070681_10025087
1733	Ga0070681_10065024
1734	Ga0070706_100156571
1735	Ga0070707_100176291
1736	Ga0070679_100017482
1737	Ga0070679_100024100
1738	Ga0070679_100174677
1739	Ga0070684_100013567
1740	Ga0070684_100089906
1741	Ga0070684_100094373
1742	Ga0070684_100285812
1743	Ga0070697_100106656
1744	Ga0068853_100009540
1745	Ga0068853_100040363
1746	Ga0068853_100416381
1747	Ga0070665_100014994
1748	Ga0070665_100552780
1749	Ga0068855_100018899
1750	Ga0068855_100067952
1751	Ga0068855_100114327
1752	Ga0068855_100151551
1753	Ga0068855_100184319
1754	Ga0068855_100386568
1755	Ga0068855_100419655
1756	Ga0068855_100480299
1757	Ga0070664_100283719
1758	Ga0068857_100016047
1759	Ga0068854_100192480
1760	Ga0068854_100207275
1761	Ga0068856_100003888
1762	Ga0068856_100055216
1763	Ga0068856_100068625
1764	Ga0068856_100230817
1765	Ga0070702_100045764
1766	Ga0068852_100011984
1767	Ga0068852_100032466
1768	Ga0068852_100213007
1769	Ga0068859_100160460
1770	Ga0068859_100163980
1771	Ga0068864_100384391
1772	Ga0068864_100544067
1773	Ga0068851_10004825
1774	Ga0068863_100315590
1775	Ga0068858_100228037
1776	Ga0068860_100000081
1777	Ga0068860_100081543
1778	Ga0068860_100100065
1779	Ga0068860_100134124
1780	Ga0068862_100103763
1781	Ga0068862_100213910
1782	Ga0081455_10001734
1783	Ga0081455_10013417
1784	Ga0081455_10015026
1785	Ga0081455_10028177
1786	Ga0081455_10056973
1787	Ga0081455_10120310
1788	Ga0081540_1003965
1789	Ga0081540_1006422
1790	Ga0081540_1007697
1791	Ga0081540_1011844
1792	Ga0081540_1012349
1793	Ga0081540_1013491
1794	Ga0081540_1014236
1795	Ga0081540_1018818
1796	Ga0081539_10000768
1797	Ga0081539_10001470
1798	Ga0070717_10001267
1799	Ga0070717_10106472
1800	Ga0070717_10115762
1801	Ga0075365_10086145
1802	Ga0075365_10103698
1803	Ga0075368_10001363
1804	Ga0075368_10021695
1805	Ga0075368_10057252
1806	Ga0075363_100013881
1807	Ga0075363_100067582
1808	Ga0075363_100077073
1809	Ga0075364_10060783
1810	Ga0075364_10145166
1811	Ga0075364_10251643
1812	Ga0070715_10005933
1813	Ga0070715_10121468
1814	Ga0070716_100002732
1815	Ga0070712_100006733
1816	Ga0070712_100055550
1817	Ga0070712_100074402
1818	Ga0070712_100085459
1819	Ga0070712_100200603
1820	Ga0075362_10024903
1821	Ga0075362_10040701
1822	Ga0075362_10056901
1823	Ga0075362_10065700
1824	Ga0075367_10007415
1825	Ga0075367_10081807
1826	Ga0075369_10035267
1827	Ga0075369_10055915
1828	Ga0075369_10080657
1829	Ga0075366_10072981
1830	Ga0097621_100315787
1831	Ga0075370_10013567
1832	Ga0075370_10109286
1833	Ga0075428_100424997
1834	Ga0075431_100002184
1835	Ga0075434_100066744
1836	Ga0075429_100020728
1837	Ga0075436_100101586
1838	Ga0097620_100160446
1839	Ga0097620_100163987
1840	Ga0099825_1032134
1841	Ga0099824_1007408
1842	Ga0099824_1023175
1843	Ga0099822_1018218
1844	Ga0099823_1024506
1845	Ga0075435_100249788
1846	Ga0099795_10047078
1847	Ga0105240_10008768
1848	Ga0105240_10034221
1849	Ga0105240_10076136
1850	Ga0105240_10120101
1851	Ga0105240_10129667
1852	Ga0105240_10206609
1853	Ga0105240_10255829
1854	Ga0105245_10063788
1855	Ga0105245_10098072
1856	Ga0105247_10026143
1857	Ga0105247_10091007
1858	Ga0105247_10116887
1859	Ga0114129_10069546
1860	Ga0105241_10028779
1861	Ga0105241_10035078
1862	Ga0105241_10265431
1863	Ga0105242_10262412
1864	Ga0105248_10374305
1865	Ga0105237_10004427
1866	Ga0105237_10047513
1867	Ga0105237_10133855
1868	Ga0105237_10263849
1869	Ga0105237_10388095
1870	Ga0105237_10389256
1871	Ga0105237_10510928
1872	Ga0105238_10017402
1873	Ga0105238_10081432
1874	Ga0105238_10105713
1875	Ga0105238_10193087
1876	Ga0105249_10206780
1877	Ga0099796_10014810
1878	Ga0105239_10017021
1879	Ga0105239_10063018
1880	Ga0105239_10083385
1881	Ga0105239_10092409
1882	Ga0105239_10132432
1883	Ga0105239_10139240
1884	Ga0105239_10684333
1885	Ga0105246_10132761
1886	Ga0105246_10202766
1887	Ga0105246_10224999
1888	Ga0105246_10270163
1889	Ga0157371_10075245
1890	Ga0157370_10014947
1891	Ga0157370_10025078
1892	Ga0157369_10012270
1893	Ga0157369_10021190
1894	Ga0157369_10151314
1895	Ga0157369_10187272
1896	Ga0157369_10227813
1897	Ga0157374_10200703
1898	Ga0157378_10009041
1899	Ga0157378_10345420
1900	Ga0163162_10088250
1901	Ga0163162_10317092
1902	Ga0157375_10047518
1903	Ga0157375_10189822
1904	Ga0157375_10197290
1905	Ga0163163_10008215
1906	Ga0163163_10011315
1907	Ga0163163_10179953
1908	Ga0163163_10232184
1909	Ga0163163_10414029
1910	Ga0157380_10141045
1911	Ga0182008_10006828
1912	Ga0157377_10191485
1913	Ga0157379_10100048
1914	Ga0157376_10347565
1915	Ga0163161_10149601
1916	Ga0163161_10196512
1917	Ga0163161_10205589
1918	Ga0214544_1001813
1919	Ga0214544_1032568
1920	Ga0214542_1001236
1921	Ga0214542_1028629
1922	Ga0214542_1039400
1923	Ga0214545_1000924
1924	Ga0214545_1023651
1925	Ga0214545_1027979
1926	Ga0214543_1003531
1927	Ga0214543_1024471
1928	Ga0214543_1034461
1929	Ga0214543_1035893
1930	Ga0213876_10000520
1931	Ga0213876_10001886
1932	Ga0213876_10008410
1933	Ga0213876_10020027
1934	Ga0213876_10089360
1935	Ga0209435_100059
1936	Ga0209436_100823
1937	Ga0209563_101384
1938	Ga0209563_102893
1939	Ga0209437_100042
1940	Ga0209437_100062
1941	Ga0209646_1000179
1942	Ga0209646_1011629
1943	Ga0209026_1000005
1944	Ga0209026_1000212
1945	Ga0209677_106293
1946	Ga0209148_1000136
1947	Ga0209148_1000180
1948	Ga0209759_1000111
1949	Ga0209759_1000246
1950	Ga0209233_1000047
1951	Ga0209233_1000054
1952	Ga0209233_1000082
1953	Ga0209233_1010707
1954	Ga0209565_1009385
1955	Ga0209455_1000170
1956	Ga0209455_1003748
1957	Ga0209673_1000642
1958	Ga0209130_1000071
1959	Ga0209130_1000154
1960	Ga0209676_1004026
1961	Ga0209025_1000032
1962	Ga0209025_1002646
1963	Ga0209564_1000025
1964	Ga0209564_1000385
1965	Ga0209564_1017303
1966	Ga0209564_1023087
1967	Ga0209758_1000011
1968	Ga0209758_1000120
1969	Ga0209758_1001210
1970	Ga0209758_1004569
1971	Ga0209758_1008059
1972	Ga0209758_1015568
1973	Ga0209758_1029522
1974	Ga0209050_1005957
1975	Ga0209256_1000073
1976	Ga0209256_1000907
1977	Ga0209256_1005155
1978	Ga0207426_1000286
1979	Ga0207426_1000572
1980	Ga0207426_1001763
1981	Ga0207426_1039826
1982	Ga0209051_1000038
1983	Ga0209051_1002477
1984	Ga0209257_1003099
1985	Ga0209257_1009764
1986	Ga0209257_1013498
1987	Ga0209257_1035619
1988	Ga0207692_10058851
1989	Ga0207692_10065222
1990	Ga0207642_10105860
1991	Ga0207710_10014873
1992	Ga0207710_10016392
1993	Ga0207688_10021360
1994	Ga0207647_10035646
1995	Ga0207699_10002275
1996	Ga0207699_10008564
1997	Ga0207699_10056061
1998	Ga0207699_10167145
1999	Ga0207705_10191644
2000	Ga0207684_10294696
2001	Ga0207684_10302188
2002	Ga0207654_10033726
2003	Ga0207654_10036096
2004	Ga0207654_10086640
2005	Ga0207707_10000419
2006	Ga0207707_10002705
2007	Ga0207707_10002868
2008	Ga0207707_10045918
2009	Ga0207695_10000008
2010	Ga0207695_10152018
2011	Ga0207695_10180414
2012	Ga0207671_10008982
2013	Ga0207671_10034078
2014	Ga0207671_10059255
2015	Ga0207671_10061259
2016	Ga0207671_10088306
2017	Ga0207671_10156832
2018	Ga0207671_10170665
2019	Ga0207693_10013446
2020	Ga0207693_10019720
2021	Ga0207693_10033602
2022	Ga0207693_10188687
2023	Ga0207693_10228159
2024	Ga0207663_10000249
2025	Ga0207663_10002050
2026	Ga0207663_10007087
2027	Ga0207663_10067281
2028	Ga0207660_10106711
2029	Ga0207657_10026743
2030	Ga0207657_10188524
2031	Ga0207657_10262314
2032	Ga0207649_10039488
2033	Ga0207649_10084927
2034	Ga0207649_10151437
2035	Ga0207652_10001690
2036	Ga0207652_10011695
2037	Ga0207652_10048077
2038	Ga0207646_10238573
2039	Ga0207694_10027290
2040	Ga0207694_10068409
2041	Ga0207694_10191173
2042	Ga0207694_10245057
2043	Ga0207694_10324959
2044	Ga0207694_10327683
2045	Ga0207650_10303663
2046	Ga0207659_10098980
2047	Ga0207700_10035637
2048	Ga0207700_10047104
2049	Ga0207700_10136610
2050	Ga0207664_10029904
2051	Ga0207664_10071647
2052	Ga0207690_10030753
2053	Ga0207706_10275897
2054	Ga0207709_10074401
2055	Ga0207670_10053842
2056	Ga0207670_10420066
2057	Ga0207669_10183380
2058	Ga0207704_10175967
2059	Ga0207665_10001320
2060	Ga0207665_10001972
2061	Ga0207711_10043240
2062	Ga0207689_10044019
2063	Ga0207689_10088660
2064	Ga0207661_10001270
2065	Ga0207661_10008213
2066	Ga0207661_10264831
2067	Ga0207679_10069235
2068	Ga0207679_10286765
2069	Ga0207667_10002017
2070	Ga0207667_10124956
2071	Ga0207667_10134592
2072	Ga0207667_10209954
2073	Ga0207651_10125014
2074	Ga0207712_10312704
2075	Ga0207668_10050204
2076	Ga0207668_10245334
2077	Ga0207640_10148313
2078	Ga0207640_10189558
2079	Ga0207640_10274661
2080	Ga0207658_10150957
2081	Ga0207658_10211814
2082	Ga0207658_10218779
2083	Ga0207677_10073275
2084	Ga0207703_10136925
2085	Ga0207639_10006277
2086	Ga0207639_10035603
2087	Ga0207639_10379100
2088	Ga0207678_10060137
2089	Ga0207678_10061454
2090	Ga0207678_10067879
2091	Ga0207678_10072014
2092	Ga0207708_10115077
2093	Ga0207702_10000548
2094	Ga0207702_10019097
2095	Ga0207702_10049458
2096	Ga0207702_10098547
2097	Ga0207702_10248491
2098	Ga0207641_10036305
2099	Ga0207676_10271343
2100	Ga0207674_10010575
2101	Ga0207674_10226613
2102	Ga0207675_100112829
2103	Ga0207675_100114354
2104	Ga0207675_100130814
2105	Ga0207675_100218893
2106	Ga0207683_10021694
2107	Ga0207683_10033936
2108	Ga0207683_10040045
2109	Ga0207683_10124367
2110	Ga0207683_10222480
2111	Ga0207698_10012367
2112	Ga0207698_10034409
2113	Ga0207698_10071611
2114	Ga0207698_10288218
2115	Ga0207698_10326389
2116	Ga0209389_1000080
2117	Ga0209389_1000115
2118	Ga0209589_1000014
2119	Ga0209589_1000033
2120	Ga0209489_100014
2121	Ga0209489_100027
2122	Ga0209489_100040
2123	Ga0209700_100022
2124	Ga0209700_100024
2125	Ga0209179_1013166
2126	Ga0209588_1009865
2127	Ga0209813_10000555
2128	Ga0268266_10011262
2129	Ga0268266_10162564
2130	Ga0268266_10173266
2131	Ga0268266_10207318
2132	Ga0268266_10222593
2133	Ga0268266_10290155
2134	Ga0268265_10063828
2135	Ga0268265_10110095
2136	Ga0268265_10319263
2137	Ga0268265_10460809
2138	Ga0268264_10000048
2139	Ga0268264_10140130
2140	Ga0265318_10021190
2141	Ga0307517_10000634
2142	Ga0307517_10039620
2143	Ga0307515_10000130
2144	Ga0307515_10000375
2145	Ga0307515_10006012
2146	Ga0307515_10011208
2147	Ga0265332_10072944
2148	Ga0265329_10010852
2149	Ga0265340_10000942
2150	Ga0265340_10062324
2151	Ga0265339_10003224
2152	Ga0265339_10004321
2153	Ga0265339_10139606
2154	Ga0265331_10005402
2155	Ga0265331_10008950
2156	Ga0307513_10000335
2157	Ga0307513_10020103
2158	Ga0307509_10005537
2159	Ga0307508_10000032
2160	Ga0316575_10027004
2161	Ga0265314_10004266
2162	Ga0265314_10070042
2163	Ga0265314_10206222
2164	Ga0265342_10000245
2165	Ga0265342_10042218
2166	Ga0307516_10005934
2167	Ga0307516_10010247
2168	Ga0307516_10039539
2169	Ga0307516_10107771
2170	Ga0307516_10290617
2171	Ga0307405_10124851
2172	Ga0307407_10110918
2173	Ga0307412_10148803
2174	Ga0307409_100018896
2175	Ga0307414_10015462
2176	Ga0307415_100080075
2177	Ga0307415_100154121
2178	Ga0316583_10000299
2179	Ga0307507_10011278
2180	Ga0307510_10016157
2181	Ga0307510_10033062
2182	Ga0307510_10079195
2183	Ga0307510_10192031
2184	Ga0315911_1000002
2185	Ga0373950_0007558
2186	Ga0373923_0018497
2187	Ga0373923_0023017
2188	Ga0373945_0007554
2189	Ga0373954_0000645
2190	Ga0373954_0089346
2191	Ga0373956_0005180
2192	Ga0373957_0001340
2193	Ga0373957_0074282
2194	Ga0373943_0044140
2195	Ga0373943_0046304
2196	Ga0373946_0017066
2197	Ga0373946_0024016
2198	Ga0373946_0137953
2199	Ga0373955_0114878
2200	Ga0373924_0073578
2201	Ga0373924_0076719
2202	Ga0373931_0002187
2203	Ga0373935_0012923
2204	Ga0373935_0054823
2205	Ga0373935_0063455
2206	Ga0373927_0000177
2207	Ga0373927_0013220
2208	Ga0373927_0017091
2209	Ga0373933_0000182
2210	Ga0373933_0003690
2211	Ga0373933_0112009
2212	Ga0373947_0025283
2213	Ga0373947_0028707
2214	Ga0373947_0057990
2215	Ga0373947_0071426
2216	Ga0373947_0103986
2217	Ga0373937_0013771
2218	Ga0373937_0028281
2219	Ga0373937_0033145
2220	Ga0373925_0000912
2221	Ga0373925_0021953
2222	Ga0373925_0108321
2223	Ga0395899_0038352
2224	Ga0395899_0083732
2225	Ga0395900_0001029
2226	Ga0395900_0004780
2227	Ga0395900_0017080
2228	Ga0395898_0002778
2229	Ga0395898_0022553
2230	Ga0395898_0169433
2231	Ga0395898_0179146
2232	Ga0395898_0211039
2233	Ga0395905_0002254
2234	Ga0395905_0006562
2235	Ga0395905_0136044
2236	Ga0395905_0198854
2237	Ga0395905_0229979
2238	Ga0436364_0341704
2239	Ga0395901_0014425
2240	Ga0395901_0031413
2241	Ga0395901_0044477
2242	Ga0395901_0052460
2243	Ga0395901_0158660
2244	Ga0395901_0386583
2245	Ga0395901_0548932
2246	Ga0400483_059947
2247	Ga0400483_121196
2248	Ga0400483_179252
2249	Ga0400483_189090
2250	Ga0400483_225275
2251	Ga0400483_291972
2252	Ga0436365_0229539
2253	Ga0436365_0459631
2254	Ga0436365_0745092
2255	Ga0436365_0982014
2256	Ga0436365_1142591
2257	Ga0436365_1590122
2258	Ga0436360_0768015
2259	Ga0436360_1204026
2260	Ga0436361_0665242
2261	Ga0436363_0725193
2262	Ga0436363_1172772
2263	Ga0436362_1155470
2264	Ga0451807_1061003
2265	Ga0451833_0369965
2266	Ga0451837_0964406
2267	Ga0451839_0063950
2268	Ga0451845_0249129
2269	Ga0451847_0341155
2270	Ga0451851_1180298
2271	Ga0451855_0392051
2272	Ga0451853_2474193
2273	Ga0439458_0013895
2274	Ga0466972_0000172
2275	Ga0466965_0005988
2276	Ga0466966_0000128
2277	Ga0466966_0074228
2278	Ga0466966_0103222
2279	Ga0466961_0000236
2280	Ga0466963_0000255
2281	Ga0466963_0200354
2282	Ga0466968_0010295
2283	Ga0466970_0000134
2284	Ga0466970_0088464
2285	Ga0466967_0091577
2286	Ga0466967_0099398
2287	Ga0466967_0132211
2288	Ga0466967_0211131
2289	Ga0495592_0039287
2290	Ga0495592_0072650
2291	Ga0495603_0000217
2292	Ga0495603_0039310
2293	Ga0495603_0050966
2294	Ga0495590_0050349
2295	Ga0495629_0000373
2296	Ga0495629_0000862
2297	Ga0495629_0021438
2298	Ga0495629_0179830
2299	Ga0495638_0004887
2300	Ga0495638_0005277
2301	Ga0495638_0007591
2302	Ga0495638_0031312
2303	Ga0495638_0035964
2304	Ga0495638_0036703
2305	Ga0495638_0041257
2306	Ga0495641_0019640
2307	Ga0495641_0048799
2308	Ga0495651_0007091
2309	Ga0495651_0019146
2310	Ga0495653_0218377
2311	Ga0495653_0255541
2312	Ga0495653_0270068
2313	Ga0495580_0006588
2314	Ga0495580_0059540
2315	Ga0495582_0006572
2316	Ga0495582_0036743
2317	Ga0495605_0046230
2318	Ga0495639_0000544
2319	Ga0495639_0038283
2320	Ga0495639_0059296
2321	Ga0495662_0045498
2322	Ga0495662_0083343
2323	Ga0495662_0123647
2324	Ga0495664_0001505
2325	Ga0495664_0019029
2326	Ga0495664_0034156
2327	Ga0495664_0039921
2328	Ga0495664_0089999
2329	Ga0495664_0098203
2330	Ga0495584_0124283
2331	Ga0495585_0033769
2332	Ga0495606_0043636
2333	Ga0495608_0002876
2334	Ga0495608_0046266
2335	Ga0495608_0224764
2336	Ga0495610_0050549
2337	Ga0495618_0009642
2338	Ga0495618_0035976
2339	Ga0495618_0066415
2340	Ga0495628_0009755
2341	Ga0495630_0026624
2342	Ga0495630_0060767
2343	Ga0495631_0005680
2344	Ga0495632_0015036
2345	Ga0495648_0001373
2346	Ga0495648_0042914
2347	Ga0495648_0071291
2348	Ga0495663_0032864
2349	Ga0495666_0067701
2350	Ga0495652_0076709
2351	Ga0495652_0090139
2352	Ga0495652_0104274
2353	Ga0495652_0158158
2354	Ga0495654_0048470
2355	Ga0495665_0006186
2356	Ga0495665_0131920
2357	Ga0495640_0002595
2358	Ga0495586_0079707
2359	Ga0495587_0197223
2360	Ga0495597_0103842
2361	Ga0495622_0034428
2362	Ga0495622_0132899
2363	Ga0495667_0034851
2364	Ga0495668_0022434
2365	Ga0495634_0001583
2366	Ga0495634_0061661
2367	Ga0495625_0069908
2368	Ga0495625_0127525
2369	Ga0495625_0145977
2370	Ga0495625_0150911
2371	Ga0495625_0205758
2372	Ga0495635_0000436
2373	Ga0495635_0051959
2374	Ga0495635_0224503
2375	Ga0495635_0229304
2376	Ga0495635_0272705
2377	Ga0495661_0020469
2378	Ga0495588_0183087
2379	Ga0495657_0028186
2380	Ga0495657_0053230
2381	Ga0495657_0058184
2382	Ga0495657_0193184
2383	Ga0495599_0042775
2384	Ga0495599_0209926
2385	Ga0495623_0056660
2386	Ga0495623_0097772
2387	Ga0495623_0184015
2388	Ga0495646_0005491
2389	Ga0495647_0011285
2390	Ga0495658_0003203
2391	Ga0495669_0000650
2392	Ga0495613_0007707
2393	Ga0495613_0332423
2394	Ga0495624_0023168
2395	Ga0495624_0040628
2396	Ga0495624_0082181
2397	Ga0495649_0036062
2398	Ga0495581_0003127
2399	Ga0495581_0019323
2400	Ga0495604_0006866
2401	Ga0495604_0025855
2402	Ga0495604_0027516
2403	Ga0495604_0290784
2404	Ga0495674_0008459
2405	Ga0495674_0069954
2406	Ga0495674_0093019
2407	Ga0495674_0208714
2408	Ga0495672_0133076
2409	Ga0495672_0137431
2410	Ga0495676_0027208
2411	Ga0495676_0146496
2412	Ga0495680_0001711
2413	Ga0495680_0009863
2414	Ga0495687_024676
2415	Ga0495687_080788
2416	Ga0495675_0005291
2417	Ga0495675_0148817
2418	Ga0495675_0267562
2419	Ga0495673_0051615
2420	Ga0495673_0079470
2421	Ga0495681_0001771
2422	Ga0495686_0015184
2423	Ga0495686_0046169
2424	Ga0495686_0060792
2425	Ga0495686_0215198
2426	Ga0495593_0000439
2427	Ga0495593_0011115
2428	Ga0495602_0009113
2429	Ga0495602_0112361
2430	Ga0496100_0239829
2431	Ga0496100_0361047
2432	Ga0496101_0230194
2433	Ga0496101_0389923
2434	Ga0496102_0001771
2435	Ga0496102_0236815
2436	Ga0496103_0110315
2437	Ga0496104_0009950
2438	Ga0496104_0020613
2439	Ga0496104_0048391
2440	Ga0496104_0136187
2441	Ga0496104_0183454
2442	Ga0496105_0009060
2443	Ga0496105_0011039
2444	Ga0496105_0030405
2445	Ga0496105_0050186
2446	Ga0496105_0078455
2447	Ga0496105_0265527
2448	Ga0496106_0009997
2449	Ga0496106_0024362
2450	Ga0496106_0075303
2451	Ga0496106_0080447
2452	Ga0496106_0144906
2453	Ga0496107_0036192
2454	Ga0496107_0081293
2455	Ga0496107_0087790
2456	Ga0496107_0156403
2457	Ga0496107_0250797
2458	Ga0496107_0295121
2459	Ga0496107_0360167
2460	Ga0496108_0006149
2461	Ga0496108_0052308
2462	Ga0496108_0066703
2463	Ga0496108_0171015
2464	Ga0496108_0460371
2465	Ga0496109_0003373
2466	Ga0496109_0031880
2467	Ga0496109_0067050
2468	Ga0496109_0328347
2469	Ga0496110_0004493
2470	Ga0496110_0055465
2471	Ga0496110_0060878
2472	Ga0496110_0111575
2473	Ga0496110_0229981
2474	Ga0496110_0266126
2475	Ga0496110_0349744
2476	Ga0496111_0029145
2477	Ga0496111_0039869
2478	Ga0496111_0108886
2479	Ga0496111_0239188
2480	Ga0496111_0251845
2481	Ga0496112_0000017
2482	Ga0496112_0013582
2483	Ga0496112_0017643
2484	Ga0496112_0019263
2485	Ga0496112_0023520
2486	Ga0496112_0137365
2487	Ga0496112_0258947
2488	Ga0496113_0011007
2489	Ga0496113_0031143
2490	Ga0496113_0071067
2491	Ga0496113_0098584
2492	Ga0496113_0111346
2493	Ga0496113_0117920
2494	Ga0496114_0011547
2495	Ga0496114_0075593
2496	Ga0496114_0266637
2497	Ga0496115_0000535
2498	Ga0496115_0002841
2499	Ga0496115_0019252
2500	Ga0496115_0034965
2501	Ga0496115_0281783
2502	Ga0496115_0323774
2503	Ga0496116_0003125
2504	Ga0496116_0040044
2505	Ga0496117_0030138
2506	Ga0496117_0035196
2507	Ga0496117_0040628
2508	Ga0496117_0118917
2509	Ga0496117_0208330
2510	Ga0496118_0003407
2511	Ga0496118_0046295
2512	Ga0496118_0069280
2513	Ga0496118_0088763
2514	Ga0496119_0001101
2515	Ga0496119_0007752
2516	Ga0496119_0008841
2517	Ga0496119_0103668
2518	Ga0496119_0117286
2519	Ga0496119_0167292
2520	Ga0496119_0177755
2521	Ga0496120_0001458
2522	Ga0496120_0009210
2523	Ga0496120_0073827
2524	Ga0496120_0138924
2525	Ga0496121_0000230
2526	Ga0496121_0004694
2527	Ga0496121_0017764
2528	Ga0496121_0024355
2529	Ga0496121_0041666
2530	Ga0496121_0080840
2531	Ga0496121_0091769
2532	Ga0496121_0125237
2533	Ga0496121_0169240
2534	Ga0496121_0192443
2535	Ga0496122_0030277
2536	Ga0496122_0038492
2537	Ga0496122_0073006
2538	Ga0496122_0125370
2539	Ga0496123_0037892
2540	Ga0496123_0041691
2541	Ga0496124_0025798
2542	Ga0496124_0027163
2543	Ga0496124_0133515
2544	Ga0496125_0000040
2545	Ga0496125_0004755
2546	Ga0496125_0022192
2547	Ga0496125_0070258
2548	Ga0496125_0089522
2549	Ga0496125_0165961
2550	Ga0496125_0197085
2551	Ga0496125_0252256
2552	Ga0496126_0002483
2553	Ga0496126_0005712
2554	Ga0496126_0012513
2555	Ga0496126_0019903
2556	Ga0496126_0024496
2557	Ga0496126_0026298
2558	Ga0496126_0037757
2559	Ga0496126_0082588
2560	Ga0496126_0102216
2561	Ga0496126_0113178
2562	Ga0496126_0209858
2563	Ga0495682_0026404
2564	Ga0495682_0046817
2565	Ga0501031_0000007
2566	Ga0501031_0008668
2567	Ga0501031_0029381
2568	Ga0501031_0153083
2569	Ga0501032_0000007
2570	Ga0501032_0000107
2571	Ga0501032_0003811
2572	Ga0501032_0256784
2573	Ga0501033_0000040
2574	Ga0501033_0000144
2575	Ga0501033_0000311
2576	Ga0501033_0000377
2577	Ga0501033_0009009
2578	Ga0501033_0024192
2579	Ga0501033_0123389
2580	Ga0501033_0240288
2581	Ga0501033_0258130
2582	Ga0501034_0000029
2583	Ga0501034_0000039
2584	Ga0501034_0000340
2585	Ga0501034_0000412
2586	Ga0501034_0042626
2587	Ga0501034_0056930
2588	Ga0501034_0062003
2589	Ga0501034_0083900
2590	Ga0501034_0159669
2591	Ga0501034_0224874
2592	Ga0501034_0260170
2593	Ga0501036_0000004
2594	Ga0501036_0000007
2595	Ga0501036_0000127
2596	Ga0501036_0017468
2597	Ga0501037_0000004
2598	Ga0501037_0000025
2599	Ga0501037_0000066
2600	Ga0501037_0000198
2601	Ga0501037_0178247
2602	Ga0501038_0000005
2603	Ga0501038_0000026
2604	Ga0501038_0000342
2605	Ga0501038_0048255
2606	Ga0501039_0000005
2607	Ga0501039_0000009
2608	Ga0501039_0000840
2609	Ga0501039_0128660
2610	Ga0501039_0205172
2611	Ga0501040_0000754
2612	Ga0501043_0000036
2613	Ga0501043_0000100
2614	Ga0501043_0000120
2615	Ga0501043_0000836
2616	Ga0501043_0050992
2617	Ga0501043_0056514
2618	Ga0501043_0141832
2619	Ga0501046_0000359
2620	Ga0501046_0002399
2621	Ga0501046_0062699
2622	Ga0501046_0164346
2623	Ga0501047_0000209
2624	Ga0501047_0000379
2625	Ga0501047_0000895
2626	Ga0501047_0007647
2627	Ga0501047_0022062
2628	Ga0501047_0117808
2629	Ga0501047_0209162
2630	Ga0501048_0000352
2631	Ga0501048_0004356
2632	Ga0501067_0000025
2633	Ga0501067_0048682
2634	Ga0501067_0160307
2635	Ga0501068_0000801
2636	Ga0501068_0001230
2637	Ga0501068_0024081
2638	Ga0501069_0000020
2639	Ga0501069_0001694
2640	Ga0501069_0016353
2641	Ga0501070_0000174
2642	Ga0501070_0002185
2643	Ga0501070_0005683
2644	Ga0501070_0011186
2645	Ga0501070_0069472
2646	Ga0501070_0135263
2647	Ga0501070_0176217
2648	Ga0501071_0017012
2649	Ga0501072_0149146
2650	Ga0501073_0000070
2651	Ga0501073_0000091
2652	Ga0501073_0015856
2653	Ga0501073_0021242
2654	Ga0501073_0035474
2655	Ga0501074_0000015
2656	Ga0501074_0000489
2657	Ga0501074_0001218
2658	Ga0501074_0120763
2659	Ga0501075_0045965
2660	Ga0501076_0118741
2661	Ga0501079_0096719
2662	Ga0501080_0000132
2663	Ga0501080_0000321
2664	Ga0501080_0026275
2665	Ga0501080_0080954
2666	Ga0501080_0118362
2667	Ga0501080_0146807
2668	Ga0501080_0252213
2669	Ga0501081_0124769
2670	Ga0501083_0000284
2671	Ga0501083_0151276
2672	Ga0501083_0193412
2673	Ga0501035_0000014
2674	Ga0501035_0000016
2675	Ga0501035_0000070
2676	Ga0501035_0000346
2677	Ga0501035_0001251
2678	Ga0501035_0001605
2679	Ga0501035_0011180
2680	Ga0501035_0025723
2681	Ga0501035_0225697
2682	Ga0501035_0361460
2683	Ga0501044_0000012
2684	Ga0501044_0000037
2685	Ga0501044_0000274
2686	Ga0501044_0000383
2687	Ga0501044_0024200
2688	Ga0501044_0057358
2689	Ga0501044_0066220
2690	Ga0501044_0090497
2691	Ga0501044_0102592
2692	Ga0501044_0158683
2693	Ga0501044_0202591
2694	Ga0501045_0020164
2695	nmdc:mga03683_19105_c1
2696	nmdc:mga03683_48412_c1
2697	nmdc:mga03n38_121304_c1
2698	nmdc:mga03n38_2341_c1
2699	nmdc:mga03n38_84717_c1
2700	nmdc:mga00v17_29763_c1
2701	nmdc:mga00v17_60502_c1
2702	nmdc:mga0yw44_247562_c1
2703	nmdc:mga0yw44_72110_c1
2704	nmdc:mga06z11_101586_c1
2705	nmdc:mga06z11_119861_c1
2706	nmdc:mga06z11_246042_c1
2707	nmdc:mga06z11_4265_c1
2708	nmdc:mga06z11_78986_c2
2709	nmdc:mga04h51_1143_c1
2710	nmdc:mga07m45_38017_c1
2711	nmdc:mga07m45_745_c1
2712	nmdc:mga05p37_196560_c1
2713	nmdc:mga09592_18338_c1
2714	nmdc:mga0qj67_76787_c1
2715	nmdc:mga06r32_1860_c1
2716	nmdc:mga0n895_44891_c1
2717	nmdc:mga0rr50_459721_c1
2718	nmdc:mga08x19_102727_c1
2719	nmdc:mga0sz30_1713_c1
2720	nmdc:mga0sz30_23321_c1
2721	nmdc:mga0sz30_24928_c1
2722	nmdc:mga0sz30_45346_c1
2723	Ga0495601_0158215
2724	Ga0495601_0256864
2725	Ga0500635_0075124
2726	Ga0495595_0006301
2727	Ga0495595_0053818
2728	Ga0500578_0168169
2729	Ga0500643_000456
2730	Ga0500646_0008495
2731	Ga0500651_0069381
2732	Ga0500566_0000370
2733	Ga0500566_0006011
2734	Ga0500566_0006917
2735	Ga0500566_0040773
2736	Ga0500640_013671
2737	Ga0500641_0002674
2738	Ga0500641_0027454
2739	Ga0500650_0000365
2740	Ga0500650_0036142
2741	Ga0500554_004225
2742	Ga0500555_003144
2743	Ga0500556_0044111
2744	Ga0500557_000003
2745	Ga0500569_021582
2746	Ga0500572_000024
2747	Ga0500595_000537
2748	Ga0500595_003301
2749	Ga0500595_009837
2750	Ga0500595_016895
2751	Ga0500595_022156
2752	Ga0500608_000807
2753	Ga0500608_001300
2754	Ga0500608_099345
2755	Ga0500618_000334
2756	Ga0500642_0000019
2757	Ga0500642_0000252
2758	Ga0500655_005108
2759	Ga0500559_0001011
2760	Ga0500559_0003877
2761	Ga0500568_0001665
2762	Ga0500577_0000833
2763	Ga0500586_000414
2764	Ga0500590_000050
2765	Ga0500590_017662
2766	Ga0500590_047558
2767	Ga0500603_000391
2768	Ga0500603_000801
2769	Ga0500604_0001275
2770	Ga0500604_0059581
2771	Ga0500616_0000041
2772	Ga0500616_0000210
2773	Ga0500616_0046158
2774	Ga0500620_000042
2775	Ga0500622_0002498
2776	Ga0500627_0029367
2777	Ga0500627_0069753
2778	Ga0500630_000112
2779	Ga0500634_0033049
2780	Ga0500638_047219
2781	Ga0500638_068958
2782	Ga0500639_000040
2783	Ga0500636_0000365
2784	Ga0500636_0012982
2785	Ga0500636_0036809
2786	Ga0500636_0064889
2787	Ga0500637_0000042
2788	Ga0500637_0002167
2789	Ga0500570_082598
2790	Ga0500625_009292
2791	Ga0500645_039063
2792	Ga0500596_000794
2793	Ga0500599_007283
2794	Ga0500601_000203
2795	Ga0501084_0104186
2796	Ga0500661_000056
2797	Ga0500661_015268
2798	Ga0501082_0040063
2799	Ga0530510_0057533
2800	2503198697
2801	2507507680
2802	2508541796
2803	2508692656
2804	2509111107
2805	2509149317
2806	2510315015
2807	2511197977
2808	2511400924
2809	2512962102
2810	2513607902
2811	2513628413
2812	2513642969
2813	2513647497
2814	2513654072
2815	2513679253
2816	2513698087
2817	2513705469
2818	2513719465
2819	2513856824
2820	2513878505
2821	2513891269
2822	2513918412
2823	2514009448
2824	2514024326
2825	2514037202
2826	2514421707
2827	2515626062
2828	2515646152
2829	2515654730
2830	2517040513
2831	2517104141
2832	2517411265
2833	2517891354
2834	2520378830
2835	2524436294
2836	2524468463
2837	2524538460
2838	2528848998
2839	2558861119
2840	2585332647
2841	2585394946
2842	2585824976
2843	2585993168
2844	2599939489
2845	2600193850
2846	2603860915
2847	2616552956
2848	2617346782
2849	2617372711
2850	2617381272
2851	2643757944
2852	2643805291
2853	2644005370
2854	2644064135
2855	2644105330
2856	2644147297
2857	2644200670
2858	2644291297
2859	2644309817
2860	2644333332
2861	2644375741
2862	2644415967
2863	2644449008
2864	2644543475
2865	2644614390
2866	2644674214
2867	2644686468
2868	2657685568
2869	2671114629
2870	2671118866
2871	2688595985
2872	2692319262
2873	2694632799
2874	2694639472
2875	2719389855
2876	2721403494
2877	2723030455
2878	2723564817
2879	2723578132
2880	2723843701
2881	2724035070
2882	2728750066
2883	2728754014
2884	2730110988
2885	2739305594
2886	2745080751
2887	2745082613
2888	2778174592
2889	2792747194
2890	2793065225
2891	2793066722
2892	2793080654
2893	2793331291
2894	2793344447
2895	2793360053
2896	2793367392
2897	2804755187
2898	2805919071
2899	2806055854
2900	2806061302
2901	2806065765
2902	2818236534
2903	2824605713
2904	2824611724
2905	2824620392
2906	2824628560
2907	2824639088
2908	2824649553
2909	2824658215
2910	2824666470
2911	2824674137
2912	2824685665
2913	2824691978
2914	2824701126
2915	2824710247
2916	2824720680
2917	2824730942
2918	2824735842
2919	2824750089
2920	2824755965
2921	2824767503
2922	2824775142
2923	2838032564
2924	2838047581
2925	2838128809
2926	2840881695
2927	2841766398
2928	2841945039
2929	2841953460
2930	2841959708
2931	2841972063
2932	2841978189
2933	2841986184
2934	2842040907
2935	2842046148
2936	2842345732
2937	2842479296
2938	2842485625
2939	2842506545
2940	2842515068
2941	2844008707
2942	2844010811
2943	2844106165
2944	2844166537
2945	2844320005
2946	2847422229
2947	2847938317
2948	2847947723
2949	2848998272
2950	2849078416
2951	2851186666
2952	2851246521
2953	2856322160
2954	2856332531
2955	2856338463
2956	2856355114
2957	2856365541
2958	2857369761
2959	2857511302
2960	2857523887
2961	2857524633
2962	2869170494
2963	2869239438
2964	2869249464
2965	2869262908
2966	2869277225
2967	2869279018
2968	2869284744
2969	2869287016
2970	2871434322
2971	2871437928
2972	2871454338
2973	2871486562
2974	2871492547
2975	2874111300
2976	2874119132
2977	2874142935
2978	2874147457
2979	2874156463
2980	2874165913
2981	2874172453
2982	2874598790
2983	2874607390
2984	2874614590
2985	2874628346
2986	2874635023
2987	2874652246
2988	2876371235
2989	2876381839
2990	2876390242
2991	2876400112
2992	2876407709
2993	2876414651
2994	2876427681
2995	2876765276
2996	2876766224
2997	2876778829
2998	2876814619
2999	2876824276
3000	2878732153
3001	2878740995
3002	2878745848
3003	2878747197
3004	2878758429
3005	2878774470
3006	2878784650
3007	2879082622
3008	2879086097
3009	2879107115
3010	2879114700
3011	2879131539
3012	2879147985
3013	2881154226
3014	2881158008
3015	2881163294
3016	2881371477
3017	2881666560
3018	2881850983
3019	2881856911
3020	2881866803
3021	2882912913
3022	2885323745
3023	2885350578
3024	2885351991
3025	2885370233
3026	2885374991
3027	2885384044
3028	2885410280
3029	2888343400
3030	2888385434
3031	2888392799
3032	2888425868
3033	2889038033
3034	2893069154
3035	2898795429
3036	2903496722
3037	2903519249
3038	2903730320
3039	2903755315
3040	2903769712
3041	2904674035
3042	2904691222
3043	2904701308
3044	2904711990
3045	2906309369
3046	2906327019
3047	2906390459
3048	2906405745
3049	2906412546
3050	2906433675
3051	2906604745
3052	2906616540
3053	2906627327
3054	2906635313
3055	2906648862
3056	2906666858
3057	2908741708
3058	2908759137
3059	2908781154
3060	2913299984
3061	2919078515
3062	2919413356
3063	2922156921
3064	2922175696
3065	2922181182
3066	2922366032
3067	2922372424
3068	2922387367
3069	2922397088
3070	2922431440
3071	2924714927
3072	2924723530
3073	2924734817
3074	2924742272
3075	2924748904
3076	2924778596
3077	2924784247
3078	2924784526
3079	2929621006
3080	2929626163
3081	2932784958
3082	2932795164
3083	2932805692
3084	2932809990
3085	2932818267
3086	2932828795
3087	2933583124
3088	2935609810
3089	2935619785
3090	2935634036
3091	2935638766
3092	2935652160
3093	2935659867
3094	2935666383
3095	2935676571
3096	2935684954
3097	2935694651
3098	2935703772
3099	2935713507
3100	2935724127
3101	2935733515
3102	2935742894
3103	2935750919
3104	2935760550
3105	2935771960
3106	2935784324
3107	2935787652
3108	2935796284
3109	2935801909
3110	2935810680
3111	2935822971
3112	2935828260
3113	2935842464
3114	2935848553
3115	2935857900
3116	2935868758
3117	2935874173
3118	2935883938
3119	2935909639
3120	2935917364
3121	2935927120
3122	2935937036
3123	2935944661
3124	2935953098
3125	2935966599
3126	2935969938
3127	2935980229
3128	2935987011
3129	2935992902
3130	2936002815
3131	2936014283
3132	2936023877
3133	2936031520
3134	2936037900
3135	2936049389
3136	2936062139
3137	2936384463
3138	2937813728
3139	2937845035
3140	2937848839
3141	2937867764
3142	2937878769
3143	2937974450
3144	2937983285
3145	2938022336
3146	2940558278
3147	2941502592
3148	2941510661
3149	2941518045
3150	2941527084
3151	2941531190
3152	2941542513
3153	2952255351
3154	2958041401
3155	2958042375
3156	2958048520
3157	2958058275
3158	2958065222
3159	2958085920
3160	2958097307
3161	2958111820
3162	2958124033
3163	2958131415
3164	2958139621
3165	2958146972
3166	2958158804
3167	2958181240
3168	2961079078
3169	2961133613
3170	2961137375
3171	2961173378
3172	2961184251
3173	2965029979
3174	2965037083
3175	2965054627
3176	2965103158
3177	2965111365
3178	2967998548
3179	2968006026
3180	2968022921
3181	2968121655
3182	2968142659
3183	2970475506
3184	2970492047
3185	2970505971
3186	2970513165
3187	2970534378
3188	2970553279
3189	2970593612
3190	2970599355
3191	2970625486
3192	2970632670
3193	2977826962
3194	2977836884
3195	2977843880
3196	2977856713
3197	2977867751
3198	2977876633
3199	2977904206
3200	2977907989
3201	2977925469
3202	2977941098
3203	2977960594
3204	2979767002
3205	2979775848
3206	2979794610
3207	2979810692
3208	2987646222
3209	2987677341
3210	2989354481
3211	2996355884
3212	2996387051
3213	3000137352
3214	3004173259
3215	3004217003
3216	3004225404
3217	3004235065
3218	3004242256
3219	3004253673
3220	3004271785
3221	3004282310
3222	3004293706
3223	3004337292
3224	3005457599
3225	3005481233
3226	3005484812
3227	3005508450
3228	3005588047
3229	3005600296
3230	3005715790
3231	3005723146
3232	643823865
3233	649870553
3234	8002289714
3235	8003574891
3236	8004301825
3237	8004319500
3238	8004379945
3239	8004390434
3240	8004642558
3241	8004696347
3242	8004715627
3243	8004727872
3244	8005260488
3245	8005275978
3246	8005286279
3247	8005301696
3248	8005383353
3249	8005398947
3250	8005683620
3251	8005695441
3252	8006927959
3253	8006939476
3254	8006972134
3255	8006979226
3256	8006984411
3257	8007001345
3258	8016520679
3259	8016528704
3260	8016533885
3261	8016547107
3262	8016555014
3263	8016563383
3264	8016572221
3265	8016576410
3266	8016594315
3267	8016601134
3268	8016615590
3269	8017064904
3270	8018128504
3271	8018163385
3272	8018180862
3273	8019533654
3274	8019546011
3275	8019552709
3276	8019565355
3277	8019575454
3278	8019584280
3279	8019592048
3280	8019599235
3281	8019609123
3282	8019619796
3283	8019633319
3284	8019649351
3285	8019661193
3286	8019670744
3287	8019685460
3288	8019691049
3289	8055745131
3290	8056381797
3291	8056681089
3292	8056684736
3293	8056693080
3294	8056975088
3295	8057163668
3296	8057531285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

49

157

0.96 PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

181

299

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4z6o-assembly1.cif.gz_B	structure of h200e variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.63 ang resolution	0.9339	3	320
4z6v-assembly1.cif.gz_B	structure of h200q variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.37 ang resolution	0.9319	2	320
5bwg-assembly1.cif.gz_D	structure of h200c variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum at 1.75 ang resolution	0.9313	2	320
4z6q-assembly1.cif.gz_B	structure of h200n variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.57 ang resolution	0.9308	2	320
4ghh-assembly1.cif.gz_A	structure of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.55 ang resolution	0.9286	3	320

ID	Description	Score	Start	End	Superfamily
1mpyD01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9379	13	130	3.10.180.10
1q0cA02	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9271	148	307	3.10.180.10
3b59D01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9256	12	127	3.10.180.10
1f1yA02	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9255	148	286	3.10.180.10
5zszA01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9238	14	133	3.10.180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A440FXN8-F1-model_v4	deleted	0.9917	1	186
AF-A0A5R2N7E1-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase	0.9912	1	175	GO:0004462 GO:0046872 GO:0051213
AF-A0A5R2N7E1-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase	0.9856	1	175	GO:0004462 GO:0046872 GO:0051213
AF-A0A350AGD8-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase	0.9818	1	243	GO:0004462 GO:0046872 GO:0051213
AF-A0A440FXN8-F1-model_v4	deleted	0.9812	1	186

F495196

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

49

157

0.96

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

181

299

0.92

Structural Annotation

Top 5 Hits

Map