F495203

General Info

Members Datasets Scaffolds Average Seq Length
1650 538 3300 102

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100398971|Ga0070683_1003989712
Length 122
Sequence MIELDHLTLAHFIGLGTILFCISVAGLFINRKNVIVLLMAIELMLLAVNMNFVAFSRFLGDVSGQIFVFFILTVAAAESAIGLAILVVLFRNRATINVGEIDTLRGQASGRPNESERKNATA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
127 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
147 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
148 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
156 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
167 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
168 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
169 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
248 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
249 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
254 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
255 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
256 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
260 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
264 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
267 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
268 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
269 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
270 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
271 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
272 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
283 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
284 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
285 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
286 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
287 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
288 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
289 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
295 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
304 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
305 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
306 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
307 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
308 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
309 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
310 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
311 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
312 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
313 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
314 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
315 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
316 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
317 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
318 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
319 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
320 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
321 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
322 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
323 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
324 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
325 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
326 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
327 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
328 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
329 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
330 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
331 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
332 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
333 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
334 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
335 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
336 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
337 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
338 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
339 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
340 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
341 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
342 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
343 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
344 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
345 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
346 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
347 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
348 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
349 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
350 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
351 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
352 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
353 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
354 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
355 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
356 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
357 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
358 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
359 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
360 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
361 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
362 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
363 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
364 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
365 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
366 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
367 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
368 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
378 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
386 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
387 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
392 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
393 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
394 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
395 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
396 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
397 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
407 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
408 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
409 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
410 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
422 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
423 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
424 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
425 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
426 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
427 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
428 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
429 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
430 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
431 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
432 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
441 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
442 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
443 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
463 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
464 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
465 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
466 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
467 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
468 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
469 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
470 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
471 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
472 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
473 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
474 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
475 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
476 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
477 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
478 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
479 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
480 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
481 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
482 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
483 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
484 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
485 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
486 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
487 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
488 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
489 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
490 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
491 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
492 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
493 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
494 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
495 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
496 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
497 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
498 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
499 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
502 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
503 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
504 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
505 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
506 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
507 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
508 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
509 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
510 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
511 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
512 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
513 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
514 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
515 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
516 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
517 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
518 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
519 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
520 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
521 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
523 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
524 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
525 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
526 2643221559 Lysobacter sp. Root559 Isolate Unclassified
527 2643221573 Lysobacter sp. Root604 Isolate Unclassified
528 2643221586 Lysobacter sp. Root667 Isolate Unclassified
529 2643221593 Lysobacter sp. Root690 Isolate Unclassified
530 2643221612 Lysobacter sp. Root76 Isolate Unclassified
531 2643221695 Lysobacter sp. Root494 Isolate Unclassified
532 2643221720 Lysobacter sp. Root916 Isolate Unclassified
533 2643221727 Lysobacter sp. Root96 Isolate Unclassified
534 2643221728 Lysobacter sp. Root983 Isolate Unclassified
535 2919513703 Luteimonas sp. 3794 Isolate Unclassified
536 2919675420 Luteimonas terrae 4099 Isolate Unclassified
537 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
538 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0.97
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0.12
Rhizoplane 3.7
Rhizosphere 78.36
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100398971 3300005329 Bacteria 1312
2 JGI24740J21852_10000470 3300001979 Bacteria 17336
3 JGI24740J21852_10100918 3300001979 Bacteria 735
4 JGI24739J22299_10000039 3300001989 Bacteria 36051
5 JGI24739J22299_10108011 3300001989 Bacteria 836
6 JGI24737J22298_10000773 3300001990 Bacteria 11314
7 JGI24737J22298_10007009 3300001990 Bacteria 3821
8 JGI24737J22298_10007226 3300001990 Bacteria 3756
9 JGI24735J21928_10010500 3300002067 Bacteria 2951
10 JGI24735J21928_10017289 3300002067 Bacteria 2231
11 JGI24744J21845_10109725 3300002077 Bacteria 512
12 JGI25156J39149_1000822 3300002705 Bacteria 15751
13 JGI25156J39149_1001275 3300002705 Bacteria 10926
14 JGI25156J39149_1010679 3300002705 Bacteria 2139
15 JGI25162J39368_1000732 3300002737 Bacteria 22514
16 JGI25154J39366_1003192 3300002738 Bacteria 3610
17 JGI25154J39366_1003368 3300002738 Bacteria 3386
18 JGI25157J39369_1000656 3300002741 Bacteria 19144
19 JGI25157J39369_1000792 3300002741 Bacteria 16143
20 JGI25157J39369_1001513 3300002741 Bacteria 8468
21 JGI25157J39369_1002022 3300002741 Bacteria 5868
22 JGI25157J39369_1002091 3300002741 Bacteria 5656
23 JGI25163J39215_1000172 3300002771 Bacteria 25403
24 JGI25164J39214_1000085 3300002772 Bacteria 92776
25 JGI25164J39214_1000243 3300002772 Bacteria 41571
26 JGI25164J39214_1000994 3300002772 Bacteria 8914
27 JGI25164J39214_1000995 3300002772 Bacteria 8901
28 JGI25164J39214_1004811 3300002772 Bacteria 1517
29 JGI25152J39213_1032881 3300002773 Bacteria 784
30 Ga0006759J45824_1122819 3300003163 Bacteria 612
31 JGI25151J46595_10089409 3300003187 Bacteria 863
32 JGI25165J46597_1000058 3300003214 Bacteria 212833
33 JGI25165J46597_1000090 3300003214 Bacteria 168833
34 JGI25165J46597_1001824 3300003214 Bacteria 8914
35 JGI25165J46597_1006457 3300003214 Bacteria 2078
36 JGI25153J46596_10131115 3300003215 Bacteria 555
37 rootH2_10015394 3300003320 Bacteria 4836
38 Ga0006562J51391_1026821 3300003578 Bacteria 13803
39 Ga0006562J51391_1026824 3300003578 Bacteria 3380
40 JGI25404J52841_10136760 3300003659 Bacteria 519
41 Ga0055538_1002456 3300003751 Bacteria 2710
42 Ga0055539_1000434 3300003752 Bacteria 14786
43 Ga0055533_1000734 3300003756 Bacteria 10594
44 Ga0055533_1001197 3300003756 Bacteria 7268
45 Ga0055525_1000097 3300003759 Bacteria 137371
46 Ga0055527_1000198 3300003760 Bacteria 39703
47 Ga0055527_1000581 3300003760 Bacteria 11933
48 Ga0055535_1000034 3300003761 Bacteria 181954
49 Ga0055535_1001535 3300003761 Bacteria 11334
50 Ga0055535_1001554 3300003761 Bacteria 11198
51 Ga0055535_1001777 3300003761 Bacteria 9499
52 Ga0055535_1003057 3300003761 Bacteria 5068
53 Ga0055535_1007979 3300003761 Bacteria 1959
54 Ga0055542_1000441 3300003762 Bacteria 39703
55 Ga0055542_1001261 3300003762 Bacteria 13798
56 Ga0055542_1001412 3300003762 Bacteria 12090
57 Ga0055542_1001429 3300003762 Bacteria 11933
58 Ga0055542_1002987 3300003762 Bacteria 4933
59 Ga0055542_1002988 3300003762 Bacteria 4932
60 Ga0055529_1000206 3300003763 Bacteria 78192
61 Ga0055529_1000870 3300003763 Bacteria 17327
62 Ga0055529_1001132 3300003763 Bacteria 11360
63 Ga0055529_1001145 3300003763 Bacteria 11198
64 Ga0055529_1035198 3300003763 Bacteria 611
65 Ga0055526_1000021 3300003771 Bacteria 180007
66 Ga0055526_1007069 3300003771 Bacteria 5932
67 Ga0055537_1000186 3300003773 Bacteria 46462
68 Ga0055524_1000062 3300003775 Bacteria 135238
69 Ga0055536_1039212 3300003781 Bacteria 1140
70 Ga0055536_1059790 3300003781 Bacteria 794
71 Ga0055534_1000052 3300003784 Bacteria 91095
72 Ga0055534_1004464 3300003784 Bacteria 4047
73 Ga0055528_1000009 3300003790 Bacteria 224150
74 Ga0055530_10009161 3300003791 Bacteria 3845
75 Ga0055540_1027462 3300003792 Bacteria 1361
76 Ga0055540_1099154 3300003792 Bacteria 544
77 Ga0055531_10003386 3300003794 Bacteria 10187
78 Ga0055531_10024760 3300003794 Bacteria 2201
79 Ga0065165_1006432 3300005262 Bacteria 6162
80 Ga0070658_10003054 3300005327 Bacteria 13838
81 Ga0070658_10506690 3300005327 Bacteria 1043
82 Ga0070658_10616842 3300005327 Bacteria 940
83 Ga0070658_10852760 3300005327 Bacteria 792
84 Ga0070658_10922143 3300005327 Bacteria 759
85 Ga0070676_10208880 3300005328 Bacteria 1284
86 Ga0070676_10216960 3300005328 Bacteria 1262
87 Ga0070676_10311370 3300005328 Bacteria 1071
88 Ga0070676_10379102 3300005328 Bacteria 979
89 Ga0070676_10575862 3300005328 Bacteria 809
90 Ga0070683_100318735 3300005329 Bacteria 1479
91 Ga0070683_100541837 3300005329 Bacteria 1113
92 Ga0070690_100411184 3300005330 Bacteria 996
93 Ga0070690_101494143 3300005330 Bacteria 546
94 Ga0070670_100068818 3300005331 Bacteria 3039
95 Ga0070670_100141643 3300005331 Bacteria 2080
96 Ga0070670_100156846 3300005331 Bacteria 1972
97 Ga0070670_100375681 3300005331 Bacteria 1252
98 Ga0070670_100419130 3300005331 Bacteria 1183
99 Ga0070670_100942112 3300005331 Bacteria 784
100 Ga0070670_101118738 3300005331 Bacteria 719
101 Ga0070670_101565348 3300005331 Bacteria 606
102 Ga0068869_100047959 3300005334 Bacteria 3087
103 Ga0068869_100128761 3300005334 Bacteria 1944
104 Ga0070666_10000003 3300005335 Bacteria 463666
105 Ga0070666_10001186 3300005335 Bacteria 15774
106 Ga0070666_10070889 3300005335 Bacteria 2371
107 Ga0070666_10089151 3300005335 Bacteria 2116
108 Ga0070666_10107381 3300005335 Bacteria 1928
109 Ga0070680_101125684 3300005336 Bacteria 678
110 Ga0070680_101335632 3300005336 Bacteria 621
111 Ga0070680_101515888 3300005336 Bacteria 581
112 Ga0070682_100058779 3300005337 Bacteria 2425
113 Ga0070682_100316697 3300005337 Bacteria 1150
114 Ga0070682_101584440 3300005337 Bacteria 566
115 Ga0068868_100035150 3300005338 Bacteria 3872
116 Ga0068868_100166786 3300005338 Bacteria 1822
117 Ga0068868_100201592 3300005338 Bacteria 1659
118 Ga0068868_100355987 3300005338 Bacteria 1255
119 Ga0068868_100724207 3300005338 Bacteria 892
120 Ga0070660_100133313 3300005339 Bacteria 1989
121 Ga0070660_100252028 3300005339 Bacteria 1440
122 Ga0070660_100878421 3300005339 Bacteria 755
123 Ga0070660_101438456 3300005339 Bacteria 586
124 Ga0070689_100236971 3300005340 Bacteria 1502
125 Ga0070689_100812744 3300005340 Bacteria 823
126 Ga0070691_10017095 3300005341 Bacteria 3338
127 Ga0070687_100645345 3300005343 Bacteria 733
128 Ga0070661_100017074 3300005344 Bacteria 5144
129 Ga0070661_100018867 3300005344 Bacteria 4910
130 Ga0070661_100057112 3300005344 Bacteria 2860
131 Ga0070661_100083093 3300005344 Bacteria 2365
132 Ga0070661_100109495 3300005344 Bacteria 2061
133 Ga0070661_100259293 3300005344 Bacteria 1344
134 Ga0070661_100735824 3300005344 Bacteria 806
135 Ga0070692_10001200 3300005345 Bacteria 9184
136 Ga0070668_100027029 3300005347 Bacteria 4355
137 Ga0070668_100029601 3300005347 Bacteria 4159
138 Ga0070668_100037989 3300005347 Bacteria 3678
139 Ga0070668_100286427 3300005347 Bacteria 1377
140 Ga0070668_100701499 3300005347 Bacteria 893
141 Ga0070668_100853455 3300005347 Bacteria 812
142 Ga0070669_100556490 3300005353 Bacteria 957
143 Ga0070669_100801015 3300005353 Bacteria 801
144 Ga0070669_101688788 3300005353 Bacteria 552
145 Ga0070675_100075966 3300005354 Bacteria 2794
146 Ga0070675_100508634 3300005354 Bacteria 1086
147 Ga0070671_100140699 3300005355 Bacteria 2036
148 Ga0070671_101007524 3300005355 Bacteria 730
149 Ga0070671_101306999 3300005355 Bacteria 640
150 Ga0070671_102088059 3300005355 Bacteria 505
151 Ga0070674_100381466 3300005356 Bacteria 1147
152 Ga0070673_100118935 3300005364 Bacteria 2201
153 Ga0070673_100121644 3300005364 Bacteria 2178
154 Ga0070673_101658429 3300005364 Bacteria 605
155 Ga0070688_100662342 3300005365 Bacteria 805
156 Ga0070659_100295472 3300005366 Bacteria 1350
157 Ga0070659_100720786 3300005366 Bacteria 863
158 Ga0070659_101252060 3300005366 Bacteria 657
159 Ga0070667_100000084 3300005367 Bacteria 118027
160 Ga0070667_100014298 3300005367 Bacteria 6557
161 Ga0070667_100016481 3300005367 Bacteria 6115
162 Ga0070667_100111163 3300005367 Bacteria 2376
163 Ga0070667_100116610 3300005367 Bacteria 2319
164 Ga0070667_100166891 3300005367 Bacteria 1942
165 Ga0070667_100258183 3300005367 Bacteria 1559
166 Ga0070667_100380143 3300005367 Bacteria 1283
167 Ga0070667_100491248 3300005367 Bacteria 1125
168 Ga0070667_100518659 3300005367 Bacteria 1093
169 Ga0070667_100568992 3300005367 Bacteria 1042
170 Ga0070667_100569730 3300005367 Bacteria 1042
171 Ga0070667_100673927 3300005367 Bacteria 956
172 Ga0070667_100714646 3300005367 Bacteria 928
173 Ga0070667_101745029 3300005367 Bacteria 586
174 Ga0070667_101865706 3300005367 Bacteria 566
175 Ga0070709_10610281 3300005434 Bacteria 841
176 Ga0070714_100092322 3300005435 Bacteria 2653
177 Ga0070714_100233190 3300005435 Bacteria 1696
178 Ga0070714_100712286 3300005435 Bacteria 969
179 Ga0070713_100000401 3300005436 Bacteria 27829
180 Ga0070713_101546112 3300005436 Bacteria 644
181 Ga0070711_100847092 3300005439 Bacteria 778
182 Ga0070711_100949692 3300005439 Bacteria 736
183 Ga0070711_101627140 3300005439 Bacteria 565
184 Ga0070711_102041554 3300005439 Bacteria 504
185 Ga0070663_100000327 3300005455 Bacteria 24677
186 Ga0070663_100019945 3300005455 Bacteria 4428
187 Ga0070663_100099652 3300005455 Bacteria 2166
188 Ga0070663_100153698 3300005455 Bacteria 1767
189 Ga0070663_100166357 3300005455 Bacteria 1701
190 Ga0070663_101025064 3300005455 Bacteria 718
191 Ga0070663_101230109 3300005455 Bacteria 659
192 Ga0070678_100025334 3300005456 Bacteria 3988
193 Ga0070678_100082189 3300005456 Bacteria 2445
194 Ga0070678_100802964 3300005456 Bacteria 854
195 Ga0070678_102049207 3300005456 Bacteria 542
196 Ga0070662_100201437 3300005457 Bacteria 1580
197 Ga0070662_100324011 3300005457 Bacteria 1257
198 Ga0070662_100451123 3300005457 Bacteria 1067
199 Ga0070662_100458096 3300005457 Bacteria 1059
200 Ga0070662_100907941 3300005457 Bacteria 752
201 Ga0070662_101204415 3300005457 Bacteria 651
202 Ga0070681_10169047 3300005458 Bacteria 2108
203 Ga0070681_10367131 3300005458 Bacteria 1350
204 Ga0070681_10507270 3300005458 Bacteria 1119
205 Ga0068867_100151954 3300005459 Bacteria 1819
206 Ga0068867_100167454 3300005459 Bacteria 1738
207 Ga0068867_100205089 3300005459 Bacteria 1580
208 Ga0068867_100822787 3300005459 Bacteria 830
209 Ga0068867_101160619 3300005459 Bacteria 708
210 Ga0070685_10005887 3300005466 Bacteria 6239
211 Ga0070685_10659667 3300005466 Bacteria 759
212 Ga0070685_11298692 3300005466 Bacteria 556
213 Ga0070699_100813160 3300005518 Bacteria 855
214 Ga0070679_100193143 3300005530 Bacteria 2004
215 Ga0070679_102188816 3300005530 Bacteria 503
216 Ga0068853_100002704 3300005539 Bacteria 13374
217 Ga0068853_100065726 3300005539 Bacteria 3147
218 Ga0068853_100077969 3300005539 Bacteria 2895
219 Ga0068853_100243932 3300005539 Bacteria 1647
220 Ga0068853_100384322 3300005539 Bacteria 1311
221 Ga0068853_100597911 3300005539 Bacteria 1047
222 Ga0068853_100663150 3300005539 Bacteria 993
223 Ga0068853_100673498 3300005539 Bacteria 986
224 Ga0068853_101016012 3300005539 Bacteria 798
225 Ga0068853_101072473 3300005539 Bacteria 776
226 Ga0068853_101419858 3300005539 Bacteria 671
227 Ga0070672_100268324 3300005543 Bacteria 1440
228 Ga0070672_100274735 3300005543 Bacteria 1423
229 Ga0070696_100026415 3300005546 Bacteria 3950
230 Ga0070696_101086134 3300005546 Bacteria 672
231 Ga0070693_100084649 3300005547 Bacteria 1898
232 Ga0070693_100188355 3300005547 Bacteria 1333
233 Ga0070693_100258338 3300005547 Bacteria 1157
234 Ga0070693_100864475 3300005547 Bacteria 675
235 Ga0070665_100000249 3300005548 Bacteria 89011
236 Ga0070665_100012690 3300005548 Bacteria 8486
237 Ga0070665_100022171 3300005548 Bacteria 6389
238 Ga0070665_100056231 3300005548 Bacteria 3945
239 Ga0070665_100259943 3300005548 Bacteria 1737
240 Ga0070665_100543687 3300005548 Bacteria 1174
241 Ga0070665_100821504 3300005548 Bacteria 942
242 Ga0070665_101151931 3300005548 Bacteria 786
243 Ga0070665_101263570 3300005548 Bacteria 749
244 Ga0070665_101603595 3300005548 Bacteria 659
245 Ga0070665_101749902 3300005548 Bacteria 628
246 Ga0068855_100042228 3300005563 Bacteria 5403
247 Ga0068855_100060595 3300005563 Bacteria 4425
248 Ga0068855_100074780 3300005563 Bacteria 3934
249 Ga0068855_100082771 3300005563 Bacteria 3719
250 Ga0068855_100093629 3300005563 Bacteria 3465
251 Ga0068855_100122346 3300005563 Bacteria 2977
252 Ga0068855_100221989 3300005563 Bacteria 2118
253 Ga0068855_100257604 3300005563 Bacteria 1944
254 Ga0068855_100306227 3300005563 Bacteria 1759
255 Ga0068855_100349227 3300005563 Bacteria 1630
256 Ga0068855_100379456 3300005563 Bacteria 1552
257 Ga0068855_100519186 3300005563 Bacteria 1292
258 Ga0068855_101070197 3300005563 Bacteria 844
259 Ga0068855_101672526 3300005563 Bacteria 650
260 Ga0070664_100066498 3300005564 Bacteria 3078
261 Ga0070664_100159884 3300005564 Bacteria 1993
262 Ga0070664_100410070 3300005564 Bacteria 1240
263 Ga0068857_100000551 3300005577 Bacteria 27318
264 Ga0068857_100148913 3300005577 Bacteria 2119
265 Ga0068857_100208283 3300005577 Bacteria 1784
266 Ga0068857_100225783 3300005577 Bacteria 1711
267 Ga0068857_100636914 3300005577 Bacteria 1010
268 Ga0068857_101718814 3300005577 Bacteria 613
269 Ga0068857_102066812 3300005577 Bacteria 559
270 Ga0068854_100000634 3300005578 Bacteria 20800
271 Ga0068854_100028199 3300005578 Bacteria 3877
272 Ga0068854_100095505 3300005578 Bacteria 2219
273 Ga0068854_100134375 3300005578 Bacteria 1892
274 Ga0068854_100345216 3300005578 Bacteria 1217
275 Ga0068854_100463767 3300005578 Bacteria 1060
276 Ga0068854_100562606 3300005578 Bacteria 969
277 Ga0068856_100000245 3300005614 Bacteria 59235
278 Ga0068856_100015179 3300005614 Bacteria 7440
279 Ga0068856_100034861 3300005614 Bacteria 4931
280 Ga0068856_100252731 3300005614 Bacteria 1778
281 Ga0068856_100372684 3300005614 Bacteria 1446
282 Ga0068856_100452730 3300005614 Bacteria 1304
283 Ga0068856_100734895 3300005614 Bacteria 1007
284 Ga0068856_100735744 3300005614 Bacteria 1006
285 Ga0068856_100761240 3300005614 Bacteria 988
286 Ga0068856_100774353 3300005614 Bacteria 979
287 Ga0068856_101836171 3300005614 Bacteria 617
288 Ga0068852_100038365 3300005616 Bacteria 4025
289 Ga0068852_100118481 3300005616 Bacteria 2419
290 Ga0068852_100166563 3300005616 Bacteria 2062
291 Ga0068852_100502344 3300005616 Bacteria 1207
292 Ga0068852_100531430 3300005616 Bacteria 1174
293 Ga0068852_100662612 3300005616 Bacteria 1052
294 Ga0068852_100761451 3300005616 Bacteria 981
295 Ga0068852_101026213 3300005616 Bacteria 844
296 Ga0068852_101128034 3300005616 Bacteria 805
297 Ga0068852_101410680 3300005616 Bacteria 719
298 Ga0068852_102722405 3300005616 Bacteria 513
299 Ga0068859_100001367 3300005617 Bacteria 24845
300 Ga0068859_100261639 3300005617 Bacteria 1821
301 Ga0068859_100797998 3300005617 Bacteria 1032
302 Ga0068859_100906336 3300005617 Bacteria 966
303 Ga0068859_100972630 3300005617 Bacteria 932
304 Ga0068864_100238138 3300005618 Bacteria 1685
305 Ga0068864_100388209 3300005618 Bacteria 1325
306 Ga0068864_100399545 3300005618 Bacteria 1306
307 Ga0068864_100585219 3300005618 Bacteria 1082
308 Ga0068866_10935768 3300005718 Bacteria 612
309 Ga0068861_100300737 3300005719 Bacteria 1390
310 Ga0068861_100927172 3300005719 Bacteria 827
311 Ga0068851_10002343 3300005834 Bacteria 8336
312 Ga0068851_10176390 3300005834 Bacteria 1182
313 Ga0068851_10221766 3300005834 Bacteria 1063
314 Ga0068851_10484571 3300005834 Bacteria 740
315 Ga0068870_10669774 3300005840 Bacteria 713
316 Ga0068863_100005779 3300005841 Bacteria 12127
317 Ga0068863_100015026 3300005841 Bacteria 7437
318 Ga0068863_100039049 3300005841 Bacteria 4517
319 Ga0068863_100090495 3300005841 Bacteria 2901
320 Ga0068863_100171415 3300005841 Bacteria 2082
321 Ga0068863_101228510 3300005841 Bacteria 755
322 Ga0068863_101273389 3300005841 Bacteria 742
323 Ga0068863_101684782 3300005841 Bacteria 644
324 Ga0068858_100002098 3300005842 Bacteria 20252
325 Ga0068858_100087159 3300005842 Bacteria 2904
326 Ga0068858_100514926 3300005842 Bacteria 1157
327 Ga0068858_102317411 3300005842 Bacteria 531
328 Ga0068860_100002623 3300005843 Bacteria 18693
329 Ga0068860_100125858 3300005843 Bacteria 2456
330 Ga0068860_100153813 3300005843 Bacteria 2216
331 Ga0068860_100231301 3300005843 Bacteria 1796
332 Ga0068860_100306934 3300005843 Bacteria 1556
333 Ga0068860_100798786 3300005843 Bacteria 957
334 Ga0068860_101747859 3300005843 Bacteria 644
335 Ga0068862_100000941 3300005844 Bacteria 28057
336 Ga0068862_100839203 3300005844 Bacteria 900
337 Ga0081455_10094355 3300005937 Bacteria 2417
338 Ga0081455_10541744 3300005937 Bacteria 772
339 Ga0081540_1001118 3300005983 Bacteria 23746
340 Ga0075365_10573912 3300006038 Bacteria 798
341 Ga0075364_10603065 3300006051 Unclassified 750
342 Ga0070716_101083873 3300006173 Bacteria 638
343 Ga0070712_100695102 3300006175 Bacteria 867
344 Ga0070712_101210084 3300006175 Bacteria 657
345 Ga0075367_10334613 3300006178 Unclassified 955
346 Ga0075366_10904500 3300006195 Bacteria 550
347 Ga0097621_100128744 3300006237 Bacteria 2152
348 Ga0097621_100250600 3300006237 Bacteria 1550
349 Ga0097621_100445794 3300006237 Bacteria 1165
350 Ga0097621_100463893 3300006237 Bacteria 1143
351 Ga0097621_101384646 3300006237 Bacteria 666
352 Ga0068871_100038080 3300006358 Bacteria 3837
353 Ga0068871_100111371 3300006358 Bacteria 2302
354 Ga0068871_100169544 3300006358 Bacteria 1870
355 Ga0068871_100362746 3300006358 Bacteria 1283
356 Ga0068871_100383698 3300006358 Bacteria 1248
357 Ga0068871_101410630 3300006358 Bacteria 657
358 Ga0068871_101446288 3300006358 Bacteria 649
359 Ga0075431_100702404 3300006847 Bacteria 989
360 Ga0075434_101493858 3300006871 Bacteria 685
361 Ga0068865_100003492 3300006881 Bacteria 9421
362 Ga0068865_100018704 3300006881 Bacteria 4475
363 Ga0068865_100196150 3300006881 Bacteria 1565
364 Ga0068865_100213578 3300006881 Bacteria 1505
365 Ga0068865_100758994 3300006881 Bacteria 834
366 Ga0068865_101901953 3300006881 Bacteria 539
367 Ga0075436_100124884 3300006914 Bacteria 1803
368 Ga0097620_100001367 3300006931 Bacteria 24845
369 Ga0097620_100261640 3300006931 Bacteria 1821
370 Ga0097620_100798097 3300006931 Bacteria 1032
371 Ga0097620_100906622 3300006931 Bacteria 966
372 Ga0097620_100972635 3300006931 Bacteria 932
373 Ga0099826_10169391 3300006948 Bacteria 1228
374 Ga0105240_10000627 3300009093 Bacteria 65150
375 Ga0105240_10098926 3300009093 Bacteria 3551
376 Ga0105240_10123497 3300009093 Bacteria 3115
377 Ga0105240_10213925 3300009093 Bacteria 2250
378 Ga0105240_10309393 3300009093 Bacteria 1805
379 Ga0105240_10335124 3300009093 Bacteria 1720
380 Ga0105240_10431908 3300009093 Bacteria 1478
381 Ga0105240_10559067 3300009093 Bacteria 1265
382 Ga0105240_10760555 3300009093 Bacteria 1053
383 Ga0105240_10760556 3300009093 Bacteria 1053
384 Ga0105240_11558216 3300009093 Bacteria 692
385 Ga0111539_11813593 3300009094 Bacteria 707
386 Ga0105245_10261611 3300009098 Bacteria 1684
387 Ga0105245_10331048 3300009098 Bacteria 1503
388 Ga0105245_10624776 3300009098 Bacteria 1106
389 Ga0105245_11467698 3300009098 Bacteria 733
390 Ga0105247_10053155 3300009101 Bacteria 2498
391 Ga0105247_10196742 3300009101 Bacteria 1352
392 Ga0105243_10674006 3300009148 Bacteria 1005
393 Ga0105243_12070627 3300009148 Bacteria 604
394 Ga0105241_10050532 3300009174 Bacteria 3169
395 Ga0105241_10104348 3300009174 Bacteria 2258
396 Ga0105241_10122703 3300009174 Bacteria 2094
397 Ga0105241_10295120 3300009174 Bacteria 1389
398 Ga0105241_10354005 3300009174 Bacteria 1276
399 Ga0105241_10622816 3300009174 Bacteria 977
400 Ga0105241_10701426 3300009174 Bacteria 924
401 Ga0105241_10864665 3300009174 Bacteria 837
402 Ga0105241_11223866 3300009174 Bacteria 712
403 Ga0105241_11551149 3300009174 Bacteria 639
404 Ga0105241_11704536 3300009174 Bacteria 612
405 Ga0105241_11788613 3300009174 Bacteria 599
406 Ga0105242_10025509 3300009176 Bacteria 4678
407 Ga0105242_10076451 3300009176 Bacteria 2791
408 Ga0105242_10312729 3300009176 Bacteria 1438
409 Ga0105242_10374891 3300009176 Bacteria 1321
410 Ga0105242_10978358 3300009176 Bacteria 852
411 Ga0105242_11022674 3300009176 Bacteria 835
412 Ga0105248_10000418 3300009177 Bacteria 48728
413 Ga0105248_10076122 3300009177 Bacteria 3772
414 Ga0105248_10326174 3300009177 Bacteria 1729
415 Ga0105248_10451960 3300009177 Bacteria 1448
416 Ga0105248_10843000 3300009177 Bacteria 1035
417 Ga0105237_10000272 3300009545 Bacteria 72718
418 Ga0105237_10006138 3300009545 Bacteria 13433
419 Ga0105237_10026547 3300009545 Bacteria 5919
420 Ga0105237_10031065 3300009545 Bacteria 5418
421 Ga0105237_10147981 3300009545 Bacteria 2344
422 Ga0105237_10245121 3300009545 Bacteria 1793
423 Ga0105237_10352560 3300009545 Bacteria 1476
424 Ga0105237_10525259 3300009545 Bacteria 1190
425 Ga0105237_10573499 3300009545 Bacteria 1135
426 Ga0105237_10659941 3300009545 Bacteria 1053
427 Ga0105237_10659942 3300009545 Bacteria 1053
428 Ga0105237_10706116 3300009545 Bacteria 1015
429 Ga0105237_10980829 3300009545 Bacteria 852
430 Ga0105237_11112211 3300009545 Bacteria 797
431 Ga0105237_11264886 3300009545 Bacteria 744
432 Ga0105237_11359290 3300009545 Bacteria 717
433 Ga0105237_11790736 3300009545 Bacteria 622
434 Ga0105238_10000920 3300009551 Bacteria 30091
435 Ga0105238_10002036 3300009551 Bacteria 20417
436 Ga0105238_10043470 3300009551 Bacteria 4546
437 Ga0105238_10060458 3300009551 Bacteria 3793
438 Ga0105238_10119920 3300009551 Bacteria 2610
439 Ga0105238_10127655 3300009551 Bacteria 2522
440 Ga0105238_10176228 3300009551 Bacteria 2115
441 Ga0105238_10176250 3300009551 Bacteria 2115
442 Ga0105238_10199227 3300009551 Bacteria 1978
443 Ga0105238_11015940 3300009551 Bacteria 850
444 Ga0105238_11210731 3300009551 Bacteria 780
445 Ga0105238_11362851 3300009551 Bacteria 736
446 Ga0105238_12579614 3300009551 Bacteria 544
447 Ga0105249_10000195 3300009553 Bacteria 69709
448 Ga0105249_10027675 3300009553 Bacteria 5116
449 Ga0105249_10216336 3300009553 Bacteria 1883
450 Ga0105249_10356663 3300009553 Bacteria 1483
451 Ga0105249_11155462 3300009553 Bacteria 845
452 Ga0105148_101049 3300009978 Bacteria 1972
453 Ga0105239_10000044 3300010375 Bacteria 187680
454 Ga0105239_10002892 3300010375 Bacteria 21455
455 Ga0105239_10006627 3300010375 Bacteria 13407
456 Ga0105239_10032059 3300010375 Bacteria 5775
457 Ga0105239_10100612 3300010375 Bacteria 3197
458 Ga0105239_10130571 3300010375 Bacteria 2794
459 Ga0105239_10170468 3300010375 Bacteria 2434
460 Ga0105239_10225035 3300010375 Bacteria 2104
461 Ga0105239_10416289 3300010375 Bacteria 1522
462 Ga0105239_10539534 3300010375 Bacteria 1328
463 Ga0105239_10661316 3300010375 Bacteria 1193
464 Ga0105239_11091601 3300010375 Bacteria 918
465 Ga0105239_11337868 3300010375 Bacteria 826
466 Ga0105239_11344595 3300010375 Bacteria 824
467 Ga0105239_12980888 3300010375 Bacteria 552
468 Ga0105246_10341529 3300011119 Bacteria 1224
469 Ga0105246_10840462 3300011119 Bacteria 818
470 Ga0105246_11919937 3300011119 Bacteria 569
471 Ga0157343_1015133 3300012488 Bacteria 641
472 Ga0157314_1013756 3300012500 Bacteria 744
473 Ga0157373_10121166 3300013100 Bacteria 1838
474 Ga0157373_10337468 3300013100 Bacteria 1074
475 Ga0157371_10011946 3300013102 Bacteria 6659
476 Ga0157371_10210003 3300013102 Bacteria 1397
477 Ga0157371_10802598 3300013102 Bacteria 709
478 Ga0157370_10007966 3300013104 Bacteria 11479
479 Ga0157370_10021865 3300013104 Bacteria 6371
480 Ga0157370_10030429 3300013104 Bacteria 5289
481 Ga0157370_10049266 3300013104 Bacteria 4032
482 Ga0157370_10113933 3300013104 Bacteria 2526
483 Ga0157370_10114393 3300013104 Bacteria 2521
484 Ga0157370_10359121 3300013104 Bacteria 1343
485 Ga0157370_10406772 3300013104 Bacteria 1252
486 Ga0157370_10620345 3300013104 Bacteria 989
487 Ga0157370_10745667 3300013104 Bacteria 892
488 Ga0157370_10769083 3300013104 Bacteria 877
489 Ga0157370_11072838 3300013104 Bacteria 728
490 Ga0157370_11495738 3300013104 Bacteria 607
491 Ga0157370_11870415 3300013104 Bacteria 538
492 Ga0157369_10000329 3300013105 Bacteria 63484
493 Ga0157369_10000604 3300013105 Bacteria 46765
494 Ga0157369_10009635 3300013105 Bacteria 11046
495 Ga0157369_10010381 3300013105 Bacteria 10617
496 Ga0157369_10023388 3300013105 Bacteria 6882
497 Ga0157369_10403660 3300013105 Bacteria 1418
498 Ga0157369_10417095 3300013105 Bacteria 1392
499 Ga0157369_10629502 3300013105 Bacteria 1107
500 Ga0157369_10852514 3300013105 Bacteria 935
501 Ga0157369_10857160 3300013105 Bacteria 932
502 Ga0157369_11972512 3300013105 Bacteria 592
503 Ga0157374_10279686 3300013296 Bacteria 1647
504 Ga0157374_10303991 3300013296 Bacteria 1578
505 Ga0157374_10435621 3300013296 Bacteria 1311
506 Ga0157374_10859562 3300013296 Bacteria 924
507 Ga0157374_10921159 3300013296 Bacteria 892
508 Ga0157374_11029757 3300013296 Bacteria 843
509 Ga0157374_12054846 3300013296 Bacteria 598
510 Ga0157378_10001163 3300013297 Bacteria 23938
511 Ga0157378_10036782 3300013297 Bacteria 4332
512 Ga0157378_10460056 3300013297 Bacteria 1264
513 Ga0157378_11489034 3300013297 Bacteria 721
514 Ga0163162_10002333 3300013306 Bacteria 17809
515 Ga0163162_10022472 3300013306 Bacteria 6214
516 Ga0163162_10039066 3300013306 Bacteria 4739
517 Ga0163162_11562272 3300013306 Bacteria 752
518 Ga0163162_12242717 3300013306 Bacteria 627
519 Ga0157372_10023320 3300013307 Bacteria 6708
520 Ga0157372_10023763 3300013307 Bacteria 6649
521 Ga0157372_10038916 3300013307 Bacteria 5249
522 Ga0157372_10072331 3300013307 Bacteria 3886
523 Ga0157372_10082841 3300013307 Bacteria 3632
524 Ga0157372_10189213 3300013307 Bacteria 2384
525 Ga0157372_10206533 3300013307 Bacteria 2276
526 Ga0157372_10375352 3300013307 Bacteria 1657
527 Ga0157372_10431261 3300013307 Bacteria 1536
528 Ga0157372_10779366 3300013307 Bacteria 1111
529 Ga0157372_11383829 3300013307 Bacteria 811
530 Ga0157375_10013024 3300013308 Bacteria 7390
531 Ga0157375_10064653 3300013308 Bacteria 3643
532 Ga0157375_10167400 3300013308 Bacteria 2343
533 Ga0157375_10896503 3300013308 Bacteria 1031
534 Ga0163163_10000754 3300014325 Bacteria 27527
535 Ga0163163_10239681 3300014325 Bacteria 1863
536 Ga0163163_10241793 3300014325 Bacteria 1855
537 Ga0163163_11931750 3300014325 Bacteria 650
538 Ga0157380_12656551 3300014326 Bacteria 567
539 Ga0182008_10066759 3300014497 Bacteria 1770
540 Ga0182008_10166729 3300014497 Bacteria 1110
541 Ga0182008_10389459 3300014497 Bacteria 746
542 Ga0157377_10969725 3300014745 Bacteria 641
543 Ga0157379_10188376 3300014968 Bacteria 1865
544 Ga0157379_10360209 3300014968 Bacteria 1333
545 Ga0157376_10002106 3300014969 Bacteria 13384
546 Ga0157376_10673001 3300014969 Bacteria 1037
547 Ga0157376_11211577 3300014969 Bacteria 783
548 Ga0182006_1013034 3300015261 Bacteria 3621
549 Ga0182007_10034657 3300015262 Bacteria 1704
550 Ga0182007_10207051 3300015262 Bacteria 688
551 Ga0182007_10221888 3300015262 Bacteria 668
552 Ga0182005_1051168 3300015265 Bacteria 1123
553 Ga0183369_1008 3300015685 Bacteria 346514
554 Ga0183368_1003 3300015687 Bacteria 1276390
555 Ga0183360_10001 3300015689 Bacteria 3943671
556 Ga0163161_10331938 3300017792 Bacteria 1204
557 Ga0163161_11073987 3300017792 Bacteria 691
558 Ga0206356_11373589 3300020070 Bacteria 1638
559 Ga0206354_10531980 3300020081 Bacteria 1185
560 Ga0206353_10211211 3300020082 Bacteria 860
561 Ga0154015_1010693 3300020610 Bacteria 1120
562 Ga0213872_10006100 3300021361 Bacteria 6099
563 Ga0209435_102375 3300025206 Bacteria 2214
564 Ga0209435_102791 3300025206 Bacteria 2023
565 Ga0209760_100371 3300025207 Bacteria 11904
566 Ga0209784_100016 3300025224 Bacteria 481036
567 Ga0209566_101455 3300025225 Bacteria 6871
568 Ga0209674_100012 3300025226 Bacteria 950162
569 Ga0209674_100322 3300025226 Bacteria 30565
570 Ga0209674_100347 3300025226 Bacteria 26865
571 Ga0209674_101036 3300025226 Bacteria 8447
572 Ga0209672_100007 3300025228 Bacteria 959482
573 Ga0209672_100078 3300025228 Bacteria 156926
574 Ga0209672_100389 3300025228 Bacteria 26663
575 Ga0209672_100559 3300025228 Bacteria 19837
576 Ga0209672_105497 3300025228 Bacteria 2164
577 Ga0209147_112175 3300025229 Bacteria 931
578 Ga0209563_100079 3300025230 Bacteria 203017
579 Ga0207427_100033 3300025231 Bacteria 338459
580 Ga0207427_100188 3300025231 Bacteria 63213
581 Ga0207427_100402 3300025231 Bacteria 25407
582 Ga0207427_100594 3300025231 Bacteria 18110
583 Ga0207427_102610 3300025231 Bacteria 4622
584 Ga0209437_100012 3300025233 Bacteria 792625
585 Ga0209437_100020 3300025233 Bacteria 656374
586 Ga0209437_100105 3300025233 Bacteria 220034
587 Ga0209437_100192 3300025233 Bacteria 122888
588 Ga0209437_100537 3300025233 Bacteria 26234
589 Ga0209437_101513 3300025233 Bacteria 5500
590 Ga0209258_100012 3300025242 Bacteria 825544
591 Ga0209258_100046 3300025242 Bacteria 369794
592 Ga0209258_100095 3300025242 Bacteria 223270
593 Ga0209258_100238 3300025242 Bacteria 102043
594 Ga0209258_100765 3300025242 Bacteria 19864
595 Ga0209258_101311 3300025242 Bacteria 9204
596 Ga0209258_101904 3300025242 Bacteria 6196
597 Ga0209258_121959 3300025242 Bacteria 656
598 Ga0207425_1001752 3300025245 Bacteria 8476
599 Ga0209646_1001514 3300025246 Bacteria 6161
600 Ga0209646_1001913 3300025246 Bacteria 5063
601 Ga0209646_1001986 3300025246 Bacteria 4915
602 Ga0209026_1000012 3300025250 Bacteria 480426
603 Ga0209026_1000105 3300025250 Bacteria 150738
604 Ga0209026_1000278 3300025250 Bacteria 59676
605 Ga0209026_1000285 3300025250 Bacteria 58221
606 Ga0209026_1000335 3300025250 Bacteria 45678
607 Ga0209026_1030371 3300025250 Bacteria 803
608 Ga0209026_1033302 3300025250 Bacteria 760
609 Ga0209677_103018 3300025253 Bacteria 5800
610 Ga0209148_1000001 3300025254 Bacteria 2545271
611 Ga0209148_1000005 3300025254 Bacteria 1806504
612 Ga0209148_1000014 3300025254 Bacteria 925277
613 Ga0209148_1000039 3300025254 Bacteria 482479
614 Ga0209148_1000087 3300025254 Bacteria 260905
615 Ga0209148_1000098 3300025254 Bacteria 233172
616 Ga0209148_1025941 3300025254 Bacteria 914
617 Ga0209759_1000356 3300025256 Bacteria 59211
618 Ga0209759_1000460 3300025256 Bacteria 46256
619 Ga0209759_1000536 3300025256 Bacteria 39942
620 Ga0209759_1000912 3300025256 Bacteria 21915
621 Ga0209759_1023568 3300025256 Bacteria 1352
622 Ga0209129_1002063 3300025258 Bacteria 10356
623 Ga0209129_1003433 3300025258 Bacteria 6893
624 Ga0209233_1000002 3300025261 Bacteria 2501366
625 Ga0209233_1000020 3300025261 Bacteria 798224
626 Ga0209233_1000080 3300025261 Bacteria 338459
627 Ga0209233_1000370 3300025261 Bacteria 40063
628 Ga0209233_1060127 3300025261 Bacteria 736
629 Ga0209565_1000048 3300025263 Bacteria 224961
630 Ga0209455_1000010 3300025272 Bacteria 959482
631 Ga0209455_1000034 3300025272 Bacteria 483129
632 Ga0209455_1000039 3300025272 Bacteria 437734
633 Ga0209455_1000126 3300025272 Bacteria 165771
634 Ga0209455_1000310 3300025272 Bacteria 49825
635 Ga0209455_1016170 3300025272 Bacteria 1613
636 Ga0209673_1000001 3300025273 Bacteria 3176258
637 Ga0209673_1018372 3300025273 Bacteria 2544
638 Ga0209673_1095729 3300025273 Bacteria 648
639 Ga0209130_1002842 3300025284 Bacteria 8029
640 Ga0209675_1000045 3300025291 Bacteria 225750
641 Ga0209675_1036559 3300025291 Bacteria 1111
642 Ga0209676_1006754 3300025292 Bacteria 5578
643 Ga0209025_1000005 3300025294 Bacteria 1272149
644 Ga0209025_1006351 3300025294 Bacteria 9208
645 Ga0209025_1013061 3300025294 Bacteria 5253
646 Ga0209025_1040960 3300025294 Bacteria 1993
647 Ga0209564_1000001 3300025295 Bacteria 3176258
648 Ga0209564_1039988 3300025295 Bacteria 1280
649 Ga0209758_1000535 3300025297 Bacteria 60513
650 Ga0209758_1009118 3300025297 Bacteria 6254
651 Ga0209758_1012999 3300025297 Bacteria 4591
652 Ga0209050_1001247 3300025298 Bacteria 29383
653 Ga0209256_1000002 3300025299 Bacteria 1906740
654 Ga0209256_1004565 3300025299 Bacteria 8591
655 Ga0209256_1039654 3300025299 Bacteria 1209
656 Ga0207426_1006400 3300025302 Bacteria 5131
657 Ga0207426_1138574 3300025302 Bacteria 581
658 Ga0209051_1014949 3300025303 Bacteria 3598
659 Ga0209051_1019027 3300025303 Bacteria 3013
660 Ga0209051_1031421 3300025303 Bacteria 2043
661 Ga0209257_1000217 3300025304 Bacteria 136049
662 Ga0209257_1016898 3300025304 Bacteria 2913
663 Ga0209257_1041047 3300025304 Bacteria 1375
664 Ga0209257_1107616 3300025304 Bacteria 670
665 Ga0207697_10114964 3300025315 Bacteria 1154
666 Ga0207656_10001733 3300025321 Bacteria 7257
667 Ga0207656_10028858 3300025321 Bacteria 2281
668 Ga0207656_10062176 3300025321 Bacteria 1640
669 Ga0207656_10175900 3300025321 Bacteria 1025
670 Ga0207656_10696310 3300025321 Bacteria 520
671 Ga0207682_10277748 3300025893 Bacteria 783
672 Ga0207692_10138951 3300025898 Bacteria 1380
673 Ga0207710_10020591 3300025900 Bacteria 2821
674 Ga0207680_10000006 3300025903 Bacteria 635950
675 Ga0207680_10001267 3300025903 Bacteria 11957
676 Ga0207680_10053739 3300025903 Bacteria 2419
677 Ga0207680_10224992 3300025903 Bacteria 1288
678 Ga0207680_10394596 3300025903 Bacteria 977
679 Ga0207680_10540156 3300025903 Bacteria 832
680 Ga0207647_10000111 3300025904 Bacteria 62900
681 Ga0207647_10000138 3300025904 Bacteria 57656
682 Ga0207647_10000859 3300025904 Bacteria 23543
683 Ga0207647_10018916 3300025904 Bacteria 4642
684 Ga0207647_10091644 3300025904 Bacteria 1812
685 Ga0207647_10308961 3300025904 Bacteria 899
686 Ga0207647_10323271 3300025904 Bacteria 876
687 Ga0207699_10193317 3300025906 Bacteria 1374
688 Ga0207645_10038319 3300025907 Bacteria 3074
689 Ga0207645_10192165 3300025907 Bacteria 1342
690 Ga0207645_10229743 3300025907 Bacteria 1224
691 Ga0207645_10350588 3300025907 Bacteria 988
692 Ga0207645_10753167 3300025907 Bacteria 662
693 Ga0207643_10178438 3300025908 Bacteria 1284
694 Ga0207705_10000798 3300025909 Bacteria 25879
695 Ga0207705_10009804 3300025909 Bacteria 6971
696 Ga0207654_10004940 3300025911 Bacteria 6748
697 Ga0207654_10027457 3300025911 Bacteria 3094
698 Ga0207654_10044512 3300025911 Bacteria 2522
699 Ga0207654_10073004 3300025911 Bacteria 2044
700 Ga0207654_10074909 3300025911 Bacteria 2021
701 Ga0207654_10348119 3300025911 Bacteria 1020
702 Ga0207654_11388909 3300025911 Bacteria 512
703 Ga0207707_10064913 3300025912 Bacteria 3179
704 Ga0207695_10000033 3300025913 Bacteria 507477
705 Ga0207695_10000811 3300025913 Bacteria 58170
706 Ga0207695_10002522 3300025913 Bacteria 26898
707 Ga0207695_10003038 3300025913 Bacteria 24050
708 Ga0207695_10009508 3300025913 Bacteria 12022
709 Ga0207695_10010778 3300025913 Bacteria 11147
710 Ga0207695_10015564 3300025913 Bacteria 8948
711 Ga0207695_10048491 3300025913 Bacteria 4485
712 Ga0207695_10073143 3300025913 Bacteria 3494
713 Ga0207695_10372772 3300025913 Bacteria 1314
714 Ga0207695_10518226 3300025913 Bacteria 1074
715 Ga0207695_10645359 3300025913 Bacteria 940
716 Ga0207671_10000020 3300025914 Bacteria 309636
717 Ga0207671_10000116 3300025914 Bacteria 122775
718 Ga0207671_10001713 3300025914 Bacteria 24767
719 Ga0207671_10012021 3300025914 Bacteria 6992
720 Ga0207671_10012358 3300025914 Bacteria 6869
721 Ga0207671_10076983 3300025914 Bacteria 2497
722 Ga0207671_10169216 3300025914 Bacteria 1696
723 Ga0207671_10315292 3300025914 Bacteria 1237
724 Ga0207671_10469545 3300025914 Bacteria 1003
725 Ga0207671_10640721 3300025914 Bacteria 846
726 Ga0207671_11105187 3300025914 Bacteria 623
727 Ga0207671_11324007 3300025914 Bacteria 560
728 Ga0207693_10275388 3300025915 Bacteria 1319
729 Ga0207663_10124228 3300025916 Bacteria 1772
730 Ga0207660_10839858 3300025917 Bacteria 750
731 Ga0207660_11339242 3300025917 Bacteria 581
732 Ga0207657_10007879 3300025919 Bacteria 10870
733 Ga0207657_10348016 3300025919 Bacteria 1169
734 Ga0207657_11127448 3300025919 Bacteria 599
735 Ga0207649_10007346 3300025920 Bacteria 5996
736 Ga0207649_10012095 3300025920 Bacteria 4777
737 Ga0207649_10450764 3300025920 Bacteria 971
738 Ga0207649_10484754 3300025920 Bacteria 938
739 Ga0207649_10505985 3300025920 Bacteria 919
740 Ga0207649_10593840 3300025920 Bacteria 851
741 Ga0207652_10735412 3300025921 Bacteria 879
742 Ga0207652_11109887 3300025921 Bacteria 691
743 Ga0207652_11361130 3300025921 Bacteria 613
744 Ga0207681_10321259 3300025923 Bacteria 1231
745 Ga0207681_11587823 3300025923 Bacteria 548
746 Ga0207694_10000298 3300025924 Bacteria 46766
747 Ga0207694_10000613 3300025924 Bacteria 32386
748 Ga0207694_10002589 3300025924 Bacteria 14673
749 Ga0207694_10017252 3300025924 Bacteria 5456
750 Ga0207694_10052522 3300025924 Bacteria 3159
751 Ga0207694_10076987 3300025924 Bacteria 2613
752 Ga0207694_10097903 3300025924 Bacteria 2321
753 Ga0207694_10188934 3300025924 Bacteria 1673
754 Ga0207694_10199790 3300025924 Bacteria 1626
755 Ga0207694_10285197 3300025924 Bacteria 1357
756 Ga0207694_10588990 3300025924 Bacteria 935
757 Ga0207694_10590678 3300025924 Bacteria 934
758 Ga0207694_10770357 3300025924 Bacteria 812
759 Ga0207650_10095582 3300025925 Bacteria 2278
760 Ga0207650_10318005 3300025925 Bacteria 1274
761 Ga0207650_10778652 3300025925 Bacteria 810
762 Ga0207650_11085080 3300025925 Bacteria 681
763 Ga0207650_11300762 3300025925 Bacteria 619
764 Ga0207659_10532511 3300025926 Bacteria 997
765 Ga0207687_10096129 3300025927 Bacteria 2170
766 Ga0207687_10363853 3300025927 Bacteria 1181
767 Ga0207700_10002543 3300025928 Bacteria 10470
768 Ga0207700_11025090 3300025928 Bacteria 738
769 Ga0207700_11074043 3300025928 Bacteria 720
770 Ga0207664_10002383 3300025929 Bacteria 12426
771 Ga0207664_10007284 3300025929 Bacteria 7672
772 Ga0207664_10213080 3300025929 Bacteria 1672
773 Ga0207664_10737564 3300025929 Bacteria 886
774 Ga0207644_10001304 3300025931 Bacteria 16036
775 Ga0207644_10016173 3300025931 Bacteria 5019
776 Ga0207644_11766530 3300025931 Bacteria 518
777 Ga0207690_10000967 3300025932 Bacteria 18375
778 Ga0207690_10093111 3300025932 Bacteria 2134
779 Ga0207706_10002270 3300025933 Bacteria 18770
780 Ga0207706_10077003 3300025933 Bacteria 2934
781 Ga0207706_10385216 3300025933 Bacteria 1216
782 Ga0207706_10533820 3300025933 Bacteria 1011
783 Ga0207686_10010245 3300025934 Bacteria 5100
784 Ga0207670_10192556 3300025936 Bacteria 1544
785 Ga0207669_11965142 3300025937 Bacteria 500
786 Ga0207704_10103961 3300025938 Bacteria 1901
787 Ga0207704_10211891 3300025938 Bacteria 1427
788 Ga0207704_10215845 3300025938 Bacteria 1416
789 Ga0207704_10480609 3300025938 Bacteria 997
790 Ga0207704_11852747 3300025938 Bacteria 519
791 Ga0207665_11491561 3300025939 Bacteria 537
792 Ga0207665_11641398 3300025939 Bacteria 509
793 Ga0207691_10024143 3300025940 Bacteria 5718
794 Ga0207691_10038895 3300025940 Bacteria 4402
795 Ga0207691_10116249 3300025940 Bacteria 2374
796 Ga0207691_10417304 3300025940 Bacteria 1144
797 Ga0207711_10000503 3300025941 Bacteria 40349
798 Ga0207711_10125299 3300025941 Bacteria 2297
799 Ga0207711_10185512 3300025941 Bacteria 1893
800 Ga0207711_10473892 3300025941 Bacteria 1166
801 Ga0207711_10671405 3300025941 Bacteria 967
802 Ga0207711_11369556 3300025941 Bacteria 650
803 Ga0207711_11654523 3300025941 Bacteria 583
804 Ga0207689_10077296 3300025942 Bacteria 2736
805 Ga0207689_10529262 3300025942 Bacteria 989
806 Ga0207661_10834126 3300025944 Bacteria 849
807 Ga0207661_11215245 3300025944 Bacteria 693
808 Ga0207679_10652056 3300025945 Bacteria 952
809 Ga0207667_10001535 3300025949 Bacteria 29037
810 Ga0207667_10001609 3300025949 Bacteria 28404
811 Ga0207667_10006791 3300025949 Bacteria 13820
812 Ga0207667_10019505 3300025949 Bacteria 7567
813 Ga0207667_10026092 3300025949 Bacteria 6389
814 Ga0207667_10037914 3300025949 Bacteria 5150
815 Ga0207667_10059529 3300025949 Bacteria 4000
816 Ga0207667_10261566 3300025949 Bacteria 1769
817 Ga0207667_10304225 3300025949 Bacteria 1629
818 Ga0207667_10591522 3300025949 Bacteria 1119
819 Ga0207667_10774748 3300025949 Bacteria 957
820 Ga0207667_10931147 3300025949 Bacteria 859
821 Ga0207667_11323449 3300025949 Bacteria 696
822 Ga0207651_10195419 3300025960 Bacteria 1617
823 Ga0207651_10493390 3300025960 Bacteria 1057
824 Ga0207651_11539128 3300025960 Bacteria 599
825 Ga0207712_10000277 3300025961 Bacteria 48990
826 Ga0207712_10000477 3300025961 Bacteria 33669
827 Ga0207712_10147728 3300025961 Bacteria 1812
828 Ga0207668_10011169 3300025972 Bacteria 5450
829 Ga0207668_10019520 3300025972 Bacteria 4288
830 Ga0207668_10075249 3300025972 Bacteria 2427
831 Ga0207668_10286079 3300025972 Bacteria 1354
832 Ga0207668_10626346 3300025972 Bacteria 939
833 Ga0207668_10746716 3300025972 Bacteria 863
834 Ga0207640_10002403 3300025981 Bacteria 10021
835 Ga0207640_10015095 3300025981 Bacteria 4464
836 Ga0207640_10016040 3300025981 Bacteria 4348
837 Ga0207640_10069799 3300025981 Bacteria 2361
838 Ga0207640_10148784 3300025981 Bacteria 1717
839 Ga0207640_10155151 3300025981 Bacteria 1687
840 Ga0207640_10461418 3300025981 Bacteria 1049
841 Ga0207640_11348161 3300025981 Bacteria 638
842 Ga0207658_10000286 3300025986 Bacteria 52832
843 Ga0207658_10007375 3300025986 Bacteria 7498
844 Ga0207658_10053046 3300025986 Bacteria 2994
845 Ga0207658_10058890 3300025986 Bacteria 2860
846 Ga0207658_10064327 3300025986 Bacteria 2751
847 Ga0207658_10101859 3300025986 Bacteria 2251
848 Ga0207658_10485862 3300025986 Bacteria 1098
849 Ga0207658_11119123 3300025986 Bacteria 719
850 Ga0207658_11657165 3300025986 Bacteria 584
851 Ga0207658_12078998 3300025986 Bacteria 516
852 Ga0207677_10159632 3300026023 Bacteria 1750
853 Ga0207677_10179200 3300026023 Bacteria 1665
854 Ga0207677_10237178 3300026023 Bacteria 1473
855 Ga0207677_10241627 3300026023 Bacteria 1461
856 Ga0207703_10002250 3300026035 Bacteria 16865
857 Ga0207703_10046054 3300026035 Bacteria 3511
858 Ga0207703_10204383 3300026035 Bacteria 1757
859 Ga0207703_10478331 3300026035 Bacteria 1167
860 Ga0207703_10752524 3300026035 Bacteria 928
861 Ga0207639_10000985 3300026041 Bacteria 19385
862 Ga0207639_10006532 3300026041 Bacteria 7931
863 Ga0207639_10008937 3300026041 Bacteria 6895
864 Ga0207639_10017968 3300026041 Bacteria 5017
865 Ga0207639_10049869 3300026041 Bacteria 3176
866 Ga0207639_10056089 3300026041 Bacteria 3018
867 Ga0207639_10056123 3300026041 Bacteria 3017
868 Ga0207639_10269372 3300026041 Bacteria 1493
869 Ga0207639_10274797 3300026041 Bacteria 1479
870 Ga0207639_10441838 3300026041 Bacteria 1179
871 Ga0207639_10584979 3300026041 Bacteria 1028
872 Ga0207639_11384434 3300026041 Bacteria 660
873 Ga0207678_10001305 3300026067 Bacteria 23111
874 Ga0207678_10004417 3300026067 Bacteria 12652
875 Ga0207678_10010903 3300026067 Bacteria 7985
876 Ga0207678_10030009 3300026067 Bacteria 4746
877 Ga0207678_10101872 3300026067 Bacteria 2451
878 Ga0207678_10159552 3300026067 Bacteria 1926
879 Ga0207678_10174807 3300026067 Bacteria 1834
880 Ga0207678_10200544 3300026067 Bacteria 1706
881 Ga0207678_10987390 3300026067 Bacteria 745
882 Ga0207678_11912761 3300026067 Bacteria 517
883 Ga0207702_10000236 3300026078 Bacteria 63978
884 Ga0207702_10010360 3300026078 Bacteria 7808
885 Ga0207702_10015281 3300026078 Bacteria 6364
886 Ga0207702_10072033 3300026078 Bacteria 2977
887 Ga0207702_10096660 3300026078 Bacteria 2598
888 Ga0207702_10331866 3300026078 Bacteria 1451
889 Ga0207702_10457507 3300026078 Bacteria 1239
890 Ga0207702_10553413 3300026078 Bacteria 1126
891 Ga0207702_10563356 3300026078 Bacteria 1115
892 Ga0207702_10815717 3300026078 Bacteria 923
893 Ga0207702_11499820 3300026078 Bacteria 668
894 Ga0207641_10010609 3300026088 Bacteria 7559
895 Ga0207641_10020369 3300026088 Bacteria 5447
896 Ga0207641_10131445 3300026088 Bacteria 2248
897 Ga0207641_10229076 3300026088 Bacteria 1726
898 Ga0207641_10291827 3300026088 Bacteria 1537
899 Ga0207641_10900498 3300026088 Bacteria 878
900 Ga0207641_11225622 3300026088 Bacteria 750
901 Ga0207648_10012324 3300026089 Bacteria 8004
902 Ga0207648_10117053 3300026089 Bacteria 2342
903 Ga0207648_10184374 3300026089 Bacteria 1848
904 Ga0207648_10253652 3300026089 Bacteria 1568
905 Ga0207648_11073968 3300026089 Bacteria 755
906 Ga0207648_11828247 3300026089 Bacteria 569
907 Ga0207676_10014128 3300026095 Bacteria 5736
908 Ga0207676_10815964 3300026095 Bacteria 911
909 Ga0207674_10011044 3300026116 Bacteria 10156
910 Ga0207674_10086156 3300026116 Bacteria 3136
911 Ga0207674_10218763 3300026116 Bacteria 1853
912 Ga0207674_10416222 3300026116 Bacteria 1298
913 Ga0207674_10613119 3300026116 Bacteria 1051
914 Ga0207674_10874354 3300026116 Bacteria 866
915 Ga0207674_10927205 3300026116 Bacteria 839
916 Ga0207675_100196738 3300026118 Bacteria 1935
917 Ga0207675_100212013 3300026118 Bacteria 1863
918 Ga0207675_100319070 3300026118 Bacteria 1516
919 Ga0207675_100627521 3300026118 Bacteria 1079
920 Ga0207675_100684184 3300026118 Bacteria 1034
921 Ga0207675_100831982 3300026118 Bacteria 937
922 Ga0207683_10048759 3300026121 Bacteria 3707
923 Ga0207683_10068547 3300026121 Bacteria 3132
924 Ga0207683_11623353 3300026121 Bacteria 596
925 Ga0207698_10002901 3300026142 Bacteria 10253
926 Ga0207698_10020428 3300026142 Bacteria 4558
927 Ga0207698_10035977 3300026142 Bacteria 3629
928 Ga0207698_10096916 3300026142 Bacteria 2432
929 Ga0207698_10293017 3300026142 Bacteria 1511
930 Ga0207698_10438167 3300026142 Bacteria 1258
931 Ga0207698_10608010 3300026142 Bacteria 1078
932 Ga0207698_10984711 3300026142 Bacteria 853
933 Ga0207698_11159987 3300026142 Bacteria 786
934 Ga0207698_12602308 3300026142 Bacteria 515
935 Ga0209282_1166348 3300027666 Bacteria 1049
936 Ga0265354_1001101 3300028016 Bacteria 4147
937 Ga0265357_1005008 3300028023 Bacteria 1213
938 Ga0268266_10000001 3300028379 Bacteria 4040580
939 Ga0268266_10000006 3300028379 Bacteria 1410021
940 Ga0268266_10000021 3300028379 Bacteria 522453
941 Ga0268266_10038420 3300028379 Bacteria 4075
942 Ga0268266_10126426 3300028379 Bacteria 2282
943 Ga0268266_10624948 3300028379 Bacteria 1036
944 Ga0268266_11777700 3300028379 Bacteria 591
945 Ga0268266_11825168 3300028379 Bacteria 582
946 Ga0268265_10000705 3300028380 Bacteria 32878
947 Ga0268265_10671110 3300028380 Bacteria 998
948 Ga0268264_10011847 3300028381 Bacteria 7185
949 Ga0268264_10014826 3300028381 Bacteria 6402
950 Ga0268264_10052860 3300028381 Bacteria 3388
951 Ga0268264_10450780 3300028381 Bacteria 1246
952 Ga0268264_10769172 3300028381 Bacteria 960
953 Ga0307517_10339098 3300028786 Bacteria 822
954 Ga0307517_10354081 3300028786 Bacteria 796
955 Ga0307515_10160864 3300028794 Bacteria 2291
956 Ga0307515_10203513 3300028794 Bacteria 1848
957 Ga0265338_10340845 3300028800 Bacteria 1080
958 Ga0265770_1000647 3300030878 Bacteria 4832
959 Ga0265760_10016048 3300031090 Bacteria 2148
960 Ga0265760_10227465 3300031090 Bacteria 638
961 Ga0265332_10000014 3300031238 Bacteria 249035
962 Ga0265328_10006973 3300031239 Bacteria 4741
963 Ga0265339_10126686 3300031249 Bacteria 1309
964 Ga0265331_10008554 3300031250 Bacteria 5814
965 Ga0265327_10000133 3300031251 Bacteria 163887
966 Ga0265327_10057675 3300031251 Bacteria 1997
967 Ga0265327_10176840 3300031251 Bacteria 978
968 Ga0307513_10013810 3300031456 Bacteria 9901
969 Ga0307513_10315870 3300031456 Bacteria 1322
970 Ga0307513_10615359 3300031456 Bacteria 795
971 Ga0307509_10799411 3300031507 Bacteria 608
972 Ga0307408_100186114 3300031548 Bacteria 1669
973 Ga0307408_100401588 3300031548 Bacteria 1177
974 Ga0307408_101265687 3300031548 Bacteria 690
975 Ga0307508_10058708 3300031616 Bacteria 3404
976 Ga0307508_10157395 3300031616 Bacteria 1876
977 Ga0307508_10395627 3300031616 Bacteria 973
978 Ga0316575_10018091 3300031665 Bacteria 2683
979 Ga0316575_10041535 3300031665 Bacteria 1819
980 Ga0316575_10264420 3300031665 Bacteria 723
981 Ga0316579_10048118 3300031691 Bacteria 1992
982 Ga0316576_10013894 3300031727 Bacteria 5366
983 Ga0316576_10177082 3300031727 Bacteria 1609
984 Ga0316578_10024244 3300031728 Bacteria 3402
985 Ga0316578_10640072 3300031728 Bacteria 621
986 Ga0307516_10019050 3300031730 Bacteria 7119
987 Ga0307516_10089609 3300031730 Bacteria 2906
988 Ga0307516_10152544 3300031730 Bacteria 2069
989 Ga0307516_10512331 3300031730 Bacteria 854
990 Ga0316577_10027318 3300031733 Bacteria 3182
991 Ga0307413_10146940 3300031824 Bacteria 1637
992 Ga0307413_10547360 3300031824 Bacteria 938
993 Ga0307413_11084950 3300031824 Bacteria 691
994 Ga0307413_11312917 3300031824 Bacteria 633
995 Ga0307410_10081792 3300031852 Bacteria 2270
996 Ga0307410_10727488 3300031852 Bacteria 838
997 Ga0307410_11439453 3300031852 Bacteria 606
998 Ga0307410_11848036 3300031852 Bacteria 537
999 Ga0307406_10007341 3300031901 Bacteria 6110
1000 Ga0307406_10228302 3300031901 Bacteria 1388
1001 Ga0307406_10697107 3300031901 Bacteria 847
1002 Ga0307407_10122594 3300031903 Bacteria 1650
1003 Ga0307407_10795982 3300031903 Bacteria 719
1004 Ga0307412_10017785 3300031911 Bacteria 4260
1005 Ga0307412_10073645 3300031911 Bacteria 2337
1006 Ga0307412_10108346 3300031911 Bacteria 1979
1007 Ga0307412_11264630 3300031911 Bacteria 663
1008 Ga0307409_100357217 3300031995 Bacteria 1381
1009 Ga0307409_101913936 3300031995 Bacteria 622
1010 Ga0307416_100594499 3300032002 Bacteria 1185
1011 Ga0307416_103550834 3300032002 Unclassified 522
1012 Ga0307414_10001343 3300032004 Bacteria 12716
1013 Ga0307414_10001931 3300032004 Bacteria 10728
1014 Ga0307414_10218311 3300032004 Bacteria 1563
1015 Ga0307414_10292332 3300032004 Bacteria 1374
1016 Ga0307414_10647718 3300032004 Bacteria 952
1017 Ga0307414_11016815 3300032004 Bacteria 763
1018 Ga0307411_10161813 3300032005 Bacteria 1677
1019 Ga0307411_10190249 3300032005 Bacteria 1566
1020 Ga0307411_10288321 3300032005 Bacteria 1310
1021 Ga0307415_100410422 3300032126 Bacteria 1159
1022 Ga0316583_10003935 3300032133 Bacteria 5277
1023 Ga0316580_10008155 3300032139 Bacteria 3135
1024 Ga0307510_10005227 3300033180 Bacteria 15430
1025 Ga0373959_0122785 3300034820 Bacteria 636
1026 Ga0373934_0134767 3300035086 Bacteria 1008
1027 Ga0373946_0202653 3300035171 Bacteria 951
1028 Ga0316574_0125565 3300035398 Bacteria 1649
1029 Ga0316574_0177539 3300035398 Bacteria 1370
1030 Ga0316574_0335179 3300035398 Bacteria 959
1031 Ga0316574_0439550 3300035398 Bacteria 818
1032 Ga0316574_0595268 3300035398 Bacteria 684
1033 Ga0373927_0601176 3300035695 Bacteria 727
1034 Ga0373927_0758943 3300035695 Bacteria 641
1035 Ga0373933_0359882 3300035724 Bacteria 946
1036 Ga0373947_0452000 3300035725 Bacteria 870
1037 Ga0373937_0006210 3300036401 Bacteria 10295
1038 Ga0373937_0101909 3300036401 Bacteria 2665
1039 Ga0373937_0864054 3300036401 Bacteria 853
1040 Ga0316582_0002013 3300036647 Bacteria 9334
1041 Ga0316582_0007984 3300036647 Bacteria 5663
1042 Ga0316582_0042210 3300036647 Bacteria 2856
1043 Ga0316582_0393451 3300036647 Bacteria 955
1044 Ga0316584_0002192 3300036712 Bacteria 12239
1045 Ga0373925_1217269 3300037068 Bacteria 619
1046 Ga0395899_0000133 3300037312 Bacteria 114879
1047 Ga0395899_0016504 3300037312 Bacteria 5632
1048 Ga0395899_0042325 3300037312 Bacteria 3401
1049 Ga0395899_0057173 3300037312 Bacteria 2880
1050 Ga0395899_0073593 3300037312 Bacteria 2497
1051 Ga0395899_0288128 3300037312 Bacteria 1115
1052 Ga0395900_0000051 3300037418 Bacteria 224228
1053 Ga0395900_0000061 3300037418 Bacteria 202483
1054 Ga0395900_0114528 3300037418 Bacteria 2767
1055 Ga0395900_0219392 3300037418 Bacteria 1917
1056 Ga0395900_0338283 3300037418 Bacteria 1481
1057 Ga0395898_0000034 3300037466 Bacteria 356745
1058 Ga0395898_0000197 3300037466 Bacteria 155187
1059 Ga0395898_0007788 3300037466 Bacteria 11368
1060 Ga0395898_0011319 3300037466 Bacteria 9274
1061 Ga0395898_0014517 3300037466 Bacteria 8088
1062 Ga0395898_0179719 3300037466 Bacteria 2022
1063 Ga0395898_0669998 3300037466 Bacteria 980
1064 Ga0395898_0777540 3300037466 Bacteria 898
1065 Ga0395905_0000306 3300037471 Bacteria 71299
1066 Ga0395905_0140120 3300037471 Bacteria 2275
1067 Ga0395905_0340379 3300037471 Bacteria 1391
1068 Ga0395905_0537682 3300037471 Bacteria 1069
1069 Ga0395905_1138998 3300037471 Bacteria 683
1070 Ga0316581_0006306 3300037588 Bacteria 3131
1071 Ga0395901_0003676 3300038443 Bacteria 15470
1072 Ga0395901_0009076 3300038443 Bacteria 10066
1073 Ga0395901_0727221 3300038443 Bacteria 988
1074 Ga0395901_1854495 3300038443 Bacteria 551
1075 Ga0395901_1938550 3300038443 Bacteria 536
1076 Ga0436361_0190082 3300039447 Bacteria 1654
1077 Ga0436361_0521891 3300039447 Bacteria 6247
1078 Ga0436363_0368017 3300039450 Bacteria 536
1079 Ga0439436_0000008 3300041404 Bacteria 112977
1080 Ga0439436_0015857 3300041404 Bacteria 2264
1081 Ga0439436_0022021 3300041404 Bacteria 1889
1082 Ga0439436_0024041 3300041404 Bacteria 1800
1083 Ga0439436_0063701 3300041404 Bacteria 1030
1084 Ga0439436_0077543 3300041404 Bacteria 925
1085 Ga0439447_007836 3300041407 Bacteria 3351
1086 Ga0439466_0229527 3300041411 Bacteria 563
1087 Ga0439465_0008559 3300041413 Bacteria 3228
1088 Ga0439465_0012695 3300041413 Bacteria 2634
1089 Ga0439465_0029794 3300041413 Bacteria 1734
1090 Ga0439465_0255027 3300041413 Bacteria 649
1091 Ga0451787_760046 3300041441 Bacteria 1243
1092 Ga0451789_0480807 3300041443 Bacteria 858
1093 Ga0451789_0594797 3300041443 Bacteria 824
1094 Ga0451789_1201078 3300041443 Bacteria 567
1095 Ga0451789_1206445 3300041443 Bacteria 1241
1096 Ga0451791_1110733 3300041451 Bacteria 1550
1097 Ga0451793_0136894 3300041452 Bacteria 843
1098 Ga0451793_1283171 3300041452 Bacteria 931
1099 Ga0451793_1723166 3300041452 Bacteria 1593
1100 Ga0451797_0719793 3300041453 Bacteria 545
1101 Ga0451797_0839044 3300041453 Bacteria 609
1102 Ga0451795_1164357 3300041456 Bacteria 886
1103 Ga0451795_1565558 3300041456 Bacteria 678
1104 Ga0451798_0160268 3300041458 Bacteria 699
1105 Ga0451800_0410448 3300041459 Bacteria 847
1106 Ga0451800_0506376 3300041459 Bacteria 827
1107 Ga0451800_1459324 3300041459 Bacteria 827
1108 Ga0451802_0744649 3300041460 Bacteria 1293
1109 Ga0451802_1852954 3300041460 Bacteria 759
1110 Ga0451804_0003308 3300041463 Bacteria 613
1111 Ga0451804_0340235 3300041463 Bacteria 997
1112 Ga0451807_1507964 3300041486 Bacteria 1203
1113 Ga0451807_1589376 3300041486 Bacteria 572
1114 Ga0451807_1924293 3300041486 Bacteria 1644
1115 Ga0451807_2135600 3300041486 Bacteria 1308
1116 Ga0451807_2735494 3300041486 Bacteria 1433
1117 Ga0451833_0532987 3300041491 Bacteria 618
1118 Ga0451833_0951430 3300041491 Bacteria 898
1119 Ga0451835_0367031 3300041492 Bacteria 593
1120 Ga0451837_0103295 3300041494 Bacteria 975
1121 Ga0451837_0244838 3300041494 Bacteria 1684
1122 Ga0451837_1610330 3300041494 Bacteria 1102
1123 Ga0451841_1138043 3300041498 Bacteria 830
1124 Ga0451849_0244638 3300041505 Bacteria 666
1125 Ga0451849_0355062 3300041505 Bacteria 917
1126 Ga0451849_1085578 3300041505 Bacteria 617
1127 Ga0451851_0574422 3300041507 Bacteria 655
1128 Ga0451843_0007405 3300041509 Bacteria 854
1129 Ga0451843_0905268 3300041509 Bacteria 1864
1130 Ga0451843_1073184 3300041509 Bacteria 818
1131 Ga0451843_1682121 3300041509 Bacteria 1737
1132 Ga0451853_1071901 3300041512 Bacteria 763
1133 Ga0451853_2123261 3300041512 Bacteria 612
1134 Ga0451853_2493278 3300041512 Bacteria 977
1135 Ga0451853_2583559 3300041512 Bacteria 528
1136 Ga0451853_2935955 3300041512 Bacteria 2135
1137 Ga0451853_3209840 3300041512 Bacteria 556
1138 Ga0439431_0011423 3300041997 Bacteria 2029
1139 Ga0439433_0014340 3300041999 Bacteria 1745
1140 Ga0439445_0027544 3300042004 Bacteria 1460
1141 Ga0439445_0029548 3300042004 Bacteria 1417
1142 Ga0439445_0101561 3300042004 Bacteria 816
1143 Ga0439449_0004432 3300042007 Bacteria 5415
1144 Ga0439449_0005563 3300042007 Bacteria 4823
1145 Ga0439449_0011023 3300042007 Bacteria 3409
1146 Ga0439449_0011092 3300042007 Bacteria 3396
1147 Ga0439449_0017334 3300042007 Bacteria 2704
1148 Ga0439449_0041485 3300042007 Bacteria 1711
1149 Ga0439449_0078816 3300042007 Bacteria 1215
1150 Ga0439449_0304020 3300042007 Bacteria 602
1151 Ga0439452_078748 3300042010 Bacteria 720
1152 Ga0439457_045877 3300042014 Bacteria 977
1153 Ga0439462_0058894 3300042015 Bacteria 1038
1154 Ga0439462_0089731 3300042015 Bacteria 843
1155 Ga0439462_0095941 3300042015 Bacteria 815
1156 Ga0439446_0177495 3300042156 Bacteria 711
1157 Ga0439458_0131439 3300042157 Bacteria 663
1158 Ga0450908_002779 3300042184 Bacteria 3407
1159 Ga0439434_0147624 3300042435 Bacteria 777
1160 Ga0439459_0006149 3300042438 Bacteria 1993
1161 Ga0439459_0085371 3300042438 Bacteria 751
1162 Ga0451577_0149158 3300042876 Bacteria 2103
1163 Ga0451577_0501910 3300042876 Bacteria 1101
1164 Ga0466969_0001457 3300044656 Bacteria 12729
1165 Ga0466969_0039210 3300044656 Bacteria 2380
1166 Ga0466969_0055973 3300044656 Bacteria 1927
1167 Ga0466972_0000555 3300044658 Bacteria 18278
1168 Ga0466972_0043049 3300044658 Bacteria 2193
1169 Ga0466982_0000026 3300044672 Bacteria 64525
1170 Ga0466982_0004003 3300044672 Bacteria 6560
1171 Ga0466965_0001099 3300044683 Bacteria 10536
1172 Ga0466965_0046974 3300044683 Bacteria 2137
1173 Ga0466966_0005830 3300044684 Bacteria 8119
1174 Ga0466966_0012407 3300044684 Bacteria 5645
1175 Ga0466966_0695670 3300044684 Bacteria 612
1176 Ga0466961_0010278 3300044693 Bacteria 5964
1177 Ga0466961_0035544 3300044693 Bacteria 3199
1178 Ga0466961_0118349 3300044693 Bacteria 1664
1179 Ga0466961_0127822 3300044693 Bacteria 1593
1180 Ga0466964_0011285 3300044706 Bacteria 3375
1181 Ga0466964_0130651 3300044706 Bacteria 1143
1182 Ga0453684_0001089 3300044712 Bacteria 85906
1183 Ga0453684_0144356 3300044712 Bacteria 2837
1184 Ga0466971_0001957 3300044719 Bacteria 8716
1185 Ga0466971_0068841 3300044719 Bacteria 1605
1186 Ga0466971_0103735 3300044719 Bacteria 1308
1187 Ga0466971_0257274 3300044719 Bacteria 833
1188 Ga0466968_0003504 3300044735 Bacteria 5803
1189 Ga0466968_0004304 3300044735 Bacteria 5316
1190 Ga0466970_0000637 3300044765 Bacteria 17240
1191 Ga0466970_0006813 3300044765 Bacteria 5719
1192 Ga0466970_0043358 3300044765 Bacteria 2393
1193 Ga0466970_0098456 3300044765 Bacteria 1591
1194 Ga0466970_0516756 3300044765 Bacteria 688
1195 Ga0466957_0005542 3300044842 Bacteria 7089
1196 Ga0466957_0030562 3300044842 Bacteria 3216
1197 Ga0466957_0351074 3300044842 Bacteria 1001
1198 Ga0466957_0611920 3300044842 Bacteria 763
1199 Ga0466957_0784745 3300044842 Bacteria 676
1200 Ga0466960_0009574 3300044901 Bacteria 3998
1201 Ga0466960_0243814 3300044901 Bacteria 996
1202 Ga0466959_0019992 3300045049 Bacteria 4927
1203 Ga0466959_0022705 3300045049 Bacteria 4639
1204 Ga0466959_0156385 3300045049 Bacteria 1604
1205 Ga0451576_0000201 3300045051 Bacteria 150175
1206 Ga0451576_0505280 3300045051 Bacteria 1270
1207 Ga0466958_0014964 3300045836 Bacteria 4437
1208 Ga0466958_0119060 3300045836 Bacteria 1652
1209 Ga0466967_0182733 3300045976 Bacteria 1979
1210 Ga0466967_0437907 3300045976 Bacteria 1276
1211 Ga0466967_0796184 3300045976 Bacteria 938
1212 Ga0495617_000424 3300046452 Bacteria 22988
1213 Ga0495629_0048970 3300046459 Bacteria 2963
1214 Ga0495638_0000146 3300046460 Bacteria 111558
1215 Ga0495638_0001668 3300046460 Bacteria 19645
1216 Ga0495638_0001669 3300046460 Bacteria 19642
1217 Ga0495638_0073075 3300046460 Bacteria 2094
1218 Ga0495638_0172342 3300046460 Bacteria 1240
1219 Ga0495641_0031745 3300046461 Bacteria 2521
1220 Ga0495651_0414840 3300046462 Bacteria 876
1221 Ga0495650_0002509 3300046471 Bacteria 14702
1222 Ga0495650_0006285 3300046471 Bacteria 7435
1223 Ga0495580_0145919 3300046472 Bacteria 1640
1224 Ga0495582_0029608 3300046473 Bacteria 3005
1225 Ga0495664_0204018 3300046477 Bacteria 1198
1226 Ga0495584_0258950 3300046491 Bacteria 884
1227 Ga0495585_0004990 3300046492 Bacteria 8485
1228 Ga0495607_0001360 3300046501 Bacteria 21785
1229 Ga0495607_0015098 3300046501 Bacteria 5015
1230 Ga0495583_0016180 3300046506 Bacteria 4020
1231 Ga0495606_0001823 3300046507 Bacteria 27025
1232 Ga0495606_0009315 3300046507 Bacteria 8323
1233 Ga0495606_0112071 3300046507 Bacteria 1644
1234 Ga0495610_0007268 3300046512 Bacteria 7420
1235 Ga0495610_0218642 3300046512 Bacteria 770
1236 Ga0495616_0000400 3300046513 Bacteria 33359
1237 Ga0495620_0111880 3300046515 Bacteria 1081
1238 Ga0495630_0084401 3300046517 Bacteria 2398
1239 Ga0495630_0301731 3300046517 Bacteria 1224
1240 Ga0495631_0003067 3300046518 Bacteria 9224
1241 Ga0495631_0004987 3300046518 Bacteria 6997
1242 Ga0495632_0000004 3300046519 Bacteria 381372
1243 Ga0495632_0006481 3300046519 Bacteria 7517
1244 Ga0495637_0081900 3300046520 Bacteria 1285
1245 Ga0495643_0111285 3300046522 Bacteria 1392
1246 Ga0495643_0147056 3300046522 Bacteria 1170
1247 Ga0495648_0069715 3300046524 Bacteria 2045
1248 Ga0495663_0000892 3300046525 Bacteria 10053
1249 Ga0495665_0036191 3300046531 Bacteria 2635
1250 Ga0495609_0013644 3300046538 Bacteria 3834
1251 Ga0495645_0654105 3300046543 Bacteria 642
1252 Ga0495622_0011411 3300046557 Bacteria 4105
1253 Ga0495622_0418385 3300046557 Bacteria 576
1254 Ga0495633_0283714 3300046558 Bacteria 753
1255 Ga0495656_0006219 3300046615 Bacteria 4177
1256 Ga0495668_0004286 3300046616 Bacteria 10228
1257 Ga0495668_0133484 3300046616 Bacteria 1359
1258 Ga0495611_0000001 3300046648 Bacteria 2628469
1259 Ga0495625_0000001 3300046660 Bacteria 1641829
1260 Ga0495625_0108723 3300046660 Bacteria 1897
1261 Ga0495625_0655523 3300046660 Bacteria 624
1262 Ga0495635_0550182 3300046663 Bacteria 757
1263 Ga0495635_1015615 3300046663 Bacteria 527
1264 Ga0495661_0004892 3300046665 Bacteria 9592
1265 Ga0495657_0090211 3300046675 Bacteria 1968
1266 Ga0495657_0819728 3300046675 Bacteria 531
1267 Ga0495599_0178684 3300046678 Bacteria 1309
1268 Ga0495646_0405921 3300046680 Bacteria 708
1269 Ga0495647_0004669 3300046681 Bacteria 4464
1270 Ga0495658_0004687 3300046683 Bacteria 6725
1271 Ga0495658_0277291 3300046683 Bacteria 1058
1272 Ga0495670_0009378 3300046691 Bacteria 4811
1273 Ga0495670_0079774 3300046691 Bacteria 1666
1274 Ga0495670_0285950 3300046691 Bacteria 882
1275 Ga0495671_0004084 3300046692 Bacteria 8806
1276 Ga0495671_0128936 3300046692 Bacteria 1233
1277 Ga0495649_0000218 3300046694 Bacteria 50633
1278 Ga0495649_0078862 3300046694 Bacteria 1762
1279 Ga0495589_0000236 3300046794 Bacteria 46053
1280 Ga0495600_0159578 3300046809 Bacteria 1458
1281 Ga0495660_0000792 3300046810 Bacteria 23696
1282 Ga0495660_0001210 3300046810 Bacteria 18055
1283 Ga0495636_0003683 3300047318 Bacteria 5959
1284 Ga0495674_0439601 3300047319 Bacteria 1049
1285 Ga0495680_0209275 3300047322 Bacteria 1397
1286 Ga0495683_0001237 3300047323 Bacteria 17374
1287 Ga0495679_000004 3300047446 Bacteria 748056
1288 Ga0495673_0000294 3300047469 Bacteria 67042
1289 Ga0495673_0000670 3300047469 Bacteria 33730
1290 Ga0495684_0065836 3300047471 Bacteria 2755
1291 Ga0495686_0000017 3300047472 Bacteria 435554
1292 Ga0495686_0002339 3300047472 Bacteria 18107
1293 Ga0495686_0327251 3300047472 Bacteria 838
1294 Ga0495614_0660955 3300048089 Bacteria 504
1295 Ga0496100_0019061 3300048903 Bacteria 4085
1296 Ga0496100_0145854 3300048903 Bacteria 1683
1297 Ga0496100_0985182 3300048903 Bacteria 663
1298 Ga0496101_0031070 3300048904 Bacteria 3751
1299 Ga0496101_0048869 3300048904 Bacteria 3041
1300 Ga0496102_0226685 3300048905 Bacteria 1762
1301 Ga0496102_0298877 3300048905 Bacteria 1517
1302 Ga0496103_0997285 3300048906 Bacteria 522
1303 Ga0496104_0000011 3300048907 Bacteria 459358
1304 Ga0496104_0058290 3300048907 Bacteria 3655
1305 Ga0496105_0000015 3300048908 Bacteria 218758
1306 Ga0496105_0002678 3300048908 Bacteria 12978
1307 Ga0496105_0216774 3300048908 Bacteria 1559
1308 Ga0496105_0869095 3300048908 Bacteria 681
1309 Ga0496105_1253327 3300048908 Bacteria 543
1310 Ga0496106_0005633 3300048909 Bacteria 9268
1311 Ga0496106_0099345 3300048909 Bacteria 2256
1312 Ga0496106_0345914 3300048909 Bacteria 1194
1313 Ga0496106_0450830 3300048909 Bacteria 1033
1314 Ga0496107_0361760 3300048910 Bacteria 1080
1315 Ga0496107_0621966 3300048910 Bacteria 797
1316 Ga0496108_0655326 3300048911 Bacteria 912
1317 Ga0496109_0076379 3300048912 Bacteria 3081
1318 Ga0496109_0954675 3300048912 Bacteria 795
1319 Ga0496111_0514662 3300048914 Bacteria 880
1320 Ga0496112_0096940 3300048915 Bacteria 2919
1321 Ga0496112_1306029 3300048915 Bacteria 641
1322 Ga0496113_0003563 3300048916 Bacteria 9337
1323 Ga0496113_0032634 3300048916 Bacteria 3784
1324 Ga0496113_1471177 3300048916 Bacteria 526
1325 Ga0496114_0267913 3300048917 Bacteria 1505
1326 Ga0496114_1501167 3300048917 Bacteria 562
1327 Ga0496115_0000275 3300048918 Bacteria 45169
1328 Ga0496115_0110062 3300048918 Bacteria 2263
1329 Ga0496115_0825272 3300048918 Bacteria 720
1330 Ga0496116_0050219 3300048919 Bacteria 2781
1331 Ga0496116_0057217 3300048919 Bacteria 2551
1332 Ga0496116_0107805 3300048919 Bacteria 1646
1333 Ga0496117_0011886 3300048920 Bacteria 7744
1334 Ga0496117_0028477 3300048920 Bacteria 4325
1335 Ga0496117_0098806 3300048920 Bacteria 1854
1336 Ga0496118_0001213 3300048921 Bacteria 39638
1337 Ga0496118_0003656 3300048921 Bacteria 19100
1338 Ga0496118_0008630 3300048921 Bacteria 10483
1339 Ga0496118_0048646 3300048921 Bacteria 3271
1340 Ga0496118_0054037 3300048921 Bacteria 3046
1341 Ga0496118_0112067 3300048921 Bacteria 1807
1342 Ga0496119_0001455 3300048922 Bacteria 28402
1343 Ga0496119_0047502 3300048922 Bacteria 2670
1344 Ga0496119_0270371 3300048922 Bacteria 849
1345 Ga0496120_0002097 3300048923 Bacteria 21371
1346 Ga0496120_0017747 3300048923 Bacteria 4602
1347 Ga0496121_0000045 3300048924 Bacteria 336130
1348 Ga0496121_0007647 3300048924 Bacteria 12982
1349 Ga0496121_0011769 3300048924 Bacteria 9649
1350 Ga0496121_0024451 3300048924 Bacteria 5775
1351 Ga0496121_0140784 3300048924 Bacteria 1790
1352 Ga0496121_0232401 3300048924 Bacteria 1290
1353 Ga0496121_0266427 3300048924 Bacteria 1180
1354 Ga0496121_0290300 3300048924 Bacteria 1114
1355 Ga0496122_0000440 3300048925 Bacteria 87364
1356 Ga0496122_0024941 3300048925 Bacteria 5218
1357 Ga0496122_0145393 3300048925 Bacteria 1474
1358 Ga0496122_0148068 3300048925 Bacteria 1455
1359 Ga0496122_0345376 3300048925 Bacteria 779
1360 Ga0496122_0360743 3300048925 Bacteria 754
1361 Ga0496123_0009708 3300048926 Bacteria 8625
1362 Ga0496123_0028799 3300048926 Bacteria 4104
1363 Ga0496123_0039503 3300048926 Bacteria 3300
1364 Ga0496123_0108679 3300048926 Bacteria 1591
1365 Ga0496123_0131222 3300048926 Bacteria 1387
1366 Ga0496124_0053164 3300048927 Bacteria 3435
1367 Ga0496124_0147051 3300048927 Bacteria 1853
1368 Ga0496125_0000149 3300048928 Bacteria 154223
1369 Ga0496125_0003559 3300048928 Bacteria 18765
1370 Ga0496125_0049218 3300048928 Bacteria 3505
1371 Ga0496125_0100187 3300048928 Bacteria 2137
1372 Ga0496125_0178110 3300048928 Bacteria 1420
1373 Ga0496126_0007818 3300048929 Bacteria 11656
1374 Ga0496126_0013267 3300048929 Bacteria 8396
1375 Ga0496126_0052512 3300048929 Bacteria 3703
1376 Ga0496126_0206149 3300048929 Bacteria 1657
1377 Ga0496126_0316301 3300048929 Bacteria 1284
1378 Ga0496126_0461445 3300048929 Bacteria 1021
1379 Ga0496126_0531690 3300048929 Bacteria 935
1380 Ga0501308_021341 3300049128 Bacteria 813
1381 Ga0495678_001023 3300049459 Bacteria 23732
1382 Ga0495678_041423 3300049459 Bacteria 1843
1383 Ga0495682_0048783 3300049460 Bacteria 1543
1384 Ga0495682_0061647 3300049460 Bacteria 1353
1385 Ga0501290_061479 3300049513 Bacteria 606
1386 Ga0501312_092391 3300049528 Bacteria 560
1387 Ga0501320_037209 3300049536 Bacteria 626
1388 Ga0501324_043447 3300049540 Bacteria 518
1389 Ga0501336_026609 3300049552 Bacteria 552
1390 Ga0501031_0101788 3300049568 Bacteria 1874
1391 Ga0501031_0235743 3300049568 Bacteria 1190
1392 Ga0501032_0002397 3300049569 Bacteria 14606
1393 Ga0501032_0049264 3300049569 Bacteria 2841
1394 Ga0501032_0070741 3300049569 Bacteria 2326
1395 Ga0501032_0203255 3300049569 Bacteria 1293
1396 Ga0501032_0217392 3300049569 Bacteria 1244
1397 Ga0501032_0874462 3300049569 Bacteria 566
1398 Ga0501033_0000632 3300049570 Bacteria 32512
1399 Ga0501033_0001720 3300049570 Bacteria 19154
1400 Ga0501033_0024689 3300049570 Bacteria 4532
1401 Ga0501033_0117429 3300049570 Bacteria 1932
1402 Ga0501033_0124122 3300049570 Bacteria 1872
1403 Ga0501033_0135168 3300049570 Bacteria 1784
1404 Ga0501033_0157089 3300049570 Bacteria 1638
1405 Ga0501033_0219572 3300049570 Bacteria 1353
1406 Ga0501033_0413091 3300049570 Bacteria 940
1407 Ga0501033_0628946 3300049570 Bacteria 734
1408 Ga0501034_0002437 3300049571 Bacteria 22445
1409 Ga0501034_0002902 3300049571 Bacteria 19931
1410 Ga0501034_0015349 3300049571 Bacteria 7871
1411 Ga0501034_0027193 3300049571 Bacteria 5819
1412 Ga0501034_0125418 3300049571 Bacteria 2553
1413 Ga0501034_0506505 3300049571 Bacteria 1120
1414 Ga0501034_0517410 3300049571 Bacteria 1105
1415 Ga0501034_0612744 3300049571 Bacteria 993
1416 Ga0501036_0009385 3300049572 Bacteria 8049
1417 Ga0501036_0012706 3300049572 Bacteria 6986
1418 Ga0501036_0093648 3300049572 Bacteria 2538
1419 Ga0501036_0197746 3300049572 Bacteria 1691
1420 Ga0501036_0221807 3300049572 Bacteria 1587
1421 Ga0501036_0354262 3300049572 Bacteria 1226
1422 Ga0501036_0807349 3300049572 Bacteria 772
1423 Ga0501037_0001300 3300049573 Bacteria 18362
1424 Ga0501037_0103023 3300049573 Bacteria 2058
1425 Ga0501037_0153572 3300049573 Bacteria 1644
1426 Ga0501037_0170990 3300049573 Bacteria 1544
1427 Ga0501037_0322920 3300049573 Bacteria 1068
1428 Ga0501037_0485949 3300049573 Bacteria 839
1429 Ga0501037_0651938 3300049573 Bacteria 703
1430 Ga0501038_0008023 3300049574 Bacteria 9725
1431 Ga0501038_0033953 3300049574 Bacteria 4488
1432 Ga0501038_0364928 3300049574 Bacteria 1122
1433 Ga0501038_0377437 3300049574 Bacteria 1100
1434 Ga0501038_0661769 3300049574 Bacteria 785
1435 Ga0501038_1027355 3300049574 Bacteria 604
1436 Ga0501039_0009363 3300049575 Bacteria 7465
1437 Ga0501039_0033279 3300049575 Bacteria 3976
1438 Ga0501039_0108130 3300049575 Bacteria 2173
1439 Ga0501039_0111301 3300049575 Bacteria 2140
1440 Ga0501039_0144763 3300049575 Bacteria 1867
1441 Ga0501039_1116322 3300049575 Bacteria 611
1442 Ga0501039_1561525 3300049575 Bacteria 507
1443 Ga0501040_0035524 3300049576 Bacteria 3380
1444 Ga0501040_0100818 3300049576 Bacteria 2014
1445 Ga0501041_0797888 3300049577 Bacteria 605
1446 Ga0501042_0025128 3300049578 Bacteria 4183
1447 Ga0501042_0221535 3300049578 Bacteria 1364
1448 Ga0501043_0001641 3300049579 Bacteria 19430
1449 Ga0501043_0005218 3300049579 Bacteria 10516
1450 Ga0501043_0012916 3300049579 Bacteria 6526
1451 Ga0501043_0104925 3300049579 Bacteria 2221
1452 Ga0501043_0133837 3300049579 Bacteria 1942
1453 Ga0501043_0357269 3300049579 Bacteria 1109
1454 Ga0501043_0587268 3300049579 Bacteria 824
1455 Ga0501043_0684301 3300049579 Bacteria 750
1456 Ga0501046_0009415 3300049580 Bacteria 8443
1457 Ga0501046_0037617 3300049580 Bacteria 3888
1458 Ga0501046_0053750 3300049580 Bacteria 3170
1459 Ga0501046_0088513 3300049580 Bacteria 2384
1460 Ga0501046_0151662 3300049580 Bacteria 1748
1461 Ga0501046_0187324 3300049580 Bacteria 1545
1462 Ga0501046_0237737 3300049580 Bacteria 1344
1463 Ga0501046_0254713 3300049580 Bacteria 1291
1464 Ga0501046_0414233 3300049580 Bacteria 972
1465 Ga0501046_0901862 3300049580 Bacteria 616
1466 Ga0501046_1257857 3300049580 Bacteria 507
1467 Ga0501047_0002573 3300049581 Bacteria 17317
1468 Ga0501047_0009259 3300049581 Bacteria 9300
1469 Ga0501047_0018810 3300049581 Bacteria 6626
1470 Ga0501047_0029549 3300049581 Bacteria 5284
1471 Ga0501047_0073773 3300049581 Bacteria 3285
1472 Ga0501047_0092889 3300049581 Bacteria 2896
1473 Ga0501047_0328782 3300049581 Bacteria 1367
1474 Ga0501047_0401208 3300049581 Bacteria 1204
1475 Ga0501047_0433185 3300049581 Bacteria 1145
1476 Ga0501047_0531502 3300049581 Bacteria 1001
1477 Ga0501047_0662514 3300049581 Bacteria 862
1478 Ga0501047_0858780 3300049581 Bacteria 721
1479 Ga0501047_1367132 3300049581 Bacteria 523
1480 Ga0501048_0026442 3300049582 Bacteria 4225
1481 Ga0501048_0076244 3300049582 Bacteria 2366
1482 Ga0501048_0274276 3300049582 Bacteria 1199
1483 Ga0501048_0315708 3300049582 Bacteria 1113
1484 Ga0501048_0586179 3300049582 Bacteria 800
1485 Ga0501067_0006199 3300049583 Bacteria 6629
1486 Ga0501067_0014755 3300049583 Bacteria 4322
1487 Ga0501068_0131777 3300049584 Bacteria 1563
1488 Ga0501068_0143933 3300049584 Bacteria 1495
1489 Ga0501069_0006685 3300049585 Bacteria 6038
1490 Ga0501069_0066085 3300049585 Bacteria 2022
1491 Ga0501069_0348860 3300049585 Bacteria 872
1492 Ga0501070_0002131 3300049586 Bacteria 17372
1493 Ga0501070_0010864 3300049586 Bacteria 7691
1494 Ga0501070_0013751 3300049586 Bacteria 6817
1495 Ga0501070_0033092 3300049586 Bacteria 4324
1496 Ga0501070_0087275 3300049586 Bacteria 2582
1497 Ga0501070_0123868 3300049586 Bacteria 2136
1498 Ga0501070_0224590 3300049586 Bacteria 1539
1499 Ga0501071_0028649 3300049587 Bacteria 3926
1500 Ga0501071_0031884 3300049587 Bacteria 3739
1501 Ga0501071_0118792 3300049587 Bacteria 1959
1502 Ga0501071_0820344 3300049587 Bacteria 717
1503 Ga0501072_0003391 3300049588 Bacteria 11986
1504 Ga0501072_0027150 3300049588 Bacteria 4467
1505 Ga0501073_0001213 3300049589 Bacteria 18787
1506 Ga0501073_0002194 3300049589 Bacteria 14603
1507 Ga0501073_0008870 3300049589 Bacteria 7435
1508 Ga0501073_0347496 3300049589 Bacteria 1024
1509 Ga0501073_0386775 3300049589 Bacteria 966
1510 Ga0501073_0547597 3300049589 Bacteria 799
1511 Ga0501073_0787524 3300049589 Bacteria 655
1512 Ga0501073_0814274 3300049589 Bacteria 643
1513 Ga0501074_0031338 3300049590 Bacteria 3852
1514 Ga0501074_0033188 3300049590 Bacteria 3740
1515 Ga0501074_0087103 3300049590 Bacteria 2237
1516 Ga0501074_0096715 3300049590 Bacteria 2114
1517 Ga0501074_0119475 3300049590 Bacteria 1884
1518 Ga0501074_0190732 3300049590 Bacteria 1461
1519 Ga0501074_0282753 3300049590 Bacteria 1179
1520 Ga0501074_0699488 3300049590 Bacteria 715
1521 Ga0501075_0003076 3300049591 Bacteria 11147
1522 Ga0501075_0104738 3300049591 Bacteria 2150
1523 Ga0501076_0001078 3300049592 Bacteria 17938
1524 Ga0501076_0420680 3300049592 Bacteria 1099
1525 Ga0501077_0026740 3300049593 Bacteria 3663
1526 Ga0501206_021096 3300049653 Bacteria 929
1527 Ga0501216_158951 3300049660 Bacteria 541
1528 Ga0501217_096638 3300049661 Bacteria 835
1529 Ga0501223_031766 3300049663 Bacteria 1027
1530 Ga0501224_040125 3300049664 Bacteria 708
1531 Ga0501247_053981 3300049677 Bacteria 603
1532 Ga0501249_019448 3300049679 Bacteria 1475
1533 Ga0501250_004457 3300049680 Bacteria 1394
1534 Ga0501252_006724 3300049682 Bacteria 1286
1535 Ga0501252_086169 3300049682 Bacteria 526
1536 Ga0501253_112865 3300049683 Bacteria 650
1537 Ga0501258_040070 3300049687 Bacteria 623
1538 Ga0501259_104530 3300049688 Bacteria 654
1539 Ga0501225_0006481 3300049705 Bacteria 3417
1540 Ga0501225_0083207 3300049705 Bacteria 921
1541 Ga0501079_0097356 3300049741 Bacteria 2281
1542 Ga0501079_0125221 3300049741 Bacteria 1999
1543 Ga0501079_0224507 3300049741 Bacteria 1467
1544 Ga0501079_0241097 3300049741 Bacteria 1412
1545 Ga0501079_0411511 3300049741 Bacteria 1061
1546 Ga0501079_0547118 3300049741 Bacteria 910
1547 Ga0501079_0999878 3300049741 Bacteria 659
1548 Ga0501080_0000791 3300049742 Bacteria 25821
1549 Ga0501080_0001319 3300049742 Bacteria 20660
1550 Ga0501080_0006958 3300049742 Bacteria 10203
1551 Ga0501080_0009707 3300049742 Bacteria 8789
1552 Ga0501080_0018776 3300049742 Bacteria 6400
1553 Ga0501080_0085197 3300049742 Bacteria 2936
1554 Ga0501080_0140553 3300049742 Bacteria 2232
1555 Ga0501080_0145790 3300049742 Bacteria 2188
1556 Ga0501080_0208236 3300049742 Bacteria 1793
1557 Ga0501080_0486833 3300049742 Bacteria 1103
1558 Ga0501080_0632213 3300049742 Bacteria 948
1559 Ga0501080_0849750 3300049742 Bacteria 798
1560 Ga0501081_0008596 3300049743 Bacteria 6636
1561 Ga0501083_0001078 3300049744 Bacteria 18217
1562 Ga0501083_0181210 3300049744 Bacteria 1375
1563 Ga0501263_039215 3300049760 Bacteria 692
1564 Ga0501264_033208 3300049761 Bacteria 602
1565 Ga0501266_003367 3300049763 Bacteria 1989
1566 Ga0501266_022659 3300049763 Bacteria 864
1567 Ga0501268_092644 3300049765 Bacteria 638
1568 Ga0501268_178276 3300049765 Bacteria 505
1569 Ga0501270_162154 3300049767 Bacteria 517
1570 Ga0501271_032041 3300049768 Bacteria 654
1571 Ga0501272_022957 3300049769 Bacteria 758
1572 Ga0501275_085427 3300049772 Bacteria 517
1573 Ga0501279_035089 3300049775 Bacteria 754
1574 Ga0501035_0013600 3300049822 Bacteria 7508
1575 Ga0501035_0027477 3300049822 Bacteria 5200
1576 Ga0501035_0041694 3300049822 Bacteria 4144
1577 Ga0501035_0098449 3300049822 Bacteria 2567
1578 Ga0501035_0252247 3300049822 Bacteria 1498
1579 Ga0501035_0275414 3300049822 Bacteria 1423
1580 Ga0501035_0317572 3300049822 Bacteria 1309
1581 Ga0501035_0545206 3300049822 Bacteria 950
1582 Ga0501035_0744110 3300049822 Bacteria 787
1583 Ga0501044_0016694 3300049823 Bacteria 7882
1584 Ga0501044_0033968 3300049823 Bacteria 5354
1585 Ga0501044_0061827 3300049823 Bacteria 3830
1586 Ga0501044_0110003 3300049823 Bacteria 2764
1587 Ga0501044_0117045 3300049823 Bacteria 2669
1588 Ga0501044_0119037 3300049823 Bacteria 2643
1589 Ga0501044_0403816 3300049823 Bacteria 1278
1590 Ga0501044_0546658 3300049823 Bacteria 1056
1591 Ga0501044_0575223 3300049823 Bacteria 1021
1592 Ga0501044_0702328 3300049823 Bacteria 897
1593 Ga0501044_1369044 3300049823 Bacteria 573
1594 Ga0501044_1614495 3300049823 Bacteria 513
1595 Ga0501045_0040200 3300049824 Bacteria 3404
1596 Ga0501045_0287400 3300049824 Bacteria 1224
1597 Ga0501045_0635430 3300049824 Bacteria 789
1598 Ga0501045_0766648 3300049824 Bacteria 711
1599 nmdc:mga00v17_54986_c1 3300050491 Bacteria 2430
1600 nmdc:mga00v17_69221_c1 3300050491 Bacteria 2184
1601 nmdc:mga06z11_578199_c1 3300050494 Unclassified 683
1602 nmdc:mga07m45_410003_c1 3300050496 Unclassified 786
1603 nmdc:mga07m45_842111_c1 3300050496 Bacteria 525
1604 nmdc:mga06r32_1434109_c1 3300050510 Bacteria 632
1605 nmdc:mga08x19_286436_c1 3300050514 Bacteria 1142
1606 Ga0495612_0353400 3300053078 Bacteria 664
1607 Ga0500610_0004715 3300053079 Bacteria 5468
1608 Ga0500643_000075 3300053087 Bacteria 111465
1609 Ga0500643_003396 3300053087 Bacteria 7696
1610 Ga0500583_0527191 3300053092 Bacteria 552
1611 Ga0500583_0562674 3300053092 Bacteria 528
1612 Ga0500651_0003714 3300053093 Bacteria 8408
1613 Ga0500566_0093620 3300053094 Bacteria 1657
1614 Ga0500555_000207 3300053103 Bacteria 27494
1615 Ga0500556_0383168 3300053104 Bacteria 541
1616 Ga0500597_002583 3300053120 Bacteria 5080
1617 Ga0500614_017765 3300053123 Bacteria 1611
1618 Ga0500568_0001907 3300053139 Bacteria 12824
1619 Ga0500620_083778 3300053155 Bacteria 1107
1620 Ga0500645_001593 3300053730 Bacteria 11275
1621 Ga0501084_0176857 3300054114 Bacteria 1801
1622 Ga0501084_0192523 3300054114 Bacteria 1720
1623 Ga0501084_0246743 3300054114 Bacteria 1507
1624 Ga0501084_0339736 3300054114 Bacteria 1268
1625 Ga0501084_0903412 3300054114 Bacteria 743
1626 Ga0587083_0264676 3300059505 Bacteria 517
1627 Ga0501082_0001359 3300060353 Bacteria 21512
1628 Ga0501082_0005033 3300060353 Bacteria 11528
1629 Ga0501082_0086117 3300060353 Bacteria 2710
1630 Ga0501082_0211950 3300060353 Bacteria 1685
1631 Ga0466962_0005761 3300061719 Bacteria 5951
1632 Ga0466962_0005882 3300061719 Bacteria 5892
1633 Ga0466962_0008347 3300061719 Bacteria 4964
1634 Ga0466962_0335946 3300061719 Bacteria 751
1635 Ga0530510_0006308 3300061734 Bacteria 8249
1636 Ga0530510_0123358 3300061734 Bacteria 1903
1637 2572253579 2571042365 Bacteria 3289345
1638 2643815249 2643221559 Bacteria 4424915
1639 2643879288 2643221573 Bacteria 4784121
1640 2643939927 2643221586 Bacteria 4446529
1641 2643976213 2643221593 Bacteria 6296053
1642 2644076985 2643221612 Bacteria 4361984
1643 2644528914 2643221695 Bacteria 3441323
1644 2644660587 2643221720 Bacteria 4694283
1645 2644695299 2643221727 Bacteria 4415595
1646 2644697948 2643221728 Bacteria 4797149
1647 2919516104 2919513703 Bacteria 3844312
1648 2919677936 2919675420 Bacteria 3969095
1649 2941491121 2941489479 Bacteria 6313767
1650 2995952052 2995948881 Bacteria 6358104
1651 Ga0070683_100398971
1652 JGI24740J21852_10000470
1653 JGI24740J21852_10100918
1654 JGI24739J22299_10000039
1655 JGI24739J22299_10108011
1656 JGI24737J22298_10000773
1657 JGI24737J22298_10007009
1658 JGI24737J22298_10007226
1659 JGI24735J21928_10010500
1660 JGI24735J21928_10017289
1661 JGI24744J21845_10109725
1662 JGI25156J39149_1000822
1663 JGI25156J39149_1001275
1664 JGI25156J39149_1010679
1665 JGI25162J39368_1000732
1666 JGI25154J39366_1003192
1667 JGI25154J39366_1003368
1668 JGI25157J39369_1000656
1669 JGI25157J39369_1000792
1670 JGI25157J39369_1001513
1671 JGI25157J39369_1002022
1672 JGI25157J39369_1002091
1673 JGI25163J39215_1000172
1674 JGI25164J39214_1000085
1675 JGI25164J39214_1000243
1676 JGI25164J39214_1000994
1677 JGI25164J39214_1000995
1678 JGI25164J39214_1004811
1679 JGI25152J39213_1032881
1680 Ga0006759J45824_1122819
1681 JGI25151J46595_10089409
1682 JGI25165J46597_1000058
1683 JGI25165J46597_1000090
1684 JGI25165J46597_1001824
1685 JGI25165J46597_1006457
1686 JGI25153J46596_10131115
1687 rootH2_10015394
1688 Ga0006562J51391_1026821
1689 Ga0006562J51391_1026824
1690 JGI25404J52841_10136760
1691 Ga0055538_1002456
1692 Ga0055539_1000434
1693 Ga0055533_1000734
1694 Ga0055533_1001197
1695 Ga0055525_1000097
1696 Ga0055527_1000198
1697 Ga0055527_1000581
1698 Ga0055535_1000034
1699 Ga0055535_1001535
1700 Ga0055535_1001554
1701 Ga0055535_1001777
1702 Ga0055535_1003057
1703 Ga0055535_1007979
1704 Ga0055542_1000441
1705 Ga0055542_1001261
1706 Ga0055542_1001412
1707 Ga0055542_1001429
1708 Ga0055542_1002987
1709 Ga0055542_1002988
1710 Ga0055529_1000206
1711 Ga0055529_1000870
1712 Ga0055529_1001132
1713 Ga0055529_1001145
1714 Ga0055529_1035198
1715 Ga0055526_1000021
1716 Ga0055526_1007069
1717 Ga0055537_1000186
1718 Ga0055524_1000062
1719 Ga0055536_1039212
1720 Ga0055536_1059790
1721 Ga0055534_1000052
1722 Ga0055534_1004464
1723 Ga0055528_1000009
1724 Ga0055530_10009161
1725 Ga0055540_1027462
1726 Ga0055540_1099154
1727 Ga0055531_10003386
1728 Ga0055531_10024760
1729 Ga0065165_1006432
1730 Ga0070658_10003054
1731 Ga0070658_10506690
1732 Ga0070658_10616842
1733 Ga0070658_10852760
1734 Ga0070658_10922143
1735 Ga0070676_10208880
1736 Ga0070676_10216960
1737 Ga0070676_10311370
1738 Ga0070676_10379102
1739 Ga0070676_10575862
1740 Ga0070683_100318735
1741 Ga0070683_100541837
1742 Ga0070690_100411184
1743 Ga0070690_101494143
1744 Ga0070670_100068818
1745 Ga0070670_100141643
1746 Ga0070670_100156846
1747 Ga0070670_100375681
1748 Ga0070670_100419130
1749 Ga0070670_100942112
1750 Ga0070670_101118738
1751 Ga0070670_101565348
1752 Ga0068869_100047959
1753 Ga0068869_100128761
1754 Ga0070666_10000003
1755 Ga0070666_10001186
1756 Ga0070666_10070889
1757 Ga0070666_10089151
1758 Ga0070666_10107381
1759 Ga0070680_101125684
1760 Ga0070680_101335632
1761 Ga0070680_101515888
1762 Ga0070682_100058779
1763 Ga0070682_100316697
1764 Ga0070682_101584440
1765 Ga0068868_100035150
1766 Ga0068868_100166786
1767 Ga0068868_100201592
1768 Ga0068868_100355987
1769 Ga0068868_100724207
1770 Ga0070660_100133313
1771 Ga0070660_100252028
1772 Ga0070660_100878421
1773 Ga0070660_101438456
1774 Ga0070689_100236971
1775 Ga0070689_100812744
1776 Ga0070691_10017095
1777 Ga0070687_100645345
1778 Ga0070661_100017074
1779 Ga0070661_100018867
1780 Ga0070661_100057112
1781 Ga0070661_100083093
1782 Ga0070661_100109495
1783 Ga0070661_100259293
1784 Ga0070661_100735824
1785 Ga0070692_10001200
1786 Ga0070668_100027029
1787 Ga0070668_100029601
1788 Ga0070668_100037989
1789 Ga0070668_100286427
1790 Ga0070668_100701499
1791 Ga0070668_100853455
1792 Ga0070669_100556490
1793 Ga0070669_100801015
1794 Ga0070669_101688788
1795 Ga0070675_100075966
1796 Ga0070675_100508634
1797 Ga0070671_100140699
1798 Ga0070671_101007524
1799 Ga0070671_101306999
1800 Ga0070671_102088059
1801 Ga0070674_100381466
1802 Ga0070673_100118935
1803 Ga0070673_100121644
1804 Ga0070673_101658429
1805 Ga0070688_100662342
1806 Ga0070659_100295472
1807 Ga0070659_100720786
1808 Ga0070659_101252060
1809 Ga0070667_100000084
1810 Ga0070667_100014298
1811 Ga0070667_100016481
1812 Ga0070667_100111163
1813 Ga0070667_100116610
1814 Ga0070667_100166891
1815 Ga0070667_100258183
1816 Ga0070667_100380143
1817 Ga0070667_100491248
1818 Ga0070667_100518659
1819 Ga0070667_100568992
1820 Ga0070667_100569730
1821 Ga0070667_100673927
1822 Ga0070667_100714646
1823 Ga0070667_101745029
1824 Ga0070667_101865706
1825 Ga0070709_10610281
1826 Ga0070714_100092322
1827 Ga0070714_100233190
1828 Ga0070714_100712286
1829 Ga0070713_100000401
1830 Ga0070713_101546112
1831 Ga0070711_100847092
1832 Ga0070711_100949692
1833 Ga0070711_101627140
1834 Ga0070711_102041554
1835 Ga0070663_100000327
1836 Ga0070663_100019945
1837 Ga0070663_100099652
1838 Ga0070663_100153698
1839 Ga0070663_100166357
1840 Ga0070663_101025064
1841 Ga0070663_101230109
1842 Ga0070678_100025334
1843 Ga0070678_100082189
1844 Ga0070678_100802964
1845 Ga0070678_102049207
1846 Ga0070662_100201437
1847 Ga0070662_100324011
1848 Ga0070662_100451123
1849 Ga0070662_100458096
1850 Ga0070662_100907941
1851 Ga0070662_101204415
1852 Ga0070681_10169047
1853 Ga0070681_10367131
1854 Ga0070681_10507270
1855 Ga0068867_100151954
1856 Ga0068867_100167454
1857 Ga0068867_100205089
1858 Ga0068867_100822787
1859 Ga0068867_101160619
1860 Ga0070685_10005887
1861 Ga0070685_10659667
1862 Ga0070685_11298692
1863 Ga0070699_100813160
1864 Ga0070679_100193143
1865 Ga0070679_102188816
1866 Ga0068853_100002704
1867 Ga0068853_100065726
1868 Ga0068853_100077969
1869 Ga0068853_100243932
1870 Ga0068853_100384322
1871 Ga0068853_100597911
1872 Ga0068853_100663150
1873 Ga0068853_100673498
1874 Ga0068853_101016012
1875 Ga0068853_101072473
1876 Ga0068853_101419858
1877 Ga0070672_100268324
1878 Ga0070672_100274735
1879 Ga0070696_100026415
1880 Ga0070696_101086134
1881 Ga0070693_100084649
1882 Ga0070693_100188355
1883 Ga0070693_100258338
1884 Ga0070693_100864475
1885 Ga0070665_100000249
1886 Ga0070665_100012690
1887 Ga0070665_100022171
1888 Ga0070665_100056231
1889 Ga0070665_100259943
1890 Ga0070665_100543687
1891 Ga0070665_100821504
1892 Ga0070665_101151931
1893 Ga0070665_101263570
1894 Ga0070665_101603595
1895 Ga0070665_101749902
1896 Ga0068855_100042228
1897 Ga0068855_100060595
1898 Ga0068855_100074780
1899 Ga0068855_100082771
1900 Ga0068855_100093629
1901 Ga0068855_100122346
1902 Ga0068855_100221989
1903 Ga0068855_100257604
1904 Ga0068855_100306227
1905 Ga0068855_100349227
1906 Ga0068855_100379456
1907 Ga0068855_100519186
1908 Ga0068855_101070197
1909 Ga0068855_101672526
1910 Ga0070664_100066498
1911 Ga0070664_100159884
1912 Ga0070664_100410070
1913 Ga0068857_100000551
1914 Ga0068857_100148913
1915 Ga0068857_100208283
1916 Ga0068857_100225783
1917 Ga0068857_100636914
1918 Ga0068857_101718814
1919 Ga0068857_102066812
1920 Ga0068854_100000634
1921 Ga0068854_100028199
1922 Ga0068854_100095505
1923 Ga0068854_100134375
1924 Ga0068854_100345216
1925 Ga0068854_100463767
1926 Ga0068854_100562606
1927 Ga0068856_100000245
1928 Ga0068856_100015179
1929 Ga0068856_100034861
1930 Ga0068856_100252731
1931 Ga0068856_100372684
1932 Ga0068856_100452730
1933 Ga0068856_100734895
1934 Ga0068856_100735744
1935 Ga0068856_100761240
1936 Ga0068856_100774353
1937 Ga0068856_101836171
1938 Ga0068852_100038365
1939 Ga0068852_100118481
1940 Ga0068852_100166563
1941 Ga0068852_100502344
1942 Ga0068852_100531430
1943 Ga0068852_100662612
1944 Ga0068852_100761451
1945 Ga0068852_101026213
1946 Ga0068852_101128034
1947 Ga0068852_101410680
1948 Ga0068852_102722405
1949 Ga0068859_100001367
1950 Ga0068859_100261639
1951 Ga0068859_100797998
1952 Ga0068859_100906336
1953 Ga0068859_100972630
1954 Ga0068864_100238138
1955 Ga0068864_100388209
1956 Ga0068864_100399545
1957 Ga0068864_100585219
1958 Ga0068866_10935768
1959 Ga0068861_100300737
1960 Ga0068861_100927172
1961 Ga0068851_10002343
1962 Ga0068851_10176390
1963 Ga0068851_10221766
1964 Ga0068851_10484571
1965 Ga0068870_10669774
1966 Ga0068863_100005779
1967 Ga0068863_100015026
1968 Ga0068863_100039049
1969 Ga0068863_100090495
1970 Ga0068863_100171415
1971 Ga0068863_101228510
1972 Ga0068863_101273389
1973 Ga0068863_101684782
1974 Ga0068858_100002098
1975 Ga0068858_100087159
1976 Ga0068858_100514926
1977 Ga0068858_102317411
1978 Ga0068860_100002623
1979 Ga0068860_100125858
1980 Ga0068860_100153813
1981 Ga0068860_100231301
1982 Ga0068860_100306934
1983 Ga0068860_100798786
1984 Ga0068860_101747859
1985 Ga0068862_100000941
1986 Ga0068862_100839203
1987 Ga0081455_10094355
1988 Ga0081455_10541744
1989 Ga0081540_1001118
1990 Ga0075365_10573912
1991 Ga0075364_10603065
1992 Ga0070716_101083873
1993 Ga0070712_100695102
1994 Ga0070712_101210084
1995 Ga0075367_10334613
1996 Ga0075366_10904500
1997 Ga0097621_100128744
1998 Ga0097621_100250600
1999 Ga0097621_100445794
2000 Ga0097621_100463893
2001 Ga0097621_101384646
2002 Ga0068871_100038080
2003 Ga0068871_100111371
2004 Ga0068871_100169544
2005 Ga0068871_100362746
2006 Ga0068871_100383698
2007 Ga0068871_101410630
2008 Ga0068871_101446288
2009 Ga0075431_100702404
2010 Ga0075434_101493858
2011 Ga0068865_100003492
2012 Ga0068865_100018704
2013 Ga0068865_100196150
2014 Ga0068865_100213578
2015 Ga0068865_100758994
2016 Ga0068865_101901953
2017 Ga0075436_100124884
2018 Ga0097620_100001367
2019 Ga0097620_100261640
2020 Ga0097620_100798097
2021 Ga0097620_100906622
2022 Ga0097620_100972635
2023 Ga0099826_10169391
2024 Ga0105240_10000627
2025 Ga0105240_10098926
2026 Ga0105240_10123497
2027 Ga0105240_10213925
2028 Ga0105240_10309393
2029 Ga0105240_10335124
2030 Ga0105240_10431908
2031 Ga0105240_10559067
2032 Ga0105240_10760555
2033 Ga0105240_10760556
2034 Ga0105240_11558216
2035 Ga0111539_11813593
2036 Ga0105245_10261611
2037 Ga0105245_10331048
2038 Ga0105245_10624776
2039 Ga0105245_11467698
2040 Ga0105247_10053155
2041 Ga0105247_10196742
2042 Ga0105243_10674006
2043 Ga0105243_12070627
2044 Ga0105241_10050532
2045 Ga0105241_10104348
2046 Ga0105241_10122703
2047 Ga0105241_10295120
2048 Ga0105241_10354005
2049 Ga0105241_10622816
2050 Ga0105241_10701426
2051 Ga0105241_10864665
2052 Ga0105241_11223866
2053 Ga0105241_11551149
2054 Ga0105241_11704536
2055 Ga0105241_11788613
2056 Ga0105242_10025509
2057 Ga0105242_10076451
2058 Ga0105242_10312729
2059 Ga0105242_10374891
2060 Ga0105242_10978358
2061 Ga0105242_11022674
2062 Ga0105248_10000418
2063 Ga0105248_10076122
2064 Ga0105248_10326174
2065 Ga0105248_10451960
2066 Ga0105248_10843000
2067 Ga0105237_10000272
2068 Ga0105237_10006138
2069 Ga0105237_10026547
2070 Ga0105237_10031065
2071 Ga0105237_10147981
2072 Ga0105237_10245121
2073 Ga0105237_10352560
2074 Ga0105237_10525259
2075 Ga0105237_10573499
2076 Ga0105237_10659941
2077 Ga0105237_10659942
2078 Ga0105237_10706116
2079 Ga0105237_10980829
2080 Ga0105237_11112211
2081 Ga0105237_11264886
2082 Ga0105237_11359290
2083 Ga0105237_11790736
2084 Ga0105238_10000920
2085 Ga0105238_10002036
2086 Ga0105238_10043470
2087 Ga0105238_10060458
2088 Ga0105238_10119920
2089 Ga0105238_10127655
2090 Ga0105238_10176228
2091 Ga0105238_10176250
2092 Ga0105238_10199227
2093 Ga0105238_11015940
2094 Ga0105238_11210731
2095 Ga0105238_11362851
2096 Ga0105238_12579614
2097 Ga0105249_10000195
2098 Ga0105249_10027675
2099 Ga0105249_10216336
2100 Ga0105249_10356663
2101 Ga0105249_11155462
2102 Ga0105148_101049
2103 Ga0105239_10000044
2104 Ga0105239_10002892
2105 Ga0105239_10006627
2106 Ga0105239_10032059
2107 Ga0105239_10100612
2108 Ga0105239_10130571
2109 Ga0105239_10170468
2110 Ga0105239_10225035
2111 Ga0105239_10416289
2112 Ga0105239_10539534
2113 Ga0105239_10661316
2114 Ga0105239_11091601
2115 Ga0105239_11337868
2116 Ga0105239_11344595
2117 Ga0105239_12980888
2118 Ga0105246_10341529
2119 Ga0105246_10840462
2120 Ga0105246_11919937
2121 Ga0157343_1015133
2122 Ga0157314_1013756
2123 Ga0157373_10121166
2124 Ga0157373_10337468
2125 Ga0157371_10011946
2126 Ga0157371_10210003
2127 Ga0157371_10802598
2128 Ga0157370_10007966
2129 Ga0157370_10021865
2130 Ga0157370_10030429
2131 Ga0157370_10049266
2132 Ga0157370_10113933
2133 Ga0157370_10114393
2134 Ga0157370_10359121
2135 Ga0157370_10406772
2136 Ga0157370_10620345
2137 Ga0157370_10745667
2138 Ga0157370_10769083
2139 Ga0157370_11072838
2140 Ga0157370_11495738
2141 Ga0157370_11870415
2142 Ga0157369_10000329
2143 Ga0157369_10000604
2144 Ga0157369_10009635
2145 Ga0157369_10010381
2146 Ga0157369_10023388
2147 Ga0157369_10403660
2148 Ga0157369_10417095
2149 Ga0157369_10629502
2150 Ga0157369_10852514
2151 Ga0157369_10857160
2152 Ga0157369_11972512
2153 Ga0157374_10279686
2154 Ga0157374_10303991
2155 Ga0157374_10435621
2156 Ga0157374_10859562
2157 Ga0157374_10921159
2158 Ga0157374_11029757
2159 Ga0157374_12054846
2160 Ga0157378_10001163
2161 Ga0157378_10036782
2162 Ga0157378_10460056
2163 Ga0157378_11489034
2164 Ga0163162_10002333
2165 Ga0163162_10022472
2166 Ga0163162_10039066
2167 Ga0163162_11562272
2168 Ga0163162_12242717
2169 Ga0157372_10023320
2170 Ga0157372_10023763
2171 Ga0157372_10038916
2172 Ga0157372_10072331
2173 Ga0157372_10082841
2174 Ga0157372_10189213
2175 Ga0157372_10206533
2176 Ga0157372_10375352
2177 Ga0157372_10431261
2178 Ga0157372_10779366
2179 Ga0157372_11383829
2180 Ga0157375_10013024
2181 Ga0157375_10064653
2182 Ga0157375_10167400
2183 Ga0157375_10896503
2184 Ga0163163_10000754
2185 Ga0163163_10239681
2186 Ga0163163_10241793
2187 Ga0163163_11931750
2188 Ga0157380_12656551
2189 Ga0182008_10066759
2190 Ga0182008_10166729
2191 Ga0182008_10389459
2192 Ga0157377_10969725
2193 Ga0157379_10188376
2194 Ga0157379_10360209
2195 Ga0157376_10002106
2196 Ga0157376_10673001
2197 Ga0157376_11211577
2198 Ga0182006_1013034
2199 Ga0182007_10034657
2200 Ga0182007_10207051
2201 Ga0182007_10221888
2202 Ga0182005_1051168
2203 Ga0183369_1008
2204 Ga0183368_1003
2205 Ga0183360_10001
2206 Ga0163161_10331938
2207 Ga0163161_11073987
2208 Ga0206356_11373589
2209 Ga0206354_10531980
2210 Ga0206353_10211211
2211 Ga0154015_1010693
2212 Ga0213872_10006100
2213 Ga0209435_102375
2214 Ga0209435_102791
2215 Ga0209760_100371
2216 Ga0209784_100016
2217 Ga0209566_101455
2218 Ga0209674_100012
2219 Ga0209674_100322
2220 Ga0209674_100347
2221 Ga0209674_101036
2222 Ga0209672_100007
2223 Ga0209672_100078
2224 Ga0209672_100389
2225 Ga0209672_100559
2226 Ga0209672_105497
2227 Ga0209147_112175
2228 Ga0209563_100079
2229 Ga0207427_100033
2230 Ga0207427_100188
2231 Ga0207427_100402
2232 Ga0207427_100594
2233 Ga0207427_102610
2234 Ga0209437_100012
2235 Ga0209437_100020
2236 Ga0209437_100105
2237 Ga0209437_100192
2238 Ga0209437_100537
2239 Ga0209437_101513
2240 Ga0209258_100012
2241 Ga0209258_100046
2242 Ga0209258_100095
2243 Ga0209258_100238
2244 Ga0209258_100765
2245 Ga0209258_101311
2246 Ga0209258_101904
2247 Ga0209258_121959
2248 Ga0207425_1001752
2249 Ga0209646_1001514
2250 Ga0209646_1001913
2251 Ga0209646_1001986
2252 Ga0209026_1000012
2253 Ga0209026_1000105
2254 Ga0209026_1000278
2255 Ga0209026_1000285
2256 Ga0209026_1000335
2257 Ga0209026_1030371
2258 Ga0209026_1033302
2259 Ga0209677_103018
2260 Ga0209148_1000001
2261 Ga0209148_1000005
2262 Ga0209148_1000014
2263 Ga0209148_1000039
2264 Ga0209148_1000087
2265 Ga0209148_1000098
2266 Ga0209148_1025941
2267 Ga0209759_1000356
2268 Ga0209759_1000460
2269 Ga0209759_1000536
2270 Ga0209759_1000912
2271 Ga0209759_1023568
2272 Ga0209129_1002063
2273 Ga0209129_1003433
2274 Ga0209233_1000002
2275 Ga0209233_1000020
2276 Ga0209233_1000080
2277 Ga0209233_1000370
2278 Ga0209233_1060127
2279 Ga0209565_1000048
2280 Ga0209455_1000010
2281 Ga0209455_1000034
2282 Ga0209455_1000039
2283 Ga0209455_1000126
2284 Ga0209455_1000310
2285 Ga0209455_1016170
2286 Ga0209673_1000001
2287 Ga0209673_1018372
2288 Ga0209673_1095729
2289 Ga0209130_1002842
2290 Ga0209675_1000045
2291 Ga0209675_1036559
2292 Ga0209676_1006754
2293 Ga0209025_1000005
2294 Ga0209025_1006351
2295 Ga0209025_1013061
2296 Ga0209025_1040960
2297 Ga0209564_1000001
2298 Ga0209564_1039988
2299 Ga0209758_1000535
2300 Ga0209758_1009118
2301 Ga0209758_1012999
2302 Ga0209050_1001247
2303 Ga0209256_1000002
2304 Ga0209256_1004565
2305 Ga0209256_1039654
2306 Ga0207426_1006400
2307 Ga0207426_1138574
2308 Ga0209051_1014949
2309 Ga0209051_1019027
2310 Ga0209051_1031421
2311 Ga0209257_1000217
2312 Ga0209257_1016898
2313 Ga0209257_1041047
2314 Ga0209257_1107616
2315 Ga0207697_10114964
2316 Ga0207656_10001733
2317 Ga0207656_10028858
2318 Ga0207656_10062176
2319 Ga0207656_10175900
2320 Ga0207656_10696310
2321 Ga0207682_10277748
2322 Ga0207692_10138951
2323 Ga0207710_10020591
2324 Ga0207680_10000006
2325 Ga0207680_10001267
2326 Ga0207680_10053739
2327 Ga0207680_10224992
2328 Ga0207680_10394596
2329 Ga0207680_10540156
2330 Ga0207647_10000111
2331 Ga0207647_10000138
2332 Ga0207647_10000859
2333 Ga0207647_10018916
2334 Ga0207647_10091644
2335 Ga0207647_10308961
2336 Ga0207647_10323271
2337 Ga0207699_10193317
2338 Ga0207645_10038319
2339 Ga0207645_10192165
2340 Ga0207645_10229743
2341 Ga0207645_10350588
2342 Ga0207645_10753167
2343 Ga0207643_10178438
2344 Ga0207705_10000798
2345 Ga0207705_10009804
2346 Ga0207654_10004940
2347 Ga0207654_10027457
2348 Ga0207654_10044512
2349 Ga0207654_10073004
2350 Ga0207654_10074909
2351 Ga0207654_10348119
2352 Ga0207654_11388909
2353 Ga0207707_10064913
2354 Ga0207695_10000033
2355 Ga0207695_10000811
2356 Ga0207695_10002522
2357 Ga0207695_10003038
2358 Ga0207695_10009508
2359 Ga0207695_10010778
2360 Ga0207695_10015564
2361 Ga0207695_10048491
2362 Ga0207695_10073143
2363 Ga0207695_10372772
2364 Ga0207695_10518226
2365 Ga0207695_10645359
2366 Ga0207671_10000020
2367 Ga0207671_10000116
2368 Ga0207671_10001713
2369 Ga0207671_10012021
2370 Ga0207671_10012358
2371 Ga0207671_10076983
2372 Ga0207671_10169216
2373 Ga0207671_10315292
2374 Ga0207671_10469545
2375 Ga0207671_10640721
2376 Ga0207671_11105187
2377 Ga0207671_11324007
2378 Ga0207693_10275388
2379 Ga0207663_10124228
2380 Ga0207660_10839858
2381 Ga0207660_11339242
2382 Ga0207657_10007879
2383 Ga0207657_10348016
2384 Ga0207657_11127448
2385 Ga0207649_10007346
2386 Ga0207649_10012095
2387 Ga0207649_10450764
2388 Ga0207649_10484754
2389 Ga0207649_10505985
2390 Ga0207649_10593840
2391 Ga0207652_10735412
2392 Ga0207652_11109887
2393 Ga0207652_11361130
2394 Ga0207681_10321259
2395 Ga0207681_11587823
2396 Ga0207694_10000298
2397 Ga0207694_10000613
2398 Ga0207694_10002589
2399 Ga0207694_10017252
2400 Ga0207694_10052522
2401 Ga0207694_10076987
2402 Ga0207694_10097903
2403 Ga0207694_10188934
2404 Ga0207694_10199790
2405 Ga0207694_10285197
2406 Ga0207694_10588990
2407 Ga0207694_10590678
2408 Ga0207694_10770357
2409 Ga0207650_10095582
2410 Ga0207650_10318005
2411 Ga0207650_10778652
2412 Ga0207650_11085080
2413 Ga0207650_11300762
2414 Ga0207659_10532511
2415 Ga0207687_10096129
2416 Ga0207687_10363853
2417 Ga0207700_10002543
2418 Ga0207700_11025090
2419 Ga0207700_11074043
2420 Ga0207664_10002383
2421 Ga0207664_10007284
2422 Ga0207664_10213080
2423 Ga0207664_10737564
2424 Ga0207644_10001304
2425 Ga0207644_10016173
2426 Ga0207644_11766530
2427 Ga0207690_10000967
2428 Ga0207690_10093111
2429 Ga0207706_10002270
2430 Ga0207706_10077003
2431 Ga0207706_10385216
2432 Ga0207706_10533820
2433 Ga0207686_10010245
2434 Ga0207670_10192556
2435 Ga0207669_11965142
2436 Ga0207704_10103961
2437 Ga0207704_10211891
2438 Ga0207704_10215845
2439 Ga0207704_10480609
2440 Ga0207704_11852747
2441 Ga0207665_11491561
2442 Ga0207665_11641398
2443 Ga0207691_10024143
2444 Ga0207691_10038895
2445 Ga0207691_10116249
2446 Ga0207691_10417304
2447 Ga0207711_10000503
2448 Ga0207711_10125299
2449 Ga0207711_10185512
2450 Ga0207711_10473892
2451 Ga0207711_10671405
2452 Ga0207711_11369556
2453 Ga0207711_11654523
2454 Ga0207689_10077296
2455 Ga0207689_10529262
2456 Ga0207661_10834126
2457 Ga0207661_11215245
2458 Ga0207679_10652056
2459 Ga0207667_10001535
2460 Ga0207667_10001609
2461 Ga0207667_10006791
2462 Ga0207667_10019505
2463 Ga0207667_10026092
2464 Ga0207667_10037914
2465 Ga0207667_10059529
2466 Ga0207667_10261566
2467 Ga0207667_10304225
2468 Ga0207667_10591522
2469 Ga0207667_10774748
2470 Ga0207667_10931147
2471 Ga0207667_11323449
2472 Ga0207651_10195419
2473 Ga0207651_10493390
2474 Ga0207651_11539128
2475 Ga0207712_10000277
2476 Ga0207712_10000477
2477 Ga0207712_10147728
2478 Ga0207668_10011169
2479 Ga0207668_10019520
2480 Ga0207668_10075249
2481 Ga0207668_10286079
2482 Ga0207668_10626346
2483 Ga0207668_10746716
2484 Ga0207640_10002403
2485 Ga0207640_10015095
2486 Ga0207640_10016040
2487 Ga0207640_10069799
2488 Ga0207640_10148784
2489 Ga0207640_10155151
2490 Ga0207640_10461418
2491 Ga0207640_11348161
2492 Ga0207658_10000286
2493 Ga0207658_10007375
2494 Ga0207658_10053046
2495 Ga0207658_10058890
2496 Ga0207658_10064327
2497 Ga0207658_10101859
2498 Ga0207658_10485862
2499 Ga0207658_11119123
2500 Ga0207658_11657165
2501 Ga0207658_12078998
2502 Ga0207677_10159632
2503 Ga0207677_10179200
2504 Ga0207677_10237178
2505 Ga0207677_10241627
2506 Ga0207703_10002250
2507 Ga0207703_10046054
2508 Ga0207703_10204383
2509 Ga0207703_10478331
2510 Ga0207703_10752524
2511 Ga0207639_10000985
2512 Ga0207639_10006532
2513 Ga0207639_10008937
2514 Ga0207639_10017968
2515 Ga0207639_10049869
2516 Ga0207639_10056089
2517 Ga0207639_10056123
2518 Ga0207639_10269372
2519 Ga0207639_10274797
2520 Ga0207639_10441838
2521 Ga0207639_10584979
2522 Ga0207639_11384434
2523 Ga0207678_10001305
2524 Ga0207678_10004417
2525 Ga0207678_10010903
2526 Ga0207678_10030009
2527 Ga0207678_10101872
2528 Ga0207678_10159552
2529 Ga0207678_10174807
2530 Ga0207678_10200544
2531 Ga0207678_10987390
2532 Ga0207678_11912761
2533 Ga0207702_10000236
2534 Ga0207702_10010360
2535 Ga0207702_10015281
2536 Ga0207702_10072033
2537 Ga0207702_10096660
2538 Ga0207702_10331866
2539 Ga0207702_10457507
2540 Ga0207702_10553413
2541 Ga0207702_10563356
2542 Ga0207702_10815717
2543 Ga0207702_11499820
2544 Ga0207641_10010609
2545 Ga0207641_10020369
2546 Ga0207641_10131445
2547 Ga0207641_10229076
2548 Ga0207641_10291827
2549 Ga0207641_10900498
2550 Ga0207641_11225622
2551 Ga0207648_10012324
2552 Ga0207648_10117053
2553 Ga0207648_10184374
2554 Ga0207648_10253652
2555 Ga0207648_11073968
2556 Ga0207648_11828247
2557 Ga0207676_10014128
2558 Ga0207676_10815964
2559 Ga0207674_10011044
2560 Ga0207674_10086156
2561 Ga0207674_10218763
2562 Ga0207674_10416222
2563 Ga0207674_10613119
2564 Ga0207674_10874354
2565 Ga0207674_10927205
2566 Ga0207675_100196738
2567 Ga0207675_100212013
2568 Ga0207675_100319070
2569 Ga0207675_100627521
2570 Ga0207675_100684184
2571 Ga0207675_100831982
2572 Ga0207683_10048759
2573 Ga0207683_10068547
2574 Ga0207683_11623353
2575 Ga0207698_10002901
2576 Ga0207698_10020428
2577 Ga0207698_10035977
2578 Ga0207698_10096916
2579 Ga0207698_10293017
2580 Ga0207698_10438167
2581 Ga0207698_10608010
2582 Ga0207698_10984711
2583 Ga0207698_11159987
2584 Ga0207698_12602308
2585 Ga0209282_1166348
2586 Ga0265354_1001101
2587 Ga0265357_1005008
2588 Ga0268266_10000001
2589 Ga0268266_10000006
2590 Ga0268266_10000021
2591 Ga0268266_10038420
2592 Ga0268266_10126426
2593 Ga0268266_10624948
2594 Ga0268266_11777700
2595 Ga0268266_11825168
2596 Ga0268265_10000705
2597 Ga0268265_10671110
2598 Ga0268264_10011847
2599 Ga0268264_10014826
2600 Ga0268264_10052860
2601 Ga0268264_10450780
2602 Ga0268264_10769172
2603 Ga0307517_10339098
2604 Ga0307517_10354081
2605 Ga0307515_10160864
2606 Ga0307515_10203513
2607 Ga0265338_10340845
2608 Ga0265770_1000647
2609 Ga0265760_10016048
2610 Ga0265760_10227465
2611 Ga0265332_10000014
2612 Ga0265328_10006973
2613 Ga0265339_10126686
2614 Ga0265331_10008554
2615 Ga0265327_10000133
2616 Ga0265327_10057675
2617 Ga0265327_10176840
2618 Ga0307513_10013810
2619 Ga0307513_10315870
2620 Ga0307513_10615359
2621 Ga0307509_10799411
2622 Ga0307408_100186114
2623 Ga0307408_100401588
2624 Ga0307408_101265687
2625 Ga0307508_10058708
2626 Ga0307508_10157395
2627 Ga0307508_10395627
2628 Ga0316575_10018091
2629 Ga0316575_10041535
2630 Ga0316575_10264420
2631 Ga0316579_10048118
2632 Ga0316576_10013894
2633 Ga0316576_10177082
2634 Ga0316578_10024244
2635 Ga0316578_10640072
2636 Ga0307516_10019050
2637 Ga0307516_10089609
2638 Ga0307516_10152544
2639 Ga0307516_10512331
2640 Ga0316577_10027318
2641 Ga0307413_10146940
2642 Ga0307413_10547360
2643 Ga0307413_11084950
2644 Ga0307413_11312917
2645 Ga0307410_10081792
2646 Ga0307410_10727488
2647 Ga0307410_11439453
2648 Ga0307410_11848036
2649 Ga0307406_10007341
2650 Ga0307406_10228302
2651 Ga0307406_10697107
2652 Ga0307407_10122594
2653 Ga0307407_10795982
2654 Ga0307412_10017785
2655 Ga0307412_10073645
2656 Ga0307412_10108346
2657 Ga0307412_11264630
2658 Ga0307409_100357217
2659 Ga0307409_101913936
2660 Ga0307416_100594499
2661 Ga0307416_103550834
2662 Ga0307414_10001343
2663 Ga0307414_10001931
2664 Ga0307414_10218311
2665 Ga0307414_10292332
2666 Ga0307414_10647718
2667 Ga0307414_11016815
2668 Ga0307411_10161813
2669 Ga0307411_10190249
2670 Ga0307411_10288321
2671 Ga0307415_100410422
2672 Ga0316583_10003935
2673 Ga0316580_10008155
2674 Ga0307510_10005227
2675 Ga0373959_0122785
2676 Ga0373934_0134767
2677 Ga0373946_0202653
2678 Ga0316574_0125565
2679 Ga0316574_0177539
2680 Ga0316574_0335179
2681 Ga0316574_0439550
2682 Ga0316574_0595268
2683 Ga0373927_0601176
2684 Ga0373927_0758943
2685 Ga0373933_0359882
2686 Ga0373947_0452000
2687 Ga0373937_0006210
2688 Ga0373937_0101909
2689 Ga0373937_0864054
2690 Ga0316582_0002013
2691 Ga0316582_0007984
2692 Ga0316582_0042210
2693 Ga0316582_0393451
2694 Ga0316584_0002192
2695 Ga0373925_1217269
2696 Ga0395899_0000133
2697 Ga0395899_0016504
2698 Ga0395899_0042325
2699 Ga0395899_0057173
2700 Ga0395899_0073593
2701 Ga0395899_0288128
2702 Ga0395900_0000051
2703 Ga0395900_0000061
2704 Ga0395900_0114528
2705 Ga0395900_0219392
2706 Ga0395900_0338283
2707 Ga0395898_0000034
2708 Ga0395898_0000197
2709 Ga0395898_0007788
2710 Ga0395898_0011319
2711 Ga0395898_0014517
2712 Ga0395898_0179719
2713 Ga0395898_0669998
2714 Ga0395898_0777540
2715 Ga0395905_0000306
2716 Ga0395905_0140120
2717 Ga0395905_0340379
2718 Ga0395905_0537682
2719 Ga0395905_1138998
2720 Ga0316581_0006306
2721 Ga0395901_0003676
2722 Ga0395901_0009076
2723 Ga0395901_0727221
2724 Ga0395901_1854495
2725 Ga0395901_1938550
2726 Ga0436361_0190082
2727 Ga0436361_0521891
2728 Ga0436363_0368017
2729 Ga0439436_0000008
2730 Ga0439436_0015857
2731 Ga0439436_0022021
2732 Ga0439436_0024041
2733 Ga0439436_0063701
2734 Ga0439436_0077543
2735 Ga0439447_007836
2736 Ga0439466_0229527
2737 Ga0439465_0008559
2738 Ga0439465_0012695
2739 Ga0439465_0029794
2740 Ga0439465_0255027
2741 Ga0451787_760046
2742 Ga0451789_0480807
2743 Ga0451789_0594797
2744 Ga0451789_1201078
2745 Ga0451789_1206445
2746 Ga0451791_1110733
2747 Ga0451793_0136894
2748 Ga0451793_1283171
2749 Ga0451793_1723166
2750 Ga0451797_0719793
2751 Ga0451797_0839044
2752 Ga0451795_1164357
2753 Ga0451795_1565558
2754 Ga0451798_0160268
2755 Ga0451800_0410448
2756 Ga0451800_0506376
2757 Ga0451800_1459324
2758 Ga0451802_0744649
2759 Ga0451802_1852954
2760 Ga0451804_0003308
2761 Ga0451804_0340235
2762 Ga0451807_1507964
2763 Ga0451807_1589376
2764 Ga0451807_1924293
2765 Ga0451807_2135600
2766 Ga0451807_2735494
2767 Ga0451833_0532987
2768 Ga0451833_0951430
2769 Ga0451835_0367031
2770 Ga0451837_0103295
2771 Ga0451837_0244838
2772 Ga0451837_1610330
2773 Ga0451841_1138043
2774 Ga0451849_0244638
2775 Ga0451849_0355062
2776 Ga0451849_1085578
2777 Ga0451851_0574422
2778 Ga0451843_0007405
2779 Ga0451843_0905268
2780 Ga0451843_1073184
2781 Ga0451843_1682121
2782 Ga0451853_1071901
2783 Ga0451853_2123261
2784 Ga0451853_2493278
2785 Ga0451853_2583559
2786 Ga0451853_2935955
2787 Ga0451853_3209840
2788 Ga0439431_0011423
2789 Ga0439433_0014340
2790 Ga0439445_0027544
2791 Ga0439445_0029548
2792 Ga0439445_0101561
2793 Ga0439449_0004432
2794 Ga0439449_0005563
2795 Ga0439449_0011023
2796 Ga0439449_0011092
2797 Ga0439449_0017334
2798 Ga0439449_0041485
2799 Ga0439449_0078816
2800 Ga0439449_0304020
2801 Ga0439452_078748
2802 Ga0439457_045877
2803 Ga0439462_0058894
2804 Ga0439462_0089731
2805 Ga0439462_0095941
2806 Ga0439446_0177495
2807 Ga0439458_0131439
2808 Ga0450908_002779
2809 Ga0439434_0147624
2810 Ga0439459_0006149
2811 Ga0439459_0085371
2812 Ga0451577_0149158
2813 Ga0451577_0501910
2814 Ga0466969_0001457
2815 Ga0466969_0039210
2816 Ga0466969_0055973
2817 Ga0466972_0000555
2818 Ga0466972_0043049
2819 Ga0466982_0000026
2820 Ga0466982_0004003
2821 Ga0466965_0001099
2822 Ga0466965_0046974
2823 Ga0466966_0005830
2824 Ga0466966_0012407
2825 Ga0466966_0695670
2826 Ga0466961_0010278
2827 Ga0466961_0035544
2828 Ga0466961_0118349
2829 Ga0466961_0127822
2830 Ga0466964_0011285
2831 Ga0466964_0130651
2832 Ga0453684_0001089
2833 Ga0453684_0144356
2834 Ga0466971_0001957
2835 Ga0466971_0068841
2836 Ga0466971_0103735
2837 Ga0466971_0257274
2838 Ga0466968_0003504
2839 Ga0466968_0004304
2840 Ga0466970_0000637
2841 Ga0466970_0006813
2842 Ga0466970_0043358
2843 Ga0466970_0098456
2844 Ga0466970_0516756
2845 Ga0466957_0005542
2846 Ga0466957_0030562
2847 Ga0466957_0351074
2848 Ga0466957_0611920
2849 Ga0466957_0784745
2850 Ga0466960_0009574
2851 Ga0466960_0243814
2852 Ga0466959_0019992
2853 Ga0466959_0022705
2854 Ga0466959_0156385
2855 Ga0451576_0000201
2856 Ga0451576_0505280
2857 Ga0466958_0014964
2858 Ga0466958_0119060
2859 Ga0466967_0182733
2860 Ga0466967_0437907
2861 Ga0466967_0796184
2862 Ga0495617_000424
2863 Ga0495629_0048970
2864 Ga0495638_0000146
2865 Ga0495638_0001668
2866 Ga0495638_0001669
2867 Ga0495638_0073075
2868 Ga0495638_0172342
2869 Ga0495641_0031745
2870 Ga0495651_0414840
2871 Ga0495650_0002509
2872 Ga0495650_0006285
2873 Ga0495580_0145919
2874 Ga0495582_0029608
2875 Ga0495664_0204018
2876 Ga0495584_0258950
2877 Ga0495585_0004990
2878 Ga0495607_0001360
2879 Ga0495607_0015098
2880 Ga0495583_0016180
2881 Ga0495606_0001823
2882 Ga0495606_0009315
2883 Ga0495606_0112071
2884 Ga0495610_0007268
2885 Ga0495610_0218642
2886 Ga0495616_0000400
2887 Ga0495620_0111880
2888 Ga0495630_0084401
2889 Ga0495630_0301731
2890 Ga0495631_0003067
2891 Ga0495631_0004987
2892 Ga0495632_0000004
2893 Ga0495632_0006481
2894 Ga0495637_0081900
2895 Ga0495643_0111285
2896 Ga0495643_0147056
2897 Ga0495648_0069715
2898 Ga0495663_0000892
2899 Ga0495665_0036191
2900 Ga0495609_0013644
2901 Ga0495645_0654105
2902 Ga0495622_0011411
2903 Ga0495622_0418385
2904 Ga0495633_0283714
2905 Ga0495656_0006219
2906 Ga0495668_0004286
2907 Ga0495668_0133484
2908 Ga0495611_0000001
2909 Ga0495625_0000001
2910 Ga0495625_0108723
2911 Ga0495625_0655523
2912 Ga0495635_0550182
2913 Ga0495635_1015615
2914 Ga0495661_0004892
2915 Ga0495657_0090211
2916 Ga0495657_0819728
2917 Ga0495599_0178684
2918 Ga0495646_0405921
2919 Ga0495647_0004669
2920 Ga0495658_0004687
2921 Ga0495658_0277291
2922 Ga0495670_0009378
2923 Ga0495670_0079774
2924 Ga0495670_0285950
2925 Ga0495671_0004084
2926 Ga0495671_0128936
2927 Ga0495649_0000218
2928 Ga0495649_0078862
2929 Ga0495589_0000236
2930 Ga0495600_0159578
2931 Ga0495660_0000792
2932 Ga0495660_0001210
2933 Ga0495636_0003683
2934 Ga0495674_0439601
2935 Ga0495680_0209275
2936 Ga0495683_0001237
2937 Ga0495679_000004
2938 Ga0495673_0000294
2939 Ga0495673_0000670
2940 Ga0495684_0065836
2941 Ga0495686_0000017
2942 Ga0495686_0002339
2943 Ga0495686_0327251
2944 Ga0495614_0660955
2945 Ga0496100_0019061
2946 Ga0496100_0145854
2947 Ga0496100_0985182
2948 Ga0496101_0031070
2949 Ga0496101_0048869
2950 Ga0496102_0226685
2951 Ga0496102_0298877
2952 Ga0496103_0997285
2953 Ga0496104_0000011
2954 Ga0496104_0058290
2955 Ga0496105_0000015
2956 Ga0496105_0002678
2957 Ga0496105_0216774
2958 Ga0496105_0869095
2959 Ga0496105_1253327
2960 Ga0496106_0005633
2961 Ga0496106_0099345
2962 Ga0496106_0345914
2963 Ga0496106_0450830
2964 Ga0496107_0361760
2965 Ga0496107_0621966
2966 Ga0496108_0655326
2967 Ga0496109_0076379
2968 Ga0496109_0954675
2969 Ga0496111_0514662
2970 Ga0496112_0096940
2971 Ga0496112_1306029
2972 Ga0496113_0003563
2973 Ga0496113_0032634
2974 Ga0496113_1471177
2975 Ga0496114_0267913
2976 Ga0496114_1501167
2977 Ga0496115_0000275
2978 Ga0496115_0110062
2979 Ga0496115_0825272
2980 Ga0496116_0050219
2981 Ga0496116_0057217
2982 Ga0496116_0107805
2983 Ga0496117_0011886
2984 Ga0496117_0028477
2985 Ga0496117_0098806
2986 Ga0496118_0001213
2987 Ga0496118_0003656
2988 Ga0496118_0008630
2989 Ga0496118_0048646
2990 Ga0496118_0054037
2991 Ga0496118_0112067
2992 Ga0496119_0001455
2993 Ga0496119_0047502
2994 Ga0496119_0270371
2995 Ga0496120_0002097
2996 Ga0496120_0017747
2997 Ga0496121_0000045
2998 Ga0496121_0007647
2999 Ga0496121_0011769
3000 Ga0496121_0024451
3001 Ga0496121_0140784
3002 Ga0496121_0232401
3003 Ga0496121_0266427
3004 Ga0496121_0290300
3005 Ga0496122_0000440
3006 Ga0496122_0024941
3007 Ga0496122_0145393
3008 Ga0496122_0148068
3009 Ga0496122_0345376
3010 Ga0496122_0360743
3011 Ga0496123_0009708
3012 Ga0496123_0028799
3013 Ga0496123_0039503
3014 Ga0496123_0108679
3015 Ga0496123_0131222
3016 Ga0496124_0053164
3017 Ga0496124_0147051
3018 Ga0496125_0000149
3019 Ga0496125_0003559
3020 Ga0496125_0049218
3021 Ga0496125_0100187
3022 Ga0496125_0178110
3023 Ga0496126_0007818
3024 Ga0496126_0013267
3025 Ga0496126_0052512
3026 Ga0496126_0206149
3027 Ga0496126_0316301
3028 Ga0496126_0461445
3029 Ga0496126_0531690
3030 Ga0501308_021341
3031 Ga0495678_001023
3032 Ga0495678_041423
3033 Ga0495682_0048783
3034 Ga0495682_0061647
3035 Ga0501290_061479
3036 Ga0501312_092391
3037 Ga0501320_037209
3038 Ga0501324_043447
3039 Ga0501336_026609
3040 Ga0501031_0101788
3041 Ga0501031_0235743
3042 Ga0501032_0002397
3043 Ga0501032_0049264
3044 Ga0501032_0070741
3045 Ga0501032_0203255
3046 Ga0501032_0217392
3047 Ga0501032_0874462
3048 Ga0501033_0000632
3049 Ga0501033_0001720
3050 Ga0501033_0024689
3051 Ga0501033_0117429
3052 Ga0501033_0124122
3053 Ga0501033_0135168
3054 Ga0501033_0157089
3055 Ga0501033_0219572
3056 Ga0501033_0413091
3057 Ga0501033_0628946
3058 Ga0501034_0002437
3059 Ga0501034_0002902
3060 Ga0501034_0015349
3061 Ga0501034_0027193
3062 Ga0501034_0125418
3063 Ga0501034_0506505
3064 Ga0501034_0517410
3065 Ga0501034_0612744
3066 Ga0501036_0009385
3067 Ga0501036_0012706
3068 Ga0501036_0093648
3069 Ga0501036_0197746
3070 Ga0501036_0221807
3071 Ga0501036_0354262
3072 Ga0501036_0807349
3073 Ga0501037_0001300
3074 Ga0501037_0103023
3075 Ga0501037_0153572
3076 Ga0501037_0170990
3077 Ga0501037_0322920
3078 Ga0501037_0485949
3079 Ga0501037_0651938
3080 Ga0501038_0008023
3081 Ga0501038_0033953
3082 Ga0501038_0364928
3083 Ga0501038_0377437
3084 Ga0501038_0661769
3085 Ga0501038_1027355
3086 Ga0501039_0009363
3087 Ga0501039_0033279
3088 Ga0501039_0108130
3089 Ga0501039_0111301
3090 Ga0501039_0144763
3091 Ga0501039_1116322
3092 Ga0501039_1561525
3093 Ga0501040_0035524
3094 Ga0501040_0100818
3095 Ga0501041_0797888
3096 Ga0501042_0025128
3097 Ga0501042_0221535
3098 Ga0501043_0001641
3099 Ga0501043_0005218
3100 Ga0501043_0012916
3101 Ga0501043_0104925
3102 Ga0501043_0133837
3103 Ga0501043_0357269
3104 Ga0501043_0587268
3105 Ga0501043_0684301
3106 Ga0501046_0009415
3107 Ga0501046_0037617
3108 Ga0501046_0053750
3109 Ga0501046_0088513
3110 Ga0501046_0151662
3111 Ga0501046_0187324
3112 Ga0501046_0237737
3113 Ga0501046_0254713
3114 Ga0501046_0414233
3115 Ga0501046_0901862
3116 Ga0501046_1257857
3117 Ga0501047_0002573
3118 Ga0501047_0009259
3119 Ga0501047_0018810
3120 Ga0501047_0029549
3121 Ga0501047_0073773
3122 Ga0501047_0092889
3123 Ga0501047_0328782
3124 Ga0501047_0401208
3125 Ga0501047_0433185
3126 Ga0501047_0531502
3127 Ga0501047_0662514
3128 Ga0501047_0858780
3129 Ga0501047_1367132
3130 Ga0501048_0026442
3131 Ga0501048_0076244
3132 Ga0501048_0274276
3133 Ga0501048_0315708
3134 Ga0501048_0586179
3135 Ga0501067_0006199
3136 Ga0501067_0014755
3137 Ga0501068_0131777
3138 Ga0501068_0143933
3139 Ga0501069_0006685
3140 Ga0501069_0066085
3141 Ga0501069_0348860
3142 Ga0501070_0002131
3143 Ga0501070_0010864
3144 Ga0501070_0013751
3145 Ga0501070_0033092
3146 Ga0501070_0087275
3147 Ga0501070_0123868
3148 Ga0501070_0224590
3149 Ga0501071_0028649
3150 Ga0501071_0031884
3151 Ga0501071_0118792
3152 Ga0501071_0820344
3153 Ga0501072_0003391
3154 Ga0501072_0027150
3155 Ga0501073_0001213
3156 Ga0501073_0002194
3157 Ga0501073_0008870
3158 Ga0501073_0347496
3159 Ga0501073_0386775
3160 Ga0501073_0547597
3161 Ga0501073_0787524
3162 Ga0501073_0814274
3163 Ga0501074_0031338
3164 Ga0501074_0033188
3165 Ga0501074_0087103
3166 Ga0501074_0096715
3167 Ga0501074_0119475
3168 Ga0501074_0190732
3169 Ga0501074_0282753
3170 Ga0501074_0699488
3171 Ga0501075_0003076
3172 Ga0501075_0104738
3173 Ga0501076_0001078
3174 Ga0501076_0420680
3175 Ga0501077_0026740
3176 Ga0501206_021096
3177 Ga0501216_158951
3178 Ga0501217_096638
3179 Ga0501223_031766
3180 Ga0501224_040125
3181 Ga0501247_053981
3182 Ga0501249_019448
3183 Ga0501250_004457
3184 Ga0501252_006724
3185 Ga0501252_086169
3186 Ga0501253_112865
3187 Ga0501258_040070
3188 Ga0501259_104530
3189 Ga0501225_0006481
3190 Ga0501225_0083207
3191 Ga0501079_0097356
3192 Ga0501079_0125221
3193 Ga0501079_0224507
3194 Ga0501079_0241097
3195 Ga0501079_0411511
3196 Ga0501079_0547118
3197 Ga0501079_0999878
3198 Ga0501080_0000791
3199 Ga0501080_0001319
3200 Ga0501080_0006958
3201 Ga0501080_0009707
3202 Ga0501080_0018776
3203 Ga0501080_0085197
3204 Ga0501080_0140553
3205 Ga0501080_0145790
3206 Ga0501080_0208236
3207 Ga0501080_0486833
3208 Ga0501080_0632213
3209 Ga0501080_0849750
3210 Ga0501081_0008596
3211 Ga0501083_0001078
3212 Ga0501083_0181210
3213 Ga0501263_039215
3214 Ga0501264_033208
3215 Ga0501266_003367
3216 Ga0501266_022659
3217 Ga0501268_092644
3218 Ga0501268_178276
3219 Ga0501270_162154
3220 Ga0501271_032041
3221 Ga0501272_022957
3222 Ga0501275_085427
3223 Ga0501279_035089
3224 Ga0501035_0013600
3225 Ga0501035_0027477
3226 Ga0501035_0041694
3227 Ga0501035_0098449
3228 Ga0501035_0252247
3229 Ga0501035_0275414
3230 Ga0501035_0317572
3231 Ga0501035_0545206
3232 Ga0501035_0744110
3233 Ga0501044_0016694
3234 Ga0501044_0033968
3235 Ga0501044_0061827
3236 Ga0501044_0110003
3237 Ga0501044_0117045
3238 Ga0501044_0119037
3239 Ga0501044_0403816
3240 Ga0501044_0546658
3241 Ga0501044_0575223
3242 Ga0501044_0702328
3243 Ga0501044_1369044
3244 Ga0501044_1614495
3245 Ga0501045_0040200
3246 Ga0501045_0287400
3247 Ga0501045_0635430
3248 Ga0501045_0766648
3249 nmdc:mga00v17_54986_c1
3250 nmdc:mga00v17_69221_c1
3251 nmdc:mga06z11_578199_c1
3252 nmdc:mga07m45_410003_c1
3253 nmdc:mga07m45_842111_c1
3254 nmdc:mga06r32_1434109_c1
3255 nmdc:mga08x19_286436_c1
3256 Ga0495612_0353400
3257 Ga0500610_0004715
3258 Ga0500643_000075
3259 Ga0500643_003396
3260 Ga0500583_0527191
3261 Ga0500583_0562674
3262 Ga0500651_0003714
3263 Ga0500566_0093620
3264 Ga0500555_000207
3265 Ga0500556_0383168
3266 Ga0500597_002583
3267 Ga0500614_017765
3268 Ga0500568_0001907
3269 Ga0500620_083778
3270 Ga0500645_001593
3271 Ga0501084_0176857
3272 Ga0501084_0192523
3273 Ga0501084_0246743
3274 Ga0501084_0339736
3275 Ga0501084_0903412
3276 Ga0587083_0264676
3277 Ga0501082_0001359
3278 Ga0501082_0005033
3279 Ga0501082_0086117
3280 Ga0501082_0211950
3281 Ga0466962_0005761
3282 Ga0466962_0005882
3283 Ga0466962_0008347
3284 Ga0466962_0335946
3285 Ga0530510_0006308
3286 Ga0530510_0123358
3287 2572253579
3288 2643815249
3289 2643879288
3290 2643939927
3291 2643976213
3292 2644076985
3293 2644528914
3294 2644660587
3295 2644695299
3296 2644697948
3297 2919516104
3298 2919677936
3299 2941491121
3300 2995952052

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

11

106

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.8737 10 90
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.859 4 86
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.8571 4 86
6h8k-assembly1.cif.gz_L crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.8538 10 82
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.8414 4 89
ID Description Score Start End Superfamily
af_P34651_608_792_1.20.120.1900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain 0.8632 35 80 1.20.120.1900
5lnkK00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8173 11 87 1.10.287.3510
2xm0A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.8157 34 73 1.20.120.10
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8003 7 100 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8002 8 84 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A2E2YBK6-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.935 1 88 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A367IZW3-F1-model_v4 NADH dehydrogenase subunit 4 0.9307 4 91 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A368F7W0-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) 0.9144 9 95 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A529HMQ9-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9125 1 67 GO:0016651
GO:0030964
GO:0042773
AF-J3M8V7-F1-model_v4 NADH dehydrogenase subunit 4L 0.9098 4 84 GO:0016651
GO:0030964
GO:0042773

Map