F495203
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1650 | 538 | 3300 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100398971|Ga0070683_1003989712 |
| Length | 122 |
| Sequence | MIELDHLTLAHFIGLGTILFCISVAGLFINRKNVIVLLMAIELMLLAVNMNFVAFSRFLGDVSGQIFVFFILTVAAAESAIGLAILVVLFRNRATINVGEIDTLRGQASGRPNESERKNATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 127 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 147 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 148 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 249 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 250 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 254 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 255 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 260 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 263 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 264 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 265 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 266 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 267 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 268 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 269 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 270 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 271 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 272 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 283 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 284 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 285 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 286 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 295 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 304 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 305 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 306 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 307 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 308 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 309 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 321 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 322 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 323 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 324 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 325 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 326 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 327 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 328 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 329 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 330 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 331 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 332 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 333 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 334 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 335 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 336 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 337 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 338 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 339 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 340 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 341 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 344 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 345 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 346 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 347 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 348 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 349 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 350 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 351 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 352 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 353 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 354 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 355 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 356 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 357 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 358 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 424 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 425 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 428 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 429 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 430 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 431 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 432 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 433 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 434 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 435 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 436 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 443 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 474 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 475 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 476 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 477 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 478 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 479 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 480 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 481 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 482 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 483 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 484 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 485 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 486 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 491 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 492 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 493 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 494 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 495 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 496 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 497 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 498 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 499 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 503 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 504 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 505 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 510 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 511 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 512 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 515 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 516 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 517 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 519 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 520 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 524 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 525 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 526 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 527 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 528 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 529 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 530 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 531 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 532 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 533 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 534 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 535 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 536 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 537 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 538 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 0.97 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.76 |
| Nodule | 0.12 |
| Rhizoplane | 3.7 |
| Rhizosphere | 78.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100398971 | 3300005329 | Bacteria | 1312 |
| 2 | JGI24740J21852_10000470 | 3300001979 | Bacteria | 17336 |
| 3 | JGI24740J21852_10100918 | 3300001979 | Bacteria | 735 |
| 4 | JGI24739J22299_10000039 | 3300001989 | Bacteria | 36051 |
| 5 | JGI24739J22299_10108011 | 3300001989 | Bacteria | 836 |
| 6 | JGI24737J22298_10000773 | 3300001990 | Bacteria | 11314 |
| 7 | JGI24737J22298_10007009 | 3300001990 | Bacteria | 3821 |
| 8 | JGI24737J22298_10007226 | 3300001990 | Bacteria | 3756 |
| 9 | JGI24735J21928_10010500 | 3300002067 | Bacteria | 2951 |
| 10 | JGI24735J21928_10017289 | 3300002067 | Bacteria | 2231 |
| 11 | JGI24744J21845_10109725 | 3300002077 | Bacteria | 512 |
| 12 | JGI25156J39149_1000822 | 3300002705 | Bacteria | 15751 |
| 13 | JGI25156J39149_1001275 | 3300002705 | Bacteria | 10926 |
| 14 | JGI25156J39149_1010679 | 3300002705 | Bacteria | 2139 |
| 15 | JGI25162J39368_1000732 | 3300002737 | Bacteria | 22514 |
| 16 | JGI25154J39366_1003192 | 3300002738 | Bacteria | 3610 |
| 17 | JGI25154J39366_1003368 | 3300002738 | Bacteria | 3386 |
| 18 | JGI25157J39369_1000656 | 3300002741 | Bacteria | 19144 |
| 19 | JGI25157J39369_1000792 | 3300002741 | Bacteria | 16143 |
| 20 | JGI25157J39369_1001513 | 3300002741 | Bacteria | 8468 |
| 21 | JGI25157J39369_1002022 | 3300002741 | Bacteria | 5868 |
| 22 | JGI25157J39369_1002091 | 3300002741 | Bacteria | 5656 |
| 23 | JGI25163J39215_1000172 | 3300002771 | Bacteria | 25403 |
| 24 | JGI25164J39214_1000085 | 3300002772 | Bacteria | 92776 |
| 25 | JGI25164J39214_1000243 | 3300002772 | Bacteria | 41571 |
| 26 | JGI25164J39214_1000994 | 3300002772 | Bacteria | 8914 |
| 27 | JGI25164J39214_1000995 | 3300002772 | Bacteria | 8901 |
| 28 | JGI25164J39214_1004811 | 3300002772 | Bacteria | 1517 |
| 29 | JGI25152J39213_1032881 | 3300002773 | Bacteria | 784 |
| 30 | Ga0006759J45824_1122819 | 3300003163 | Bacteria | 612 |
| 31 | JGI25151J46595_10089409 | 3300003187 | Bacteria | 863 |
| 32 | JGI25165J46597_1000058 | 3300003214 | Bacteria | 212833 |
| 33 | JGI25165J46597_1000090 | 3300003214 | Bacteria | 168833 |
| 34 | JGI25165J46597_1001824 | 3300003214 | Bacteria | 8914 |
| 35 | JGI25165J46597_1006457 | 3300003214 | Bacteria | 2078 |
| 36 | JGI25153J46596_10131115 | 3300003215 | Bacteria | 555 |
| 37 | rootH2_10015394 | 3300003320 | Bacteria | 4836 |
| 38 | Ga0006562J51391_1026821 | 3300003578 | Bacteria | 13803 |
| 39 | Ga0006562J51391_1026824 | 3300003578 | Bacteria | 3380 |
| 40 | JGI25404J52841_10136760 | 3300003659 | Bacteria | 519 |
| 41 | Ga0055538_1002456 | 3300003751 | Bacteria | 2710 |
| 42 | Ga0055539_1000434 | 3300003752 | Bacteria | 14786 |
| 43 | Ga0055533_1000734 | 3300003756 | Bacteria | 10594 |
| 44 | Ga0055533_1001197 | 3300003756 | Bacteria | 7268 |
| 45 | Ga0055525_1000097 | 3300003759 | Bacteria | 137371 |
| 46 | Ga0055527_1000198 | 3300003760 | Bacteria | 39703 |
| 47 | Ga0055527_1000581 | 3300003760 | Bacteria | 11933 |
| 48 | Ga0055535_1000034 | 3300003761 | Bacteria | 181954 |
| 49 | Ga0055535_1001535 | 3300003761 | Bacteria | 11334 |
| 50 | Ga0055535_1001554 | 3300003761 | Bacteria | 11198 |
| 51 | Ga0055535_1001777 | 3300003761 | Bacteria | 9499 |
| 52 | Ga0055535_1003057 | 3300003761 | Bacteria | 5068 |
| 53 | Ga0055535_1007979 | 3300003761 | Bacteria | 1959 |
| 54 | Ga0055542_1000441 | 3300003762 | Bacteria | 39703 |
| 55 | Ga0055542_1001261 | 3300003762 | Bacteria | 13798 |
| 56 | Ga0055542_1001412 | 3300003762 | Bacteria | 12090 |
| 57 | Ga0055542_1001429 | 3300003762 | Bacteria | 11933 |
| 58 | Ga0055542_1002987 | 3300003762 | Bacteria | 4933 |
| 59 | Ga0055542_1002988 | 3300003762 | Bacteria | 4932 |
| 60 | Ga0055529_1000206 | 3300003763 | Bacteria | 78192 |
| 61 | Ga0055529_1000870 | 3300003763 | Bacteria | 17327 |
| 62 | Ga0055529_1001132 | 3300003763 | Bacteria | 11360 |
| 63 | Ga0055529_1001145 | 3300003763 | Bacteria | 11198 |
| 64 | Ga0055529_1035198 | 3300003763 | Bacteria | 611 |
| 65 | Ga0055526_1000021 | 3300003771 | Bacteria | 180007 |
| 66 | Ga0055526_1007069 | 3300003771 | Bacteria | 5932 |
| 67 | Ga0055537_1000186 | 3300003773 | Bacteria | 46462 |
| 68 | Ga0055524_1000062 | 3300003775 | Bacteria | 135238 |
| 69 | Ga0055536_1039212 | 3300003781 | Bacteria | 1140 |
| 70 | Ga0055536_1059790 | 3300003781 | Bacteria | 794 |
| 71 | Ga0055534_1000052 | 3300003784 | Bacteria | 91095 |
| 72 | Ga0055534_1004464 | 3300003784 | Bacteria | 4047 |
| 73 | Ga0055528_1000009 | 3300003790 | Bacteria | 224150 |
| 74 | Ga0055530_10009161 | 3300003791 | Bacteria | 3845 |
| 75 | Ga0055540_1027462 | 3300003792 | Bacteria | 1361 |
| 76 | Ga0055540_1099154 | 3300003792 | Bacteria | 544 |
| 77 | Ga0055531_10003386 | 3300003794 | Bacteria | 10187 |
| 78 | Ga0055531_10024760 | 3300003794 | Bacteria | 2201 |
| 79 | Ga0065165_1006432 | 3300005262 | Bacteria | 6162 |
| 80 | Ga0070658_10003054 | 3300005327 | Bacteria | 13838 |
| 81 | Ga0070658_10506690 | 3300005327 | Bacteria | 1043 |
| 82 | Ga0070658_10616842 | 3300005327 | Bacteria | 940 |
| 83 | Ga0070658_10852760 | 3300005327 | Bacteria | 792 |
| 84 | Ga0070658_10922143 | 3300005327 | Bacteria | 759 |
| 85 | Ga0070676_10208880 | 3300005328 | Bacteria | 1284 |
| 86 | Ga0070676_10216960 | 3300005328 | Bacteria | 1262 |
| 87 | Ga0070676_10311370 | 3300005328 | Bacteria | 1071 |
| 88 | Ga0070676_10379102 | 3300005328 | Bacteria | 979 |
| 89 | Ga0070676_10575862 | 3300005328 | Bacteria | 809 |
| 90 | Ga0070683_100318735 | 3300005329 | Bacteria | 1479 |
| 91 | Ga0070683_100541837 | 3300005329 | Bacteria | 1113 |
| 92 | Ga0070690_100411184 | 3300005330 | Bacteria | 996 |
| 93 | Ga0070690_101494143 | 3300005330 | Bacteria | 546 |
| 94 | Ga0070670_100068818 | 3300005331 | Bacteria | 3039 |
| 95 | Ga0070670_100141643 | 3300005331 | Bacteria | 2080 |
| 96 | Ga0070670_100156846 | 3300005331 | Bacteria | 1972 |
| 97 | Ga0070670_100375681 | 3300005331 | Bacteria | 1252 |
| 98 | Ga0070670_100419130 | 3300005331 | Bacteria | 1183 |
| 99 | Ga0070670_100942112 | 3300005331 | Bacteria | 784 |
| 100 | Ga0070670_101118738 | 3300005331 | Bacteria | 719 |
| 101 | Ga0070670_101565348 | 3300005331 | Bacteria | 606 |
| 102 | Ga0068869_100047959 | 3300005334 | Bacteria | 3087 |
| 103 | Ga0068869_100128761 | 3300005334 | Bacteria | 1944 |
| 104 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 105 | Ga0070666_10001186 | 3300005335 | Bacteria | 15774 |
| 106 | Ga0070666_10070889 | 3300005335 | Bacteria | 2371 |
| 107 | Ga0070666_10089151 | 3300005335 | Bacteria | 2116 |
| 108 | Ga0070666_10107381 | 3300005335 | Bacteria | 1928 |
| 109 | Ga0070680_101125684 | 3300005336 | Bacteria | 678 |
| 110 | Ga0070680_101335632 | 3300005336 | Bacteria | 621 |
| 111 | Ga0070680_101515888 | 3300005336 | Bacteria | 581 |
| 112 | Ga0070682_100058779 | 3300005337 | Bacteria | 2425 |
| 113 | Ga0070682_100316697 | 3300005337 | Bacteria | 1150 |
| 114 | Ga0070682_101584440 | 3300005337 | Bacteria | 566 |
| 115 | Ga0068868_100035150 | 3300005338 | Bacteria | 3872 |
| 116 | Ga0068868_100166786 | 3300005338 | Bacteria | 1822 |
| 117 | Ga0068868_100201592 | 3300005338 | Bacteria | 1659 |
| 118 | Ga0068868_100355987 | 3300005338 | Bacteria | 1255 |
| 119 | Ga0068868_100724207 | 3300005338 | Bacteria | 892 |
| 120 | Ga0070660_100133313 | 3300005339 | Bacteria | 1989 |
| 121 | Ga0070660_100252028 | 3300005339 | Bacteria | 1440 |
| 122 | Ga0070660_100878421 | 3300005339 | Bacteria | 755 |
| 123 | Ga0070660_101438456 | 3300005339 | Bacteria | 586 |
| 124 | Ga0070689_100236971 | 3300005340 | Bacteria | 1502 |
| 125 | Ga0070689_100812744 | 3300005340 | Bacteria | 823 |
| 126 | Ga0070691_10017095 | 3300005341 | Bacteria | 3338 |
| 127 | Ga0070687_100645345 | 3300005343 | Bacteria | 733 |
| 128 | Ga0070661_100017074 | 3300005344 | Bacteria | 5144 |
| 129 | Ga0070661_100018867 | 3300005344 | Bacteria | 4910 |
| 130 | Ga0070661_100057112 | 3300005344 | Bacteria | 2860 |
| 131 | Ga0070661_100083093 | 3300005344 | Bacteria | 2365 |
| 132 | Ga0070661_100109495 | 3300005344 | Bacteria | 2061 |
| 133 | Ga0070661_100259293 | 3300005344 | Bacteria | 1344 |
| 134 | Ga0070661_100735824 | 3300005344 | Bacteria | 806 |
| 135 | Ga0070692_10001200 | 3300005345 | Bacteria | 9184 |
| 136 | Ga0070668_100027029 | 3300005347 | Bacteria | 4355 |
| 137 | Ga0070668_100029601 | 3300005347 | Bacteria | 4159 |
| 138 | Ga0070668_100037989 | 3300005347 | Bacteria | 3678 |
| 139 | Ga0070668_100286427 | 3300005347 | Bacteria | 1377 |
| 140 | Ga0070668_100701499 | 3300005347 | Bacteria | 893 |
| 141 | Ga0070668_100853455 | 3300005347 | Bacteria | 812 |
| 142 | Ga0070669_100556490 | 3300005353 | Bacteria | 957 |
| 143 | Ga0070669_100801015 | 3300005353 | Bacteria | 801 |
| 144 | Ga0070669_101688788 | 3300005353 | Bacteria | 552 |
| 145 | Ga0070675_100075966 | 3300005354 | Bacteria | 2794 |
| 146 | Ga0070675_100508634 | 3300005354 | Bacteria | 1086 |
| 147 | Ga0070671_100140699 | 3300005355 | Bacteria | 2036 |
| 148 | Ga0070671_101007524 | 3300005355 | Bacteria | 730 |
| 149 | Ga0070671_101306999 | 3300005355 | Bacteria | 640 |
| 150 | Ga0070671_102088059 | 3300005355 | Bacteria | 505 |
| 151 | Ga0070674_100381466 | 3300005356 | Bacteria | 1147 |
| 152 | Ga0070673_100118935 | 3300005364 | Bacteria | 2201 |
| 153 | Ga0070673_100121644 | 3300005364 | Bacteria | 2178 |
| 154 | Ga0070673_101658429 | 3300005364 | Bacteria | 605 |
| 155 | Ga0070688_100662342 | 3300005365 | Bacteria | 805 |
| 156 | Ga0070659_100295472 | 3300005366 | Bacteria | 1350 |
| 157 | Ga0070659_100720786 | 3300005366 | Bacteria | 863 |
| 158 | Ga0070659_101252060 | 3300005366 | Bacteria | 657 |
| 159 | Ga0070667_100000084 | 3300005367 | Bacteria | 118027 |
| 160 | Ga0070667_100014298 | 3300005367 | Bacteria | 6557 |
| 161 | Ga0070667_100016481 | 3300005367 | Bacteria | 6115 |
| 162 | Ga0070667_100111163 | 3300005367 | Bacteria | 2376 |
| 163 | Ga0070667_100116610 | 3300005367 | Bacteria | 2319 |
| 164 | Ga0070667_100166891 | 3300005367 | Bacteria | 1942 |
| 165 | Ga0070667_100258183 | 3300005367 | Bacteria | 1559 |
| 166 | Ga0070667_100380143 | 3300005367 | Bacteria | 1283 |
| 167 | Ga0070667_100491248 | 3300005367 | Bacteria | 1125 |
| 168 | Ga0070667_100518659 | 3300005367 | Bacteria | 1093 |
| 169 | Ga0070667_100568992 | 3300005367 | Bacteria | 1042 |
| 170 | Ga0070667_100569730 | 3300005367 | Bacteria | 1042 |
| 171 | Ga0070667_100673927 | 3300005367 | Bacteria | 956 |
| 172 | Ga0070667_100714646 | 3300005367 | Bacteria | 928 |
| 173 | Ga0070667_101745029 | 3300005367 | Bacteria | 586 |
| 174 | Ga0070667_101865706 | 3300005367 | Bacteria | 566 |
| 175 | Ga0070709_10610281 | 3300005434 | Bacteria | 841 |
| 176 | Ga0070714_100092322 | 3300005435 | Bacteria | 2653 |
| 177 | Ga0070714_100233190 | 3300005435 | Bacteria | 1696 |
| 178 | Ga0070714_100712286 | 3300005435 | Bacteria | 969 |
| 179 | Ga0070713_100000401 | 3300005436 | Bacteria | 27829 |
| 180 | Ga0070713_101546112 | 3300005436 | Bacteria | 644 |
| 181 | Ga0070711_100847092 | 3300005439 | Bacteria | 778 |
| 182 | Ga0070711_100949692 | 3300005439 | Bacteria | 736 |
| 183 | Ga0070711_101627140 | 3300005439 | Bacteria | 565 |
| 184 | Ga0070711_102041554 | 3300005439 | Bacteria | 504 |
| 185 | Ga0070663_100000327 | 3300005455 | Bacteria | 24677 |
| 186 | Ga0070663_100019945 | 3300005455 | Bacteria | 4428 |
| 187 | Ga0070663_100099652 | 3300005455 | Bacteria | 2166 |
| 188 | Ga0070663_100153698 | 3300005455 | Bacteria | 1767 |
| 189 | Ga0070663_100166357 | 3300005455 | Bacteria | 1701 |
| 190 | Ga0070663_101025064 | 3300005455 | Bacteria | 718 |
| 191 | Ga0070663_101230109 | 3300005455 | Bacteria | 659 |
| 192 | Ga0070678_100025334 | 3300005456 | Bacteria | 3988 |
| 193 | Ga0070678_100082189 | 3300005456 | Bacteria | 2445 |
| 194 | Ga0070678_100802964 | 3300005456 | Bacteria | 854 |
| 195 | Ga0070678_102049207 | 3300005456 | Bacteria | 542 |
| 196 | Ga0070662_100201437 | 3300005457 | Bacteria | 1580 |
| 197 | Ga0070662_100324011 | 3300005457 | Bacteria | 1257 |
| 198 | Ga0070662_100451123 | 3300005457 | Bacteria | 1067 |
| 199 | Ga0070662_100458096 | 3300005457 | Bacteria | 1059 |
| 200 | Ga0070662_100907941 | 3300005457 | Bacteria | 752 |
| 201 | Ga0070662_101204415 | 3300005457 | Bacteria | 651 |
| 202 | Ga0070681_10169047 | 3300005458 | Bacteria | 2108 |
| 203 | Ga0070681_10367131 | 3300005458 | Bacteria | 1350 |
| 204 | Ga0070681_10507270 | 3300005458 | Bacteria | 1119 |
| 205 | Ga0068867_100151954 | 3300005459 | Bacteria | 1819 |
| 206 | Ga0068867_100167454 | 3300005459 | Bacteria | 1738 |
| 207 | Ga0068867_100205089 | 3300005459 | Bacteria | 1580 |
| 208 | Ga0068867_100822787 | 3300005459 | Bacteria | 830 |
| 209 | Ga0068867_101160619 | 3300005459 | Bacteria | 708 |
| 210 | Ga0070685_10005887 | 3300005466 | Bacteria | 6239 |
| 211 | Ga0070685_10659667 | 3300005466 | Bacteria | 759 |
| 212 | Ga0070685_11298692 | 3300005466 | Bacteria | 556 |
| 213 | Ga0070699_100813160 | 3300005518 | Bacteria | 855 |
| 214 | Ga0070679_100193143 | 3300005530 | Bacteria | 2004 |
| 215 | Ga0070679_102188816 | 3300005530 | Bacteria | 503 |
| 216 | Ga0068853_100002704 | 3300005539 | Bacteria | 13374 |
| 217 | Ga0068853_100065726 | 3300005539 | Bacteria | 3147 |
| 218 | Ga0068853_100077969 | 3300005539 | Bacteria | 2895 |
| 219 | Ga0068853_100243932 | 3300005539 | Bacteria | 1647 |
| 220 | Ga0068853_100384322 | 3300005539 | Bacteria | 1311 |
| 221 | Ga0068853_100597911 | 3300005539 | Bacteria | 1047 |
| 222 | Ga0068853_100663150 | 3300005539 | Bacteria | 993 |
| 223 | Ga0068853_100673498 | 3300005539 | Bacteria | 986 |
| 224 | Ga0068853_101016012 | 3300005539 | Bacteria | 798 |
| 225 | Ga0068853_101072473 | 3300005539 | Bacteria | 776 |
| 226 | Ga0068853_101419858 | 3300005539 | Bacteria | 671 |
| 227 | Ga0070672_100268324 | 3300005543 | Bacteria | 1440 |
| 228 | Ga0070672_100274735 | 3300005543 | Bacteria | 1423 |
| 229 | Ga0070696_100026415 | 3300005546 | Bacteria | 3950 |
| 230 | Ga0070696_101086134 | 3300005546 | Bacteria | 672 |
| 231 | Ga0070693_100084649 | 3300005547 | Bacteria | 1898 |
| 232 | Ga0070693_100188355 | 3300005547 | Bacteria | 1333 |
| 233 | Ga0070693_100258338 | 3300005547 | Bacteria | 1157 |
| 234 | Ga0070693_100864475 | 3300005547 | Bacteria | 675 |
| 235 | Ga0070665_100000249 | 3300005548 | Bacteria | 89011 |
| 236 | Ga0070665_100012690 | 3300005548 | Bacteria | 8486 |
| 237 | Ga0070665_100022171 | 3300005548 | Bacteria | 6389 |
| 238 | Ga0070665_100056231 | 3300005548 | Bacteria | 3945 |
| 239 | Ga0070665_100259943 | 3300005548 | Bacteria | 1737 |
| 240 | Ga0070665_100543687 | 3300005548 | Bacteria | 1174 |
| 241 | Ga0070665_100821504 | 3300005548 | Bacteria | 942 |
| 242 | Ga0070665_101151931 | 3300005548 | Bacteria | 786 |
| 243 | Ga0070665_101263570 | 3300005548 | Bacteria | 749 |
| 244 | Ga0070665_101603595 | 3300005548 | Bacteria | 659 |
| 245 | Ga0070665_101749902 | 3300005548 | Bacteria | 628 |
| 246 | Ga0068855_100042228 | 3300005563 | Bacteria | 5403 |
| 247 | Ga0068855_100060595 | 3300005563 | Bacteria | 4425 |
| 248 | Ga0068855_100074780 | 3300005563 | Bacteria | 3934 |
| 249 | Ga0068855_100082771 | 3300005563 | Bacteria | 3719 |
| 250 | Ga0068855_100093629 | 3300005563 | Bacteria | 3465 |
| 251 | Ga0068855_100122346 | 3300005563 | Bacteria | 2977 |
| 252 | Ga0068855_100221989 | 3300005563 | Bacteria | 2118 |
| 253 | Ga0068855_100257604 | 3300005563 | Bacteria | 1944 |
| 254 | Ga0068855_100306227 | 3300005563 | Bacteria | 1759 |
| 255 | Ga0068855_100349227 | 3300005563 | Bacteria | 1630 |
| 256 | Ga0068855_100379456 | 3300005563 | Bacteria | 1552 |
| 257 | Ga0068855_100519186 | 3300005563 | Bacteria | 1292 |
| 258 | Ga0068855_101070197 | 3300005563 | Bacteria | 844 |
| 259 | Ga0068855_101672526 | 3300005563 | Bacteria | 650 |
| 260 | Ga0070664_100066498 | 3300005564 | Bacteria | 3078 |
| 261 | Ga0070664_100159884 | 3300005564 | Bacteria | 1993 |
| 262 | Ga0070664_100410070 | 3300005564 | Bacteria | 1240 |
| 263 | Ga0068857_100000551 | 3300005577 | Bacteria | 27318 |
| 264 | Ga0068857_100148913 | 3300005577 | Bacteria | 2119 |
| 265 | Ga0068857_100208283 | 3300005577 | Bacteria | 1784 |
| 266 | Ga0068857_100225783 | 3300005577 | Bacteria | 1711 |
| 267 | Ga0068857_100636914 | 3300005577 | Bacteria | 1010 |
| 268 | Ga0068857_101718814 | 3300005577 | Bacteria | 613 |
| 269 | Ga0068857_102066812 | 3300005577 | Bacteria | 559 |
| 270 | Ga0068854_100000634 | 3300005578 | Bacteria | 20800 |
| 271 | Ga0068854_100028199 | 3300005578 | Bacteria | 3877 |
| 272 | Ga0068854_100095505 | 3300005578 | Bacteria | 2219 |
| 273 | Ga0068854_100134375 | 3300005578 | Bacteria | 1892 |
| 274 | Ga0068854_100345216 | 3300005578 | Bacteria | 1217 |
| 275 | Ga0068854_100463767 | 3300005578 | Bacteria | 1060 |
| 276 | Ga0068854_100562606 | 3300005578 | Bacteria | 969 |
| 277 | Ga0068856_100000245 | 3300005614 | Bacteria | 59235 |
| 278 | Ga0068856_100015179 | 3300005614 | Bacteria | 7440 |
| 279 | Ga0068856_100034861 | 3300005614 | Bacteria | 4931 |
| 280 | Ga0068856_100252731 | 3300005614 | Bacteria | 1778 |
| 281 | Ga0068856_100372684 | 3300005614 | Bacteria | 1446 |
| 282 | Ga0068856_100452730 | 3300005614 | Bacteria | 1304 |
| 283 | Ga0068856_100734895 | 3300005614 | Bacteria | 1007 |
| 284 | Ga0068856_100735744 | 3300005614 | Bacteria | 1006 |
| 285 | Ga0068856_100761240 | 3300005614 | Bacteria | 988 |
| 286 | Ga0068856_100774353 | 3300005614 | Bacteria | 979 |
| 287 | Ga0068856_101836171 | 3300005614 | Bacteria | 617 |
| 288 | Ga0068852_100038365 | 3300005616 | Bacteria | 4025 |
| 289 | Ga0068852_100118481 | 3300005616 | Bacteria | 2419 |
| 290 | Ga0068852_100166563 | 3300005616 | Bacteria | 2062 |
| 291 | Ga0068852_100502344 | 3300005616 | Bacteria | 1207 |
| 292 | Ga0068852_100531430 | 3300005616 | Bacteria | 1174 |
| 293 | Ga0068852_100662612 | 3300005616 | Bacteria | 1052 |
| 294 | Ga0068852_100761451 | 3300005616 | Bacteria | 981 |
| 295 | Ga0068852_101026213 | 3300005616 | Bacteria | 844 |
| 296 | Ga0068852_101128034 | 3300005616 | Bacteria | 805 |
| 297 | Ga0068852_101410680 | 3300005616 | Bacteria | 719 |
| 298 | Ga0068852_102722405 | 3300005616 | Bacteria | 513 |
| 299 | Ga0068859_100001367 | 3300005617 | Bacteria | 24845 |
| 300 | Ga0068859_100261639 | 3300005617 | Bacteria | 1821 |
| 301 | Ga0068859_100797998 | 3300005617 | Bacteria | 1032 |
| 302 | Ga0068859_100906336 | 3300005617 | Bacteria | 966 |
| 303 | Ga0068859_100972630 | 3300005617 | Bacteria | 932 |
| 304 | Ga0068864_100238138 | 3300005618 | Bacteria | 1685 |
| 305 | Ga0068864_100388209 | 3300005618 | Bacteria | 1325 |
| 306 | Ga0068864_100399545 | 3300005618 | Bacteria | 1306 |
| 307 | Ga0068864_100585219 | 3300005618 | Bacteria | 1082 |
| 308 | Ga0068866_10935768 | 3300005718 | Bacteria | 612 |
| 309 | Ga0068861_100300737 | 3300005719 | Bacteria | 1390 |
| 310 | Ga0068861_100927172 | 3300005719 | Bacteria | 827 |
| 311 | Ga0068851_10002343 | 3300005834 | Bacteria | 8336 |
| 312 | Ga0068851_10176390 | 3300005834 | Bacteria | 1182 |
| 313 | Ga0068851_10221766 | 3300005834 | Bacteria | 1063 |
| 314 | Ga0068851_10484571 | 3300005834 | Bacteria | 740 |
| 315 | Ga0068870_10669774 | 3300005840 | Bacteria | 713 |
| 316 | Ga0068863_100005779 | 3300005841 | Bacteria | 12127 |
| 317 | Ga0068863_100015026 | 3300005841 | Bacteria | 7437 |
| 318 | Ga0068863_100039049 | 3300005841 | Bacteria | 4517 |
| 319 | Ga0068863_100090495 | 3300005841 | Bacteria | 2901 |
| 320 | Ga0068863_100171415 | 3300005841 | Bacteria | 2082 |
| 321 | Ga0068863_101228510 | 3300005841 | Bacteria | 755 |
| 322 | Ga0068863_101273389 | 3300005841 | Bacteria | 742 |
| 323 | Ga0068863_101684782 | 3300005841 | Bacteria | 644 |
| 324 | Ga0068858_100002098 | 3300005842 | Bacteria | 20252 |
| 325 | Ga0068858_100087159 | 3300005842 | Bacteria | 2904 |
| 326 | Ga0068858_100514926 | 3300005842 | Bacteria | 1157 |
| 327 | Ga0068858_102317411 | 3300005842 | Bacteria | 531 |
| 328 | Ga0068860_100002623 | 3300005843 | Bacteria | 18693 |
| 329 | Ga0068860_100125858 | 3300005843 | Bacteria | 2456 |
| 330 | Ga0068860_100153813 | 3300005843 | Bacteria | 2216 |
| 331 | Ga0068860_100231301 | 3300005843 | Bacteria | 1796 |
| 332 | Ga0068860_100306934 | 3300005843 | Bacteria | 1556 |
| 333 | Ga0068860_100798786 | 3300005843 | Bacteria | 957 |
| 334 | Ga0068860_101747859 | 3300005843 | Bacteria | 644 |
| 335 | Ga0068862_100000941 | 3300005844 | Bacteria | 28057 |
| 336 | Ga0068862_100839203 | 3300005844 | Bacteria | 900 |
| 337 | Ga0081455_10094355 | 3300005937 | Bacteria | 2417 |
| 338 | Ga0081455_10541744 | 3300005937 | Bacteria | 772 |
| 339 | Ga0081540_1001118 | 3300005983 | Bacteria | 23746 |
| 340 | Ga0075365_10573912 | 3300006038 | Bacteria | 798 |
| 341 | Ga0075364_10603065 | 3300006051 | Unclassified | 750 |
| 342 | Ga0070716_101083873 | 3300006173 | Bacteria | 638 |
| 343 | Ga0070712_100695102 | 3300006175 | Bacteria | 867 |
| 344 | Ga0070712_101210084 | 3300006175 | Bacteria | 657 |
| 345 | Ga0075367_10334613 | 3300006178 | Unclassified | 955 |
| 346 | Ga0075366_10904500 | 3300006195 | Bacteria | 550 |
| 347 | Ga0097621_100128744 | 3300006237 | Bacteria | 2152 |
| 348 | Ga0097621_100250600 | 3300006237 | Bacteria | 1550 |
| 349 | Ga0097621_100445794 | 3300006237 | Bacteria | 1165 |
| 350 | Ga0097621_100463893 | 3300006237 | Bacteria | 1143 |
| 351 | Ga0097621_101384646 | 3300006237 | Bacteria | 666 |
| 352 | Ga0068871_100038080 | 3300006358 | Bacteria | 3837 |
| 353 | Ga0068871_100111371 | 3300006358 | Bacteria | 2302 |
| 354 | Ga0068871_100169544 | 3300006358 | Bacteria | 1870 |
| 355 | Ga0068871_100362746 | 3300006358 | Bacteria | 1283 |
| 356 | Ga0068871_100383698 | 3300006358 | Bacteria | 1248 |
| 357 | Ga0068871_101410630 | 3300006358 | Bacteria | 657 |
| 358 | Ga0068871_101446288 | 3300006358 | Bacteria | 649 |
| 359 | Ga0075431_100702404 | 3300006847 | Bacteria | 989 |
| 360 | Ga0075434_101493858 | 3300006871 | Bacteria | 685 |
| 361 | Ga0068865_100003492 | 3300006881 | Bacteria | 9421 |
| 362 | Ga0068865_100018704 | 3300006881 | Bacteria | 4475 |
| 363 | Ga0068865_100196150 | 3300006881 | Bacteria | 1565 |
| 364 | Ga0068865_100213578 | 3300006881 | Bacteria | 1505 |
| 365 | Ga0068865_100758994 | 3300006881 | Bacteria | 834 |
| 366 | Ga0068865_101901953 | 3300006881 | Bacteria | 539 |
| 367 | Ga0075436_100124884 | 3300006914 | Bacteria | 1803 |
| 368 | Ga0097620_100001367 | 3300006931 | Bacteria | 24845 |
| 369 | Ga0097620_100261640 | 3300006931 | Bacteria | 1821 |
| 370 | Ga0097620_100798097 | 3300006931 | Bacteria | 1032 |
| 371 | Ga0097620_100906622 | 3300006931 | Bacteria | 966 |
| 372 | Ga0097620_100972635 | 3300006931 | Bacteria | 932 |
| 373 | Ga0099826_10169391 | 3300006948 | Bacteria | 1228 |
| 374 | Ga0105240_10000627 | 3300009093 | Bacteria | 65150 |
| 375 | Ga0105240_10098926 | 3300009093 | Bacteria | 3551 |
| 376 | Ga0105240_10123497 | 3300009093 | Bacteria | 3115 |
| 377 | Ga0105240_10213925 | 3300009093 | Bacteria | 2250 |
| 378 | Ga0105240_10309393 | 3300009093 | Bacteria | 1805 |
| 379 | Ga0105240_10335124 | 3300009093 | Bacteria | 1720 |
| 380 | Ga0105240_10431908 | 3300009093 | Bacteria | 1478 |
| 381 | Ga0105240_10559067 | 3300009093 | Bacteria | 1265 |
| 382 | Ga0105240_10760555 | 3300009093 | Bacteria | 1053 |
| 383 | Ga0105240_10760556 | 3300009093 | Bacteria | 1053 |
| 384 | Ga0105240_11558216 | 3300009093 | Bacteria | 692 |
| 385 | Ga0111539_11813593 | 3300009094 | Bacteria | 707 |
| 386 | Ga0105245_10261611 | 3300009098 | Bacteria | 1684 |
| 387 | Ga0105245_10331048 | 3300009098 | Bacteria | 1503 |
| 388 | Ga0105245_10624776 | 3300009098 | Bacteria | 1106 |
| 389 | Ga0105245_11467698 | 3300009098 | Bacteria | 733 |
| 390 | Ga0105247_10053155 | 3300009101 | Bacteria | 2498 |
| 391 | Ga0105247_10196742 | 3300009101 | Bacteria | 1352 |
| 392 | Ga0105243_10674006 | 3300009148 | Bacteria | 1005 |
| 393 | Ga0105243_12070627 | 3300009148 | Bacteria | 604 |
| 394 | Ga0105241_10050532 | 3300009174 | Bacteria | 3169 |
| 395 | Ga0105241_10104348 | 3300009174 | Bacteria | 2258 |
| 396 | Ga0105241_10122703 | 3300009174 | Bacteria | 2094 |
| 397 | Ga0105241_10295120 | 3300009174 | Bacteria | 1389 |
| 398 | Ga0105241_10354005 | 3300009174 | Bacteria | 1276 |
| 399 | Ga0105241_10622816 | 3300009174 | Bacteria | 977 |
| 400 | Ga0105241_10701426 | 3300009174 | Bacteria | 924 |
| 401 | Ga0105241_10864665 | 3300009174 | Bacteria | 837 |
| 402 | Ga0105241_11223866 | 3300009174 | Bacteria | 712 |
| 403 | Ga0105241_11551149 | 3300009174 | Bacteria | 639 |
| 404 | Ga0105241_11704536 | 3300009174 | Bacteria | 612 |
| 405 | Ga0105241_11788613 | 3300009174 | Bacteria | 599 |
| 406 | Ga0105242_10025509 | 3300009176 | Bacteria | 4678 |
| 407 | Ga0105242_10076451 | 3300009176 | Bacteria | 2791 |
| 408 | Ga0105242_10312729 | 3300009176 | Bacteria | 1438 |
| 409 | Ga0105242_10374891 | 3300009176 | Bacteria | 1321 |
| 410 | Ga0105242_10978358 | 3300009176 | Bacteria | 852 |
| 411 | Ga0105242_11022674 | 3300009176 | Bacteria | 835 |
| 412 | Ga0105248_10000418 | 3300009177 | Bacteria | 48728 |
| 413 | Ga0105248_10076122 | 3300009177 | Bacteria | 3772 |
| 414 | Ga0105248_10326174 | 3300009177 | Bacteria | 1729 |
| 415 | Ga0105248_10451960 | 3300009177 | Bacteria | 1448 |
| 416 | Ga0105248_10843000 | 3300009177 | Bacteria | 1035 |
| 417 | Ga0105237_10000272 | 3300009545 | Bacteria | 72718 |
| 418 | Ga0105237_10006138 | 3300009545 | Bacteria | 13433 |
| 419 | Ga0105237_10026547 | 3300009545 | Bacteria | 5919 |
| 420 | Ga0105237_10031065 | 3300009545 | Bacteria | 5418 |
| 421 | Ga0105237_10147981 | 3300009545 | Bacteria | 2344 |
| 422 | Ga0105237_10245121 | 3300009545 | Bacteria | 1793 |
| 423 | Ga0105237_10352560 | 3300009545 | Bacteria | 1476 |
| 424 | Ga0105237_10525259 | 3300009545 | Bacteria | 1190 |
| 425 | Ga0105237_10573499 | 3300009545 | Bacteria | 1135 |
| 426 | Ga0105237_10659941 | 3300009545 | Bacteria | 1053 |
| 427 | Ga0105237_10659942 | 3300009545 | Bacteria | 1053 |
| 428 | Ga0105237_10706116 | 3300009545 | Bacteria | 1015 |
| 429 | Ga0105237_10980829 | 3300009545 | Bacteria | 852 |
| 430 | Ga0105237_11112211 | 3300009545 | Bacteria | 797 |
| 431 | Ga0105237_11264886 | 3300009545 | Bacteria | 744 |
| 432 | Ga0105237_11359290 | 3300009545 | Bacteria | 717 |
| 433 | Ga0105237_11790736 | 3300009545 | Bacteria | 622 |
| 434 | Ga0105238_10000920 | 3300009551 | Bacteria | 30091 |
| 435 | Ga0105238_10002036 | 3300009551 | Bacteria | 20417 |
| 436 | Ga0105238_10043470 | 3300009551 | Bacteria | 4546 |
| 437 | Ga0105238_10060458 | 3300009551 | Bacteria | 3793 |
| 438 | Ga0105238_10119920 | 3300009551 | Bacteria | 2610 |
| 439 | Ga0105238_10127655 | 3300009551 | Bacteria | 2522 |
| 440 | Ga0105238_10176228 | 3300009551 | Bacteria | 2115 |
| 441 | Ga0105238_10176250 | 3300009551 | Bacteria | 2115 |
| 442 | Ga0105238_10199227 | 3300009551 | Bacteria | 1978 |
| 443 | Ga0105238_11015940 | 3300009551 | Bacteria | 850 |
| 444 | Ga0105238_11210731 | 3300009551 | Bacteria | 780 |
| 445 | Ga0105238_11362851 | 3300009551 | Bacteria | 736 |
| 446 | Ga0105238_12579614 | 3300009551 | Bacteria | 544 |
| 447 | Ga0105249_10000195 | 3300009553 | Bacteria | 69709 |
| 448 | Ga0105249_10027675 | 3300009553 | Bacteria | 5116 |
| 449 | Ga0105249_10216336 | 3300009553 | Bacteria | 1883 |
| 450 | Ga0105249_10356663 | 3300009553 | Bacteria | 1483 |
| 451 | Ga0105249_11155462 | 3300009553 | Bacteria | 845 |
| 452 | Ga0105148_101049 | 3300009978 | Bacteria | 1972 |
| 453 | Ga0105239_10000044 | 3300010375 | Bacteria | 187680 |
| 454 | Ga0105239_10002892 | 3300010375 | Bacteria | 21455 |
| 455 | Ga0105239_10006627 | 3300010375 | Bacteria | 13407 |
| 456 | Ga0105239_10032059 | 3300010375 | Bacteria | 5775 |
| 457 | Ga0105239_10100612 | 3300010375 | Bacteria | 3197 |
| 458 | Ga0105239_10130571 | 3300010375 | Bacteria | 2794 |
| 459 | Ga0105239_10170468 | 3300010375 | Bacteria | 2434 |
| 460 | Ga0105239_10225035 | 3300010375 | Bacteria | 2104 |
| 461 | Ga0105239_10416289 | 3300010375 | Bacteria | 1522 |
| 462 | Ga0105239_10539534 | 3300010375 | Bacteria | 1328 |
| 463 | Ga0105239_10661316 | 3300010375 | Bacteria | 1193 |
| 464 | Ga0105239_11091601 | 3300010375 | Bacteria | 918 |
| 465 | Ga0105239_11337868 | 3300010375 | Bacteria | 826 |
| 466 | Ga0105239_11344595 | 3300010375 | Bacteria | 824 |
| 467 | Ga0105239_12980888 | 3300010375 | Bacteria | 552 |
| 468 | Ga0105246_10341529 | 3300011119 | Bacteria | 1224 |
| 469 | Ga0105246_10840462 | 3300011119 | Bacteria | 818 |
| 470 | Ga0105246_11919937 | 3300011119 | Bacteria | 569 |
| 471 | Ga0157343_1015133 | 3300012488 | Bacteria | 641 |
| 472 | Ga0157314_1013756 | 3300012500 | Bacteria | 744 |
| 473 | Ga0157373_10121166 | 3300013100 | Bacteria | 1838 |
| 474 | Ga0157373_10337468 | 3300013100 | Bacteria | 1074 |
| 475 | Ga0157371_10011946 | 3300013102 | Bacteria | 6659 |
| 476 | Ga0157371_10210003 | 3300013102 | Bacteria | 1397 |
| 477 | Ga0157371_10802598 | 3300013102 | Bacteria | 709 |
| 478 | Ga0157370_10007966 | 3300013104 | Bacteria | 11479 |
| 479 | Ga0157370_10021865 | 3300013104 | Bacteria | 6371 |
| 480 | Ga0157370_10030429 | 3300013104 | Bacteria | 5289 |
| 481 | Ga0157370_10049266 | 3300013104 | Bacteria | 4032 |
| 482 | Ga0157370_10113933 | 3300013104 | Bacteria | 2526 |
| 483 | Ga0157370_10114393 | 3300013104 | Bacteria | 2521 |
| 484 | Ga0157370_10359121 | 3300013104 | Bacteria | 1343 |
| 485 | Ga0157370_10406772 | 3300013104 | Bacteria | 1252 |
| 486 | Ga0157370_10620345 | 3300013104 | Bacteria | 989 |
| 487 | Ga0157370_10745667 | 3300013104 | Bacteria | 892 |
| 488 | Ga0157370_10769083 | 3300013104 | Bacteria | 877 |
| 489 | Ga0157370_11072838 | 3300013104 | Bacteria | 728 |
| 490 | Ga0157370_11495738 | 3300013104 | Bacteria | 607 |
| 491 | Ga0157370_11870415 | 3300013104 | Bacteria | 538 |
| 492 | Ga0157369_10000329 | 3300013105 | Bacteria | 63484 |
| 493 | Ga0157369_10000604 | 3300013105 | Bacteria | 46765 |
| 494 | Ga0157369_10009635 | 3300013105 | Bacteria | 11046 |
| 495 | Ga0157369_10010381 | 3300013105 | Bacteria | 10617 |
| 496 | Ga0157369_10023388 | 3300013105 | Bacteria | 6882 |
| 497 | Ga0157369_10403660 | 3300013105 | Bacteria | 1418 |
| 498 | Ga0157369_10417095 | 3300013105 | Bacteria | 1392 |
| 499 | Ga0157369_10629502 | 3300013105 | Bacteria | 1107 |
| 500 | Ga0157369_10852514 | 3300013105 | Bacteria | 935 |
| 501 | Ga0157369_10857160 | 3300013105 | Bacteria | 932 |
| 502 | Ga0157369_11972512 | 3300013105 | Bacteria | 592 |
| 503 | Ga0157374_10279686 | 3300013296 | Bacteria | 1647 |
| 504 | Ga0157374_10303991 | 3300013296 | Bacteria | 1578 |
| 505 | Ga0157374_10435621 | 3300013296 | Bacteria | 1311 |
| 506 | Ga0157374_10859562 | 3300013296 | Bacteria | 924 |
| 507 | Ga0157374_10921159 | 3300013296 | Bacteria | 892 |
| 508 | Ga0157374_11029757 | 3300013296 | Bacteria | 843 |
| 509 | Ga0157374_12054846 | 3300013296 | Bacteria | 598 |
| 510 | Ga0157378_10001163 | 3300013297 | Bacteria | 23938 |
| 511 | Ga0157378_10036782 | 3300013297 | Bacteria | 4332 |
| 512 | Ga0157378_10460056 | 3300013297 | Bacteria | 1264 |
| 513 | Ga0157378_11489034 | 3300013297 | Bacteria | 721 |
| 514 | Ga0163162_10002333 | 3300013306 | Bacteria | 17809 |
| 515 | Ga0163162_10022472 | 3300013306 | Bacteria | 6214 |
| 516 | Ga0163162_10039066 | 3300013306 | Bacteria | 4739 |
| 517 | Ga0163162_11562272 | 3300013306 | Bacteria | 752 |
| 518 | Ga0163162_12242717 | 3300013306 | Bacteria | 627 |
| 519 | Ga0157372_10023320 | 3300013307 | Bacteria | 6708 |
| 520 | Ga0157372_10023763 | 3300013307 | Bacteria | 6649 |
| 521 | Ga0157372_10038916 | 3300013307 | Bacteria | 5249 |
| 522 | Ga0157372_10072331 | 3300013307 | Bacteria | 3886 |
| 523 | Ga0157372_10082841 | 3300013307 | Bacteria | 3632 |
| 524 | Ga0157372_10189213 | 3300013307 | Bacteria | 2384 |
| 525 | Ga0157372_10206533 | 3300013307 | Bacteria | 2276 |
| 526 | Ga0157372_10375352 | 3300013307 | Bacteria | 1657 |
| 527 | Ga0157372_10431261 | 3300013307 | Bacteria | 1536 |
| 528 | Ga0157372_10779366 | 3300013307 | Bacteria | 1111 |
| 529 | Ga0157372_11383829 | 3300013307 | Bacteria | 811 |
| 530 | Ga0157375_10013024 | 3300013308 | Bacteria | 7390 |
| 531 | Ga0157375_10064653 | 3300013308 | Bacteria | 3643 |
| 532 | Ga0157375_10167400 | 3300013308 | Bacteria | 2343 |
| 533 | Ga0157375_10896503 | 3300013308 | Bacteria | 1031 |
| 534 | Ga0163163_10000754 | 3300014325 | Bacteria | 27527 |
| 535 | Ga0163163_10239681 | 3300014325 | Bacteria | 1863 |
| 536 | Ga0163163_10241793 | 3300014325 | Bacteria | 1855 |
| 537 | Ga0163163_11931750 | 3300014325 | Bacteria | 650 |
| 538 | Ga0157380_12656551 | 3300014326 | Bacteria | 567 |
| 539 | Ga0182008_10066759 | 3300014497 | Bacteria | 1770 |
| 540 | Ga0182008_10166729 | 3300014497 | Bacteria | 1110 |
| 541 | Ga0182008_10389459 | 3300014497 | Bacteria | 746 |
| 542 | Ga0157377_10969725 | 3300014745 | Bacteria | 641 |
| 543 | Ga0157379_10188376 | 3300014968 | Bacteria | 1865 |
| 544 | Ga0157379_10360209 | 3300014968 | Bacteria | 1333 |
| 545 | Ga0157376_10002106 | 3300014969 | Bacteria | 13384 |
| 546 | Ga0157376_10673001 | 3300014969 | Bacteria | 1037 |
| 547 | Ga0157376_11211577 | 3300014969 | Bacteria | 783 |
| 548 | Ga0182006_1013034 | 3300015261 | Bacteria | 3621 |
| 549 | Ga0182007_10034657 | 3300015262 | Bacteria | 1704 |
| 550 | Ga0182007_10207051 | 3300015262 | Bacteria | 688 |
| 551 | Ga0182007_10221888 | 3300015262 | Bacteria | 668 |
| 552 | Ga0182005_1051168 | 3300015265 | Bacteria | 1123 |
| 553 | Ga0183369_1008 | 3300015685 | Bacteria | 346514 |
| 554 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 555 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 556 | Ga0163161_10331938 | 3300017792 | Bacteria | 1204 |
| 557 | Ga0163161_11073987 | 3300017792 | Bacteria | 691 |
| 558 | Ga0206356_11373589 | 3300020070 | Bacteria | 1638 |
| 559 | Ga0206354_10531980 | 3300020081 | Bacteria | 1185 |
| 560 | Ga0206353_10211211 | 3300020082 | Bacteria | 860 |
| 561 | Ga0154015_1010693 | 3300020610 | Bacteria | 1120 |
| 562 | Ga0213872_10006100 | 3300021361 | Bacteria | 6099 |
| 563 | Ga0209435_102375 | 3300025206 | Bacteria | 2214 |
| 564 | Ga0209435_102791 | 3300025206 | Bacteria | 2023 |
| 565 | Ga0209760_100371 | 3300025207 | Bacteria | 11904 |
| 566 | Ga0209784_100016 | 3300025224 | Bacteria | 481036 |
| 567 | Ga0209566_101455 | 3300025225 | Bacteria | 6871 |
| 568 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 569 | Ga0209674_100322 | 3300025226 | Bacteria | 30565 |
| 570 | Ga0209674_100347 | 3300025226 | Bacteria | 26865 |
| 571 | Ga0209674_101036 | 3300025226 | Bacteria | 8447 |
| 572 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 573 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 574 | Ga0209672_100389 | 3300025228 | Bacteria | 26663 |
| 575 | Ga0209672_100559 | 3300025228 | Bacteria | 19837 |
| 576 | Ga0209672_105497 | 3300025228 | Bacteria | 2164 |
| 577 | Ga0209147_112175 | 3300025229 | Bacteria | 931 |
| 578 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 579 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 580 | Ga0207427_100188 | 3300025231 | Bacteria | 63213 |
| 581 | Ga0207427_100402 | 3300025231 | Bacteria | 25407 |
| 582 | Ga0207427_100594 | 3300025231 | Bacteria | 18110 |
| 583 | Ga0207427_102610 | 3300025231 | Bacteria | 4622 |
| 584 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 585 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 586 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 587 | Ga0209437_100192 | 3300025233 | Bacteria | 122888 |
| 588 | Ga0209437_100537 | 3300025233 | Bacteria | 26234 |
| 589 | Ga0209437_101513 | 3300025233 | Bacteria | 5500 |
| 590 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 591 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 592 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 593 | Ga0209258_100238 | 3300025242 | Bacteria | 102043 |
| 594 | Ga0209258_100765 | 3300025242 | Bacteria | 19864 |
| 595 | Ga0209258_101311 | 3300025242 | Bacteria | 9204 |
| 596 | Ga0209258_101904 | 3300025242 | Bacteria | 6196 |
| 597 | Ga0209258_121959 | 3300025242 | Bacteria | 656 |
| 598 | Ga0207425_1001752 | 3300025245 | Bacteria | 8476 |
| 599 | Ga0209646_1001514 | 3300025246 | Bacteria | 6161 |
| 600 | Ga0209646_1001913 | 3300025246 | Bacteria | 5063 |
| 601 | Ga0209646_1001986 | 3300025246 | Bacteria | 4915 |
| 602 | Ga0209026_1000012 | 3300025250 | Bacteria | 480426 |
| 603 | Ga0209026_1000105 | 3300025250 | Bacteria | 150738 |
| 604 | Ga0209026_1000278 | 3300025250 | Bacteria | 59676 |
| 605 | Ga0209026_1000285 | 3300025250 | Bacteria | 58221 |
| 606 | Ga0209026_1000335 | 3300025250 | Bacteria | 45678 |
| 607 | Ga0209026_1030371 | 3300025250 | Bacteria | 803 |
| 608 | Ga0209026_1033302 | 3300025250 | Bacteria | 760 |
| 609 | Ga0209677_103018 | 3300025253 | Bacteria | 5800 |
| 610 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 611 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 612 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 613 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 614 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 615 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 616 | Ga0209148_1025941 | 3300025254 | Bacteria | 914 |
| 617 | Ga0209759_1000356 | 3300025256 | Bacteria | 59211 |
| 618 | Ga0209759_1000460 | 3300025256 | Bacteria | 46256 |
| 619 | Ga0209759_1000536 | 3300025256 | Bacteria | 39942 |
| 620 | Ga0209759_1000912 | 3300025256 | Bacteria | 21915 |
| 621 | Ga0209759_1023568 | 3300025256 | Bacteria | 1352 |
| 622 | Ga0209129_1002063 | 3300025258 | Bacteria | 10356 |
| 623 | Ga0209129_1003433 | 3300025258 | Bacteria | 6893 |
| 624 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 625 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 626 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 627 | Ga0209233_1000370 | 3300025261 | Bacteria | 40063 |
| 628 | Ga0209233_1060127 | 3300025261 | Bacteria | 736 |
| 629 | Ga0209565_1000048 | 3300025263 | Bacteria | 224961 |
| 630 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 631 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 632 | Ga0209455_1000039 | 3300025272 | Bacteria | 437734 |
| 633 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 634 | Ga0209455_1000310 | 3300025272 | Bacteria | 49825 |
| 635 | Ga0209455_1016170 | 3300025272 | Bacteria | 1613 |
| 636 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 637 | Ga0209673_1018372 | 3300025273 | Bacteria | 2544 |
| 638 | Ga0209673_1095729 | 3300025273 | Bacteria | 648 |
| 639 | Ga0209130_1002842 | 3300025284 | Bacteria | 8029 |
| 640 | Ga0209675_1000045 | 3300025291 | Bacteria | 225750 |
| 641 | Ga0209675_1036559 | 3300025291 | Bacteria | 1111 |
| 642 | Ga0209676_1006754 | 3300025292 | Bacteria | 5578 |
| 643 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 644 | Ga0209025_1006351 | 3300025294 | Bacteria | 9208 |
| 645 | Ga0209025_1013061 | 3300025294 | Bacteria | 5253 |
| 646 | Ga0209025_1040960 | 3300025294 | Bacteria | 1993 |
| 647 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 648 | Ga0209564_1039988 | 3300025295 | Bacteria | 1280 |
| 649 | Ga0209758_1000535 | 3300025297 | Bacteria | 60513 |
| 650 | Ga0209758_1009118 | 3300025297 | Bacteria | 6254 |
| 651 | Ga0209758_1012999 | 3300025297 | Bacteria | 4591 |
| 652 | Ga0209050_1001247 | 3300025298 | Bacteria | 29383 |
| 653 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 654 | Ga0209256_1004565 | 3300025299 | Bacteria | 8591 |
| 655 | Ga0209256_1039654 | 3300025299 | Bacteria | 1209 |
| 656 | Ga0207426_1006400 | 3300025302 | Bacteria | 5131 |
| 657 | Ga0207426_1138574 | 3300025302 | Bacteria | 581 |
| 658 | Ga0209051_1014949 | 3300025303 | Bacteria | 3598 |
| 659 | Ga0209051_1019027 | 3300025303 | Bacteria | 3013 |
| 660 | Ga0209051_1031421 | 3300025303 | Bacteria | 2043 |
| 661 | Ga0209257_1000217 | 3300025304 | Bacteria | 136049 |
| 662 | Ga0209257_1016898 | 3300025304 | Bacteria | 2913 |
| 663 | Ga0209257_1041047 | 3300025304 | Bacteria | 1375 |
| 664 | Ga0209257_1107616 | 3300025304 | Bacteria | 670 |
| 665 | Ga0207697_10114964 | 3300025315 | Bacteria | 1154 |
| 666 | Ga0207656_10001733 | 3300025321 | Bacteria | 7257 |
| 667 | Ga0207656_10028858 | 3300025321 | Bacteria | 2281 |
| 668 | Ga0207656_10062176 | 3300025321 | Bacteria | 1640 |
| 669 | Ga0207656_10175900 | 3300025321 | Bacteria | 1025 |
| 670 | Ga0207656_10696310 | 3300025321 | Bacteria | 520 |
| 671 | Ga0207682_10277748 | 3300025893 | Bacteria | 783 |
| 672 | Ga0207692_10138951 | 3300025898 | Bacteria | 1380 |
| 673 | Ga0207710_10020591 | 3300025900 | Bacteria | 2821 |
| 674 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 675 | Ga0207680_10001267 | 3300025903 | Bacteria | 11957 |
| 676 | Ga0207680_10053739 | 3300025903 | Bacteria | 2419 |
| 677 | Ga0207680_10224992 | 3300025903 | Bacteria | 1288 |
| 678 | Ga0207680_10394596 | 3300025903 | Bacteria | 977 |
| 679 | Ga0207680_10540156 | 3300025903 | Bacteria | 832 |
| 680 | Ga0207647_10000111 | 3300025904 | Bacteria | 62900 |
| 681 | Ga0207647_10000138 | 3300025904 | Bacteria | 57656 |
| 682 | Ga0207647_10000859 | 3300025904 | Bacteria | 23543 |
| 683 | Ga0207647_10018916 | 3300025904 | Bacteria | 4642 |
| 684 | Ga0207647_10091644 | 3300025904 | Bacteria | 1812 |
| 685 | Ga0207647_10308961 | 3300025904 | Bacteria | 899 |
| 686 | Ga0207647_10323271 | 3300025904 | Bacteria | 876 |
| 687 | Ga0207699_10193317 | 3300025906 | Bacteria | 1374 |
| 688 | Ga0207645_10038319 | 3300025907 | Bacteria | 3074 |
| 689 | Ga0207645_10192165 | 3300025907 | Bacteria | 1342 |
| 690 | Ga0207645_10229743 | 3300025907 | Bacteria | 1224 |
| 691 | Ga0207645_10350588 | 3300025907 | Bacteria | 988 |
| 692 | Ga0207645_10753167 | 3300025907 | Bacteria | 662 |
| 693 | Ga0207643_10178438 | 3300025908 | Bacteria | 1284 |
| 694 | Ga0207705_10000798 | 3300025909 | Bacteria | 25879 |
| 695 | Ga0207705_10009804 | 3300025909 | Bacteria | 6971 |
| 696 | Ga0207654_10004940 | 3300025911 | Bacteria | 6748 |
| 697 | Ga0207654_10027457 | 3300025911 | Bacteria | 3094 |
| 698 | Ga0207654_10044512 | 3300025911 | Bacteria | 2522 |
| 699 | Ga0207654_10073004 | 3300025911 | Bacteria | 2044 |
| 700 | Ga0207654_10074909 | 3300025911 | Bacteria | 2021 |
| 701 | Ga0207654_10348119 | 3300025911 | Bacteria | 1020 |
| 702 | Ga0207654_11388909 | 3300025911 | Bacteria | 512 |
| 703 | Ga0207707_10064913 | 3300025912 | Bacteria | 3179 |
| 704 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 705 | Ga0207695_10000811 | 3300025913 | Bacteria | 58170 |
| 706 | Ga0207695_10002522 | 3300025913 | Bacteria | 26898 |
| 707 | Ga0207695_10003038 | 3300025913 | Bacteria | 24050 |
| 708 | Ga0207695_10009508 | 3300025913 | Bacteria | 12022 |
| 709 | Ga0207695_10010778 | 3300025913 | Bacteria | 11147 |
| 710 | Ga0207695_10015564 | 3300025913 | Bacteria | 8948 |
| 711 | Ga0207695_10048491 | 3300025913 | Bacteria | 4485 |
| 712 | Ga0207695_10073143 | 3300025913 | Bacteria | 3494 |
| 713 | Ga0207695_10372772 | 3300025913 | Bacteria | 1314 |
| 714 | Ga0207695_10518226 | 3300025913 | Bacteria | 1074 |
| 715 | Ga0207695_10645359 | 3300025913 | Bacteria | 940 |
| 716 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 717 | Ga0207671_10000116 | 3300025914 | Bacteria | 122775 |
| 718 | Ga0207671_10001713 | 3300025914 | Bacteria | 24767 |
| 719 | Ga0207671_10012021 | 3300025914 | Bacteria | 6992 |
| 720 | Ga0207671_10012358 | 3300025914 | Bacteria | 6869 |
| 721 | Ga0207671_10076983 | 3300025914 | Bacteria | 2497 |
| 722 | Ga0207671_10169216 | 3300025914 | Bacteria | 1696 |
| 723 | Ga0207671_10315292 | 3300025914 | Bacteria | 1237 |
| 724 | Ga0207671_10469545 | 3300025914 | Bacteria | 1003 |
| 725 | Ga0207671_10640721 | 3300025914 | Bacteria | 846 |
| 726 | Ga0207671_11105187 | 3300025914 | Bacteria | 623 |
| 727 | Ga0207671_11324007 | 3300025914 | Bacteria | 560 |
| 728 | Ga0207693_10275388 | 3300025915 | Bacteria | 1319 |
| 729 | Ga0207663_10124228 | 3300025916 | Bacteria | 1772 |
| 730 | Ga0207660_10839858 | 3300025917 | Bacteria | 750 |
| 731 | Ga0207660_11339242 | 3300025917 | Bacteria | 581 |
| 732 | Ga0207657_10007879 | 3300025919 | Bacteria | 10870 |
| 733 | Ga0207657_10348016 | 3300025919 | Bacteria | 1169 |
| 734 | Ga0207657_11127448 | 3300025919 | Bacteria | 599 |
| 735 | Ga0207649_10007346 | 3300025920 | Bacteria | 5996 |
| 736 | Ga0207649_10012095 | 3300025920 | Bacteria | 4777 |
| 737 | Ga0207649_10450764 | 3300025920 | Bacteria | 971 |
| 738 | Ga0207649_10484754 | 3300025920 | Bacteria | 938 |
| 739 | Ga0207649_10505985 | 3300025920 | Bacteria | 919 |
| 740 | Ga0207649_10593840 | 3300025920 | Bacteria | 851 |
| 741 | Ga0207652_10735412 | 3300025921 | Bacteria | 879 |
| 742 | Ga0207652_11109887 | 3300025921 | Bacteria | 691 |
| 743 | Ga0207652_11361130 | 3300025921 | Bacteria | 613 |
| 744 | Ga0207681_10321259 | 3300025923 | Bacteria | 1231 |
| 745 | Ga0207681_11587823 | 3300025923 | Bacteria | 548 |
| 746 | Ga0207694_10000298 | 3300025924 | Bacteria | 46766 |
| 747 | Ga0207694_10000613 | 3300025924 | Bacteria | 32386 |
| 748 | Ga0207694_10002589 | 3300025924 | Bacteria | 14673 |
| 749 | Ga0207694_10017252 | 3300025924 | Bacteria | 5456 |
| 750 | Ga0207694_10052522 | 3300025924 | Bacteria | 3159 |
| 751 | Ga0207694_10076987 | 3300025924 | Bacteria | 2613 |
| 752 | Ga0207694_10097903 | 3300025924 | Bacteria | 2321 |
| 753 | Ga0207694_10188934 | 3300025924 | Bacteria | 1673 |
| 754 | Ga0207694_10199790 | 3300025924 | Bacteria | 1626 |
| 755 | Ga0207694_10285197 | 3300025924 | Bacteria | 1357 |
| 756 | Ga0207694_10588990 | 3300025924 | Bacteria | 935 |
| 757 | Ga0207694_10590678 | 3300025924 | Bacteria | 934 |
| 758 | Ga0207694_10770357 | 3300025924 | Bacteria | 812 |
| 759 | Ga0207650_10095582 | 3300025925 | Bacteria | 2278 |
| 760 | Ga0207650_10318005 | 3300025925 | Bacteria | 1274 |
| 761 | Ga0207650_10778652 | 3300025925 | Bacteria | 810 |
| 762 | Ga0207650_11085080 | 3300025925 | Bacteria | 681 |
| 763 | Ga0207650_11300762 | 3300025925 | Bacteria | 619 |
| 764 | Ga0207659_10532511 | 3300025926 | Bacteria | 997 |
| 765 | Ga0207687_10096129 | 3300025927 | Bacteria | 2170 |
| 766 | Ga0207687_10363853 | 3300025927 | Bacteria | 1181 |
| 767 | Ga0207700_10002543 | 3300025928 | Bacteria | 10470 |
| 768 | Ga0207700_11025090 | 3300025928 | Bacteria | 738 |
| 769 | Ga0207700_11074043 | 3300025928 | Bacteria | 720 |
| 770 | Ga0207664_10002383 | 3300025929 | Bacteria | 12426 |
| 771 | Ga0207664_10007284 | 3300025929 | Bacteria | 7672 |
| 772 | Ga0207664_10213080 | 3300025929 | Bacteria | 1672 |
| 773 | Ga0207664_10737564 | 3300025929 | Bacteria | 886 |
| 774 | Ga0207644_10001304 | 3300025931 | Bacteria | 16036 |
| 775 | Ga0207644_10016173 | 3300025931 | Bacteria | 5019 |
| 776 | Ga0207644_11766530 | 3300025931 | Bacteria | 518 |
| 777 | Ga0207690_10000967 | 3300025932 | Bacteria | 18375 |
| 778 | Ga0207690_10093111 | 3300025932 | Bacteria | 2134 |
| 779 | Ga0207706_10002270 | 3300025933 | Bacteria | 18770 |
| 780 | Ga0207706_10077003 | 3300025933 | Bacteria | 2934 |
| 781 | Ga0207706_10385216 | 3300025933 | Bacteria | 1216 |
| 782 | Ga0207706_10533820 | 3300025933 | Bacteria | 1011 |
| 783 | Ga0207686_10010245 | 3300025934 | Bacteria | 5100 |
| 784 | Ga0207670_10192556 | 3300025936 | Bacteria | 1544 |
| 785 | Ga0207669_11965142 | 3300025937 | Bacteria | 500 |
| 786 | Ga0207704_10103961 | 3300025938 | Bacteria | 1901 |
| 787 | Ga0207704_10211891 | 3300025938 | Bacteria | 1427 |
| 788 | Ga0207704_10215845 | 3300025938 | Bacteria | 1416 |
| 789 | Ga0207704_10480609 | 3300025938 | Bacteria | 997 |
| 790 | Ga0207704_11852747 | 3300025938 | Bacteria | 519 |
| 791 | Ga0207665_11491561 | 3300025939 | Bacteria | 537 |
| 792 | Ga0207665_11641398 | 3300025939 | Bacteria | 509 |
| 793 | Ga0207691_10024143 | 3300025940 | Bacteria | 5718 |
| 794 | Ga0207691_10038895 | 3300025940 | Bacteria | 4402 |
| 795 | Ga0207691_10116249 | 3300025940 | Bacteria | 2374 |
| 796 | Ga0207691_10417304 | 3300025940 | Bacteria | 1144 |
| 797 | Ga0207711_10000503 | 3300025941 | Bacteria | 40349 |
| 798 | Ga0207711_10125299 | 3300025941 | Bacteria | 2297 |
| 799 | Ga0207711_10185512 | 3300025941 | Bacteria | 1893 |
| 800 | Ga0207711_10473892 | 3300025941 | Bacteria | 1166 |
| 801 | Ga0207711_10671405 | 3300025941 | Bacteria | 967 |
| 802 | Ga0207711_11369556 | 3300025941 | Bacteria | 650 |
| 803 | Ga0207711_11654523 | 3300025941 | Bacteria | 583 |
| 804 | Ga0207689_10077296 | 3300025942 | Bacteria | 2736 |
| 805 | Ga0207689_10529262 | 3300025942 | Bacteria | 989 |
| 806 | Ga0207661_10834126 | 3300025944 | Bacteria | 849 |
| 807 | Ga0207661_11215245 | 3300025944 | Bacteria | 693 |
| 808 | Ga0207679_10652056 | 3300025945 | Bacteria | 952 |
| 809 | Ga0207667_10001535 | 3300025949 | Bacteria | 29037 |
| 810 | Ga0207667_10001609 | 3300025949 | Bacteria | 28404 |
| 811 | Ga0207667_10006791 | 3300025949 | Bacteria | 13820 |
| 812 | Ga0207667_10019505 | 3300025949 | Bacteria | 7567 |
| 813 | Ga0207667_10026092 | 3300025949 | Bacteria | 6389 |
| 814 | Ga0207667_10037914 | 3300025949 | Bacteria | 5150 |
| 815 | Ga0207667_10059529 | 3300025949 | Bacteria | 4000 |
| 816 | Ga0207667_10261566 | 3300025949 | Bacteria | 1769 |
| 817 | Ga0207667_10304225 | 3300025949 | Bacteria | 1629 |
| 818 | Ga0207667_10591522 | 3300025949 | Bacteria | 1119 |
| 819 | Ga0207667_10774748 | 3300025949 | Bacteria | 957 |
| 820 | Ga0207667_10931147 | 3300025949 | Bacteria | 859 |
| 821 | Ga0207667_11323449 | 3300025949 | Bacteria | 696 |
| 822 | Ga0207651_10195419 | 3300025960 | Bacteria | 1617 |
| 823 | Ga0207651_10493390 | 3300025960 | Bacteria | 1057 |
| 824 | Ga0207651_11539128 | 3300025960 | Bacteria | 599 |
| 825 | Ga0207712_10000277 | 3300025961 | Bacteria | 48990 |
| 826 | Ga0207712_10000477 | 3300025961 | Bacteria | 33669 |
| 827 | Ga0207712_10147728 | 3300025961 | Bacteria | 1812 |
| 828 | Ga0207668_10011169 | 3300025972 | Bacteria | 5450 |
| 829 | Ga0207668_10019520 | 3300025972 | Bacteria | 4288 |
| 830 | Ga0207668_10075249 | 3300025972 | Bacteria | 2427 |
| 831 | Ga0207668_10286079 | 3300025972 | Bacteria | 1354 |
| 832 | Ga0207668_10626346 | 3300025972 | Bacteria | 939 |
| 833 | Ga0207668_10746716 | 3300025972 | Bacteria | 863 |
| 834 | Ga0207640_10002403 | 3300025981 | Bacteria | 10021 |
| 835 | Ga0207640_10015095 | 3300025981 | Bacteria | 4464 |
| 836 | Ga0207640_10016040 | 3300025981 | Bacteria | 4348 |
| 837 | Ga0207640_10069799 | 3300025981 | Bacteria | 2361 |
| 838 | Ga0207640_10148784 | 3300025981 | Bacteria | 1717 |
| 839 | Ga0207640_10155151 | 3300025981 | Bacteria | 1687 |
| 840 | Ga0207640_10461418 | 3300025981 | Bacteria | 1049 |
| 841 | Ga0207640_11348161 | 3300025981 | Bacteria | 638 |
| 842 | Ga0207658_10000286 | 3300025986 | Bacteria | 52832 |
| 843 | Ga0207658_10007375 | 3300025986 | Bacteria | 7498 |
| 844 | Ga0207658_10053046 | 3300025986 | Bacteria | 2994 |
| 845 | Ga0207658_10058890 | 3300025986 | Bacteria | 2860 |
| 846 | Ga0207658_10064327 | 3300025986 | Bacteria | 2751 |
| 847 | Ga0207658_10101859 | 3300025986 | Bacteria | 2251 |
| 848 | Ga0207658_10485862 | 3300025986 | Bacteria | 1098 |
| 849 | Ga0207658_11119123 | 3300025986 | Bacteria | 719 |
| 850 | Ga0207658_11657165 | 3300025986 | Bacteria | 584 |
| 851 | Ga0207658_12078998 | 3300025986 | Bacteria | 516 |
| 852 | Ga0207677_10159632 | 3300026023 | Bacteria | 1750 |
| 853 | Ga0207677_10179200 | 3300026023 | Bacteria | 1665 |
| 854 | Ga0207677_10237178 | 3300026023 | Bacteria | 1473 |
| 855 | Ga0207677_10241627 | 3300026023 | Bacteria | 1461 |
| 856 | Ga0207703_10002250 | 3300026035 | Bacteria | 16865 |
| 857 | Ga0207703_10046054 | 3300026035 | Bacteria | 3511 |
| 858 | Ga0207703_10204383 | 3300026035 | Bacteria | 1757 |
| 859 | Ga0207703_10478331 | 3300026035 | Bacteria | 1167 |
| 860 | Ga0207703_10752524 | 3300026035 | Bacteria | 928 |
| 861 | Ga0207639_10000985 | 3300026041 | Bacteria | 19385 |
| 862 | Ga0207639_10006532 | 3300026041 | Bacteria | 7931 |
| 863 | Ga0207639_10008937 | 3300026041 | Bacteria | 6895 |
| 864 | Ga0207639_10017968 | 3300026041 | Bacteria | 5017 |
| 865 | Ga0207639_10049869 | 3300026041 | Bacteria | 3176 |
| 866 | Ga0207639_10056089 | 3300026041 | Bacteria | 3018 |
| 867 | Ga0207639_10056123 | 3300026041 | Bacteria | 3017 |
| 868 | Ga0207639_10269372 | 3300026041 | Bacteria | 1493 |
| 869 | Ga0207639_10274797 | 3300026041 | Bacteria | 1479 |
| 870 | Ga0207639_10441838 | 3300026041 | Bacteria | 1179 |
| 871 | Ga0207639_10584979 | 3300026041 | Bacteria | 1028 |
| 872 | Ga0207639_11384434 | 3300026041 | Bacteria | 660 |
| 873 | Ga0207678_10001305 | 3300026067 | Bacteria | 23111 |
| 874 | Ga0207678_10004417 | 3300026067 | Bacteria | 12652 |
| 875 | Ga0207678_10010903 | 3300026067 | Bacteria | 7985 |
| 876 | Ga0207678_10030009 | 3300026067 | Bacteria | 4746 |
| 877 | Ga0207678_10101872 | 3300026067 | Bacteria | 2451 |
| 878 | Ga0207678_10159552 | 3300026067 | Bacteria | 1926 |
| 879 | Ga0207678_10174807 | 3300026067 | Bacteria | 1834 |
| 880 | Ga0207678_10200544 | 3300026067 | Bacteria | 1706 |
| 881 | Ga0207678_10987390 | 3300026067 | Bacteria | 745 |
| 882 | Ga0207678_11912761 | 3300026067 | Bacteria | 517 |
| 883 | Ga0207702_10000236 | 3300026078 | Bacteria | 63978 |
| 884 | Ga0207702_10010360 | 3300026078 | Bacteria | 7808 |
| 885 | Ga0207702_10015281 | 3300026078 | Bacteria | 6364 |
| 886 | Ga0207702_10072033 | 3300026078 | Bacteria | 2977 |
| 887 | Ga0207702_10096660 | 3300026078 | Bacteria | 2598 |
| 888 | Ga0207702_10331866 | 3300026078 | Bacteria | 1451 |
| 889 | Ga0207702_10457507 | 3300026078 | Bacteria | 1239 |
| 890 | Ga0207702_10553413 | 3300026078 | Bacteria | 1126 |
| 891 | Ga0207702_10563356 | 3300026078 | Bacteria | 1115 |
| 892 | Ga0207702_10815717 | 3300026078 | Bacteria | 923 |
| 893 | Ga0207702_11499820 | 3300026078 | Bacteria | 668 |
| 894 | Ga0207641_10010609 | 3300026088 | Bacteria | 7559 |
| 895 | Ga0207641_10020369 | 3300026088 | Bacteria | 5447 |
| 896 | Ga0207641_10131445 | 3300026088 | Bacteria | 2248 |
| 897 | Ga0207641_10229076 | 3300026088 | Bacteria | 1726 |
| 898 | Ga0207641_10291827 | 3300026088 | Bacteria | 1537 |
| 899 | Ga0207641_10900498 | 3300026088 | Bacteria | 878 |
| 900 | Ga0207641_11225622 | 3300026088 | Bacteria | 750 |
| 901 | Ga0207648_10012324 | 3300026089 | Bacteria | 8004 |
| 902 | Ga0207648_10117053 | 3300026089 | Bacteria | 2342 |
| 903 | Ga0207648_10184374 | 3300026089 | Bacteria | 1848 |
| 904 | Ga0207648_10253652 | 3300026089 | Bacteria | 1568 |
| 905 | Ga0207648_11073968 | 3300026089 | Bacteria | 755 |
| 906 | Ga0207648_11828247 | 3300026089 | Bacteria | 569 |
| 907 | Ga0207676_10014128 | 3300026095 | Bacteria | 5736 |
| 908 | Ga0207676_10815964 | 3300026095 | Bacteria | 911 |
| 909 | Ga0207674_10011044 | 3300026116 | Bacteria | 10156 |
| 910 | Ga0207674_10086156 | 3300026116 | Bacteria | 3136 |
| 911 | Ga0207674_10218763 | 3300026116 | Bacteria | 1853 |
| 912 | Ga0207674_10416222 | 3300026116 | Bacteria | 1298 |
| 913 | Ga0207674_10613119 | 3300026116 | Bacteria | 1051 |
| 914 | Ga0207674_10874354 | 3300026116 | Bacteria | 866 |
| 915 | Ga0207674_10927205 | 3300026116 | Bacteria | 839 |
| 916 | Ga0207675_100196738 | 3300026118 | Bacteria | 1935 |
| 917 | Ga0207675_100212013 | 3300026118 | Bacteria | 1863 |
| 918 | Ga0207675_100319070 | 3300026118 | Bacteria | 1516 |
| 919 | Ga0207675_100627521 | 3300026118 | Bacteria | 1079 |
| 920 | Ga0207675_100684184 | 3300026118 | Bacteria | 1034 |
| 921 | Ga0207675_100831982 | 3300026118 | Bacteria | 937 |
| 922 | Ga0207683_10048759 | 3300026121 | Bacteria | 3707 |
| 923 | Ga0207683_10068547 | 3300026121 | Bacteria | 3132 |
| 924 | Ga0207683_11623353 | 3300026121 | Bacteria | 596 |
| 925 | Ga0207698_10002901 | 3300026142 | Bacteria | 10253 |
| 926 | Ga0207698_10020428 | 3300026142 | Bacteria | 4558 |
| 927 | Ga0207698_10035977 | 3300026142 | Bacteria | 3629 |
| 928 | Ga0207698_10096916 | 3300026142 | Bacteria | 2432 |
| 929 | Ga0207698_10293017 | 3300026142 | Bacteria | 1511 |
| 930 | Ga0207698_10438167 | 3300026142 | Bacteria | 1258 |
| 931 | Ga0207698_10608010 | 3300026142 | Bacteria | 1078 |
| 932 | Ga0207698_10984711 | 3300026142 | Bacteria | 853 |
| 933 | Ga0207698_11159987 | 3300026142 | Bacteria | 786 |
| 934 | Ga0207698_12602308 | 3300026142 | Bacteria | 515 |
| 935 | Ga0209282_1166348 | 3300027666 | Bacteria | 1049 |
| 936 | Ga0265354_1001101 | 3300028016 | Bacteria | 4147 |
| 937 | Ga0265357_1005008 | 3300028023 | Bacteria | 1213 |
| 938 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 939 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 940 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 941 | Ga0268266_10038420 | 3300028379 | Bacteria | 4075 |
| 942 | Ga0268266_10126426 | 3300028379 | Bacteria | 2282 |
| 943 | Ga0268266_10624948 | 3300028379 | Bacteria | 1036 |
| 944 | Ga0268266_11777700 | 3300028379 | Bacteria | 591 |
| 945 | Ga0268266_11825168 | 3300028379 | Bacteria | 582 |
| 946 | Ga0268265_10000705 | 3300028380 | Bacteria | 32878 |
| 947 | Ga0268265_10671110 | 3300028380 | Bacteria | 998 |
| 948 | Ga0268264_10011847 | 3300028381 | Bacteria | 7185 |
| 949 | Ga0268264_10014826 | 3300028381 | Bacteria | 6402 |
| 950 | Ga0268264_10052860 | 3300028381 | Bacteria | 3388 |
| 951 | Ga0268264_10450780 | 3300028381 | Bacteria | 1246 |
| 952 | Ga0268264_10769172 | 3300028381 | Bacteria | 960 |
| 953 | Ga0307517_10339098 | 3300028786 | Bacteria | 822 |
| 954 | Ga0307517_10354081 | 3300028786 | Bacteria | 796 |
| 955 | Ga0307515_10160864 | 3300028794 | Bacteria | 2291 |
| 956 | Ga0307515_10203513 | 3300028794 | Bacteria | 1848 |
| 957 | Ga0265338_10340845 | 3300028800 | Bacteria | 1080 |
| 958 | Ga0265770_1000647 | 3300030878 | Bacteria | 4832 |
| 959 | Ga0265760_10016048 | 3300031090 | Bacteria | 2148 |
| 960 | Ga0265760_10227465 | 3300031090 | Bacteria | 638 |
| 961 | Ga0265332_10000014 | 3300031238 | Bacteria | 249035 |
| 962 | Ga0265328_10006973 | 3300031239 | Bacteria | 4741 |
| 963 | Ga0265339_10126686 | 3300031249 | Bacteria | 1309 |
| 964 | Ga0265331_10008554 | 3300031250 | Bacteria | 5814 |
| 965 | Ga0265327_10000133 | 3300031251 | Bacteria | 163887 |
| 966 | Ga0265327_10057675 | 3300031251 | Bacteria | 1997 |
| 967 | Ga0265327_10176840 | 3300031251 | Bacteria | 978 |
| 968 | Ga0307513_10013810 | 3300031456 | Bacteria | 9901 |
| 969 | Ga0307513_10315870 | 3300031456 | Bacteria | 1322 |
| 970 | Ga0307513_10615359 | 3300031456 | Bacteria | 795 |
| 971 | Ga0307509_10799411 | 3300031507 | Bacteria | 608 |
| 972 | Ga0307408_100186114 | 3300031548 | Bacteria | 1669 |
| 973 | Ga0307408_100401588 | 3300031548 | Bacteria | 1177 |
| 974 | Ga0307408_101265687 | 3300031548 | Bacteria | 690 |
| 975 | Ga0307508_10058708 | 3300031616 | Bacteria | 3404 |
| 976 | Ga0307508_10157395 | 3300031616 | Bacteria | 1876 |
| 977 | Ga0307508_10395627 | 3300031616 | Bacteria | 973 |
| 978 | Ga0316575_10018091 | 3300031665 | Bacteria | 2683 |
| 979 | Ga0316575_10041535 | 3300031665 | Bacteria | 1819 |
| 980 | Ga0316575_10264420 | 3300031665 | Bacteria | 723 |
| 981 | Ga0316579_10048118 | 3300031691 | Bacteria | 1992 |
| 982 | Ga0316576_10013894 | 3300031727 | Bacteria | 5366 |
| 983 | Ga0316576_10177082 | 3300031727 | Bacteria | 1609 |
| 984 | Ga0316578_10024244 | 3300031728 | Bacteria | 3402 |
| 985 | Ga0316578_10640072 | 3300031728 | Bacteria | 621 |
| 986 | Ga0307516_10019050 | 3300031730 | Bacteria | 7119 |
| 987 | Ga0307516_10089609 | 3300031730 | Bacteria | 2906 |
| 988 | Ga0307516_10152544 | 3300031730 | Bacteria | 2069 |
| 989 | Ga0307516_10512331 | 3300031730 | Bacteria | 854 |
| 990 | Ga0316577_10027318 | 3300031733 | Bacteria | 3182 |
| 991 | Ga0307413_10146940 | 3300031824 | Bacteria | 1637 |
| 992 | Ga0307413_10547360 | 3300031824 | Bacteria | 938 |
| 993 | Ga0307413_11084950 | 3300031824 | Bacteria | 691 |
| 994 | Ga0307413_11312917 | 3300031824 | Bacteria | 633 |
| 995 | Ga0307410_10081792 | 3300031852 | Bacteria | 2270 |
| 996 | Ga0307410_10727488 | 3300031852 | Bacteria | 838 |
| 997 | Ga0307410_11439453 | 3300031852 | Bacteria | 606 |
| 998 | Ga0307410_11848036 | 3300031852 | Bacteria | 537 |
| 999 | Ga0307406_10007341 | 3300031901 | Bacteria | 6110 |
| 1000 | Ga0307406_10228302 | 3300031901 | Bacteria | 1388 |
| 1001 | Ga0307406_10697107 | 3300031901 | Bacteria | 847 |
| 1002 | Ga0307407_10122594 | 3300031903 | Bacteria | 1650 |
| 1003 | Ga0307407_10795982 | 3300031903 | Bacteria | 719 |
| 1004 | Ga0307412_10017785 | 3300031911 | Bacteria | 4260 |
| 1005 | Ga0307412_10073645 | 3300031911 | Bacteria | 2337 |
| 1006 | Ga0307412_10108346 | 3300031911 | Bacteria | 1979 |
| 1007 | Ga0307412_11264630 | 3300031911 | Bacteria | 663 |
| 1008 | Ga0307409_100357217 | 3300031995 | Bacteria | 1381 |
| 1009 | Ga0307409_101913936 | 3300031995 | Bacteria | 622 |
| 1010 | Ga0307416_100594499 | 3300032002 | Bacteria | 1185 |
| 1011 | Ga0307416_103550834 | 3300032002 | Unclassified | 522 |
| 1012 | Ga0307414_10001343 | 3300032004 | Bacteria | 12716 |
| 1013 | Ga0307414_10001931 | 3300032004 | Bacteria | 10728 |
| 1014 | Ga0307414_10218311 | 3300032004 | Bacteria | 1563 |
| 1015 | Ga0307414_10292332 | 3300032004 | Bacteria | 1374 |
| 1016 | Ga0307414_10647718 | 3300032004 | Bacteria | 952 |
| 1017 | Ga0307414_11016815 | 3300032004 | Bacteria | 763 |
| 1018 | Ga0307411_10161813 | 3300032005 | Bacteria | 1677 |
| 1019 | Ga0307411_10190249 | 3300032005 | Bacteria | 1566 |
| 1020 | Ga0307411_10288321 | 3300032005 | Bacteria | 1310 |
| 1021 | Ga0307415_100410422 | 3300032126 | Bacteria | 1159 |
| 1022 | Ga0316583_10003935 | 3300032133 | Bacteria | 5277 |
| 1023 | Ga0316580_10008155 | 3300032139 | Bacteria | 3135 |
| 1024 | Ga0307510_10005227 | 3300033180 | Bacteria | 15430 |
| 1025 | Ga0373959_0122785 | 3300034820 | Bacteria | 636 |
| 1026 | Ga0373934_0134767 | 3300035086 | Bacteria | 1008 |
| 1027 | Ga0373946_0202653 | 3300035171 | Bacteria | 951 |
| 1028 | Ga0316574_0125565 | 3300035398 | Bacteria | 1649 |
| 1029 | Ga0316574_0177539 | 3300035398 | Bacteria | 1370 |
| 1030 | Ga0316574_0335179 | 3300035398 | Bacteria | 959 |
| 1031 | Ga0316574_0439550 | 3300035398 | Bacteria | 818 |
| 1032 | Ga0316574_0595268 | 3300035398 | Bacteria | 684 |
| 1033 | Ga0373927_0601176 | 3300035695 | Bacteria | 727 |
| 1034 | Ga0373927_0758943 | 3300035695 | Bacteria | 641 |
| 1035 | Ga0373933_0359882 | 3300035724 | Bacteria | 946 |
| 1036 | Ga0373947_0452000 | 3300035725 | Bacteria | 870 |
| 1037 | Ga0373937_0006210 | 3300036401 | Bacteria | 10295 |
| 1038 | Ga0373937_0101909 | 3300036401 | Bacteria | 2665 |
| 1039 | Ga0373937_0864054 | 3300036401 | Bacteria | 853 |
| 1040 | Ga0316582_0002013 | 3300036647 | Bacteria | 9334 |
| 1041 | Ga0316582_0007984 | 3300036647 | Bacteria | 5663 |
| 1042 | Ga0316582_0042210 | 3300036647 | Bacteria | 2856 |
| 1043 | Ga0316582_0393451 | 3300036647 | Bacteria | 955 |
| 1044 | Ga0316584_0002192 | 3300036712 | Bacteria | 12239 |
| 1045 | Ga0373925_1217269 | 3300037068 | Bacteria | 619 |
| 1046 | Ga0395899_0000133 | 3300037312 | Bacteria | 114879 |
| 1047 | Ga0395899_0016504 | 3300037312 | Bacteria | 5632 |
| 1048 | Ga0395899_0042325 | 3300037312 | Bacteria | 3401 |
| 1049 | Ga0395899_0057173 | 3300037312 | Bacteria | 2880 |
| 1050 | Ga0395899_0073593 | 3300037312 | Bacteria | 2497 |
| 1051 | Ga0395899_0288128 | 3300037312 | Bacteria | 1115 |
| 1052 | Ga0395900_0000051 | 3300037418 | Bacteria | 224228 |
| 1053 | Ga0395900_0000061 | 3300037418 | Bacteria | 202483 |
| 1054 | Ga0395900_0114528 | 3300037418 | Bacteria | 2767 |
| 1055 | Ga0395900_0219392 | 3300037418 | Bacteria | 1917 |
| 1056 | Ga0395900_0338283 | 3300037418 | Bacteria | 1481 |
| 1057 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 1058 | Ga0395898_0000197 | 3300037466 | Bacteria | 155187 |
| 1059 | Ga0395898_0007788 | 3300037466 | Bacteria | 11368 |
| 1060 | Ga0395898_0011319 | 3300037466 | Bacteria | 9274 |
| 1061 | Ga0395898_0014517 | 3300037466 | Bacteria | 8088 |
| 1062 | Ga0395898_0179719 | 3300037466 | Bacteria | 2022 |
| 1063 | Ga0395898_0669998 | 3300037466 | Bacteria | 980 |
| 1064 | Ga0395898_0777540 | 3300037466 | Bacteria | 898 |
| 1065 | Ga0395905_0000306 | 3300037471 | Bacteria | 71299 |
| 1066 | Ga0395905_0140120 | 3300037471 | Bacteria | 2275 |
| 1067 | Ga0395905_0340379 | 3300037471 | Bacteria | 1391 |
| 1068 | Ga0395905_0537682 | 3300037471 | Bacteria | 1069 |
| 1069 | Ga0395905_1138998 | 3300037471 | Bacteria | 683 |
| 1070 | Ga0316581_0006306 | 3300037588 | Bacteria | 3131 |
| 1071 | Ga0395901_0003676 | 3300038443 | Bacteria | 15470 |
| 1072 | Ga0395901_0009076 | 3300038443 | Bacteria | 10066 |
| 1073 | Ga0395901_0727221 | 3300038443 | Bacteria | 988 |
| 1074 | Ga0395901_1854495 | 3300038443 | Bacteria | 551 |
| 1075 | Ga0395901_1938550 | 3300038443 | Bacteria | 536 |
| 1076 | Ga0436361_0190082 | 3300039447 | Bacteria | 1654 |
| 1077 | Ga0436361_0521891 | 3300039447 | Bacteria | 6247 |
| 1078 | Ga0436363_0368017 | 3300039450 | Bacteria | 536 |
| 1079 | Ga0439436_0000008 | 3300041404 | Bacteria | 112977 |
| 1080 | Ga0439436_0015857 | 3300041404 | Bacteria | 2264 |
| 1081 | Ga0439436_0022021 | 3300041404 | Bacteria | 1889 |
| 1082 | Ga0439436_0024041 | 3300041404 | Bacteria | 1800 |
| 1083 | Ga0439436_0063701 | 3300041404 | Bacteria | 1030 |
| 1084 | Ga0439436_0077543 | 3300041404 | Bacteria | 925 |
| 1085 | Ga0439447_007836 | 3300041407 | Bacteria | 3351 |
| 1086 | Ga0439466_0229527 | 3300041411 | Bacteria | 563 |
| 1087 | Ga0439465_0008559 | 3300041413 | Bacteria | 3228 |
| 1088 | Ga0439465_0012695 | 3300041413 | Bacteria | 2634 |
| 1089 | Ga0439465_0029794 | 3300041413 | Bacteria | 1734 |
| 1090 | Ga0439465_0255027 | 3300041413 | Bacteria | 649 |
| 1091 | Ga0451787_760046 | 3300041441 | Bacteria | 1243 |
| 1092 | Ga0451789_0480807 | 3300041443 | Bacteria | 858 |
| 1093 | Ga0451789_0594797 | 3300041443 | Bacteria | 824 |
| 1094 | Ga0451789_1201078 | 3300041443 | Bacteria | 567 |
| 1095 | Ga0451789_1206445 | 3300041443 | Bacteria | 1241 |
| 1096 | Ga0451791_1110733 | 3300041451 | Bacteria | 1550 |
| 1097 | Ga0451793_0136894 | 3300041452 | Bacteria | 843 |
| 1098 | Ga0451793_1283171 | 3300041452 | Bacteria | 931 |
| 1099 | Ga0451793_1723166 | 3300041452 | Bacteria | 1593 |
| 1100 | Ga0451797_0719793 | 3300041453 | Bacteria | 545 |
| 1101 | Ga0451797_0839044 | 3300041453 | Bacteria | 609 |
| 1102 | Ga0451795_1164357 | 3300041456 | Bacteria | 886 |
| 1103 | Ga0451795_1565558 | 3300041456 | Bacteria | 678 |
| 1104 | Ga0451798_0160268 | 3300041458 | Bacteria | 699 |
| 1105 | Ga0451800_0410448 | 3300041459 | Bacteria | 847 |
| 1106 | Ga0451800_0506376 | 3300041459 | Bacteria | 827 |
| 1107 | Ga0451800_1459324 | 3300041459 | Bacteria | 827 |
| 1108 | Ga0451802_0744649 | 3300041460 | Bacteria | 1293 |
| 1109 | Ga0451802_1852954 | 3300041460 | Bacteria | 759 |
| 1110 | Ga0451804_0003308 | 3300041463 | Bacteria | 613 |
| 1111 | Ga0451804_0340235 | 3300041463 | Bacteria | 997 |
| 1112 | Ga0451807_1507964 | 3300041486 | Bacteria | 1203 |
| 1113 | Ga0451807_1589376 | 3300041486 | Bacteria | 572 |
| 1114 | Ga0451807_1924293 | 3300041486 | Bacteria | 1644 |
| 1115 | Ga0451807_2135600 | 3300041486 | Bacteria | 1308 |
| 1116 | Ga0451807_2735494 | 3300041486 | Bacteria | 1433 |
| 1117 | Ga0451833_0532987 | 3300041491 | Bacteria | 618 |
| 1118 | Ga0451833_0951430 | 3300041491 | Bacteria | 898 |
| 1119 | Ga0451835_0367031 | 3300041492 | Bacteria | 593 |
| 1120 | Ga0451837_0103295 | 3300041494 | Bacteria | 975 |
| 1121 | Ga0451837_0244838 | 3300041494 | Bacteria | 1684 |
| 1122 | Ga0451837_1610330 | 3300041494 | Bacteria | 1102 |
| 1123 | Ga0451841_1138043 | 3300041498 | Bacteria | 830 |
| 1124 | Ga0451849_0244638 | 3300041505 | Bacteria | 666 |
| 1125 | Ga0451849_0355062 | 3300041505 | Bacteria | 917 |
| 1126 | Ga0451849_1085578 | 3300041505 | Bacteria | 617 |
| 1127 | Ga0451851_0574422 | 3300041507 | Bacteria | 655 |
| 1128 | Ga0451843_0007405 | 3300041509 | Bacteria | 854 |
| 1129 | Ga0451843_0905268 | 3300041509 | Bacteria | 1864 |
| 1130 | Ga0451843_1073184 | 3300041509 | Bacteria | 818 |
| 1131 | Ga0451843_1682121 | 3300041509 | Bacteria | 1737 |
| 1132 | Ga0451853_1071901 | 3300041512 | Bacteria | 763 |
| 1133 | Ga0451853_2123261 | 3300041512 | Bacteria | 612 |
| 1134 | Ga0451853_2493278 | 3300041512 | Bacteria | 977 |
| 1135 | Ga0451853_2583559 | 3300041512 | Bacteria | 528 |
| 1136 | Ga0451853_2935955 | 3300041512 | Bacteria | 2135 |
| 1137 | Ga0451853_3209840 | 3300041512 | Bacteria | 556 |
| 1138 | Ga0439431_0011423 | 3300041997 | Bacteria | 2029 |
| 1139 | Ga0439433_0014340 | 3300041999 | Bacteria | 1745 |
| 1140 | Ga0439445_0027544 | 3300042004 | Bacteria | 1460 |
| 1141 | Ga0439445_0029548 | 3300042004 | Bacteria | 1417 |
| 1142 | Ga0439445_0101561 | 3300042004 | Bacteria | 816 |
| 1143 | Ga0439449_0004432 | 3300042007 | Bacteria | 5415 |
| 1144 | Ga0439449_0005563 | 3300042007 | Bacteria | 4823 |
| 1145 | Ga0439449_0011023 | 3300042007 | Bacteria | 3409 |
| 1146 | Ga0439449_0011092 | 3300042007 | Bacteria | 3396 |
| 1147 | Ga0439449_0017334 | 3300042007 | Bacteria | 2704 |
| 1148 | Ga0439449_0041485 | 3300042007 | Bacteria | 1711 |
| 1149 | Ga0439449_0078816 | 3300042007 | Bacteria | 1215 |
| 1150 | Ga0439449_0304020 | 3300042007 | Bacteria | 602 |
| 1151 | Ga0439452_078748 | 3300042010 | Bacteria | 720 |
| 1152 | Ga0439457_045877 | 3300042014 | Bacteria | 977 |
| 1153 | Ga0439462_0058894 | 3300042015 | Bacteria | 1038 |
| 1154 | Ga0439462_0089731 | 3300042015 | Bacteria | 843 |
| 1155 | Ga0439462_0095941 | 3300042015 | Bacteria | 815 |
| 1156 | Ga0439446_0177495 | 3300042156 | Bacteria | 711 |
| 1157 | Ga0439458_0131439 | 3300042157 | Bacteria | 663 |
| 1158 | Ga0450908_002779 | 3300042184 | Bacteria | 3407 |
| 1159 | Ga0439434_0147624 | 3300042435 | Bacteria | 777 |
| 1160 | Ga0439459_0006149 | 3300042438 | Bacteria | 1993 |
| 1161 | Ga0439459_0085371 | 3300042438 | Bacteria | 751 |
| 1162 | Ga0451577_0149158 | 3300042876 | Bacteria | 2103 |
| 1163 | Ga0451577_0501910 | 3300042876 | Bacteria | 1101 |
| 1164 | Ga0466969_0001457 | 3300044656 | Bacteria | 12729 |
| 1165 | Ga0466969_0039210 | 3300044656 | Bacteria | 2380 |
| 1166 | Ga0466969_0055973 | 3300044656 | Bacteria | 1927 |
| 1167 | Ga0466972_0000555 | 3300044658 | Bacteria | 18278 |
| 1168 | Ga0466972_0043049 | 3300044658 | Bacteria | 2193 |
| 1169 | Ga0466982_0000026 | 3300044672 | Bacteria | 64525 |
| 1170 | Ga0466982_0004003 | 3300044672 | Bacteria | 6560 |
| 1171 | Ga0466965_0001099 | 3300044683 | Bacteria | 10536 |
| 1172 | Ga0466965_0046974 | 3300044683 | Bacteria | 2137 |
| 1173 | Ga0466966_0005830 | 3300044684 | Bacteria | 8119 |
| 1174 | Ga0466966_0012407 | 3300044684 | Bacteria | 5645 |
| 1175 | Ga0466966_0695670 | 3300044684 | Bacteria | 612 |
| 1176 | Ga0466961_0010278 | 3300044693 | Bacteria | 5964 |
| 1177 | Ga0466961_0035544 | 3300044693 | Bacteria | 3199 |
| 1178 | Ga0466961_0118349 | 3300044693 | Bacteria | 1664 |
| 1179 | Ga0466961_0127822 | 3300044693 | Bacteria | 1593 |
| 1180 | Ga0466964_0011285 | 3300044706 | Bacteria | 3375 |
| 1181 | Ga0466964_0130651 | 3300044706 | Bacteria | 1143 |
| 1182 | Ga0453684_0001089 | 3300044712 | Bacteria | 85906 |
| 1183 | Ga0453684_0144356 | 3300044712 | Bacteria | 2837 |
| 1184 | Ga0466971_0001957 | 3300044719 | Bacteria | 8716 |
| 1185 | Ga0466971_0068841 | 3300044719 | Bacteria | 1605 |
| 1186 | Ga0466971_0103735 | 3300044719 | Bacteria | 1308 |
| 1187 | Ga0466971_0257274 | 3300044719 | Bacteria | 833 |
| 1188 | Ga0466968_0003504 | 3300044735 | Bacteria | 5803 |
| 1189 | Ga0466968_0004304 | 3300044735 | Bacteria | 5316 |
| 1190 | Ga0466970_0000637 | 3300044765 | Bacteria | 17240 |
| 1191 | Ga0466970_0006813 | 3300044765 | Bacteria | 5719 |
| 1192 | Ga0466970_0043358 | 3300044765 | Bacteria | 2393 |
| 1193 | Ga0466970_0098456 | 3300044765 | Bacteria | 1591 |
| 1194 | Ga0466970_0516756 | 3300044765 | Bacteria | 688 |
| 1195 | Ga0466957_0005542 | 3300044842 | Bacteria | 7089 |
| 1196 | Ga0466957_0030562 | 3300044842 | Bacteria | 3216 |
| 1197 | Ga0466957_0351074 | 3300044842 | Bacteria | 1001 |
| 1198 | Ga0466957_0611920 | 3300044842 | Bacteria | 763 |
| 1199 | Ga0466957_0784745 | 3300044842 | Bacteria | 676 |
| 1200 | Ga0466960_0009574 | 3300044901 | Bacteria | 3998 |
| 1201 | Ga0466960_0243814 | 3300044901 | Bacteria | 996 |
| 1202 | Ga0466959_0019992 | 3300045049 | Bacteria | 4927 |
| 1203 | Ga0466959_0022705 | 3300045049 | Bacteria | 4639 |
| 1204 | Ga0466959_0156385 | 3300045049 | Bacteria | 1604 |
| 1205 | Ga0451576_0000201 | 3300045051 | Bacteria | 150175 |
| 1206 | Ga0451576_0505280 | 3300045051 | Bacteria | 1270 |
| 1207 | Ga0466958_0014964 | 3300045836 | Bacteria | 4437 |
| 1208 | Ga0466958_0119060 | 3300045836 | Bacteria | 1652 |
| 1209 | Ga0466967_0182733 | 3300045976 | Bacteria | 1979 |
| 1210 | Ga0466967_0437907 | 3300045976 | Bacteria | 1276 |
| 1211 | Ga0466967_0796184 | 3300045976 | Bacteria | 938 |
| 1212 | Ga0495617_000424 | 3300046452 | Bacteria | 22988 |
| 1213 | Ga0495629_0048970 | 3300046459 | Bacteria | 2963 |
| 1214 | Ga0495638_0000146 | 3300046460 | Bacteria | 111558 |
| 1215 | Ga0495638_0001668 | 3300046460 | Bacteria | 19645 |
| 1216 | Ga0495638_0001669 | 3300046460 | Bacteria | 19642 |
| 1217 | Ga0495638_0073075 | 3300046460 | Bacteria | 2094 |
| 1218 | Ga0495638_0172342 | 3300046460 | Bacteria | 1240 |
| 1219 | Ga0495641_0031745 | 3300046461 | Bacteria | 2521 |
| 1220 | Ga0495651_0414840 | 3300046462 | Bacteria | 876 |
| 1221 | Ga0495650_0002509 | 3300046471 | Bacteria | 14702 |
| 1222 | Ga0495650_0006285 | 3300046471 | Bacteria | 7435 |
| 1223 | Ga0495580_0145919 | 3300046472 | Bacteria | 1640 |
| 1224 | Ga0495582_0029608 | 3300046473 | Bacteria | 3005 |
| 1225 | Ga0495664_0204018 | 3300046477 | Bacteria | 1198 |
| 1226 | Ga0495584_0258950 | 3300046491 | Bacteria | 884 |
| 1227 | Ga0495585_0004990 | 3300046492 | Bacteria | 8485 |
| 1228 | Ga0495607_0001360 | 3300046501 | Bacteria | 21785 |
| 1229 | Ga0495607_0015098 | 3300046501 | Bacteria | 5015 |
| 1230 | Ga0495583_0016180 | 3300046506 | Bacteria | 4020 |
| 1231 | Ga0495606_0001823 | 3300046507 | Bacteria | 27025 |
| 1232 | Ga0495606_0009315 | 3300046507 | Bacteria | 8323 |
| 1233 | Ga0495606_0112071 | 3300046507 | Bacteria | 1644 |
| 1234 | Ga0495610_0007268 | 3300046512 | Bacteria | 7420 |
| 1235 | Ga0495610_0218642 | 3300046512 | Bacteria | 770 |
| 1236 | Ga0495616_0000400 | 3300046513 | Bacteria | 33359 |
| 1237 | Ga0495620_0111880 | 3300046515 | Bacteria | 1081 |
| 1238 | Ga0495630_0084401 | 3300046517 | Bacteria | 2398 |
| 1239 | Ga0495630_0301731 | 3300046517 | Bacteria | 1224 |
| 1240 | Ga0495631_0003067 | 3300046518 | Bacteria | 9224 |
| 1241 | Ga0495631_0004987 | 3300046518 | Bacteria | 6997 |
| 1242 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 1243 | Ga0495632_0006481 | 3300046519 | Bacteria | 7517 |
| 1244 | Ga0495637_0081900 | 3300046520 | Bacteria | 1285 |
| 1245 | Ga0495643_0111285 | 3300046522 | Bacteria | 1392 |
| 1246 | Ga0495643_0147056 | 3300046522 | Bacteria | 1170 |
| 1247 | Ga0495648_0069715 | 3300046524 | Bacteria | 2045 |
| 1248 | Ga0495663_0000892 | 3300046525 | Bacteria | 10053 |
| 1249 | Ga0495665_0036191 | 3300046531 | Bacteria | 2635 |
| 1250 | Ga0495609_0013644 | 3300046538 | Bacteria | 3834 |
| 1251 | Ga0495645_0654105 | 3300046543 | Bacteria | 642 |
| 1252 | Ga0495622_0011411 | 3300046557 | Bacteria | 4105 |
| 1253 | Ga0495622_0418385 | 3300046557 | Bacteria | 576 |
| 1254 | Ga0495633_0283714 | 3300046558 | Bacteria | 753 |
| 1255 | Ga0495656_0006219 | 3300046615 | Bacteria | 4177 |
| 1256 | Ga0495668_0004286 | 3300046616 | Bacteria | 10228 |
| 1257 | Ga0495668_0133484 | 3300046616 | Bacteria | 1359 |
| 1258 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 1259 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 1260 | Ga0495625_0108723 | 3300046660 | Bacteria | 1897 |
| 1261 | Ga0495625_0655523 | 3300046660 | Bacteria | 624 |
| 1262 | Ga0495635_0550182 | 3300046663 | Bacteria | 757 |
| 1263 | Ga0495635_1015615 | 3300046663 | Bacteria | 527 |
| 1264 | Ga0495661_0004892 | 3300046665 | Bacteria | 9592 |
| 1265 | Ga0495657_0090211 | 3300046675 | Bacteria | 1968 |
| 1266 | Ga0495657_0819728 | 3300046675 | Bacteria | 531 |
| 1267 | Ga0495599_0178684 | 3300046678 | Bacteria | 1309 |
| 1268 | Ga0495646_0405921 | 3300046680 | Bacteria | 708 |
| 1269 | Ga0495647_0004669 | 3300046681 | Bacteria | 4464 |
| 1270 | Ga0495658_0004687 | 3300046683 | Bacteria | 6725 |
| 1271 | Ga0495658_0277291 | 3300046683 | Bacteria | 1058 |
| 1272 | Ga0495670_0009378 | 3300046691 | Bacteria | 4811 |
| 1273 | Ga0495670_0079774 | 3300046691 | Bacteria | 1666 |
| 1274 | Ga0495670_0285950 | 3300046691 | Bacteria | 882 |
| 1275 | Ga0495671_0004084 | 3300046692 | Bacteria | 8806 |
| 1276 | Ga0495671_0128936 | 3300046692 | Bacteria | 1233 |
| 1277 | Ga0495649_0000218 | 3300046694 | Bacteria | 50633 |
| 1278 | Ga0495649_0078862 | 3300046694 | Bacteria | 1762 |
| 1279 | Ga0495589_0000236 | 3300046794 | Bacteria | 46053 |
| 1280 | Ga0495600_0159578 | 3300046809 | Bacteria | 1458 |
| 1281 | Ga0495660_0000792 | 3300046810 | Bacteria | 23696 |
| 1282 | Ga0495660_0001210 | 3300046810 | Bacteria | 18055 |
| 1283 | Ga0495636_0003683 | 3300047318 | Bacteria | 5959 |
| 1284 | Ga0495674_0439601 | 3300047319 | Bacteria | 1049 |
| 1285 | Ga0495680_0209275 | 3300047322 | Bacteria | 1397 |
| 1286 | Ga0495683_0001237 | 3300047323 | Bacteria | 17374 |
| 1287 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 1288 | Ga0495673_0000294 | 3300047469 | Bacteria | 67042 |
| 1289 | Ga0495673_0000670 | 3300047469 | Bacteria | 33730 |
| 1290 | Ga0495684_0065836 | 3300047471 | Bacteria | 2755 |
| 1291 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 1292 | Ga0495686_0002339 | 3300047472 | Bacteria | 18107 |
| 1293 | Ga0495686_0327251 | 3300047472 | Bacteria | 838 |
| 1294 | Ga0495614_0660955 | 3300048089 | Bacteria | 504 |
| 1295 | Ga0496100_0019061 | 3300048903 | Bacteria | 4085 |
| 1296 | Ga0496100_0145854 | 3300048903 | Bacteria | 1683 |
| 1297 | Ga0496100_0985182 | 3300048903 | Bacteria | 663 |
| 1298 | Ga0496101_0031070 | 3300048904 | Bacteria | 3751 |
| 1299 | Ga0496101_0048869 | 3300048904 | Bacteria | 3041 |
| 1300 | Ga0496102_0226685 | 3300048905 | Bacteria | 1762 |
| 1301 | Ga0496102_0298877 | 3300048905 | Bacteria | 1517 |
| 1302 | Ga0496103_0997285 | 3300048906 | Bacteria | 522 |
| 1303 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 1304 | Ga0496104_0058290 | 3300048907 | Bacteria | 3655 |
| 1305 | Ga0496105_0000015 | 3300048908 | Bacteria | 218758 |
| 1306 | Ga0496105_0002678 | 3300048908 | Bacteria | 12978 |
| 1307 | Ga0496105_0216774 | 3300048908 | Bacteria | 1559 |
| 1308 | Ga0496105_0869095 | 3300048908 | Bacteria | 681 |
| 1309 | Ga0496105_1253327 | 3300048908 | Bacteria | 543 |
| 1310 | Ga0496106_0005633 | 3300048909 | Bacteria | 9268 |
| 1311 | Ga0496106_0099345 | 3300048909 | Bacteria | 2256 |
| 1312 | Ga0496106_0345914 | 3300048909 | Bacteria | 1194 |
| 1313 | Ga0496106_0450830 | 3300048909 | Bacteria | 1033 |
| 1314 | Ga0496107_0361760 | 3300048910 | Bacteria | 1080 |
| 1315 | Ga0496107_0621966 | 3300048910 | Bacteria | 797 |
| 1316 | Ga0496108_0655326 | 3300048911 | Bacteria | 912 |
| 1317 | Ga0496109_0076379 | 3300048912 | Bacteria | 3081 |
| 1318 | Ga0496109_0954675 | 3300048912 | Bacteria | 795 |
| 1319 | Ga0496111_0514662 | 3300048914 | Bacteria | 880 |
| 1320 | Ga0496112_0096940 | 3300048915 | Bacteria | 2919 |
| 1321 | Ga0496112_1306029 | 3300048915 | Bacteria | 641 |
| 1322 | Ga0496113_0003563 | 3300048916 | Bacteria | 9337 |
| 1323 | Ga0496113_0032634 | 3300048916 | Bacteria | 3784 |
| 1324 | Ga0496113_1471177 | 3300048916 | Bacteria | 526 |
| 1325 | Ga0496114_0267913 | 3300048917 | Bacteria | 1505 |
| 1326 | Ga0496114_1501167 | 3300048917 | Bacteria | 562 |
| 1327 | Ga0496115_0000275 | 3300048918 | Bacteria | 45169 |
| 1328 | Ga0496115_0110062 | 3300048918 | Bacteria | 2263 |
| 1329 | Ga0496115_0825272 | 3300048918 | Bacteria | 720 |
| 1330 | Ga0496116_0050219 | 3300048919 | Bacteria | 2781 |
| 1331 | Ga0496116_0057217 | 3300048919 | Bacteria | 2551 |
| 1332 | Ga0496116_0107805 | 3300048919 | Bacteria | 1646 |
| 1333 | Ga0496117_0011886 | 3300048920 | Bacteria | 7744 |
| 1334 | Ga0496117_0028477 | 3300048920 | Bacteria | 4325 |
| 1335 | Ga0496117_0098806 | 3300048920 | Bacteria | 1854 |
| 1336 | Ga0496118_0001213 | 3300048921 | Bacteria | 39638 |
| 1337 | Ga0496118_0003656 | 3300048921 | Bacteria | 19100 |
| 1338 | Ga0496118_0008630 | 3300048921 | Bacteria | 10483 |
| 1339 | Ga0496118_0048646 | 3300048921 | Bacteria | 3271 |
| 1340 | Ga0496118_0054037 | 3300048921 | Bacteria | 3046 |
| 1341 | Ga0496118_0112067 | 3300048921 | Bacteria | 1807 |
| 1342 | Ga0496119_0001455 | 3300048922 | Bacteria | 28402 |
| 1343 | Ga0496119_0047502 | 3300048922 | Bacteria | 2670 |
| 1344 | Ga0496119_0270371 | 3300048922 | Bacteria | 849 |
| 1345 | Ga0496120_0002097 | 3300048923 | Bacteria | 21371 |
| 1346 | Ga0496120_0017747 | 3300048923 | Bacteria | 4602 |
| 1347 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 1348 | Ga0496121_0007647 | 3300048924 | Bacteria | 12982 |
| 1349 | Ga0496121_0011769 | 3300048924 | Bacteria | 9649 |
| 1350 | Ga0496121_0024451 | 3300048924 | Bacteria | 5775 |
| 1351 | Ga0496121_0140784 | 3300048924 | Bacteria | 1790 |
| 1352 | Ga0496121_0232401 | 3300048924 | Bacteria | 1290 |
| 1353 | Ga0496121_0266427 | 3300048924 | Bacteria | 1180 |
| 1354 | Ga0496121_0290300 | 3300048924 | Bacteria | 1114 |
| 1355 | Ga0496122_0000440 | 3300048925 | Bacteria | 87364 |
| 1356 | Ga0496122_0024941 | 3300048925 | Bacteria | 5218 |
| 1357 | Ga0496122_0145393 | 3300048925 | Bacteria | 1474 |
| 1358 | Ga0496122_0148068 | 3300048925 | Bacteria | 1455 |
| 1359 | Ga0496122_0345376 | 3300048925 | Bacteria | 779 |
| 1360 | Ga0496122_0360743 | 3300048925 | Bacteria | 754 |
| 1361 | Ga0496123_0009708 | 3300048926 | Bacteria | 8625 |
| 1362 | Ga0496123_0028799 | 3300048926 | Bacteria | 4104 |
| 1363 | Ga0496123_0039503 | 3300048926 | Bacteria | 3300 |
| 1364 | Ga0496123_0108679 | 3300048926 | Bacteria | 1591 |
| 1365 | Ga0496123_0131222 | 3300048926 | Bacteria | 1387 |
| 1366 | Ga0496124_0053164 | 3300048927 | Bacteria | 3435 |
| 1367 | Ga0496124_0147051 | 3300048927 | Bacteria | 1853 |
| 1368 | Ga0496125_0000149 | 3300048928 | Bacteria | 154223 |
| 1369 | Ga0496125_0003559 | 3300048928 | Bacteria | 18765 |
| 1370 | Ga0496125_0049218 | 3300048928 | Bacteria | 3505 |
| 1371 | Ga0496125_0100187 | 3300048928 | Bacteria | 2137 |
| 1372 | Ga0496125_0178110 | 3300048928 | Bacteria | 1420 |
| 1373 | Ga0496126_0007818 | 3300048929 | Bacteria | 11656 |
| 1374 | Ga0496126_0013267 | 3300048929 | Bacteria | 8396 |
| 1375 | Ga0496126_0052512 | 3300048929 | Bacteria | 3703 |
| 1376 | Ga0496126_0206149 | 3300048929 | Bacteria | 1657 |
| 1377 | Ga0496126_0316301 | 3300048929 | Bacteria | 1284 |
| 1378 | Ga0496126_0461445 | 3300048929 | Bacteria | 1021 |
| 1379 | Ga0496126_0531690 | 3300048929 | Bacteria | 935 |
| 1380 | Ga0501308_021341 | 3300049128 | Bacteria | 813 |
| 1381 | Ga0495678_001023 | 3300049459 | Bacteria | 23732 |
| 1382 | Ga0495678_041423 | 3300049459 | Bacteria | 1843 |
| 1383 | Ga0495682_0048783 | 3300049460 | Bacteria | 1543 |
| 1384 | Ga0495682_0061647 | 3300049460 | Bacteria | 1353 |
| 1385 | Ga0501290_061479 | 3300049513 | Bacteria | 606 |
| 1386 | Ga0501312_092391 | 3300049528 | Bacteria | 560 |
| 1387 | Ga0501320_037209 | 3300049536 | Bacteria | 626 |
| 1388 | Ga0501324_043447 | 3300049540 | Bacteria | 518 |
| 1389 | Ga0501336_026609 | 3300049552 | Bacteria | 552 |
| 1390 | Ga0501031_0101788 | 3300049568 | Bacteria | 1874 |
| 1391 | Ga0501031_0235743 | 3300049568 | Bacteria | 1190 |
| 1392 | Ga0501032_0002397 | 3300049569 | Bacteria | 14606 |
| 1393 | Ga0501032_0049264 | 3300049569 | Bacteria | 2841 |
| 1394 | Ga0501032_0070741 | 3300049569 | Bacteria | 2326 |
| 1395 | Ga0501032_0203255 | 3300049569 | Bacteria | 1293 |
| 1396 | Ga0501032_0217392 | 3300049569 | Bacteria | 1244 |
| 1397 | Ga0501032_0874462 | 3300049569 | Bacteria | 566 |
| 1398 | Ga0501033_0000632 | 3300049570 | Bacteria | 32512 |
| 1399 | Ga0501033_0001720 | 3300049570 | Bacteria | 19154 |
| 1400 | Ga0501033_0024689 | 3300049570 | Bacteria | 4532 |
| 1401 | Ga0501033_0117429 | 3300049570 | Bacteria | 1932 |
| 1402 | Ga0501033_0124122 | 3300049570 | Bacteria | 1872 |
| 1403 | Ga0501033_0135168 | 3300049570 | Bacteria | 1784 |
| 1404 | Ga0501033_0157089 | 3300049570 | Bacteria | 1638 |
| 1405 | Ga0501033_0219572 | 3300049570 | Bacteria | 1353 |
| 1406 | Ga0501033_0413091 | 3300049570 | Bacteria | 940 |
| 1407 | Ga0501033_0628946 | 3300049570 | Bacteria | 734 |
| 1408 | Ga0501034_0002437 | 3300049571 | Bacteria | 22445 |
| 1409 | Ga0501034_0002902 | 3300049571 | Bacteria | 19931 |
| 1410 | Ga0501034_0015349 | 3300049571 | Bacteria | 7871 |
| 1411 | Ga0501034_0027193 | 3300049571 | Bacteria | 5819 |
| 1412 | Ga0501034_0125418 | 3300049571 | Bacteria | 2553 |
| 1413 | Ga0501034_0506505 | 3300049571 | Bacteria | 1120 |
| 1414 | Ga0501034_0517410 | 3300049571 | Bacteria | 1105 |
| 1415 | Ga0501034_0612744 | 3300049571 | Bacteria | 993 |
| 1416 | Ga0501036_0009385 | 3300049572 | Bacteria | 8049 |
| 1417 | Ga0501036_0012706 | 3300049572 | Bacteria | 6986 |
| 1418 | Ga0501036_0093648 | 3300049572 | Bacteria | 2538 |
| 1419 | Ga0501036_0197746 | 3300049572 | Bacteria | 1691 |
| 1420 | Ga0501036_0221807 | 3300049572 | Bacteria | 1587 |
| 1421 | Ga0501036_0354262 | 3300049572 | Bacteria | 1226 |
| 1422 | Ga0501036_0807349 | 3300049572 | Bacteria | 772 |
| 1423 | Ga0501037_0001300 | 3300049573 | Bacteria | 18362 |
| 1424 | Ga0501037_0103023 | 3300049573 | Bacteria | 2058 |
| 1425 | Ga0501037_0153572 | 3300049573 | Bacteria | 1644 |
| 1426 | Ga0501037_0170990 | 3300049573 | Bacteria | 1544 |
| 1427 | Ga0501037_0322920 | 3300049573 | Bacteria | 1068 |
| 1428 | Ga0501037_0485949 | 3300049573 | Bacteria | 839 |
| 1429 | Ga0501037_0651938 | 3300049573 | Bacteria | 703 |
| 1430 | Ga0501038_0008023 | 3300049574 | Bacteria | 9725 |
| 1431 | Ga0501038_0033953 | 3300049574 | Bacteria | 4488 |
| 1432 | Ga0501038_0364928 | 3300049574 | Bacteria | 1122 |
| 1433 | Ga0501038_0377437 | 3300049574 | Bacteria | 1100 |
| 1434 | Ga0501038_0661769 | 3300049574 | Bacteria | 785 |
| 1435 | Ga0501038_1027355 | 3300049574 | Bacteria | 604 |
| 1436 | Ga0501039_0009363 | 3300049575 | Bacteria | 7465 |
| 1437 | Ga0501039_0033279 | 3300049575 | Bacteria | 3976 |
| 1438 | Ga0501039_0108130 | 3300049575 | Bacteria | 2173 |
| 1439 | Ga0501039_0111301 | 3300049575 | Bacteria | 2140 |
| 1440 | Ga0501039_0144763 | 3300049575 | Bacteria | 1867 |
| 1441 | Ga0501039_1116322 | 3300049575 | Bacteria | 611 |
| 1442 | Ga0501039_1561525 | 3300049575 | Bacteria | 507 |
| 1443 | Ga0501040_0035524 | 3300049576 | Bacteria | 3380 |
| 1444 | Ga0501040_0100818 | 3300049576 | Bacteria | 2014 |
| 1445 | Ga0501041_0797888 | 3300049577 | Bacteria | 605 |
| 1446 | Ga0501042_0025128 | 3300049578 | Bacteria | 4183 |
| 1447 | Ga0501042_0221535 | 3300049578 | Bacteria | 1364 |
| 1448 | Ga0501043_0001641 | 3300049579 | Bacteria | 19430 |
| 1449 | Ga0501043_0005218 | 3300049579 | Bacteria | 10516 |
| 1450 | Ga0501043_0012916 | 3300049579 | Bacteria | 6526 |
| 1451 | Ga0501043_0104925 | 3300049579 | Bacteria | 2221 |
| 1452 | Ga0501043_0133837 | 3300049579 | Bacteria | 1942 |
| 1453 | Ga0501043_0357269 | 3300049579 | Bacteria | 1109 |
| 1454 | Ga0501043_0587268 | 3300049579 | Bacteria | 824 |
| 1455 | Ga0501043_0684301 | 3300049579 | Bacteria | 750 |
| 1456 | Ga0501046_0009415 | 3300049580 | Bacteria | 8443 |
| 1457 | Ga0501046_0037617 | 3300049580 | Bacteria | 3888 |
| 1458 | Ga0501046_0053750 | 3300049580 | Bacteria | 3170 |
| 1459 | Ga0501046_0088513 | 3300049580 | Bacteria | 2384 |
| 1460 | Ga0501046_0151662 | 3300049580 | Bacteria | 1748 |
| 1461 | Ga0501046_0187324 | 3300049580 | Bacteria | 1545 |
| 1462 | Ga0501046_0237737 | 3300049580 | Bacteria | 1344 |
| 1463 | Ga0501046_0254713 | 3300049580 | Bacteria | 1291 |
| 1464 | Ga0501046_0414233 | 3300049580 | Bacteria | 972 |
| 1465 | Ga0501046_0901862 | 3300049580 | Bacteria | 616 |
| 1466 | Ga0501046_1257857 | 3300049580 | Bacteria | 507 |
| 1467 | Ga0501047_0002573 | 3300049581 | Bacteria | 17317 |
| 1468 | Ga0501047_0009259 | 3300049581 | Bacteria | 9300 |
| 1469 | Ga0501047_0018810 | 3300049581 | Bacteria | 6626 |
| 1470 | Ga0501047_0029549 | 3300049581 | Bacteria | 5284 |
| 1471 | Ga0501047_0073773 | 3300049581 | Bacteria | 3285 |
| 1472 | Ga0501047_0092889 | 3300049581 | Bacteria | 2896 |
| 1473 | Ga0501047_0328782 | 3300049581 | Bacteria | 1367 |
| 1474 | Ga0501047_0401208 | 3300049581 | Bacteria | 1204 |
| 1475 | Ga0501047_0433185 | 3300049581 | Bacteria | 1145 |
| 1476 | Ga0501047_0531502 | 3300049581 | Bacteria | 1001 |
| 1477 | Ga0501047_0662514 | 3300049581 | Bacteria | 862 |
| 1478 | Ga0501047_0858780 | 3300049581 | Bacteria | 721 |
| 1479 | Ga0501047_1367132 | 3300049581 | Bacteria | 523 |
| 1480 | Ga0501048_0026442 | 3300049582 | Bacteria | 4225 |
| 1481 | Ga0501048_0076244 | 3300049582 | Bacteria | 2366 |
| 1482 | Ga0501048_0274276 | 3300049582 | Bacteria | 1199 |
| 1483 | Ga0501048_0315708 | 3300049582 | Bacteria | 1113 |
| 1484 | Ga0501048_0586179 | 3300049582 | Bacteria | 800 |
| 1485 | Ga0501067_0006199 | 3300049583 | Bacteria | 6629 |
| 1486 | Ga0501067_0014755 | 3300049583 | Bacteria | 4322 |
| 1487 | Ga0501068_0131777 | 3300049584 | Bacteria | 1563 |
| 1488 | Ga0501068_0143933 | 3300049584 | Bacteria | 1495 |
| 1489 | Ga0501069_0006685 | 3300049585 | Bacteria | 6038 |
| 1490 | Ga0501069_0066085 | 3300049585 | Bacteria | 2022 |
| 1491 | Ga0501069_0348860 | 3300049585 | Bacteria | 872 |
| 1492 | Ga0501070_0002131 | 3300049586 | Bacteria | 17372 |
| 1493 | Ga0501070_0010864 | 3300049586 | Bacteria | 7691 |
| 1494 | Ga0501070_0013751 | 3300049586 | Bacteria | 6817 |
| 1495 | Ga0501070_0033092 | 3300049586 | Bacteria | 4324 |
| 1496 | Ga0501070_0087275 | 3300049586 | Bacteria | 2582 |
| 1497 | Ga0501070_0123868 | 3300049586 | Bacteria | 2136 |
| 1498 | Ga0501070_0224590 | 3300049586 | Bacteria | 1539 |
| 1499 | Ga0501071_0028649 | 3300049587 | Bacteria | 3926 |
| 1500 | Ga0501071_0031884 | 3300049587 | Bacteria | 3739 |
| 1501 | Ga0501071_0118792 | 3300049587 | Bacteria | 1959 |
| 1502 | Ga0501071_0820344 | 3300049587 | Bacteria | 717 |
| 1503 | Ga0501072_0003391 | 3300049588 | Bacteria | 11986 |
| 1504 | Ga0501072_0027150 | 3300049588 | Bacteria | 4467 |
| 1505 | Ga0501073_0001213 | 3300049589 | Bacteria | 18787 |
| 1506 | Ga0501073_0002194 | 3300049589 | Bacteria | 14603 |
| 1507 | Ga0501073_0008870 | 3300049589 | Bacteria | 7435 |
| 1508 | Ga0501073_0347496 | 3300049589 | Bacteria | 1024 |
| 1509 | Ga0501073_0386775 | 3300049589 | Bacteria | 966 |
| 1510 | Ga0501073_0547597 | 3300049589 | Bacteria | 799 |
| 1511 | Ga0501073_0787524 | 3300049589 | Bacteria | 655 |
| 1512 | Ga0501073_0814274 | 3300049589 | Bacteria | 643 |
| 1513 | Ga0501074_0031338 | 3300049590 | Bacteria | 3852 |
| 1514 | Ga0501074_0033188 | 3300049590 | Bacteria | 3740 |
| 1515 | Ga0501074_0087103 | 3300049590 | Bacteria | 2237 |
| 1516 | Ga0501074_0096715 | 3300049590 | Bacteria | 2114 |
| 1517 | Ga0501074_0119475 | 3300049590 | Bacteria | 1884 |
| 1518 | Ga0501074_0190732 | 3300049590 | Bacteria | 1461 |
| 1519 | Ga0501074_0282753 | 3300049590 | Bacteria | 1179 |
| 1520 | Ga0501074_0699488 | 3300049590 | Bacteria | 715 |
| 1521 | Ga0501075_0003076 | 3300049591 | Bacteria | 11147 |
| 1522 | Ga0501075_0104738 | 3300049591 | Bacteria | 2150 |
| 1523 | Ga0501076_0001078 | 3300049592 | Bacteria | 17938 |
| 1524 | Ga0501076_0420680 | 3300049592 | Bacteria | 1099 |
| 1525 | Ga0501077_0026740 | 3300049593 | Bacteria | 3663 |
| 1526 | Ga0501206_021096 | 3300049653 | Bacteria | 929 |
| 1527 | Ga0501216_158951 | 3300049660 | Bacteria | 541 |
| 1528 | Ga0501217_096638 | 3300049661 | Bacteria | 835 |
| 1529 | Ga0501223_031766 | 3300049663 | Bacteria | 1027 |
| 1530 | Ga0501224_040125 | 3300049664 | Bacteria | 708 |
| 1531 | Ga0501247_053981 | 3300049677 | Bacteria | 603 |
| 1532 | Ga0501249_019448 | 3300049679 | Bacteria | 1475 |
| 1533 | Ga0501250_004457 | 3300049680 | Bacteria | 1394 |
| 1534 | Ga0501252_006724 | 3300049682 | Bacteria | 1286 |
| 1535 | Ga0501252_086169 | 3300049682 | Bacteria | 526 |
| 1536 | Ga0501253_112865 | 3300049683 | Bacteria | 650 |
| 1537 | Ga0501258_040070 | 3300049687 | Bacteria | 623 |
| 1538 | Ga0501259_104530 | 3300049688 | Bacteria | 654 |
| 1539 | Ga0501225_0006481 | 3300049705 | Bacteria | 3417 |
| 1540 | Ga0501225_0083207 | 3300049705 | Bacteria | 921 |
| 1541 | Ga0501079_0097356 | 3300049741 | Bacteria | 2281 |
| 1542 | Ga0501079_0125221 | 3300049741 | Bacteria | 1999 |
| 1543 | Ga0501079_0224507 | 3300049741 | Bacteria | 1467 |
| 1544 | Ga0501079_0241097 | 3300049741 | Bacteria | 1412 |
| 1545 | Ga0501079_0411511 | 3300049741 | Bacteria | 1061 |
| 1546 | Ga0501079_0547118 | 3300049741 | Bacteria | 910 |
| 1547 | Ga0501079_0999878 | 3300049741 | Bacteria | 659 |
| 1548 | Ga0501080_0000791 | 3300049742 | Bacteria | 25821 |
| 1549 | Ga0501080_0001319 | 3300049742 | Bacteria | 20660 |
| 1550 | Ga0501080_0006958 | 3300049742 | Bacteria | 10203 |
| 1551 | Ga0501080_0009707 | 3300049742 | Bacteria | 8789 |
| 1552 | Ga0501080_0018776 | 3300049742 | Bacteria | 6400 |
| 1553 | Ga0501080_0085197 | 3300049742 | Bacteria | 2936 |
| 1554 | Ga0501080_0140553 | 3300049742 | Bacteria | 2232 |
| 1555 | Ga0501080_0145790 | 3300049742 | Bacteria | 2188 |
| 1556 | Ga0501080_0208236 | 3300049742 | Bacteria | 1793 |
| 1557 | Ga0501080_0486833 | 3300049742 | Bacteria | 1103 |
| 1558 | Ga0501080_0632213 | 3300049742 | Bacteria | 948 |
| 1559 | Ga0501080_0849750 | 3300049742 | Bacteria | 798 |
| 1560 | Ga0501081_0008596 | 3300049743 | Bacteria | 6636 |
| 1561 | Ga0501083_0001078 | 3300049744 | Bacteria | 18217 |
| 1562 | Ga0501083_0181210 | 3300049744 | Bacteria | 1375 |
| 1563 | Ga0501263_039215 | 3300049760 | Bacteria | 692 |
| 1564 | Ga0501264_033208 | 3300049761 | Bacteria | 602 |
| 1565 | Ga0501266_003367 | 3300049763 | Bacteria | 1989 |
| 1566 | Ga0501266_022659 | 3300049763 | Bacteria | 864 |
| 1567 | Ga0501268_092644 | 3300049765 | Bacteria | 638 |
| 1568 | Ga0501268_178276 | 3300049765 | Bacteria | 505 |
| 1569 | Ga0501270_162154 | 3300049767 | Bacteria | 517 |
| 1570 | Ga0501271_032041 | 3300049768 | Bacteria | 654 |
| 1571 | Ga0501272_022957 | 3300049769 | Bacteria | 758 |
| 1572 | Ga0501275_085427 | 3300049772 | Bacteria | 517 |
| 1573 | Ga0501279_035089 | 3300049775 | Bacteria | 754 |
| 1574 | Ga0501035_0013600 | 3300049822 | Bacteria | 7508 |
| 1575 | Ga0501035_0027477 | 3300049822 | Bacteria | 5200 |
| 1576 | Ga0501035_0041694 | 3300049822 | Bacteria | 4144 |
| 1577 | Ga0501035_0098449 | 3300049822 | Bacteria | 2567 |
| 1578 | Ga0501035_0252247 | 3300049822 | Bacteria | 1498 |
| 1579 | Ga0501035_0275414 | 3300049822 | Bacteria | 1423 |
| 1580 | Ga0501035_0317572 | 3300049822 | Bacteria | 1309 |
| 1581 | Ga0501035_0545206 | 3300049822 | Bacteria | 950 |
| 1582 | Ga0501035_0744110 | 3300049822 | Bacteria | 787 |
| 1583 | Ga0501044_0016694 | 3300049823 | Bacteria | 7882 |
| 1584 | Ga0501044_0033968 | 3300049823 | Bacteria | 5354 |
| 1585 | Ga0501044_0061827 | 3300049823 | Bacteria | 3830 |
| 1586 | Ga0501044_0110003 | 3300049823 | Bacteria | 2764 |
| 1587 | Ga0501044_0117045 | 3300049823 | Bacteria | 2669 |
| 1588 | Ga0501044_0119037 | 3300049823 | Bacteria | 2643 |
| 1589 | Ga0501044_0403816 | 3300049823 | Bacteria | 1278 |
| 1590 | Ga0501044_0546658 | 3300049823 | Bacteria | 1056 |
| 1591 | Ga0501044_0575223 | 3300049823 | Bacteria | 1021 |
| 1592 | Ga0501044_0702328 | 3300049823 | Bacteria | 897 |
| 1593 | Ga0501044_1369044 | 3300049823 | Bacteria | 573 |
| 1594 | Ga0501044_1614495 | 3300049823 | Bacteria | 513 |
| 1595 | Ga0501045_0040200 | 3300049824 | Bacteria | 3404 |
| 1596 | Ga0501045_0287400 | 3300049824 | Bacteria | 1224 |
| 1597 | Ga0501045_0635430 | 3300049824 | Bacteria | 789 |
| 1598 | Ga0501045_0766648 | 3300049824 | Bacteria | 711 |
| 1599 | nmdc:mga00v17_54986_c1 | 3300050491 | Bacteria | 2430 |
| 1600 | nmdc:mga00v17_69221_c1 | 3300050491 | Bacteria | 2184 |
| 1601 | nmdc:mga06z11_578199_c1 | 3300050494 | Unclassified | 683 |
| 1602 | nmdc:mga07m45_410003_c1 | 3300050496 | Unclassified | 786 |
| 1603 | nmdc:mga07m45_842111_c1 | 3300050496 | Bacteria | 525 |
| 1604 | nmdc:mga06r32_1434109_c1 | 3300050510 | Bacteria | 632 |
| 1605 | nmdc:mga08x19_286436_c1 | 3300050514 | Bacteria | 1142 |
| 1606 | Ga0495612_0353400 | 3300053078 | Bacteria | 664 |
| 1607 | Ga0500610_0004715 | 3300053079 | Bacteria | 5468 |
| 1608 | Ga0500643_000075 | 3300053087 | Bacteria | 111465 |
| 1609 | Ga0500643_003396 | 3300053087 | Bacteria | 7696 |
| 1610 | Ga0500583_0527191 | 3300053092 | Bacteria | 552 |
| 1611 | Ga0500583_0562674 | 3300053092 | Bacteria | 528 |
| 1612 | Ga0500651_0003714 | 3300053093 | Bacteria | 8408 |
| 1613 | Ga0500566_0093620 | 3300053094 | Bacteria | 1657 |
| 1614 | Ga0500555_000207 | 3300053103 | Bacteria | 27494 |
| 1615 | Ga0500556_0383168 | 3300053104 | Bacteria | 541 |
| 1616 | Ga0500597_002583 | 3300053120 | Bacteria | 5080 |
| 1617 | Ga0500614_017765 | 3300053123 | Bacteria | 1611 |
| 1618 | Ga0500568_0001907 | 3300053139 | Bacteria | 12824 |
| 1619 | Ga0500620_083778 | 3300053155 | Bacteria | 1107 |
| 1620 | Ga0500645_001593 | 3300053730 | Bacteria | 11275 |
| 1621 | Ga0501084_0176857 | 3300054114 | Bacteria | 1801 |
| 1622 | Ga0501084_0192523 | 3300054114 | Bacteria | 1720 |
| 1623 | Ga0501084_0246743 | 3300054114 | Bacteria | 1507 |
| 1624 | Ga0501084_0339736 | 3300054114 | Bacteria | 1268 |
| 1625 | Ga0501084_0903412 | 3300054114 | Bacteria | 743 |
| 1626 | Ga0587083_0264676 | 3300059505 | Bacteria | 517 |
| 1627 | Ga0501082_0001359 | 3300060353 | Bacteria | 21512 |
| 1628 | Ga0501082_0005033 | 3300060353 | Bacteria | 11528 |
| 1629 | Ga0501082_0086117 | 3300060353 | Bacteria | 2710 |
| 1630 | Ga0501082_0211950 | 3300060353 | Bacteria | 1685 |
| 1631 | Ga0466962_0005761 | 3300061719 | Bacteria | 5951 |
| 1632 | Ga0466962_0005882 | 3300061719 | Bacteria | 5892 |
| 1633 | Ga0466962_0008347 | 3300061719 | Bacteria | 4964 |
| 1634 | Ga0466962_0335946 | 3300061719 | Bacteria | 751 |
| 1635 | Ga0530510_0006308 | 3300061734 | Bacteria | 8249 |
| 1636 | Ga0530510_0123358 | 3300061734 | Bacteria | 1903 |
| 1637 | 2572253579 | 2571042365 | Bacteria | 3289345 |
| 1638 | 2643815249 | 2643221559 | Bacteria | 4424915 |
| 1639 | 2643879288 | 2643221573 | Bacteria | 4784121 |
| 1640 | 2643939927 | 2643221586 | Bacteria | 4446529 |
| 1641 | 2643976213 | 2643221593 | Bacteria | 6296053 |
| 1642 | 2644076985 | 2643221612 | Bacteria | 4361984 |
| 1643 | 2644528914 | 2643221695 | Bacteria | 3441323 |
| 1644 | 2644660587 | 2643221720 | Bacteria | 4694283 |
| 1645 | 2644695299 | 2643221727 | Bacteria | 4415595 |
| 1646 | 2644697948 | 2643221728 | Bacteria | 4797149 |
| 1647 | 2919516104 | 2919513703 | Bacteria | 3844312 |
| 1648 | 2919677936 | 2919675420 | Bacteria | 3969095 |
| 1649 | 2941491121 | 2941489479 | Bacteria | 6313767 |
| 1650 | 2995952052 | 2995948881 | Bacteria | 6358104 |
| 1651 | Ga0070683_100398971 | |||
| 1652 | JGI24740J21852_10000470 | |||
| 1653 | JGI24740J21852_10100918 | |||
| 1654 | JGI24739J22299_10000039 | |||
| 1655 | JGI24739J22299_10108011 | |||
| 1656 | JGI24737J22298_10000773 | |||
| 1657 | JGI24737J22298_10007009 | |||
| 1658 | JGI24737J22298_10007226 | |||
| 1659 | JGI24735J21928_10010500 | |||
| 1660 | JGI24735J21928_10017289 | |||
| 1661 | JGI24744J21845_10109725 | |||
| 1662 | JGI25156J39149_1000822 | |||
| 1663 | JGI25156J39149_1001275 | |||
| 1664 | JGI25156J39149_1010679 | |||
| 1665 | JGI25162J39368_1000732 | |||
| 1666 | JGI25154J39366_1003192 | |||
| 1667 | JGI25154J39366_1003368 | |||
| 1668 | JGI25157J39369_1000656 | |||
| 1669 | JGI25157J39369_1000792 | |||
| 1670 | JGI25157J39369_1001513 | |||
| 1671 | JGI25157J39369_1002022 | |||
| 1672 | JGI25157J39369_1002091 | |||
| 1673 | JGI25163J39215_1000172 | |||
| 1674 | JGI25164J39214_1000085 | |||
| 1675 | JGI25164J39214_1000243 | |||
| 1676 | JGI25164J39214_1000994 | |||
| 1677 | JGI25164J39214_1000995 | |||
| 1678 | JGI25164J39214_1004811 | |||
| 1679 | JGI25152J39213_1032881 | |||
| 1680 | Ga0006759J45824_1122819 | |||
| 1681 | JGI25151J46595_10089409 | |||
| 1682 | JGI25165J46597_1000058 | |||
| 1683 | JGI25165J46597_1000090 | |||
| 1684 | JGI25165J46597_1001824 | |||
| 1685 | JGI25165J46597_1006457 | |||
| 1686 | JGI25153J46596_10131115 | |||
| 1687 | rootH2_10015394 | |||
| 1688 | Ga0006562J51391_1026821 | |||
| 1689 | Ga0006562J51391_1026824 | |||
| 1690 | JGI25404J52841_10136760 | |||
| 1691 | Ga0055538_1002456 | |||
| 1692 | Ga0055539_1000434 | |||
| 1693 | Ga0055533_1000734 | |||
| 1694 | Ga0055533_1001197 | |||
| 1695 | Ga0055525_1000097 | |||
| 1696 | Ga0055527_1000198 | |||
| 1697 | Ga0055527_1000581 | |||
| 1698 | Ga0055535_1000034 | |||
| 1699 | Ga0055535_1001535 | |||
| 1700 | Ga0055535_1001554 | |||
| 1701 | Ga0055535_1001777 | |||
| 1702 | Ga0055535_1003057 | |||
| 1703 | Ga0055535_1007979 | |||
| 1704 | Ga0055542_1000441 | |||
| 1705 | Ga0055542_1001261 | |||
| 1706 | Ga0055542_1001412 | |||
| 1707 | Ga0055542_1001429 | |||
| 1708 | Ga0055542_1002987 | |||
| 1709 | Ga0055542_1002988 | |||
| 1710 | Ga0055529_1000206 | |||
| 1711 | Ga0055529_1000870 | |||
| 1712 | Ga0055529_1001132 | |||
| 1713 | Ga0055529_1001145 | |||
| 1714 | Ga0055529_1035198 | |||
| 1715 | Ga0055526_1000021 | |||
| 1716 | Ga0055526_1007069 | |||
| 1717 | Ga0055537_1000186 | |||
| 1718 | Ga0055524_1000062 | |||
| 1719 | Ga0055536_1039212 | |||
| 1720 | Ga0055536_1059790 | |||
| 1721 | Ga0055534_1000052 | |||
| 1722 | Ga0055534_1004464 | |||
| 1723 | Ga0055528_1000009 | |||
| 1724 | Ga0055530_10009161 | |||
| 1725 | Ga0055540_1027462 | |||
| 1726 | Ga0055540_1099154 | |||
| 1727 | Ga0055531_10003386 | |||
| 1728 | Ga0055531_10024760 | |||
| 1729 | Ga0065165_1006432 | |||
| 1730 | Ga0070658_10003054 | |||
| 1731 | Ga0070658_10506690 | |||
| 1732 | Ga0070658_10616842 | |||
| 1733 | Ga0070658_10852760 | |||
| 1734 | Ga0070658_10922143 | |||
| 1735 | Ga0070676_10208880 | |||
| 1736 | Ga0070676_10216960 | |||
| 1737 | Ga0070676_10311370 | |||
| 1738 | Ga0070676_10379102 | |||
| 1739 | Ga0070676_10575862 | |||
| 1740 | Ga0070683_100318735 | |||
| 1741 | Ga0070683_100541837 | |||
| 1742 | Ga0070690_100411184 | |||
| 1743 | Ga0070690_101494143 | |||
| 1744 | Ga0070670_100068818 | |||
| 1745 | Ga0070670_100141643 | |||
| 1746 | Ga0070670_100156846 | |||
| 1747 | Ga0070670_100375681 | |||
| 1748 | Ga0070670_100419130 | |||
| 1749 | Ga0070670_100942112 | |||
| 1750 | Ga0070670_101118738 | |||
| 1751 | Ga0070670_101565348 | |||
| 1752 | Ga0068869_100047959 | |||
| 1753 | Ga0068869_100128761 | |||
| 1754 | Ga0070666_10000003 | |||
| 1755 | Ga0070666_10001186 | |||
| 1756 | Ga0070666_10070889 | |||
| 1757 | Ga0070666_10089151 | |||
| 1758 | Ga0070666_10107381 | |||
| 1759 | Ga0070680_101125684 | |||
| 1760 | Ga0070680_101335632 | |||
| 1761 | Ga0070680_101515888 | |||
| 1762 | Ga0070682_100058779 | |||
| 1763 | Ga0070682_100316697 | |||
| 1764 | Ga0070682_101584440 | |||
| 1765 | Ga0068868_100035150 | |||
| 1766 | Ga0068868_100166786 | |||
| 1767 | Ga0068868_100201592 | |||
| 1768 | Ga0068868_100355987 | |||
| 1769 | Ga0068868_100724207 | |||
| 1770 | Ga0070660_100133313 | |||
| 1771 | Ga0070660_100252028 | |||
| 1772 | Ga0070660_100878421 | |||
| 1773 | Ga0070660_101438456 | |||
| 1774 | Ga0070689_100236971 | |||
| 1775 | Ga0070689_100812744 | |||
| 1776 | Ga0070691_10017095 | |||
| 1777 | Ga0070687_100645345 | |||
| 1778 | Ga0070661_100017074 | |||
| 1779 | Ga0070661_100018867 | |||
| 1780 | Ga0070661_100057112 | |||
| 1781 | Ga0070661_100083093 | |||
| 1782 | Ga0070661_100109495 | |||
| 1783 | Ga0070661_100259293 | |||
| 1784 | Ga0070661_100735824 | |||
| 1785 | Ga0070692_10001200 | |||
| 1786 | Ga0070668_100027029 | |||
| 1787 | Ga0070668_100029601 | |||
| 1788 | Ga0070668_100037989 | |||
| 1789 | Ga0070668_100286427 | |||
| 1790 | Ga0070668_100701499 | |||
| 1791 | Ga0070668_100853455 | |||
| 1792 | Ga0070669_100556490 | |||
| 1793 | Ga0070669_100801015 | |||
| 1794 | Ga0070669_101688788 | |||
| 1795 | Ga0070675_100075966 | |||
| 1796 | Ga0070675_100508634 | |||
| 1797 | Ga0070671_100140699 | |||
| 1798 | Ga0070671_101007524 | |||
| 1799 | Ga0070671_101306999 | |||
| 1800 | Ga0070671_102088059 | |||
| 1801 | Ga0070674_100381466 | |||
| 1802 | Ga0070673_100118935 | |||
| 1803 | Ga0070673_100121644 | |||
| 1804 | Ga0070673_101658429 | |||
| 1805 | Ga0070688_100662342 | |||
| 1806 | Ga0070659_100295472 | |||
| 1807 | Ga0070659_100720786 | |||
| 1808 | Ga0070659_101252060 | |||
| 1809 | Ga0070667_100000084 | |||
| 1810 | Ga0070667_100014298 | |||
| 1811 | Ga0070667_100016481 | |||
| 1812 | Ga0070667_100111163 | |||
| 1813 | Ga0070667_100116610 | |||
| 1814 | Ga0070667_100166891 | |||
| 1815 | Ga0070667_100258183 | |||
| 1816 | Ga0070667_100380143 | |||
| 1817 | Ga0070667_100491248 | |||
| 1818 | Ga0070667_100518659 | |||
| 1819 | Ga0070667_100568992 | |||
| 1820 | Ga0070667_100569730 | |||
| 1821 | Ga0070667_100673927 | |||
| 1822 | Ga0070667_100714646 | |||
| 1823 | Ga0070667_101745029 | |||
| 1824 | Ga0070667_101865706 | |||
| 1825 | Ga0070709_10610281 | |||
| 1826 | Ga0070714_100092322 | |||
| 1827 | Ga0070714_100233190 | |||
| 1828 | Ga0070714_100712286 | |||
| 1829 | Ga0070713_100000401 | |||
| 1830 | Ga0070713_101546112 | |||
| 1831 | Ga0070711_100847092 | |||
| 1832 | Ga0070711_100949692 | |||
| 1833 | Ga0070711_101627140 | |||
| 1834 | Ga0070711_102041554 | |||
| 1835 | Ga0070663_100000327 | |||
| 1836 | Ga0070663_100019945 | |||
| 1837 | Ga0070663_100099652 | |||
| 1838 | Ga0070663_100153698 | |||
| 1839 | Ga0070663_100166357 | |||
| 1840 | Ga0070663_101025064 | |||
| 1841 | Ga0070663_101230109 | |||
| 1842 | Ga0070678_100025334 | |||
| 1843 | Ga0070678_100082189 | |||
| 1844 | Ga0070678_100802964 | |||
| 1845 | Ga0070678_102049207 | |||
| 1846 | Ga0070662_100201437 | |||
| 1847 | Ga0070662_100324011 | |||
| 1848 | Ga0070662_100451123 | |||
| 1849 | Ga0070662_100458096 | |||
| 1850 | Ga0070662_100907941 | |||
| 1851 | Ga0070662_101204415 | |||
| 1852 | Ga0070681_10169047 | |||
| 1853 | Ga0070681_10367131 | |||
| 1854 | Ga0070681_10507270 | |||
| 1855 | Ga0068867_100151954 | |||
| 1856 | Ga0068867_100167454 | |||
| 1857 | Ga0068867_100205089 | |||
| 1858 | Ga0068867_100822787 | |||
| 1859 | Ga0068867_101160619 | |||
| 1860 | Ga0070685_10005887 | |||
| 1861 | Ga0070685_10659667 | |||
| 1862 | Ga0070685_11298692 | |||
| 1863 | Ga0070699_100813160 | |||
| 1864 | Ga0070679_100193143 | |||
| 1865 | Ga0070679_102188816 | |||
| 1866 | Ga0068853_100002704 | |||
| 1867 | Ga0068853_100065726 | |||
| 1868 | Ga0068853_100077969 | |||
| 1869 | Ga0068853_100243932 | |||
| 1870 | Ga0068853_100384322 | |||
| 1871 | Ga0068853_100597911 | |||
| 1872 | Ga0068853_100663150 | |||
| 1873 | Ga0068853_100673498 | |||
| 1874 | Ga0068853_101016012 | |||
| 1875 | Ga0068853_101072473 | |||
| 1876 | Ga0068853_101419858 | |||
| 1877 | Ga0070672_100268324 | |||
| 1878 | Ga0070672_100274735 | |||
| 1879 | Ga0070696_100026415 | |||
| 1880 | Ga0070696_101086134 | |||
| 1881 | Ga0070693_100084649 | |||
| 1882 | Ga0070693_100188355 | |||
| 1883 | Ga0070693_100258338 | |||
| 1884 | Ga0070693_100864475 | |||
| 1885 | Ga0070665_100000249 | |||
| 1886 | Ga0070665_100012690 | |||
| 1887 | Ga0070665_100022171 | |||
| 1888 | Ga0070665_100056231 | |||
| 1889 | Ga0070665_100259943 | |||
| 1890 | Ga0070665_100543687 | |||
| 1891 | Ga0070665_100821504 | |||
| 1892 | Ga0070665_101151931 | |||
| 1893 | Ga0070665_101263570 | |||
| 1894 | Ga0070665_101603595 | |||
| 1895 | Ga0070665_101749902 | |||
| 1896 | Ga0068855_100042228 | |||
| 1897 | Ga0068855_100060595 | |||
| 1898 | Ga0068855_100074780 | |||
| 1899 | Ga0068855_100082771 | |||
| 1900 | Ga0068855_100093629 | |||
| 1901 | Ga0068855_100122346 | |||
| 1902 | Ga0068855_100221989 | |||
| 1903 | Ga0068855_100257604 | |||
| 1904 | Ga0068855_100306227 | |||
| 1905 | Ga0068855_100349227 | |||
| 1906 | Ga0068855_100379456 | |||
| 1907 | Ga0068855_100519186 | |||
| 1908 | Ga0068855_101070197 | |||
| 1909 | Ga0068855_101672526 | |||
| 1910 | Ga0070664_100066498 | |||
| 1911 | Ga0070664_100159884 | |||
| 1912 | Ga0070664_100410070 | |||
| 1913 | Ga0068857_100000551 | |||
| 1914 | Ga0068857_100148913 | |||
| 1915 | Ga0068857_100208283 | |||
| 1916 | Ga0068857_100225783 | |||
| 1917 | Ga0068857_100636914 | |||
| 1918 | Ga0068857_101718814 | |||
| 1919 | Ga0068857_102066812 | |||
| 1920 | Ga0068854_100000634 | |||
| 1921 | Ga0068854_100028199 | |||
| 1922 | Ga0068854_100095505 | |||
| 1923 | Ga0068854_100134375 | |||
| 1924 | Ga0068854_100345216 | |||
| 1925 | Ga0068854_100463767 | |||
| 1926 | Ga0068854_100562606 | |||
| 1927 | Ga0068856_100000245 | |||
| 1928 | Ga0068856_100015179 | |||
| 1929 | Ga0068856_100034861 | |||
| 1930 | Ga0068856_100252731 | |||
| 1931 | Ga0068856_100372684 | |||
| 1932 | Ga0068856_100452730 | |||
| 1933 | Ga0068856_100734895 | |||
| 1934 | Ga0068856_100735744 | |||
| 1935 | Ga0068856_100761240 | |||
| 1936 | Ga0068856_100774353 | |||
| 1937 | Ga0068856_101836171 | |||
| 1938 | Ga0068852_100038365 | |||
| 1939 | Ga0068852_100118481 | |||
| 1940 | Ga0068852_100166563 | |||
| 1941 | Ga0068852_100502344 | |||
| 1942 | Ga0068852_100531430 | |||
| 1943 | Ga0068852_100662612 | |||
| 1944 | Ga0068852_100761451 | |||
| 1945 | Ga0068852_101026213 | |||
| 1946 | Ga0068852_101128034 | |||
| 1947 | Ga0068852_101410680 | |||
| 1948 | Ga0068852_102722405 | |||
| 1949 | Ga0068859_100001367 | |||
| 1950 | Ga0068859_100261639 | |||
| 1951 | Ga0068859_100797998 | |||
| 1952 | Ga0068859_100906336 | |||
| 1953 | Ga0068859_100972630 | |||
| 1954 | Ga0068864_100238138 | |||
| 1955 | Ga0068864_100388209 | |||
| 1956 | Ga0068864_100399545 | |||
| 1957 | Ga0068864_100585219 | |||
| 1958 | Ga0068866_10935768 | |||
| 1959 | Ga0068861_100300737 | |||
| 1960 | Ga0068861_100927172 | |||
| 1961 | Ga0068851_10002343 | |||
| 1962 | Ga0068851_10176390 | |||
| 1963 | Ga0068851_10221766 | |||
| 1964 | Ga0068851_10484571 | |||
| 1965 | Ga0068870_10669774 | |||
| 1966 | Ga0068863_100005779 | |||
| 1967 | Ga0068863_100015026 | |||
| 1968 | Ga0068863_100039049 | |||
| 1969 | Ga0068863_100090495 | |||
| 1970 | Ga0068863_100171415 | |||
| 1971 | Ga0068863_101228510 | |||
| 1972 | Ga0068863_101273389 | |||
| 1973 | Ga0068863_101684782 | |||
| 1974 | Ga0068858_100002098 | |||
| 1975 | Ga0068858_100087159 | |||
| 1976 | Ga0068858_100514926 | |||
| 1977 | Ga0068858_102317411 | |||
| 1978 | Ga0068860_100002623 | |||
| 1979 | Ga0068860_100125858 | |||
| 1980 | Ga0068860_100153813 | |||
| 1981 | Ga0068860_100231301 | |||
| 1982 | Ga0068860_100306934 | |||
| 1983 | Ga0068860_100798786 | |||
| 1984 | Ga0068860_101747859 | |||
| 1985 | Ga0068862_100000941 | |||
| 1986 | Ga0068862_100839203 | |||
| 1987 | Ga0081455_10094355 | |||
| 1988 | Ga0081455_10541744 | |||
| 1989 | Ga0081540_1001118 | |||
| 1990 | Ga0075365_10573912 | |||
| 1991 | Ga0075364_10603065 | |||
| 1992 | Ga0070716_101083873 | |||
| 1993 | Ga0070712_100695102 | |||
| 1994 | Ga0070712_101210084 | |||
| 1995 | Ga0075367_10334613 | |||
| 1996 | Ga0075366_10904500 | |||
| 1997 | Ga0097621_100128744 | |||
| 1998 | Ga0097621_100250600 | |||
| 1999 | Ga0097621_100445794 | |||
| 2000 | Ga0097621_100463893 | |||
| 2001 | Ga0097621_101384646 | |||
| 2002 | Ga0068871_100038080 | |||
| 2003 | Ga0068871_100111371 | |||
| 2004 | Ga0068871_100169544 | |||
| 2005 | Ga0068871_100362746 | |||
| 2006 | Ga0068871_100383698 | |||
| 2007 | Ga0068871_101410630 | |||
| 2008 | Ga0068871_101446288 | |||
| 2009 | Ga0075431_100702404 | |||
| 2010 | Ga0075434_101493858 | |||
| 2011 | Ga0068865_100003492 | |||
| 2012 | Ga0068865_100018704 | |||
| 2013 | Ga0068865_100196150 | |||
| 2014 | Ga0068865_100213578 | |||
| 2015 | Ga0068865_100758994 | |||
| 2016 | Ga0068865_101901953 | |||
| 2017 | Ga0075436_100124884 | |||
| 2018 | Ga0097620_100001367 | |||
| 2019 | Ga0097620_100261640 | |||
| 2020 | Ga0097620_100798097 | |||
| 2021 | Ga0097620_100906622 | |||
| 2022 | Ga0097620_100972635 | |||
| 2023 | Ga0099826_10169391 | |||
| 2024 | Ga0105240_10000627 | |||
| 2025 | Ga0105240_10098926 | |||
| 2026 | Ga0105240_10123497 | |||
| 2027 | Ga0105240_10213925 | |||
| 2028 | Ga0105240_10309393 | |||
| 2029 | Ga0105240_10335124 | |||
| 2030 | Ga0105240_10431908 | |||
| 2031 | Ga0105240_10559067 | |||
| 2032 | Ga0105240_10760555 | |||
| 2033 | Ga0105240_10760556 | |||
| 2034 | Ga0105240_11558216 | |||
| 2035 | Ga0111539_11813593 | |||
| 2036 | Ga0105245_10261611 | |||
| 2037 | Ga0105245_10331048 | |||
| 2038 | Ga0105245_10624776 | |||
| 2039 | Ga0105245_11467698 | |||
| 2040 | Ga0105247_10053155 | |||
| 2041 | Ga0105247_10196742 | |||
| 2042 | Ga0105243_10674006 | |||
| 2043 | Ga0105243_12070627 | |||
| 2044 | Ga0105241_10050532 | |||
| 2045 | Ga0105241_10104348 | |||
| 2046 | Ga0105241_10122703 | |||
| 2047 | Ga0105241_10295120 | |||
| 2048 | Ga0105241_10354005 | |||
| 2049 | Ga0105241_10622816 | |||
| 2050 | Ga0105241_10701426 | |||
| 2051 | Ga0105241_10864665 | |||
| 2052 | Ga0105241_11223866 | |||
| 2053 | Ga0105241_11551149 | |||
| 2054 | Ga0105241_11704536 | |||
| 2055 | Ga0105241_11788613 | |||
| 2056 | Ga0105242_10025509 | |||
| 2057 | Ga0105242_10076451 | |||
| 2058 | Ga0105242_10312729 | |||
| 2059 | Ga0105242_10374891 | |||
| 2060 | Ga0105242_10978358 | |||
| 2061 | Ga0105242_11022674 | |||
| 2062 | Ga0105248_10000418 | |||
| 2063 | Ga0105248_10076122 | |||
| 2064 | Ga0105248_10326174 | |||
| 2065 | Ga0105248_10451960 | |||
| 2066 | Ga0105248_10843000 | |||
| 2067 | Ga0105237_10000272 | |||
| 2068 | Ga0105237_10006138 | |||
| 2069 | Ga0105237_10026547 | |||
| 2070 | Ga0105237_10031065 | |||
| 2071 | Ga0105237_10147981 | |||
| 2072 | Ga0105237_10245121 | |||
| 2073 | Ga0105237_10352560 | |||
| 2074 | Ga0105237_10525259 | |||
| 2075 | Ga0105237_10573499 | |||
| 2076 | Ga0105237_10659941 | |||
| 2077 | Ga0105237_10659942 | |||
| 2078 | Ga0105237_10706116 | |||
| 2079 | Ga0105237_10980829 | |||
| 2080 | Ga0105237_11112211 | |||
| 2081 | Ga0105237_11264886 | |||
| 2082 | Ga0105237_11359290 | |||
| 2083 | Ga0105237_11790736 | |||
| 2084 | Ga0105238_10000920 | |||
| 2085 | Ga0105238_10002036 | |||
| 2086 | Ga0105238_10043470 | |||
| 2087 | Ga0105238_10060458 | |||
| 2088 | Ga0105238_10119920 | |||
| 2089 | Ga0105238_10127655 | |||
| 2090 | Ga0105238_10176228 | |||
| 2091 | Ga0105238_10176250 | |||
| 2092 | Ga0105238_10199227 | |||
| 2093 | Ga0105238_11015940 | |||
| 2094 | Ga0105238_11210731 | |||
| 2095 | Ga0105238_11362851 | |||
| 2096 | Ga0105238_12579614 | |||
| 2097 | Ga0105249_10000195 | |||
| 2098 | Ga0105249_10027675 | |||
| 2099 | Ga0105249_10216336 | |||
| 2100 | Ga0105249_10356663 | |||
| 2101 | Ga0105249_11155462 | |||
| 2102 | Ga0105148_101049 | |||
| 2103 | Ga0105239_10000044 | |||
| 2104 | Ga0105239_10002892 | |||
| 2105 | Ga0105239_10006627 | |||
| 2106 | Ga0105239_10032059 | |||
| 2107 | Ga0105239_10100612 | |||
| 2108 | Ga0105239_10130571 | |||
| 2109 | Ga0105239_10170468 | |||
| 2110 | Ga0105239_10225035 | |||
| 2111 | Ga0105239_10416289 | |||
| 2112 | Ga0105239_10539534 | |||
| 2113 | Ga0105239_10661316 | |||
| 2114 | Ga0105239_11091601 | |||
| 2115 | Ga0105239_11337868 | |||
| 2116 | Ga0105239_11344595 | |||
| 2117 | Ga0105239_12980888 | |||
| 2118 | Ga0105246_10341529 | |||
| 2119 | Ga0105246_10840462 | |||
| 2120 | Ga0105246_11919937 | |||
| 2121 | Ga0157343_1015133 | |||
| 2122 | Ga0157314_1013756 | |||
| 2123 | Ga0157373_10121166 | |||
| 2124 | Ga0157373_10337468 | |||
| 2125 | Ga0157371_10011946 | |||
| 2126 | Ga0157371_10210003 | |||
| 2127 | Ga0157371_10802598 | |||
| 2128 | Ga0157370_10007966 | |||
| 2129 | Ga0157370_10021865 | |||
| 2130 | Ga0157370_10030429 | |||
| 2131 | Ga0157370_10049266 | |||
| 2132 | Ga0157370_10113933 | |||
| 2133 | Ga0157370_10114393 | |||
| 2134 | Ga0157370_10359121 | |||
| 2135 | Ga0157370_10406772 | |||
| 2136 | Ga0157370_10620345 | |||
| 2137 | Ga0157370_10745667 | |||
| 2138 | Ga0157370_10769083 | |||
| 2139 | Ga0157370_11072838 | |||
| 2140 | Ga0157370_11495738 | |||
| 2141 | Ga0157370_11870415 | |||
| 2142 | Ga0157369_10000329 | |||
| 2143 | Ga0157369_10000604 | |||
| 2144 | Ga0157369_10009635 | |||
| 2145 | Ga0157369_10010381 | |||
| 2146 | Ga0157369_10023388 | |||
| 2147 | Ga0157369_10403660 | |||
| 2148 | Ga0157369_10417095 | |||
| 2149 | Ga0157369_10629502 | |||
| 2150 | Ga0157369_10852514 | |||
| 2151 | Ga0157369_10857160 | |||
| 2152 | Ga0157369_11972512 | |||
| 2153 | Ga0157374_10279686 | |||
| 2154 | Ga0157374_10303991 | |||
| 2155 | Ga0157374_10435621 | |||
| 2156 | Ga0157374_10859562 | |||
| 2157 | Ga0157374_10921159 | |||
| 2158 | Ga0157374_11029757 | |||
| 2159 | Ga0157374_12054846 | |||
| 2160 | Ga0157378_10001163 | |||
| 2161 | Ga0157378_10036782 | |||
| 2162 | Ga0157378_10460056 | |||
| 2163 | Ga0157378_11489034 | |||
| 2164 | Ga0163162_10002333 | |||
| 2165 | Ga0163162_10022472 | |||
| 2166 | Ga0163162_10039066 | |||
| 2167 | Ga0163162_11562272 | |||
| 2168 | Ga0163162_12242717 | |||
| 2169 | Ga0157372_10023320 | |||
| 2170 | Ga0157372_10023763 | |||
| 2171 | Ga0157372_10038916 | |||
| 2172 | Ga0157372_10072331 | |||
| 2173 | Ga0157372_10082841 | |||
| 2174 | Ga0157372_10189213 | |||
| 2175 | Ga0157372_10206533 | |||
| 2176 | Ga0157372_10375352 | |||
| 2177 | Ga0157372_10431261 | |||
| 2178 | Ga0157372_10779366 | |||
| 2179 | Ga0157372_11383829 | |||
| 2180 | Ga0157375_10013024 | |||
| 2181 | Ga0157375_10064653 | |||
| 2182 | Ga0157375_10167400 | |||
| 2183 | Ga0157375_10896503 | |||
| 2184 | Ga0163163_10000754 | |||
| 2185 | Ga0163163_10239681 | |||
| 2186 | Ga0163163_10241793 | |||
| 2187 | Ga0163163_11931750 | |||
| 2188 | Ga0157380_12656551 | |||
| 2189 | Ga0182008_10066759 | |||
| 2190 | Ga0182008_10166729 | |||
| 2191 | Ga0182008_10389459 | |||
| 2192 | Ga0157377_10969725 | |||
| 2193 | Ga0157379_10188376 | |||
| 2194 | Ga0157379_10360209 | |||
| 2195 | Ga0157376_10002106 | |||
| 2196 | Ga0157376_10673001 | |||
| 2197 | Ga0157376_11211577 | |||
| 2198 | Ga0182006_1013034 | |||
| 2199 | Ga0182007_10034657 | |||
| 2200 | Ga0182007_10207051 | |||
| 2201 | Ga0182007_10221888 | |||
| 2202 | Ga0182005_1051168 | |||
| 2203 | Ga0183369_1008 | |||
| 2204 | Ga0183368_1003 | |||
| 2205 | Ga0183360_10001 | |||
| 2206 | Ga0163161_10331938 | |||
| 2207 | Ga0163161_11073987 | |||
| 2208 | Ga0206356_11373589 | |||
| 2209 | Ga0206354_10531980 | |||
| 2210 | Ga0206353_10211211 | |||
| 2211 | Ga0154015_1010693 | |||
| 2212 | Ga0213872_10006100 | |||
| 2213 | Ga0209435_102375 | |||
| 2214 | Ga0209435_102791 | |||
| 2215 | Ga0209760_100371 | |||
| 2216 | Ga0209784_100016 | |||
| 2217 | Ga0209566_101455 | |||
| 2218 | Ga0209674_100012 | |||
| 2219 | Ga0209674_100322 | |||
| 2220 | Ga0209674_100347 | |||
| 2221 | Ga0209674_101036 | |||
| 2222 | Ga0209672_100007 | |||
| 2223 | Ga0209672_100078 | |||
| 2224 | Ga0209672_100389 | |||
| 2225 | Ga0209672_100559 | |||
| 2226 | Ga0209672_105497 | |||
| 2227 | Ga0209147_112175 | |||
| 2228 | Ga0209563_100079 | |||
| 2229 | Ga0207427_100033 | |||
| 2230 | Ga0207427_100188 | |||
| 2231 | Ga0207427_100402 | |||
| 2232 | Ga0207427_100594 | |||
| 2233 | Ga0207427_102610 | |||
| 2234 | Ga0209437_100012 | |||
| 2235 | Ga0209437_100020 | |||
| 2236 | Ga0209437_100105 | |||
| 2237 | Ga0209437_100192 | |||
| 2238 | Ga0209437_100537 | |||
| 2239 | Ga0209437_101513 | |||
| 2240 | Ga0209258_100012 | |||
| 2241 | Ga0209258_100046 | |||
| 2242 | Ga0209258_100095 | |||
| 2243 | Ga0209258_100238 | |||
| 2244 | Ga0209258_100765 | |||
| 2245 | Ga0209258_101311 | |||
| 2246 | Ga0209258_101904 | |||
| 2247 | Ga0209258_121959 | |||
| 2248 | Ga0207425_1001752 | |||
| 2249 | Ga0209646_1001514 | |||
| 2250 | Ga0209646_1001913 | |||
| 2251 | Ga0209646_1001986 | |||
| 2252 | Ga0209026_1000012 | |||
| 2253 | Ga0209026_1000105 | |||
| 2254 | Ga0209026_1000278 | |||
| 2255 | Ga0209026_1000285 | |||
| 2256 | Ga0209026_1000335 | |||
| 2257 | Ga0209026_1030371 | |||
| 2258 | Ga0209026_1033302 | |||
| 2259 | Ga0209677_103018 | |||
| 2260 | Ga0209148_1000001 | |||
| 2261 | Ga0209148_1000005 | |||
| 2262 | Ga0209148_1000014 | |||
| 2263 | Ga0209148_1000039 | |||
| 2264 | Ga0209148_1000087 | |||
| 2265 | Ga0209148_1000098 | |||
| 2266 | Ga0209148_1025941 | |||
| 2267 | Ga0209759_1000356 | |||
| 2268 | Ga0209759_1000460 | |||
| 2269 | Ga0209759_1000536 | |||
| 2270 | Ga0209759_1000912 | |||
| 2271 | Ga0209759_1023568 | |||
| 2272 | Ga0209129_1002063 | |||
| 2273 | Ga0209129_1003433 | |||
| 2274 | Ga0209233_1000002 | |||
| 2275 | Ga0209233_1000020 | |||
| 2276 | Ga0209233_1000080 | |||
| 2277 | Ga0209233_1000370 | |||
| 2278 | Ga0209233_1060127 | |||
| 2279 | Ga0209565_1000048 | |||
| 2280 | Ga0209455_1000010 | |||
| 2281 | Ga0209455_1000034 | |||
| 2282 | Ga0209455_1000039 | |||
| 2283 | Ga0209455_1000126 | |||
| 2284 | Ga0209455_1000310 | |||
| 2285 | Ga0209455_1016170 | |||
| 2286 | Ga0209673_1000001 | |||
| 2287 | Ga0209673_1018372 | |||
| 2288 | Ga0209673_1095729 | |||
| 2289 | Ga0209130_1002842 | |||
| 2290 | Ga0209675_1000045 | |||
| 2291 | Ga0209675_1036559 | |||
| 2292 | Ga0209676_1006754 | |||
| 2293 | Ga0209025_1000005 | |||
| 2294 | Ga0209025_1006351 | |||
| 2295 | Ga0209025_1013061 | |||
| 2296 | Ga0209025_1040960 | |||
| 2297 | Ga0209564_1000001 | |||
| 2298 | Ga0209564_1039988 | |||
| 2299 | Ga0209758_1000535 | |||
| 2300 | Ga0209758_1009118 | |||
| 2301 | Ga0209758_1012999 | |||
| 2302 | Ga0209050_1001247 | |||
| 2303 | Ga0209256_1000002 | |||
| 2304 | Ga0209256_1004565 | |||
| 2305 | Ga0209256_1039654 | |||
| 2306 | Ga0207426_1006400 | |||
| 2307 | Ga0207426_1138574 | |||
| 2308 | Ga0209051_1014949 | |||
| 2309 | Ga0209051_1019027 | |||
| 2310 | Ga0209051_1031421 | |||
| 2311 | Ga0209257_1000217 | |||
| 2312 | Ga0209257_1016898 | |||
| 2313 | Ga0209257_1041047 | |||
| 2314 | Ga0209257_1107616 | |||
| 2315 | Ga0207697_10114964 | |||
| 2316 | Ga0207656_10001733 | |||
| 2317 | Ga0207656_10028858 | |||
| 2318 | Ga0207656_10062176 | |||
| 2319 | Ga0207656_10175900 | |||
| 2320 | Ga0207656_10696310 | |||
| 2321 | Ga0207682_10277748 | |||
| 2322 | Ga0207692_10138951 | |||
| 2323 | Ga0207710_10020591 | |||
| 2324 | Ga0207680_10000006 | |||
| 2325 | Ga0207680_10001267 | |||
| 2326 | Ga0207680_10053739 | |||
| 2327 | Ga0207680_10224992 | |||
| 2328 | Ga0207680_10394596 | |||
| 2329 | Ga0207680_10540156 | |||
| 2330 | Ga0207647_10000111 | |||
| 2331 | Ga0207647_10000138 | |||
| 2332 | Ga0207647_10000859 | |||
| 2333 | Ga0207647_10018916 | |||
| 2334 | Ga0207647_10091644 | |||
| 2335 | Ga0207647_10308961 | |||
| 2336 | Ga0207647_10323271 | |||
| 2337 | Ga0207699_10193317 | |||
| 2338 | Ga0207645_10038319 | |||
| 2339 | Ga0207645_10192165 | |||
| 2340 | Ga0207645_10229743 | |||
| 2341 | Ga0207645_10350588 | |||
| 2342 | Ga0207645_10753167 | |||
| 2343 | Ga0207643_10178438 | |||
| 2344 | Ga0207705_10000798 | |||
| 2345 | Ga0207705_10009804 | |||
| 2346 | Ga0207654_10004940 | |||
| 2347 | Ga0207654_10027457 | |||
| 2348 | Ga0207654_10044512 | |||
| 2349 | Ga0207654_10073004 | |||
| 2350 | Ga0207654_10074909 | |||
| 2351 | Ga0207654_10348119 | |||
| 2352 | Ga0207654_11388909 | |||
| 2353 | Ga0207707_10064913 | |||
| 2354 | Ga0207695_10000033 | |||
| 2355 | Ga0207695_10000811 | |||
| 2356 | Ga0207695_10002522 | |||
| 2357 | Ga0207695_10003038 | |||
| 2358 | Ga0207695_10009508 | |||
| 2359 | Ga0207695_10010778 | |||
| 2360 | Ga0207695_10015564 | |||
| 2361 | Ga0207695_10048491 | |||
| 2362 | Ga0207695_10073143 | |||
| 2363 | Ga0207695_10372772 | |||
| 2364 | Ga0207695_10518226 | |||
| 2365 | Ga0207695_10645359 | |||
| 2366 | Ga0207671_10000020 | |||
| 2367 | Ga0207671_10000116 | |||
| 2368 | Ga0207671_10001713 | |||
| 2369 | Ga0207671_10012021 | |||
| 2370 | Ga0207671_10012358 | |||
| 2371 | Ga0207671_10076983 | |||
| 2372 | Ga0207671_10169216 | |||
| 2373 | Ga0207671_10315292 | |||
| 2374 | Ga0207671_10469545 | |||
| 2375 | Ga0207671_10640721 | |||
| 2376 | Ga0207671_11105187 | |||
| 2377 | Ga0207671_11324007 | |||
| 2378 | Ga0207693_10275388 | |||
| 2379 | Ga0207663_10124228 | |||
| 2380 | Ga0207660_10839858 | |||
| 2381 | Ga0207660_11339242 | |||
| 2382 | Ga0207657_10007879 | |||
| 2383 | Ga0207657_10348016 | |||
| 2384 | Ga0207657_11127448 | |||
| 2385 | Ga0207649_10007346 | |||
| 2386 | Ga0207649_10012095 | |||
| 2387 | Ga0207649_10450764 | |||
| 2388 | Ga0207649_10484754 | |||
| 2389 | Ga0207649_10505985 | |||
| 2390 | Ga0207649_10593840 | |||
| 2391 | Ga0207652_10735412 | |||
| 2392 | Ga0207652_11109887 | |||
| 2393 | Ga0207652_11361130 | |||
| 2394 | Ga0207681_10321259 | |||
| 2395 | Ga0207681_11587823 | |||
| 2396 | Ga0207694_10000298 | |||
| 2397 | Ga0207694_10000613 | |||
| 2398 | Ga0207694_10002589 | |||
| 2399 | Ga0207694_10017252 | |||
| 2400 | Ga0207694_10052522 | |||
| 2401 | Ga0207694_10076987 | |||
| 2402 | Ga0207694_10097903 | |||
| 2403 | Ga0207694_10188934 | |||
| 2404 | Ga0207694_10199790 | |||
| 2405 | Ga0207694_10285197 | |||
| 2406 | Ga0207694_10588990 | |||
| 2407 | Ga0207694_10590678 | |||
| 2408 | Ga0207694_10770357 | |||
| 2409 | Ga0207650_10095582 | |||
| 2410 | Ga0207650_10318005 | |||
| 2411 | Ga0207650_10778652 | |||
| 2412 | Ga0207650_11085080 | |||
| 2413 | Ga0207650_11300762 | |||
| 2414 | Ga0207659_10532511 | |||
| 2415 | Ga0207687_10096129 | |||
| 2416 | Ga0207687_10363853 | |||
| 2417 | Ga0207700_10002543 | |||
| 2418 | Ga0207700_11025090 | |||
| 2419 | Ga0207700_11074043 | |||
| 2420 | Ga0207664_10002383 | |||
| 2421 | Ga0207664_10007284 | |||
| 2422 | Ga0207664_10213080 | |||
| 2423 | Ga0207664_10737564 | |||
| 2424 | Ga0207644_10001304 | |||
| 2425 | Ga0207644_10016173 | |||
| 2426 | Ga0207644_11766530 | |||
| 2427 | Ga0207690_10000967 | |||
| 2428 | Ga0207690_10093111 | |||
| 2429 | Ga0207706_10002270 | |||
| 2430 | Ga0207706_10077003 | |||
| 2431 | Ga0207706_10385216 | |||
| 2432 | Ga0207706_10533820 | |||
| 2433 | Ga0207686_10010245 | |||
| 2434 | Ga0207670_10192556 | |||
| 2435 | Ga0207669_11965142 | |||
| 2436 | Ga0207704_10103961 | |||
| 2437 | Ga0207704_10211891 | |||
| 2438 | Ga0207704_10215845 | |||
| 2439 | Ga0207704_10480609 | |||
| 2440 | Ga0207704_11852747 | |||
| 2441 | Ga0207665_11491561 | |||
| 2442 | Ga0207665_11641398 | |||
| 2443 | Ga0207691_10024143 | |||
| 2444 | Ga0207691_10038895 | |||
| 2445 | Ga0207691_10116249 | |||
| 2446 | Ga0207691_10417304 | |||
| 2447 | Ga0207711_10000503 | |||
| 2448 | Ga0207711_10125299 | |||
| 2449 | Ga0207711_10185512 | |||
| 2450 | Ga0207711_10473892 | |||
| 2451 | Ga0207711_10671405 | |||
| 2452 | Ga0207711_11369556 | |||
| 2453 | Ga0207711_11654523 | |||
| 2454 | Ga0207689_10077296 | |||
| 2455 | Ga0207689_10529262 | |||
| 2456 | Ga0207661_10834126 | |||
| 2457 | Ga0207661_11215245 | |||
| 2458 | Ga0207679_10652056 | |||
| 2459 | Ga0207667_10001535 | |||
| 2460 | Ga0207667_10001609 | |||
| 2461 | Ga0207667_10006791 | |||
| 2462 | Ga0207667_10019505 | |||
| 2463 | Ga0207667_10026092 | |||
| 2464 | Ga0207667_10037914 | |||
| 2465 | Ga0207667_10059529 | |||
| 2466 | Ga0207667_10261566 | |||
| 2467 | Ga0207667_10304225 | |||
| 2468 | Ga0207667_10591522 | |||
| 2469 | Ga0207667_10774748 | |||
| 2470 | Ga0207667_10931147 | |||
| 2471 | Ga0207667_11323449 | |||
| 2472 | Ga0207651_10195419 | |||
| 2473 | Ga0207651_10493390 | |||
| 2474 | Ga0207651_11539128 | |||
| 2475 | Ga0207712_10000277 | |||
| 2476 | Ga0207712_10000477 | |||
| 2477 | Ga0207712_10147728 | |||
| 2478 | Ga0207668_10011169 | |||
| 2479 | Ga0207668_10019520 | |||
| 2480 | Ga0207668_10075249 | |||
| 2481 | Ga0207668_10286079 | |||
| 2482 | Ga0207668_10626346 | |||
| 2483 | Ga0207668_10746716 | |||
| 2484 | Ga0207640_10002403 | |||
| 2485 | Ga0207640_10015095 | |||
| 2486 | Ga0207640_10016040 | |||
| 2487 | Ga0207640_10069799 | |||
| 2488 | Ga0207640_10148784 | |||
| 2489 | Ga0207640_10155151 | |||
| 2490 | Ga0207640_10461418 | |||
| 2491 | Ga0207640_11348161 | |||
| 2492 | Ga0207658_10000286 | |||
| 2493 | Ga0207658_10007375 | |||
| 2494 | Ga0207658_10053046 | |||
| 2495 | Ga0207658_10058890 | |||
| 2496 | Ga0207658_10064327 | |||
| 2497 | Ga0207658_10101859 | |||
| 2498 | Ga0207658_10485862 | |||
| 2499 | Ga0207658_11119123 | |||
| 2500 | Ga0207658_11657165 | |||
| 2501 | Ga0207658_12078998 | |||
| 2502 | Ga0207677_10159632 | |||
| 2503 | Ga0207677_10179200 | |||
| 2504 | Ga0207677_10237178 | |||
| 2505 | Ga0207677_10241627 | |||
| 2506 | Ga0207703_10002250 | |||
| 2507 | Ga0207703_10046054 | |||
| 2508 | Ga0207703_10204383 | |||
| 2509 | Ga0207703_10478331 | |||
| 2510 | Ga0207703_10752524 | |||
| 2511 | Ga0207639_10000985 | |||
| 2512 | Ga0207639_10006532 | |||
| 2513 | Ga0207639_10008937 | |||
| 2514 | Ga0207639_10017968 | |||
| 2515 | Ga0207639_10049869 | |||
| 2516 | Ga0207639_10056089 | |||
| 2517 | Ga0207639_10056123 | |||
| 2518 | Ga0207639_10269372 | |||
| 2519 | Ga0207639_10274797 | |||
| 2520 | Ga0207639_10441838 | |||
| 2521 | Ga0207639_10584979 | |||
| 2522 | Ga0207639_11384434 | |||
| 2523 | Ga0207678_10001305 | |||
| 2524 | Ga0207678_10004417 | |||
| 2525 | Ga0207678_10010903 | |||
| 2526 | Ga0207678_10030009 | |||
| 2527 | Ga0207678_10101872 | |||
| 2528 | Ga0207678_10159552 | |||
| 2529 | Ga0207678_10174807 | |||
| 2530 | Ga0207678_10200544 | |||
| 2531 | Ga0207678_10987390 | |||
| 2532 | Ga0207678_11912761 | |||
| 2533 | Ga0207702_10000236 | |||
| 2534 | Ga0207702_10010360 | |||
| 2535 | Ga0207702_10015281 | |||
| 2536 | Ga0207702_10072033 | |||
| 2537 | Ga0207702_10096660 | |||
| 2538 | Ga0207702_10331866 | |||
| 2539 | Ga0207702_10457507 | |||
| 2540 | Ga0207702_10553413 | |||
| 2541 | Ga0207702_10563356 | |||
| 2542 | Ga0207702_10815717 | |||
| 2543 | Ga0207702_11499820 | |||
| 2544 | Ga0207641_10010609 | |||
| 2545 | Ga0207641_10020369 | |||
| 2546 | Ga0207641_10131445 | |||
| 2547 | Ga0207641_10229076 | |||
| 2548 | Ga0207641_10291827 | |||
| 2549 | Ga0207641_10900498 | |||
| 2550 | Ga0207641_11225622 | |||
| 2551 | Ga0207648_10012324 | |||
| 2552 | Ga0207648_10117053 | |||
| 2553 | Ga0207648_10184374 | |||
| 2554 | Ga0207648_10253652 | |||
| 2555 | Ga0207648_11073968 | |||
| 2556 | Ga0207648_11828247 | |||
| 2557 | Ga0207676_10014128 | |||
| 2558 | Ga0207676_10815964 | |||
| 2559 | Ga0207674_10011044 | |||
| 2560 | Ga0207674_10086156 | |||
| 2561 | Ga0207674_10218763 | |||
| 2562 | Ga0207674_10416222 | |||
| 2563 | Ga0207674_10613119 | |||
| 2564 | Ga0207674_10874354 | |||
| 2565 | Ga0207674_10927205 | |||
| 2566 | Ga0207675_100196738 | |||
| 2567 | Ga0207675_100212013 | |||
| 2568 | Ga0207675_100319070 | |||
| 2569 | Ga0207675_100627521 | |||
| 2570 | Ga0207675_100684184 | |||
| 2571 | Ga0207675_100831982 | |||
| 2572 | Ga0207683_10048759 | |||
| 2573 | Ga0207683_10068547 | |||
| 2574 | Ga0207683_11623353 | |||
| 2575 | Ga0207698_10002901 | |||
| 2576 | Ga0207698_10020428 | |||
| 2577 | Ga0207698_10035977 | |||
| 2578 | Ga0207698_10096916 | |||
| 2579 | Ga0207698_10293017 | |||
| 2580 | Ga0207698_10438167 | |||
| 2581 | Ga0207698_10608010 | |||
| 2582 | Ga0207698_10984711 | |||
| 2583 | Ga0207698_11159987 | |||
| 2584 | Ga0207698_12602308 | |||
| 2585 | Ga0209282_1166348 | |||
| 2586 | Ga0265354_1001101 | |||
| 2587 | Ga0265357_1005008 | |||
| 2588 | Ga0268266_10000001 | |||
| 2589 | Ga0268266_10000006 | |||
| 2590 | Ga0268266_10000021 | |||
| 2591 | Ga0268266_10038420 | |||
| 2592 | Ga0268266_10126426 | |||
| 2593 | Ga0268266_10624948 | |||
| 2594 | Ga0268266_11777700 | |||
| 2595 | Ga0268266_11825168 | |||
| 2596 | Ga0268265_10000705 | |||
| 2597 | Ga0268265_10671110 | |||
| 2598 | Ga0268264_10011847 | |||
| 2599 | Ga0268264_10014826 | |||
| 2600 | Ga0268264_10052860 | |||
| 2601 | Ga0268264_10450780 | |||
| 2602 | Ga0268264_10769172 | |||
| 2603 | Ga0307517_10339098 | |||
| 2604 | Ga0307517_10354081 | |||
| 2605 | Ga0307515_10160864 | |||
| 2606 | Ga0307515_10203513 | |||
| 2607 | Ga0265338_10340845 | |||
| 2608 | Ga0265770_1000647 | |||
| 2609 | Ga0265760_10016048 | |||
| 2610 | Ga0265760_10227465 | |||
| 2611 | Ga0265332_10000014 | |||
| 2612 | Ga0265328_10006973 | |||
| 2613 | Ga0265339_10126686 | |||
| 2614 | Ga0265331_10008554 | |||
| 2615 | Ga0265327_10000133 | |||
| 2616 | Ga0265327_10057675 | |||
| 2617 | Ga0265327_10176840 | |||
| 2618 | Ga0307513_10013810 | |||
| 2619 | Ga0307513_10315870 | |||
| 2620 | Ga0307513_10615359 | |||
| 2621 | Ga0307509_10799411 | |||
| 2622 | Ga0307408_100186114 | |||
| 2623 | Ga0307408_100401588 | |||
| 2624 | Ga0307408_101265687 | |||
| 2625 | Ga0307508_10058708 | |||
| 2626 | Ga0307508_10157395 | |||
| 2627 | Ga0307508_10395627 | |||
| 2628 | Ga0316575_10018091 | |||
| 2629 | Ga0316575_10041535 | |||
| 2630 | Ga0316575_10264420 | |||
| 2631 | Ga0316579_10048118 | |||
| 2632 | Ga0316576_10013894 | |||
| 2633 | Ga0316576_10177082 | |||
| 2634 | Ga0316578_10024244 | |||
| 2635 | Ga0316578_10640072 | |||
| 2636 | Ga0307516_10019050 | |||
| 2637 | Ga0307516_10089609 | |||
| 2638 | Ga0307516_10152544 | |||
| 2639 | Ga0307516_10512331 | |||
| 2640 | Ga0316577_10027318 | |||
| 2641 | Ga0307413_10146940 | |||
| 2642 | Ga0307413_10547360 | |||
| 2643 | Ga0307413_11084950 | |||
| 2644 | Ga0307413_11312917 | |||
| 2645 | Ga0307410_10081792 | |||
| 2646 | Ga0307410_10727488 | |||
| 2647 | Ga0307410_11439453 | |||
| 2648 | Ga0307410_11848036 | |||
| 2649 | Ga0307406_10007341 | |||
| 2650 | Ga0307406_10228302 | |||
| 2651 | Ga0307406_10697107 | |||
| 2652 | Ga0307407_10122594 | |||
| 2653 | Ga0307407_10795982 | |||
| 2654 | Ga0307412_10017785 | |||
| 2655 | Ga0307412_10073645 | |||
| 2656 | Ga0307412_10108346 | |||
| 2657 | Ga0307412_11264630 | |||
| 2658 | Ga0307409_100357217 | |||
| 2659 | Ga0307409_101913936 | |||
| 2660 | Ga0307416_100594499 | |||
| 2661 | Ga0307416_103550834 | |||
| 2662 | Ga0307414_10001343 | |||
| 2663 | Ga0307414_10001931 | |||
| 2664 | Ga0307414_10218311 | |||
| 2665 | Ga0307414_10292332 | |||
| 2666 | Ga0307414_10647718 | |||
| 2667 | Ga0307414_11016815 | |||
| 2668 | Ga0307411_10161813 | |||
| 2669 | Ga0307411_10190249 | |||
| 2670 | Ga0307411_10288321 | |||
| 2671 | Ga0307415_100410422 | |||
| 2672 | Ga0316583_10003935 | |||
| 2673 | Ga0316580_10008155 | |||
| 2674 | Ga0307510_10005227 | |||
| 2675 | Ga0373959_0122785 | |||
| 2676 | Ga0373934_0134767 | |||
| 2677 | Ga0373946_0202653 | |||
| 2678 | Ga0316574_0125565 | |||
| 2679 | Ga0316574_0177539 | |||
| 2680 | Ga0316574_0335179 | |||
| 2681 | Ga0316574_0439550 | |||
| 2682 | Ga0316574_0595268 | |||
| 2683 | Ga0373927_0601176 | |||
| 2684 | Ga0373927_0758943 | |||
| 2685 | Ga0373933_0359882 | |||
| 2686 | Ga0373947_0452000 | |||
| 2687 | Ga0373937_0006210 | |||
| 2688 | Ga0373937_0101909 | |||
| 2689 | Ga0373937_0864054 | |||
| 2690 | Ga0316582_0002013 | |||
| 2691 | Ga0316582_0007984 | |||
| 2692 | Ga0316582_0042210 | |||
| 2693 | Ga0316582_0393451 | |||
| 2694 | Ga0316584_0002192 | |||
| 2695 | Ga0373925_1217269 | |||
| 2696 | Ga0395899_0000133 | |||
| 2697 | Ga0395899_0016504 | |||
| 2698 | Ga0395899_0042325 | |||
| 2699 | Ga0395899_0057173 | |||
| 2700 | Ga0395899_0073593 | |||
| 2701 | Ga0395899_0288128 | |||
| 2702 | Ga0395900_0000051 | |||
| 2703 | Ga0395900_0000061 | |||
| 2704 | Ga0395900_0114528 | |||
| 2705 | Ga0395900_0219392 | |||
| 2706 | Ga0395900_0338283 | |||
| 2707 | Ga0395898_0000034 | |||
| 2708 | Ga0395898_0000197 | |||
| 2709 | Ga0395898_0007788 | |||
| 2710 | Ga0395898_0011319 | |||
| 2711 | Ga0395898_0014517 | |||
| 2712 | Ga0395898_0179719 | |||
| 2713 | Ga0395898_0669998 | |||
| 2714 | Ga0395898_0777540 | |||
| 2715 | Ga0395905_0000306 | |||
| 2716 | Ga0395905_0140120 | |||
| 2717 | Ga0395905_0340379 | |||
| 2718 | Ga0395905_0537682 | |||
| 2719 | Ga0395905_1138998 | |||
| 2720 | Ga0316581_0006306 | |||
| 2721 | Ga0395901_0003676 | |||
| 2722 | Ga0395901_0009076 | |||
| 2723 | Ga0395901_0727221 | |||
| 2724 | Ga0395901_1854495 | |||
| 2725 | Ga0395901_1938550 | |||
| 2726 | Ga0436361_0190082 | |||
| 2727 | Ga0436361_0521891 | |||
| 2728 | Ga0436363_0368017 | |||
| 2729 | Ga0439436_0000008 | |||
| 2730 | Ga0439436_0015857 | |||
| 2731 | Ga0439436_0022021 | |||
| 2732 | Ga0439436_0024041 | |||
| 2733 | Ga0439436_0063701 | |||
| 2734 | Ga0439436_0077543 | |||
| 2735 | Ga0439447_007836 | |||
| 2736 | Ga0439466_0229527 | |||
| 2737 | Ga0439465_0008559 | |||
| 2738 | Ga0439465_0012695 | |||
| 2739 | Ga0439465_0029794 | |||
| 2740 | Ga0439465_0255027 | |||
| 2741 | Ga0451787_760046 | |||
| 2742 | Ga0451789_0480807 | |||
| 2743 | Ga0451789_0594797 | |||
| 2744 | Ga0451789_1201078 | |||
| 2745 | Ga0451789_1206445 | |||
| 2746 | Ga0451791_1110733 | |||
| 2747 | Ga0451793_0136894 | |||
| 2748 | Ga0451793_1283171 | |||
| 2749 | Ga0451793_1723166 | |||
| 2750 | Ga0451797_0719793 | |||
| 2751 | Ga0451797_0839044 | |||
| 2752 | Ga0451795_1164357 | |||
| 2753 | Ga0451795_1565558 | |||
| 2754 | Ga0451798_0160268 | |||
| 2755 | Ga0451800_0410448 | |||
| 2756 | Ga0451800_0506376 | |||
| 2757 | Ga0451800_1459324 | |||
| 2758 | Ga0451802_0744649 | |||
| 2759 | Ga0451802_1852954 | |||
| 2760 | Ga0451804_0003308 | |||
| 2761 | Ga0451804_0340235 | |||
| 2762 | Ga0451807_1507964 | |||
| 2763 | Ga0451807_1589376 | |||
| 2764 | Ga0451807_1924293 | |||
| 2765 | Ga0451807_2135600 | |||
| 2766 | Ga0451807_2735494 | |||
| 2767 | Ga0451833_0532987 | |||
| 2768 | Ga0451833_0951430 | |||
| 2769 | Ga0451835_0367031 | |||
| 2770 | Ga0451837_0103295 | |||
| 2771 | Ga0451837_0244838 | |||
| 2772 | Ga0451837_1610330 | |||
| 2773 | Ga0451841_1138043 | |||
| 2774 | Ga0451849_0244638 | |||
| 2775 | Ga0451849_0355062 | |||
| 2776 | Ga0451849_1085578 | |||
| 2777 | Ga0451851_0574422 | |||
| 2778 | Ga0451843_0007405 | |||
| 2779 | Ga0451843_0905268 | |||
| 2780 | Ga0451843_1073184 | |||
| 2781 | Ga0451843_1682121 | |||
| 2782 | Ga0451853_1071901 | |||
| 2783 | Ga0451853_2123261 | |||
| 2784 | Ga0451853_2493278 | |||
| 2785 | Ga0451853_2583559 | |||
| 2786 | Ga0451853_2935955 | |||
| 2787 | Ga0451853_3209840 | |||
| 2788 | Ga0439431_0011423 | |||
| 2789 | Ga0439433_0014340 | |||
| 2790 | Ga0439445_0027544 | |||
| 2791 | Ga0439445_0029548 | |||
| 2792 | Ga0439445_0101561 | |||
| 2793 | Ga0439449_0004432 | |||
| 2794 | Ga0439449_0005563 | |||
| 2795 | Ga0439449_0011023 | |||
| 2796 | Ga0439449_0011092 | |||
| 2797 | Ga0439449_0017334 | |||
| 2798 | Ga0439449_0041485 | |||
| 2799 | Ga0439449_0078816 | |||
| 2800 | Ga0439449_0304020 | |||
| 2801 | Ga0439452_078748 | |||
| 2802 | Ga0439457_045877 | |||
| 2803 | Ga0439462_0058894 | |||
| 2804 | Ga0439462_0089731 | |||
| 2805 | Ga0439462_0095941 | |||
| 2806 | Ga0439446_0177495 | |||
| 2807 | Ga0439458_0131439 | |||
| 2808 | Ga0450908_002779 | |||
| 2809 | Ga0439434_0147624 | |||
| 2810 | Ga0439459_0006149 | |||
| 2811 | Ga0439459_0085371 | |||
| 2812 | Ga0451577_0149158 | |||
| 2813 | Ga0451577_0501910 | |||
| 2814 | Ga0466969_0001457 | |||
| 2815 | Ga0466969_0039210 | |||
| 2816 | Ga0466969_0055973 | |||
| 2817 | Ga0466972_0000555 | |||
| 2818 | Ga0466972_0043049 | |||
| 2819 | Ga0466982_0000026 | |||
| 2820 | Ga0466982_0004003 | |||
| 2821 | Ga0466965_0001099 | |||
| 2822 | Ga0466965_0046974 | |||
| 2823 | Ga0466966_0005830 | |||
| 2824 | Ga0466966_0012407 | |||
| 2825 | Ga0466966_0695670 | |||
| 2826 | Ga0466961_0010278 | |||
| 2827 | Ga0466961_0035544 | |||
| 2828 | Ga0466961_0118349 | |||
| 2829 | Ga0466961_0127822 | |||
| 2830 | Ga0466964_0011285 | |||
| 2831 | Ga0466964_0130651 | |||
| 2832 | Ga0453684_0001089 | |||
| 2833 | Ga0453684_0144356 | |||
| 2834 | Ga0466971_0001957 | |||
| 2835 | Ga0466971_0068841 | |||
| 2836 | Ga0466971_0103735 | |||
| 2837 | Ga0466971_0257274 | |||
| 2838 | Ga0466968_0003504 | |||
| 2839 | Ga0466968_0004304 | |||
| 2840 | Ga0466970_0000637 | |||
| 2841 | Ga0466970_0006813 | |||
| 2842 | Ga0466970_0043358 | |||
| 2843 | Ga0466970_0098456 | |||
| 2844 | Ga0466970_0516756 | |||
| 2845 | Ga0466957_0005542 | |||
| 2846 | Ga0466957_0030562 | |||
| 2847 | Ga0466957_0351074 | |||
| 2848 | Ga0466957_0611920 | |||
| 2849 | Ga0466957_0784745 | |||
| 2850 | Ga0466960_0009574 | |||
| 2851 | Ga0466960_0243814 | |||
| 2852 | Ga0466959_0019992 | |||
| 2853 | Ga0466959_0022705 | |||
| 2854 | Ga0466959_0156385 | |||
| 2855 | Ga0451576_0000201 | |||
| 2856 | Ga0451576_0505280 | |||
| 2857 | Ga0466958_0014964 | |||
| 2858 | Ga0466958_0119060 | |||
| 2859 | Ga0466967_0182733 | |||
| 2860 | Ga0466967_0437907 | |||
| 2861 | Ga0466967_0796184 | |||
| 2862 | Ga0495617_000424 | |||
| 2863 | Ga0495629_0048970 | |||
| 2864 | Ga0495638_0000146 | |||
| 2865 | Ga0495638_0001668 | |||
| 2866 | Ga0495638_0001669 | |||
| 2867 | Ga0495638_0073075 | |||
| 2868 | Ga0495638_0172342 | |||
| 2869 | Ga0495641_0031745 | |||
| 2870 | Ga0495651_0414840 | |||
| 2871 | Ga0495650_0002509 | |||
| 2872 | Ga0495650_0006285 | |||
| 2873 | Ga0495580_0145919 | |||
| 2874 | Ga0495582_0029608 | |||
| 2875 | Ga0495664_0204018 | |||
| 2876 | Ga0495584_0258950 | |||
| 2877 | Ga0495585_0004990 | |||
| 2878 | Ga0495607_0001360 | |||
| 2879 | Ga0495607_0015098 | |||
| 2880 | Ga0495583_0016180 | |||
| 2881 | Ga0495606_0001823 | |||
| 2882 | Ga0495606_0009315 | |||
| 2883 | Ga0495606_0112071 | |||
| 2884 | Ga0495610_0007268 | |||
| 2885 | Ga0495610_0218642 | |||
| 2886 | Ga0495616_0000400 | |||
| 2887 | Ga0495620_0111880 | |||
| 2888 | Ga0495630_0084401 | |||
| 2889 | Ga0495630_0301731 | |||
| 2890 | Ga0495631_0003067 | |||
| 2891 | Ga0495631_0004987 | |||
| 2892 | Ga0495632_0000004 | |||
| 2893 | Ga0495632_0006481 | |||
| 2894 | Ga0495637_0081900 | |||
| 2895 | Ga0495643_0111285 | |||
| 2896 | Ga0495643_0147056 | |||
| 2897 | Ga0495648_0069715 | |||
| 2898 | Ga0495663_0000892 | |||
| 2899 | Ga0495665_0036191 | |||
| 2900 | Ga0495609_0013644 | |||
| 2901 | Ga0495645_0654105 | |||
| 2902 | Ga0495622_0011411 | |||
| 2903 | Ga0495622_0418385 | |||
| 2904 | Ga0495633_0283714 | |||
| 2905 | Ga0495656_0006219 | |||
| 2906 | Ga0495668_0004286 | |||
| 2907 | Ga0495668_0133484 | |||
| 2908 | Ga0495611_0000001 | |||
| 2909 | Ga0495625_0000001 | |||
| 2910 | Ga0495625_0108723 | |||
| 2911 | Ga0495625_0655523 | |||
| 2912 | Ga0495635_0550182 | |||
| 2913 | Ga0495635_1015615 | |||
| 2914 | Ga0495661_0004892 | |||
| 2915 | Ga0495657_0090211 | |||
| 2916 | Ga0495657_0819728 | |||
| 2917 | Ga0495599_0178684 | |||
| 2918 | Ga0495646_0405921 | |||
| 2919 | Ga0495647_0004669 | |||
| 2920 | Ga0495658_0004687 | |||
| 2921 | Ga0495658_0277291 | |||
| 2922 | Ga0495670_0009378 | |||
| 2923 | Ga0495670_0079774 | |||
| 2924 | Ga0495670_0285950 | |||
| 2925 | Ga0495671_0004084 | |||
| 2926 | Ga0495671_0128936 | |||
| 2927 | Ga0495649_0000218 | |||
| 2928 | Ga0495649_0078862 | |||
| 2929 | Ga0495589_0000236 | |||
| 2930 | Ga0495600_0159578 | |||
| 2931 | Ga0495660_0000792 | |||
| 2932 | Ga0495660_0001210 | |||
| 2933 | Ga0495636_0003683 | |||
| 2934 | Ga0495674_0439601 | |||
| 2935 | Ga0495680_0209275 | |||
| 2936 | Ga0495683_0001237 | |||
| 2937 | Ga0495679_000004 | |||
| 2938 | Ga0495673_0000294 | |||
| 2939 | Ga0495673_0000670 | |||
| 2940 | Ga0495684_0065836 | |||
| 2941 | Ga0495686_0000017 | |||
| 2942 | Ga0495686_0002339 | |||
| 2943 | Ga0495686_0327251 | |||
| 2944 | Ga0495614_0660955 | |||
| 2945 | Ga0496100_0019061 | |||
| 2946 | Ga0496100_0145854 | |||
| 2947 | Ga0496100_0985182 | |||
| 2948 | Ga0496101_0031070 | |||
| 2949 | Ga0496101_0048869 | |||
| 2950 | Ga0496102_0226685 | |||
| 2951 | Ga0496102_0298877 | |||
| 2952 | Ga0496103_0997285 | |||
| 2953 | Ga0496104_0000011 | |||
| 2954 | Ga0496104_0058290 | |||
| 2955 | Ga0496105_0000015 | |||
| 2956 | Ga0496105_0002678 | |||
| 2957 | Ga0496105_0216774 | |||
| 2958 | Ga0496105_0869095 | |||
| 2959 | Ga0496105_1253327 | |||
| 2960 | Ga0496106_0005633 | |||
| 2961 | Ga0496106_0099345 | |||
| 2962 | Ga0496106_0345914 | |||
| 2963 | Ga0496106_0450830 | |||
| 2964 | Ga0496107_0361760 | |||
| 2965 | Ga0496107_0621966 | |||
| 2966 | Ga0496108_0655326 | |||
| 2967 | Ga0496109_0076379 | |||
| 2968 | Ga0496109_0954675 | |||
| 2969 | Ga0496111_0514662 | |||
| 2970 | Ga0496112_0096940 | |||
| 2971 | Ga0496112_1306029 | |||
| 2972 | Ga0496113_0003563 | |||
| 2973 | Ga0496113_0032634 | |||
| 2974 | Ga0496113_1471177 | |||
| 2975 | Ga0496114_0267913 | |||
| 2976 | Ga0496114_1501167 | |||
| 2977 | Ga0496115_0000275 | |||
| 2978 | Ga0496115_0110062 | |||
| 2979 | Ga0496115_0825272 | |||
| 2980 | Ga0496116_0050219 | |||
| 2981 | Ga0496116_0057217 | |||
| 2982 | Ga0496116_0107805 | |||
| 2983 | Ga0496117_0011886 | |||
| 2984 | Ga0496117_0028477 | |||
| 2985 | Ga0496117_0098806 | |||
| 2986 | Ga0496118_0001213 | |||
| 2987 | Ga0496118_0003656 | |||
| 2988 | Ga0496118_0008630 | |||
| 2989 | Ga0496118_0048646 | |||
| 2990 | Ga0496118_0054037 | |||
| 2991 | Ga0496118_0112067 | |||
| 2992 | Ga0496119_0001455 | |||
| 2993 | Ga0496119_0047502 | |||
| 2994 | Ga0496119_0270371 | |||
| 2995 | Ga0496120_0002097 | |||
| 2996 | Ga0496120_0017747 | |||
| 2997 | Ga0496121_0000045 | |||
| 2998 | Ga0496121_0007647 | |||
| 2999 | Ga0496121_0011769 | |||
| 3000 | Ga0496121_0024451 | |||
| 3001 | Ga0496121_0140784 | |||
| 3002 | Ga0496121_0232401 | |||
| 3003 | Ga0496121_0266427 | |||
| 3004 | Ga0496121_0290300 | |||
| 3005 | Ga0496122_0000440 | |||
| 3006 | Ga0496122_0024941 | |||
| 3007 | Ga0496122_0145393 | |||
| 3008 | Ga0496122_0148068 | |||
| 3009 | Ga0496122_0345376 | |||
| 3010 | Ga0496122_0360743 | |||
| 3011 | Ga0496123_0009708 | |||
| 3012 | Ga0496123_0028799 | |||
| 3013 | Ga0496123_0039503 | |||
| 3014 | Ga0496123_0108679 | |||
| 3015 | Ga0496123_0131222 | |||
| 3016 | Ga0496124_0053164 | |||
| 3017 | Ga0496124_0147051 | |||
| 3018 | Ga0496125_0000149 | |||
| 3019 | Ga0496125_0003559 | |||
| 3020 | Ga0496125_0049218 | |||
| 3021 | Ga0496125_0100187 | |||
| 3022 | Ga0496125_0178110 | |||
| 3023 | Ga0496126_0007818 | |||
| 3024 | Ga0496126_0013267 | |||
| 3025 | Ga0496126_0052512 | |||
| 3026 | Ga0496126_0206149 | |||
| 3027 | Ga0496126_0316301 | |||
| 3028 | Ga0496126_0461445 | |||
| 3029 | Ga0496126_0531690 | |||
| 3030 | Ga0501308_021341 | |||
| 3031 | Ga0495678_001023 | |||
| 3032 | Ga0495678_041423 | |||
| 3033 | Ga0495682_0048783 | |||
| 3034 | Ga0495682_0061647 | |||
| 3035 | Ga0501290_061479 | |||
| 3036 | Ga0501312_092391 | |||
| 3037 | Ga0501320_037209 | |||
| 3038 | Ga0501324_043447 | |||
| 3039 | Ga0501336_026609 | |||
| 3040 | Ga0501031_0101788 | |||
| 3041 | Ga0501031_0235743 | |||
| 3042 | Ga0501032_0002397 | |||
| 3043 | Ga0501032_0049264 | |||
| 3044 | Ga0501032_0070741 | |||
| 3045 | Ga0501032_0203255 | |||
| 3046 | Ga0501032_0217392 | |||
| 3047 | Ga0501032_0874462 | |||
| 3048 | Ga0501033_0000632 | |||
| 3049 | Ga0501033_0001720 | |||
| 3050 | Ga0501033_0024689 | |||
| 3051 | Ga0501033_0117429 | |||
| 3052 | Ga0501033_0124122 | |||
| 3053 | Ga0501033_0135168 | |||
| 3054 | Ga0501033_0157089 | |||
| 3055 | Ga0501033_0219572 | |||
| 3056 | Ga0501033_0413091 | |||
| 3057 | Ga0501033_0628946 | |||
| 3058 | Ga0501034_0002437 | |||
| 3059 | Ga0501034_0002902 | |||
| 3060 | Ga0501034_0015349 | |||
| 3061 | Ga0501034_0027193 | |||
| 3062 | Ga0501034_0125418 | |||
| 3063 | Ga0501034_0506505 | |||
| 3064 | Ga0501034_0517410 | |||
| 3065 | Ga0501034_0612744 | |||
| 3066 | Ga0501036_0009385 | |||
| 3067 | Ga0501036_0012706 | |||
| 3068 | Ga0501036_0093648 | |||
| 3069 | Ga0501036_0197746 | |||
| 3070 | Ga0501036_0221807 | |||
| 3071 | Ga0501036_0354262 | |||
| 3072 | Ga0501036_0807349 | |||
| 3073 | Ga0501037_0001300 | |||
| 3074 | Ga0501037_0103023 | |||
| 3075 | Ga0501037_0153572 | |||
| 3076 | Ga0501037_0170990 | |||
| 3077 | Ga0501037_0322920 | |||
| 3078 | Ga0501037_0485949 | |||
| 3079 | Ga0501037_0651938 | |||
| 3080 | Ga0501038_0008023 | |||
| 3081 | Ga0501038_0033953 | |||
| 3082 | Ga0501038_0364928 | |||
| 3083 | Ga0501038_0377437 | |||
| 3084 | Ga0501038_0661769 | |||
| 3085 | Ga0501038_1027355 | |||
| 3086 | Ga0501039_0009363 | |||
| 3087 | Ga0501039_0033279 | |||
| 3088 | Ga0501039_0108130 | |||
| 3089 | Ga0501039_0111301 | |||
| 3090 | Ga0501039_0144763 | |||
| 3091 | Ga0501039_1116322 | |||
| 3092 | Ga0501039_1561525 | |||
| 3093 | Ga0501040_0035524 | |||
| 3094 | Ga0501040_0100818 | |||
| 3095 | Ga0501041_0797888 | |||
| 3096 | Ga0501042_0025128 | |||
| 3097 | Ga0501042_0221535 | |||
| 3098 | Ga0501043_0001641 | |||
| 3099 | Ga0501043_0005218 | |||
| 3100 | Ga0501043_0012916 | |||
| 3101 | Ga0501043_0104925 | |||
| 3102 | Ga0501043_0133837 | |||
| 3103 | Ga0501043_0357269 | |||
| 3104 | Ga0501043_0587268 | |||
| 3105 | Ga0501043_0684301 | |||
| 3106 | Ga0501046_0009415 | |||
| 3107 | Ga0501046_0037617 | |||
| 3108 | Ga0501046_0053750 | |||
| 3109 | Ga0501046_0088513 | |||
| 3110 | Ga0501046_0151662 | |||
| 3111 | Ga0501046_0187324 | |||
| 3112 | Ga0501046_0237737 | |||
| 3113 | Ga0501046_0254713 | |||
| 3114 | Ga0501046_0414233 | |||
| 3115 | Ga0501046_0901862 | |||
| 3116 | Ga0501046_1257857 | |||
| 3117 | Ga0501047_0002573 | |||
| 3118 | Ga0501047_0009259 | |||
| 3119 | Ga0501047_0018810 | |||
| 3120 | Ga0501047_0029549 | |||
| 3121 | Ga0501047_0073773 | |||
| 3122 | Ga0501047_0092889 | |||
| 3123 | Ga0501047_0328782 | |||
| 3124 | Ga0501047_0401208 | |||
| 3125 | Ga0501047_0433185 | |||
| 3126 | Ga0501047_0531502 | |||
| 3127 | Ga0501047_0662514 | |||
| 3128 | Ga0501047_0858780 | |||
| 3129 | Ga0501047_1367132 | |||
| 3130 | Ga0501048_0026442 | |||
| 3131 | Ga0501048_0076244 | |||
| 3132 | Ga0501048_0274276 | |||
| 3133 | Ga0501048_0315708 | |||
| 3134 | Ga0501048_0586179 | |||
| 3135 | Ga0501067_0006199 | |||
| 3136 | Ga0501067_0014755 | |||
| 3137 | Ga0501068_0131777 | |||
| 3138 | Ga0501068_0143933 | |||
| 3139 | Ga0501069_0006685 | |||
| 3140 | Ga0501069_0066085 | |||
| 3141 | Ga0501069_0348860 | |||
| 3142 | Ga0501070_0002131 | |||
| 3143 | Ga0501070_0010864 | |||
| 3144 | Ga0501070_0013751 | |||
| 3145 | Ga0501070_0033092 | |||
| 3146 | Ga0501070_0087275 | |||
| 3147 | Ga0501070_0123868 | |||
| 3148 | Ga0501070_0224590 | |||
| 3149 | Ga0501071_0028649 | |||
| 3150 | Ga0501071_0031884 | |||
| 3151 | Ga0501071_0118792 | |||
| 3152 | Ga0501071_0820344 | |||
| 3153 | Ga0501072_0003391 | |||
| 3154 | Ga0501072_0027150 | |||
| 3155 | Ga0501073_0001213 | |||
| 3156 | Ga0501073_0002194 | |||
| 3157 | Ga0501073_0008870 | |||
| 3158 | Ga0501073_0347496 | |||
| 3159 | Ga0501073_0386775 | |||
| 3160 | Ga0501073_0547597 | |||
| 3161 | Ga0501073_0787524 | |||
| 3162 | Ga0501073_0814274 | |||
| 3163 | Ga0501074_0031338 | |||
| 3164 | Ga0501074_0033188 | |||
| 3165 | Ga0501074_0087103 | |||
| 3166 | Ga0501074_0096715 | |||
| 3167 | Ga0501074_0119475 | |||
| 3168 | Ga0501074_0190732 | |||
| 3169 | Ga0501074_0282753 | |||
| 3170 | Ga0501074_0699488 | |||
| 3171 | Ga0501075_0003076 | |||
| 3172 | Ga0501075_0104738 | |||
| 3173 | Ga0501076_0001078 | |||
| 3174 | Ga0501076_0420680 | |||
| 3175 | Ga0501077_0026740 | |||
| 3176 | Ga0501206_021096 | |||
| 3177 | Ga0501216_158951 | |||
| 3178 | Ga0501217_096638 | |||
| 3179 | Ga0501223_031766 | |||
| 3180 | Ga0501224_040125 | |||
| 3181 | Ga0501247_053981 | |||
| 3182 | Ga0501249_019448 | |||
| 3183 | Ga0501250_004457 | |||
| 3184 | Ga0501252_006724 | |||
| 3185 | Ga0501252_086169 | |||
| 3186 | Ga0501253_112865 | |||
| 3187 | Ga0501258_040070 | |||
| 3188 | Ga0501259_104530 | |||
| 3189 | Ga0501225_0006481 | |||
| 3190 | Ga0501225_0083207 | |||
| 3191 | Ga0501079_0097356 | |||
| 3192 | Ga0501079_0125221 | |||
| 3193 | Ga0501079_0224507 | |||
| 3194 | Ga0501079_0241097 | |||
| 3195 | Ga0501079_0411511 | |||
| 3196 | Ga0501079_0547118 | |||
| 3197 | Ga0501079_0999878 | |||
| 3198 | Ga0501080_0000791 | |||
| 3199 | Ga0501080_0001319 | |||
| 3200 | Ga0501080_0006958 | |||
| 3201 | Ga0501080_0009707 | |||
| 3202 | Ga0501080_0018776 | |||
| 3203 | Ga0501080_0085197 | |||
| 3204 | Ga0501080_0140553 | |||
| 3205 | Ga0501080_0145790 | |||
| 3206 | Ga0501080_0208236 | |||
| 3207 | Ga0501080_0486833 | |||
| 3208 | Ga0501080_0632213 | |||
| 3209 | Ga0501080_0849750 | |||
| 3210 | Ga0501081_0008596 | |||
| 3211 | Ga0501083_0001078 | |||
| 3212 | Ga0501083_0181210 | |||
| 3213 | Ga0501263_039215 | |||
| 3214 | Ga0501264_033208 | |||
| 3215 | Ga0501266_003367 | |||
| 3216 | Ga0501266_022659 | |||
| 3217 | Ga0501268_092644 | |||
| 3218 | Ga0501268_178276 | |||
| 3219 | Ga0501270_162154 | |||
| 3220 | Ga0501271_032041 | |||
| 3221 | Ga0501272_022957 | |||
| 3222 | Ga0501275_085427 | |||
| 3223 | Ga0501279_035089 | |||
| 3224 | Ga0501035_0013600 | |||
| 3225 | Ga0501035_0027477 | |||
| 3226 | Ga0501035_0041694 | |||
| 3227 | Ga0501035_0098449 | |||
| 3228 | Ga0501035_0252247 | |||
| 3229 | Ga0501035_0275414 | |||
| 3230 | Ga0501035_0317572 | |||
| 3231 | Ga0501035_0545206 | |||
| 3232 | Ga0501035_0744110 | |||
| 3233 | Ga0501044_0016694 | |||
| 3234 | Ga0501044_0033968 | |||
| 3235 | Ga0501044_0061827 | |||
| 3236 | Ga0501044_0110003 | |||
| 3237 | Ga0501044_0117045 | |||
| 3238 | Ga0501044_0119037 | |||
| 3239 | Ga0501044_0403816 | |||
| 3240 | Ga0501044_0546658 | |||
| 3241 | Ga0501044_0575223 | |||
| 3242 | Ga0501044_0702328 | |||
| 3243 | Ga0501044_1369044 | |||
| 3244 | Ga0501044_1614495 | |||
| 3245 | Ga0501045_0040200 | |||
| 3246 | Ga0501045_0287400 | |||
| 3247 | Ga0501045_0635430 | |||
| 3248 | Ga0501045_0766648 | |||
| 3249 | nmdc:mga00v17_54986_c1 | |||
| 3250 | nmdc:mga00v17_69221_c1 | |||
| 3251 | nmdc:mga06z11_578199_c1 | |||
| 3252 | nmdc:mga07m45_410003_c1 | |||
| 3253 | nmdc:mga07m45_842111_c1 | |||
| 3254 | nmdc:mga06r32_1434109_c1 | |||
| 3255 | nmdc:mga08x19_286436_c1 | |||
| 3256 | Ga0495612_0353400 | |||
| 3257 | Ga0500610_0004715 | |||
| 3258 | Ga0500643_000075 | |||
| 3259 | Ga0500643_003396 | |||
| 3260 | Ga0500583_0527191 | |||
| 3261 | Ga0500583_0562674 | |||
| 3262 | Ga0500651_0003714 | |||
| 3263 | Ga0500566_0093620 | |||
| 3264 | Ga0500555_000207 | |||
| 3265 | Ga0500556_0383168 | |||
| 3266 | Ga0500597_002583 | |||
| 3267 | Ga0500614_017765 | |||
| 3268 | Ga0500568_0001907 | |||
| 3269 | Ga0500620_083778 | |||
| 3270 | Ga0500645_001593 | |||
| 3271 | Ga0501084_0176857 | |||
| 3272 | Ga0501084_0192523 | |||
| 3273 | Ga0501084_0246743 | |||
| 3274 | Ga0501084_0339736 | |||
| 3275 | Ga0501084_0903412 | |||
| 3276 | Ga0587083_0264676 | |||
| 3277 | Ga0501082_0001359 | |||
| 3278 | Ga0501082_0005033 | |||
| 3279 | Ga0501082_0086117 | |||
| 3280 | Ga0501082_0211950 | |||
| 3281 | Ga0466962_0005761 | |||
| 3282 | Ga0466962_0005882 | |||
| 3283 | Ga0466962_0008347 | |||
| 3284 | Ga0466962_0335946 | |||
| 3285 | Ga0530510_0006308 | |||
| 3286 | Ga0530510_0123358 | |||
| 3287 | 2572253579 | |||
| 3288 | 2643815249 | |||
| 3289 | 2643879288 | |||
| 3290 | 2643939927 | |||
| 3291 | 2643976213 | |||
| 3292 | 2644076985 | |||
| 3293 | 2644528914 | |||
| 3294 | 2644660587 | |||
| 3295 | 2644695299 | |||
| 3296 | 2644697948 | |||
| 3297 | 2919516104 | |||
| 3298 | 2919677936 | |||
| 3299 | 2941491121 | |||
| 3300 | 2995952052 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zmh-assembly1.cif.gz_L | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm | 0.8737 | 10 | 90 |
| 7a24-assembly1.cif.gz_K | assembly intermediate of the plant mitochondrial complex i | 0.859 | 4 | 86 |
| 6x89-assembly1.cif.gz_4L | vigna radiata mitochondrial complex i* | 0.8571 | 4 | 86 |
| 6h8k-assembly1.cif.gz_L | crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i | 0.8538 | 10 | 82 |
| 7ar7-assembly1.cif.gz_K | cryo-em structure of arabidopsis thaliana complex-i (open conformation) | 0.8414 | 4 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P34651_608_792_1.20.120.1900 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain | 0.8632 | 35 | 80 | 1.20.120.1900 |
| 5lnkK00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8173 | 11 | 87 | 1.10.287.3510 |
| 2xm0A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.8157 | 34 | 73 | 1.20.120.10 |
| af_A0A3B6U9Q8_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8003 | 7 | 100 | 1.10.287.3510 |
| 5xtdk00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8002 | 8 | 84 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2YBK6-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.935 | 1 | 88 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A367IZW3-F1-model_v4 | NADH dehydrogenase subunit 4 | 0.9307 | 4 | 91 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A368F7W0-F1-model_v4 | NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) | 0.9144 | 9 | 95 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 |
| AF-A0A529HMQ9-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) | 0.9125 | 1 | 67 |
GO:0016651
GO:0030964 GO:0042773 |
| AF-J3M8V7-F1-model_v4 | NADH dehydrogenase subunit 4L | 0.9098 | 4 | 84 |
GO:0016651
GO:0030964 GO:0042773 |