F495221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1654 | 593 | 3308 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_42252_c1|nmdc:mga03n38_42252_c1_103_1023 |
| Length | 306 |
| Sequence | MLFVLQNGFLEKEVPQFVRQLIDERRLLRKRTLSLFPGGAGKSEAEAEQLPGTMGRQRLVAVLELTNISKHFGAIQAVNDVSLSIEPGQVVGLMGDNGAGKSTLVKMIAGNFHPSHGTMQMDGKELILNKPVEARQHGIEIVHQDLALCNNLTAAANVYLGRELRRGVGPFRILDYAAMYKRAGQIFAELKSETRPRDLVKQMSGGQRQAVAIARTMLSQAKIVLMDEPTAAISVRQVAEVLNLIRHLRDQGIAVVLISHRMPDVFDVADRVIVMRRGRKVADKTIASSSPEEVTGLITGAIEQVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 136 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 156 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 159 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 160 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 161 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 162 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 165 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 257 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 258 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 259 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 260 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 266 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 267 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 268 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 269 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 274 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 276 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 283 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 284 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 285 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 286 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 287 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 288 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 289 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 303 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 305 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 307 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 308 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 309 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 312 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 313 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 314 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 315 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 316 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 317 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 318 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 319 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 320 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 321 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 322 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 323 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 324 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 325 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 326 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 327 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 329 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 330 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 331 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 332 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 333 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 334 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 335 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 336 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 337 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 338 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 339 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 340 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 343 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 344 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 345 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 428 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 429 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 430 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 431 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 432 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 435 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 436 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 437 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 438 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 439 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 440 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 441 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 442 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 443 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 444 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 445 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 446 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 447 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 448 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 449 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 450 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 452 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 479 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 487 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 488 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 489 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 490 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 491 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 501 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 504 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 508 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 511 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 512 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 513 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 514 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 517 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 519 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 520 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 522 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 523 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 524 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 525 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 526 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 527 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 530 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 531 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 532 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 533 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 534 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 536 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 537 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 538 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 539 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 541 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 542 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 543 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 544 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 545 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 547 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 550 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 551 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 552 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 554 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 555 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 557 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 558 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 559 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 560 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 561 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 562 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 563 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 564 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 565 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 566 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 567 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 568 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 569 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 570 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 571 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 572 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 573 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 574 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 575 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 576 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 577 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 578 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 579 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 580 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 581 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 582 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 583 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 584 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 585 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 586 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 587 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 588 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 589 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 590 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 591 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 592 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 593 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.76 |
| Metatranscriptomes | 0 |
| Isolates | 2.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.6 |
| Nodule | 2 |
| Rhizoplane | 2.54 |
| Rhizosphere | 72.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga03n38_42252_c1 | 3300050490 | Bacteria | 1992 |
| 2 | JGI24740J21852_10040824 | 3300001979 | Bacteria | 1403 |
| 3 | JGI25158J39367_1000548 | 3300002739 | Bacteria | 7548 |
| 4 | JGI25157J39369_1001276 | 3300002741 | Bacteria | 10204 |
| 5 | JGI25152J39213_1005130 | 3300002773 | Bacteria | 3929 |
| 6 | JGI25152J39213_1006776 | 3300002773 | Bacteria | 3047 |
| 7 | JGI25150J39212_1007959 | 3300002774 | Bacteria | 2100 |
| 8 | JGI25159J45721_1000012 | 3300002987 | Bacteria | 149808 |
| 9 | JGI25159J45721_1001972 | 3300002987 | Bacteria | 8179 |
| 10 | JGI25151J46595_10005842 | 3300003187 | Bacteria | 6295 |
| 11 | JGI25406J46586_10005327 | 3300003203 | Bacteria | 5968 |
| 12 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 13 | JGI25165J46597_1002828 | 3300003214 | Bacteria | 4982 |
| 14 | JGI25153J46596_10000033 | 3300003215 | Bacteria | 194912 |
| 15 | JGI25153J46596_10000047 | 3300003215 | Bacteria | 146400 |
| 16 | JGI25153J46596_10024486 | 3300003215 | Bacteria | 2176 |
| 17 | rootH2_10079132 | 3300003320 | Bacteria | 7066 |
| 18 | JGI25160J50197_1000042 | 3300003354 | Bacteria | 149808 |
| 19 | JGI25160J50197_1000068 | 3300003354 | Bacteria | 112790 |
| 20 | JGI25160J50197_1006678 | 3300003354 | Bacteria | 4637 |
| 21 | JGI25161J50226_1000048 | 3300003374 | Bacteria | 112790 |
| 22 | JGI25161J50226_1000254 | 3300003374 | Bacteria | 31906 |
| 23 | JGI25161J50226_1002172 | 3300003374 | Bacteria | 5231 |
| 24 | Ga0055542_1000406 | 3300003762 | Bacteria | 42163 |
| 25 | Ga0055526_1003068 | 3300003771 | Bacteria | 10857 |
| 26 | Ga0055526_1003780 | 3300003771 | Bacteria | 9437 |
| 27 | Ga0055526_1005774 | 3300003771 | Bacteria | 6976 |
| 28 | Ga0055524_1022164 | 3300003775 | Bacteria | 2084 |
| 29 | Ga0055536_1007787 | 3300003781 | Bacteria | 4729 |
| 30 | Ga0055536_1009742 | 3300003781 | Bacteria | 3925 |
| 31 | Ga0055534_1002995 | 3300003784 | Bacteria | 5557 |
| 32 | Ga0055528_1000081 | 3300003790 | Bacteria | 75261 |
| 33 | Ga0055528_1002961 | 3300003790 | Bacteria | 8807 |
| 34 | Ga0055528_1010205 | 3300003790 | Bacteria | 3843 |
| 35 | Ga0055530_10023412 | 3300003791 | Bacteria | 1775 |
| 36 | Ga0055540_1005863 | 3300003792 | Bacteria | 5031 |
| 37 | Ga0055540_1007063 | 3300003792 | Bacteria | 4318 |
| 38 | Ga0055531_10000775 | 3300003794 | Bacteria | 26585 |
| 39 | Ga0055531_10020004 | 3300003794 | Bacteria | 2671 |
| 40 | Ga0055543_1000031 | 3300004625 | Bacteria | 130583 |
| 41 | Ga0055543_1000046 | 3300004625 | Bacteria | 113628 |
| 42 | Ga0055543_1000452 | 3300004625 | Bacteria | 24678 |
| 43 | Ga0065165_1000174 | 3300005262 | Bacteria | 113769 |
| 44 | Ga0065165_1000175 | 3300005262 | Bacteria | 113628 |
| 45 | Ga0065165_1016574 | 3300005262 | Bacteria | 2751 |
| 46 | Ga0065704_10243647 | 3300005289 | Bacteria | 993 |
| 47 | Ga0065712_10084375 | 3300005290 | Bacteria | 2768 |
| 48 | Ga0065715_10005719 | 3300005293 | Bacteria | 4176 |
| 49 | Ga0070658_10072794 | 3300005327 | Bacteria | 2817 |
| 50 | Ga0070658_10121171 | 3300005327 | Bacteria | 2173 |
| 51 | Ga0070676_10001690 | 3300005328 | Bacteria | 11215 |
| 52 | Ga0070676_10032420 | 3300005328 | Bacteria | 2993 |
| 53 | Ga0070690_100000104 | 3300005330 | Bacteria | 43588 |
| 54 | Ga0070690_100006691 | 3300005330 | Bacteria | 6547 |
| 55 | Ga0070690_100093173 | 3300005330 | Bacteria | 1987 |
| 56 | Ga0070690_100115124 | 3300005330 | Bacteria | 1799 |
| 57 | Ga0070670_100234182 | 3300005331 | Bacteria | 1598 |
| 58 | Ga0070677_10006920 | 3300005333 | Bacteria | 3768 |
| 59 | Ga0070677_10087821 | 3300005333 | Bacteria | 1346 |
| 60 | Ga0068869_100006830 | 3300005334 | Bacteria | 7259 |
| 61 | Ga0068869_100010468 | 3300005334 | Bacteria | 6049 |
| 62 | Ga0068869_100013291 | 3300005334 | Bacteria | 5471 |
| 63 | Ga0068869_100037678 | 3300005334 | Bacteria | 3439 |
| 64 | Ga0068869_100045381 | 3300005334 | Bacteria | 3164 |
| 65 | Ga0068869_100195193 | 3300005334 | Bacteria | 1594 |
| 66 | Ga0070666_10003654 | 3300005335 | Bacteria | 9323 |
| 67 | Ga0070666_10266559 | 3300005335 | Bacteria | 1215 |
| 68 | Ga0070666_10374691 | 3300005335 | Bacteria | 1021 |
| 69 | Ga0070680_100106467 | 3300005336 | Bacteria | 2332 |
| 70 | Ga0070680_100140641 | 3300005336 | Bacteria | 2024 |
| 71 | Ga0068868_100001028 | 3300005338 | Bacteria | 19079 |
| 72 | Ga0068868_100002870 | 3300005338 | Bacteria | 11952 |
| 73 | Ga0068868_100020673 | 3300005338 | Bacteria | 4951 |
| 74 | Ga0068868_100028159 | 3300005338 | Bacteria | 4293 |
| 75 | Ga0068868_100101056 | 3300005338 | Bacteria | 2334 |
| 76 | Ga0070660_100021992 | 3300005339 | Bacteria | 4711 |
| 77 | Ga0070660_100027337 | 3300005339 | Bacteria | 4256 |
| 78 | Ga0070660_100160073 | 3300005339 | Bacteria | 1814 |
| 79 | Ga0070689_100002051 | 3300005340 | Bacteria | 13079 |
| 80 | Ga0070689_100039569 | 3300005340 | Bacteria | 3611 |
| 81 | Ga0070689_100262363 | 3300005340 | Bacteria | 1428 |
| 82 | Ga0070691_10032040 | 3300005341 | Bacteria | 2468 |
| 83 | Ga0070687_100375729 | 3300005343 | Bacteria | 925 |
| 84 | Ga0070661_100003782 | 3300005344 | Bacteria | 10428 |
| 85 | Ga0070661_100135355 | 3300005344 | Bacteria | 1854 |
| 86 | Ga0070668_100004957 | 3300005347 | Bacteria | 9855 |
| 87 | Ga0070668_100021056 | 3300005347 | Bacteria | 4928 |
| 88 | Ga0070668_100060860 | 3300005347 | Bacteria | 2925 |
| 89 | Ga0070668_100423111 | 3300005347 | Bacteria | 1141 |
| 90 | Ga0070669_100007652 | 3300005353 | Bacteria | 7722 |
| 91 | Ga0070669_100047893 | 3300005353 | Bacteria | 3119 |
| 92 | Ga0070669_100058280 | 3300005353 | Bacteria | 2834 |
| 93 | Ga0070669_100107389 | 3300005353 | Bacteria | 2114 |
| 94 | Ga0070669_100124903 | 3300005353 | Bacteria | 1968 |
| 95 | Ga0070669_100232146 | 3300005353 | Bacteria | 1463 |
| 96 | Ga0070675_100002408 | 3300005354 | Bacteria | 13959 |
| 97 | Ga0070675_100011906 | 3300005354 | Bacteria | 6816 |
| 98 | Ga0070675_100174674 | 3300005354 | Bacteria | 1854 |
| 99 | Ga0070671_100009046 | 3300005355 | Bacteria | 7993 |
| 100 | Ga0070671_100012205 | 3300005355 | Bacteria | 6913 |
| 101 | Ga0070671_100022921 | 3300005355 | Bacteria | 5103 |
| 102 | Ga0070671_100050547 | 3300005355 | Bacteria | 3457 |
| 103 | Ga0070671_100420339 | 3300005355 | Bacteria | 1145 |
| 104 | Ga0070674_100014204 | 3300005356 | Bacteria | 4945 |
| 105 | Ga0070674_100017014 | 3300005356 | Bacteria | 4564 |
| 106 | Ga0070674_100018973 | 3300005356 | Bacteria | 4361 |
| 107 | Ga0070674_100060883 | 3300005356 | Bacteria | 2633 |
| 108 | Ga0070674_100283065 | 3300005356 | Bacteria | 1315 |
| 109 | Ga0070674_100326663 | 3300005356 | Bacteria | 1231 |
| 110 | Ga0070674_100353166 | 3300005356 | Bacteria | 1188 |
| 111 | Ga0070674_100422101 | 3300005356 | Bacteria | 1094 |
| 112 | Ga0070673_100008458 | 3300005364 | Bacteria | 6843 |
| 113 | Ga0070673_100028973 | 3300005364 | Bacteria | 4124 |
| 114 | Ga0070673_100338482 | 3300005364 | Bacteria | 1333 |
| 115 | Ga0070688_100160781 | 3300005365 | Bacteria | 1543 |
| 116 | Ga0070688_100422618 | 3300005365 | Bacteria | 991 |
| 117 | Ga0070659_100040241 | 3300005366 | Bacteria | 3652 |
| 118 | Ga0070659_100056900 | 3300005366 | Bacteria | 3083 |
| 119 | Ga0070659_100181776 | 3300005366 | Bacteria | 1726 |
| 120 | Ga0070659_100573082 | 3300005366 | Bacteria | 968 |
| 121 | Ga0070667_100010392 | 3300005367 | Bacteria | 7684 |
| 122 | Ga0070667_100040888 | 3300005367 | Bacteria | 3888 |
| 123 | Ga0070667_100136027 | 3300005367 | Bacteria | 2149 |
| 124 | Ga0070667_100429243 | 3300005367 | Bacteria | 1205 |
| 125 | Ga0070709_10012841 | 3300005434 | Bacteria | 4696 |
| 126 | Ga0070714_100005358 | 3300005435 | Bacteria | 9786 |
| 127 | Ga0070713_100100618 | 3300005436 | Bacteria | 2503 |
| 128 | Ga0070713_100399502 | 3300005436 | Bacteria | 1283 |
| 129 | Ga0070710_10001811 | 3300005437 | Bacteria | 10101 |
| 130 | Ga0070701_10000723 | 3300005438 | Bacteria | 11685 |
| 131 | Ga0070711_100000775 | 3300005439 | Bacteria | 16660 |
| 132 | Ga0070711_100215371 | 3300005439 | Bacteria | 1490 |
| 133 | Ga0070700_100043222 | 3300005441 | Bacteria | 2771 |
| 134 | Ga0070700_100453120 | 3300005441 | Bacteria | 977 |
| 135 | Ga0070694_100049626 | 3300005444 | Bacteria | 2827 |
| 136 | Ga0070663_100256134 | 3300005455 | Bacteria | 1387 |
| 137 | Ga0070663_100299082 | 3300005455 | Bacteria | 1287 |
| 138 | Ga0070663_100416249 | 3300005455 | Bacteria | 1101 |
| 139 | Ga0070678_100003442 | 3300005456 | Bacteria | 8830 |
| 140 | Ga0070678_100030637 | 3300005456 | Bacteria | 3701 |
| 141 | Ga0070678_100032986 | 3300005456 | Bacteria | 3590 |
| 142 | Ga0070678_100036530 | 3300005456 | Bacteria | 3440 |
| 143 | Ga0070678_100124938 | 3300005456 | Bacteria | 2035 |
| 144 | Ga0070662_100072730 | 3300005457 | Bacteria | 2539 |
| 145 | Ga0070662_100124422 | 3300005457 | Bacteria | 1980 |
| 146 | Ga0070662_100128016 | 3300005457 | Bacteria | 1954 |
| 147 | Ga0070681_10673650 | 3300005458 | Bacteria | 949 |
| 148 | Ga0068867_100000091 | 3300005459 | Bacteria | 57689 |
| 149 | Ga0068867_100010378 | 3300005459 | Bacteria | 6572 |
| 150 | Ga0068867_100035822 | 3300005459 | Bacteria | 3600 |
| 151 | Ga0068867_100039441 | 3300005459 | Bacteria | 3443 |
| 152 | Ga0068867_100040970 | 3300005459 | Bacteria | 3384 |
| 153 | Ga0068867_100056274 | 3300005459 | Bacteria | 2909 |
| 154 | Ga0068867_100104180 | 3300005459 | Bacteria | 2171 |
| 155 | Ga0068867_100213062 | 3300005459 | Bacteria | 1552 |
| 156 | Ga0070685_10147600 | 3300005466 | Bacteria | 1487 |
| 157 | Ga0070685_10356336 | 3300005466 | Bacteria | 1002 |
| 158 | Ga0070706_100154516 | 3300005467 | Bacteria | 2142 |
| 159 | Ga0070706_100239790 | 3300005467 | Bacteria | 1693 |
| 160 | Ga0070707_100251578 | 3300005468 | Bacteria | 1720 |
| 161 | Ga0070679_100515053 | 3300005530 | Bacteria | 1140 |
| 162 | Ga0070684_100214762 | 3300005535 | Bacteria | 1754 |
| 163 | Ga0068853_100000533 | 3300005539 | Bacteria | 25847 |
| 164 | Ga0068853_100008721 | 3300005539 | Bacteria | 8155 |
| 165 | Ga0068853_100062492 | 3300005539 | Bacteria | 3223 |
| 166 | Ga0068853_100392547 | 3300005539 | Bacteria | 1297 |
| 167 | Ga0070672_100004518 | 3300005543 | Bacteria | 9106 |
| 168 | Ga0070672_100006066 | 3300005543 | Bacteria | 8076 |
| 169 | Ga0070672_100091402 | 3300005543 | Bacteria | 2455 |
| 170 | Ga0070672_100133529 | 3300005543 | Bacteria | 2042 |
| 171 | Ga0070672_100194448 | 3300005543 | Bacteria | 1695 |
| 172 | Ga0070686_100001185 | 3300005544 | Bacteria | 14822 |
| 173 | Ga0070695_100012848 | 3300005545 | Bacteria | 5027 |
| 174 | Ga0070695_100567310 | 3300005545 | Bacteria | 887 |
| 175 | Ga0070696_100003912 | 3300005546 | Bacteria | 9951 |
| 176 | Ga0070665_100011966 | 3300005548 | Bacteria | 8759 |
| 177 | Ga0070665_100021983 | 3300005548 | Bacteria | 6416 |
| 178 | Ga0070665_100026315 | 3300005548 | Bacteria | 5859 |
| 179 | Ga0070665_100228629 | 3300005548 | Bacteria | 1860 |
| 180 | Ga0070665_100284493 | 3300005548 | Bacteria | 1655 |
| 181 | Ga0070665_100408231 | 3300005548 | Bacteria | 1366 |
| 182 | Ga0070665_100834977 | 3300005548 | Bacteria | 934 |
| 183 | Ga0070704_100130432 | 3300005549 | Bacteria | 1947 |
| 184 | Ga0068855_100059452 | 3300005563 | Bacteria | 4472 |
| 185 | Ga0068855_100138782 | 3300005563 | Bacteria | 2773 |
| 186 | Ga0070664_100035788 | 3300005564 | Bacteria | 4169 |
| 187 | Ga0068857_100007296 | 3300005577 | Bacteria | 9520 |
| 188 | Ga0068857_100049797 | 3300005577 | Bacteria | 3717 |
| 189 | Ga0068854_100006614 | 3300005578 | Bacteria | 7384 |
| 190 | Ga0068854_100111128 | 3300005578 | Bacteria | 2067 |
| 191 | Ga0068854_100367257 | 3300005578 | Bacteria | 1182 |
| 192 | Ga0068854_100448352 | 3300005578 | Bacteria | 1077 |
| 193 | Ga0068856_100030869 | 3300005614 | Bacteria | 5240 |
| 194 | Ga0068856_100105689 | 3300005614 | Bacteria | 2809 |
| 195 | Ga0068856_100170805 | 3300005614 | Bacteria | 2186 |
| 196 | Ga0068856_100209837 | 3300005614 | Bacteria | 1963 |
| 197 | Ga0068856_100252995 | 3300005614 | Bacteria | 1777 |
| 198 | Ga0068856_100320316 | 3300005614 | Bacteria | 1568 |
| 199 | Ga0068856_100528222 | 3300005614 | Bacteria | 1201 |
| 200 | Ga0070702_100000465 | 3300005615 | Bacteria | 14450 |
| 201 | Ga0070702_100181716 | 3300005615 | Bacteria | 1377 |
| 202 | Ga0070702_100187663 | 3300005615 | Bacteria | 1358 |
| 203 | Ga0068852_100004682 | 3300005616 | Bacteria | 9691 |
| 204 | Ga0068852_100018895 | 3300005616 | Bacteria | 5442 |
| 205 | Ga0068852_100038314 | 3300005616 | Bacteria | 4028 |
| 206 | Ga0068852_100518076 | 3300005616 | Bacteria | 1189 |
| 207 | Ga0068852_100523866 | 3300005616 | Bacteria | 1183 |
| 208 | Ga0068852_100898063 | 3300005616 | Bacteria | 903 |
| 209 | Ga0068859_100004139 | 3300005617 | Bacteria | 14808 |
| 210 | Ga0068859_100024768 | 3300005617 | Bacteria | 6022 |
| 211 | Ga0068859_100066366 | 3300005617 | Bacteria | 3643 |
| 212 | Ga0068859_100258096 | 3300005617 | Bacteria | 1834 |
| 213 | Ga0068859_100281564 | 3300005617 | Bacteria | 1756 |
| 214 | Ga0068859_100407028 | 3300005617 | Bacteria | 1456 |
| 215 | Ga0068864_100017958 | 3300005618 | Bacteria | 5902 |
| 216 | Ga0068864_100124212 | 3300005618 | Bacteria | 2311 |
| 217 | Ga0068864_100180333 | 3300005618 | Bacteria | 1930 |
| 218 | Ga0068864_100270219 | 3300005618 | Bacteria | 1584 |
| 219 | Ga0068864_100350494 | 3300005618 | Bacteria | 1393 |
| 220 | Ga0068866_10002429 | 3300005718 | Bacteria | 7686 |
| 221 | Ga0068866_10042055 | 3300005718 | Bacteria | 2272 |
| 222 | Ga0068866_10052992 | 3300005718 | Bacteria | 2072 |
| 223 | Ga0068866_10105319 | 3300005718 | Bacteria | 1563 |
| 224 | Ga0068861_100002134 | 3300005719 | Bacteria | 12795 |
| 225 | Ga0068861_100004235 | 3300005719 | Bacteria | 9622 |
| 226 | Ga0068861_100015953 | 3300005719 | Bacteria | 5303 |
| 227 | Ga0068861_100067724 | 3300005719 | Bacteria | 2756 |
| 228 | Ga0068861_100077139 | 3300005719 | Bacteria | 2598 |
| 229 | Ga0068861_100188954 | 3300005719 | Bacteria | 1720 |
| 230 | Ga0068861_100413072 | 3300005719 | Bacteria | 1201 |
| 231 | Ga0068851_10158537 | 3300005834 | Bacteria | 1241 |
| 232 | Ga0068870_10121037 | 3300005840 | Bacteria | 1508 |
| 233 | Ga0068870_10170422 | 3300005840 | Bacteria | 1299 |
| 234 | Ga0068863_100057708 | 3300005841 | Bacteria | 3674 |
| 235 | Ga0068863_100156268 | 3300005841 | Bacteria | 2184 |
| 236 | Ga0068863_100192197 | 3300005841 | Bacteria | 1962 |
| 237 | Ga0068863_100218540 | 3300005841 | Bacteria | 1836 |
| 238 | Ga0068858_100000679 | 3300005842 | Bacteria | 35449 |
| 239 | Ga0068858_100000774 | 3300005842 | Bacteria | 33365 |
| 240 | Ga0068858_100039707 | 3300005842 | Bacteria | 4363 |
| 241 | Ga0068858_100062433 | 3300005842 | Bacteria | 3444 |
| 242 | Ga0068858_100113932 | 3300005842 | Bacteria | 2526 |
| 243 | Ga0068858_100208795 | 3300005842 | Bacteria | 1848 |
| 244 | Ga0068858_100257248 | 3300005842 | Bacteria | 1659 |
| 245 | Ga0068858_100294160 | 3300005842 | Bacteria | 1548 |
| 246 | Ga0068860_100005264 | 3300005843 | Bacteria | 13132 |
| 247 | Ga0068860_100021326 | 3300005843 | Bacteria | 6272 |
| 248 | Ga0068860_100114065 | 3300005843 | Bacteria | 2584 |
| 249 | Ga0068860_100398874 | 3300005843 | Bacteria | 1360 |
| 250 | Ga0068860_100473424 | 3300005843 | Bacteria | 1248 |
| 251 | Ga0068862_100004858 | 3300005844 | Bacteria | 11313 |
| 252 | Ga0068862_100037860 | 3300005844 | Bacteria | 4090 |
| 253 | Ga0068862_100039976 | 3300005844 | Bacteria | 3985 |
| 254 | Ga0068862_100053778 | 3300005844 | Bacteria | 3447 |
| 255 | Ga0068862_100155416 | 3300005844 | Bacteria | 2039 |
| 256 | Ga0068862_100204281 | 3300005844 | Bacteria | 1783 |
| 257 | Ga0068862_100470055 | 3300005844 | Bacteria | 1188 |
| 258 | Ga0068862_100644166 | 3300005844 | Bacteria | 1021 |
| 259 | Ga0081455_10033573 | 3300005937 | Bacteria | 4609 |
| 260 | Ga0081538_10037477 | 3300005981 | Bacteria | 3145 |
| 261 | Ga0081540_1007796 | 3300005983 | Bacteria | 7577 |
| 262 | Ga0081540_1018556 | 3300005983 | Bacteria | 4261 |
| 263 | Ga0081540_1028680 | 3300005983 | Bacteria | 3119 |
| 264 | Ga0081540_1034711 | 3300005983 | Bacteria | 2714 |
| 265 | Ga0081539_10001065 | 3300005985 | Bacteria | 50187 |
| 266 | Ga0081539_10002462 | 3300005985 | Bacteria | 26092 |
| 267 | Ga0070717_10049598 | 3300006028 | Bacteria | 3446 |
| 268 | Ga0070717_10060157 | 3300006028 | Bacteria | 3145 |
| 269 | Ga0070717_10174840 | 3300006028 | Bacteria | 1869 |
| 270 | Ga0070717_10521222 | 3300006028 | Bacteria | 1075 |
| 271 | Ga0075365_10001077 | 3300006038 | Bacteria | 11841 |
| 272 | Ga0075365_10005631 | 3300006038 | Bacteria | 6781 |
| 273 | Ga0075365_10015495 | 3300006038 | Bacteria | 4614 |
| 274 | Ga0075365_10028179 | 3300006038 | Bacteria | 3580 |
| 275 | Ga0075365_10033264 | 3300006038 | Bacteria | 3321 |
| 276 | Ga0075365_10051810 | 3300006038 | Bacteria | 2712 |
| 277 | Ga0075365_10057918 | 3300006038 | Bacteria | 2578 |
| 278 | Ga0075365_10077386 | 3300006038 | Bacteria | 2247 |
| 279 | Ga0075365_10086523 | 3300006038 | Bacteria | 2130 |
| 280 | Ga0075365_10162450 | 3300006038 | Bacteria | 1557 |
| 281 | Ga0075365_10187535 | 3300006038 | Bacteria | 1447 |
| 282 | Ga0075368_10000497 | 3300006042 | Bacteria | 11660 |
| 283 | Ga0075363_100019120 | 3300006048 | Bacteria | 3422 |
| 284 | Ga0075363_100034775 | 3300006048 | Bacteria | 2632 |
| 285 | Ga0075364_10043362 | 3300006051 | Bacteria | 2924 |
| 286 | Ga0075364_10053411 | 3300006051 | Bacteria | 2642 |
| 287 | Ga0075364_10093419 | 3300006051 | Bacteria | 1997 |
| 288 | Ga0075364_10126716 | 3300006051 | Bacteria | 1712 |
| 289 | Ga0075364_10145322 | 3300006051 | Bacteria | 1597 |
| 290 | Ga0075432_10161255 | 3300006058 | Bacteria | 867 |
| 291 | Ga0070715_10052960 | 3300006163 | Bacteria | 1752 |
| 292 | Ga0070716_100002789 | 3300006173 | Bacteria | 8121 |
| 293 | Ga0070716_100060583 | 3300006173 | Bacteria | 2187 |
| 294 | Ga0075362_10015521 | 3300006177 | Bacteria | 3099 |
| 295 | Ga0075362_10076585 | 3300006177 | Bacteria | 1536 |
| 296 | Ga0075367_10005545 | 3300006178 | Bacteria | 6285 |
| 297 | Ga0075367_10029428 | 3300006178 | Bacteria | 3141 |
| 298 | Ga0075367_10102443 | 3300006178 | Bacteria | 1751 |
| 299 | Ga0075367_10241541 | 3300006178 | Bacteria | 1132 |
| 300 | Ga0075369_10000668 | 3300006186 | Bacteria | 10918 |
| 301 | Ga0075369_10003981 | 3300006186 | Bacteria | 5421 |
| 302 | Ga0075369_10007492 | 3300006186 | Bacteria | 4158 |
| 303 | Ga0075369_10100272 | 3300006186 | Bacteria | 1299 |
| 304 | Ga0075369_10123852 | 3300006186 | Bacteria | 1171 |
| 305 | Ga0075366_10001925 | 3300006195 | Bacteria | 10502 |
| 306 | Ga0075366_10032269 | 3300006195 | Bacteria | 3083 |
| 307 | Ga0075366_10083112 | 3300006195 | Bacteria | 1914 |
| 308 | Ga0075366_10155636 | 3300006195 | Bacteria | 1384 |
| 309 | Ga0075366_10207258 | 3300006195 | Bacteria | 1193 |
| 310 | Ga0097621_100014601 | 3300006237 | Bacteria | 5884 |
| 311 | Ga0097621_100023403 | 3300006237 | Bacteria | 4811 |
| 312 | Ga0097621_100027531 | 3300006237 | Bacteria | 4471 |
| 313 | Ga0097621_100141217 | 3300006237 | Bacteria | 2058 |
| 314 | Ga0097621_100182239 | 3300006237 | Bacteria | 1815 |
| 315 | Ga0097621_100585443 | 3300006237 | Bacteria | 1019 |
| 316 | Ga0075370_10003750 | 3300006353 | Bacteria | 7273 |
| 317 | Ga0075370_10012857 | 3300006353 | Bacteria | 4435 |
| 318 | Ga0075370_10014816 | 3300006353 | Bacteria | 4163 |
| 319 | Ga0075370_10076779 | 3300006353 | Bacteria | 1916 |
| 320 | Ga0068871_100072151 | 3300006358 | Bacteria | 2842 |
| 321 | Ga0068871_100117432 | 3300006358 | Bacteria | 2244 |
| 322 | Ga0075428_100297821 | 3300006844 | Bacteria | 1734 |
| 323 | Ga0075428_100385730 | 3300006844 | Bacteria | 1502 |
| 324 | Ga0075430_100056046 | 3300006846 | Bacteria | 3314 |
| 325 | Ga0075430_100289627 | 3300006846 | Bacteria | 1355 |
| 326 | Ga0075431_100008686 | 3300006847 | Bacteria | 10180 |
| 327 | Ga0075431_100014607 | 3300006847 | Bacteria | 7944 |
| 328 | Ga0075431_100802983 | 3300006847 | Bacteria | 914 |
| 329 | Ga0075433_10004359 | 3300006852 | Bacteria | 10998 |
| 330 | Ga0075433_10111317 | 3300006852 | Bacteria | 2429 |
| 331 | Ga0075433_10246146 | 3300006852 | Bacteria | 1587 |
| 332 | Ga0075434_100001107 | 3300006871 | Bacteria | 22100 |
| 333 | Ga0075434_100080113 | 3300006871 | Bacteria | 3262 |
| 334 | Ga0075434_100716813 | 3300006871 | Bacteria | 1017 |
| 335 | Ga0075429_100162181 | 3300006880 | Bacteria | 1958 |
| 336 | Ga0075429_100315527 | 3300006880 | Bacteria | 1368 |
| 337 | Ga0068865_100002181 | 3300006881 | Bacteria | 11531 |
| 338 | Ga0068865_100005350 | 3300006881 | Bacteria | 7775 |
| 339 | Ga0068865_100006891 | 3300006881 | Bacteria | 6962 |
| 340 | Ga0068865_100043120 | 3300006881 | Bacteria | 3080 |
| 341 | Ga0068865_100057693 | 3300006881 | Bacteria | 2709 |
| 342 | Ga0097620_100004139 | 3300006931 | Bacteria | 14808 |
| 343 | Ga0097620_100024768 | 3300006931 | Bacteria | 6022 |
| 344 | Ga0097620_100066364 | 3300006931 | Bacteria | 3643 |
| 345 | Ga0097620_100239842 | 3300006931 | Bacteria | 1902 |
| 346 | Ga0097620_100258095 | 3300006931 | Bacteria | 1834 |
| 347 | Ga0097620_100281543 | 3300006931 | Bacteria | 1756 |
| 348 | Ga0097620_100407008 | 3300006931 | Bacteria | 1456 |
| 349 | Ga0075435_100084847 | 3300007076 | Bacteria | 2607 |
| 350 | Ga0075435_100096110 | 3300007076 | Bacteria | 2451 |
| 351 | Ga0099795_10197466 | 3300007788 | Bacteria | 847 |
| 352 | Ga0105240_10030702 | 3300009093 | Bacteria | 6980 |
| 353 | Ga0105240_10188585 | 3300009093 | Bacteria | 2426 |
| 354 | Ga0105240_10193464 | 3300009093 | Bacteria | 2390 |
| 355 | Ga0105240_10317039 | 3300009093 | Bacteria | 1778 |
| 356 | Ga0105240_10445115 | 3300009093 | Bacteria | 1451 |
| 357 | Ga0105240_10470161 | 3300009093 | Bacteria | 1403 |
| 358 | Ga0111539_10000090 | 3300009094 | Bacteria | 94888 |
| 359 | Ga0111539_10095317 | 3300009094 | Bacteria | 3495 |
| 360 | Ga0111539_10106388 | 3300009094 | Bacteria | 3291 |
| 361 | Ga0111539_10228537 | 3300009094 | Bacteria | 2167 |
| 362 | Ga0111539_10594395 | 3300009094 | Bacteria | 1289 |
| 363 | Ga0111539_10741676 | 3300009094 | Bacteria | 1143 |
| 364 | Ga0111539_11228693 | 3300009094 | Bacteria | 870 |
| 365 | Ga0105245_10008017 | 3300009098 | Bacteria | 9237 |
| 366 | Ga0105245_10063580 | 3300009098 | Bacteria | 3333 |
| 367 | Ga0105245_10091787 | 3300009098 | Bacteria | 2795 |
| 368 | Ga0105245_10413657 | 3300009098 | Bacteria | 1350 |
| 369 | Ga0105245_10444206 | 3300009098 | Bacteria | 1304 |
| 370 | Ga0105245_10470834 | 3300009098 | Bacteria | 1268 |
| 371 | Ga0105245_10577174 | 3300009098 | Bacteria | 1149 |
| 372 | Ga0105247_10006831 | 3300009101 | Bacteria | 7031 |
| 373 | Ga0105247_10146901 | 3300009101 | Bacteria | 1550 |
| 374 | Ga0105247_10398480 | 3300009101 | Bacteria | 980 |
| 375 | Ga0114129_10179262 | 3300009147 | Bacteria | 2884 |
| 376 | Ga0114129_10271647 | 3300009147 | Bacteria | 2268 |
| 377 | Ga0114129_10286300 | 3300009147 | Bacteria | 2200 |
| 378 | Ga0105243_10000959 | 3300009148 | Bacteria | 26971 |
| 379 | Ga0105243_10015761 | 3300009148 | Bacteria | 5716 |
| 380 | Ga0105243_10105952 | 3300009148 | Bacteria | 2342 |
| 381 | Ga0105243_10155973 | 3300009148 | Bacteria | 1963 |
| 382 | Ga0105243_10182807 | 3300009148 | Bacteria | 1825 |
| 383 | Ga0105243_10292051 | 3300009148 | Bacteria | 1473 |
| 384 | Ga0105243_10616879 | 3300009148 | Bacteria | 1046 |
| 385 | Ga0105241_10002442 | 3300009174 | Bacteria | 13945 |
| 386 | Ga0105241_10113365 | 3300009174 | Bacteria | 2173 |
| 387 | Ga0105241_10292450 | 3300009174 | Bacteria | 1395 |
| 388 | Ga0105242_10002489 | 3300009176 | Bacteria | 14439 |
| 389 | Ga0105242_10193932 | 3300009176 | Bacteria | 1800 |
| 390 | Ga0105248_10000901 | 3300009177 | Bacteria | 33234 |
| 391 | Ga0105248_10013900 | 3300009177 | Bacteria | 8858 |
| 392 | Ga0105248_10015246 | 3300009177 | Bacteria | 8470 |
| 393 | Ga0105248_10019917 | 3300009177 | Bacteria | 7426 |
| 394 | Ga0105248_10060349 | 3300009177 | Bacteria | 4257 |
| 395 | Ga0105248_10479903 | 3300009177 | Bacteria | 1401 |
| 396 | Ga0105237_10000174 | 3300009545 | Bacteria | 90431 |
| 397 | Ga0105237_10009955 | 3300009545 | Bacteria | 10142 |
| 398 | Ga0105237_10018733 | 3300009545 | Bacteria | 7158 |
| 399 | Ga0105237_10034874 | 3300009545 | Bacteria | 5092 |
| 400 | Ga0105237_10035664 | 3300009545 | Bacteria | 5032 |
| 401 | Ga0105237_10043232 | 3300009545 | Bacteria | 4540 |
| 402 | Ga0105237_10049540 | 3300009545 | Bacteria | 4221 |
| 403 | Ga0105237_10186456 | 3300009545 | Bacteria | 2074 |
| 404 | Ga0105237_10364295 | 3300009545 | Bacteria | 1450 |
| 405 | Ga0105237_10403976 | 3300009545 | Bacteria | 1371 |
| 406 | Ga0105237_10673565 | 3300009545 | Bacteria | 1041 |
| 407 | Ga0105238_10010957 | 3300009551 | Bacteria | 9118 |
| 408 | Ga0105238_10029974 | 3300009551 | Bacteria | 5538 |
| 409 | Ga0105238_10033358 | 3300009551 | Bacteria | 5241 |
| 410 | Ga0105238_10045923 | 3300009551 | Bacteria | 4411 |
| 411 | Ga0105238_10487166 | 3300009551 | Bacteria | 1233 |
| 412 | Ga0105249_10049194 | 3300009553 | Bacteria | 3845 |
| 413 | Ga0105249_10185849 | 3300009553 | Bacteria | 2025 |
| 414 | Ga0105249_10247261 | 3300009553 | Bacteria | 1766 |
| 415 | Ga0105249_10400273 | 3300009553 | Bacteria | 1403 |
| 416 | Ga0105249_10444825 | 3300009553 | Bacteria | 1334 |
| 417 | Ga0105249_10504884 | 3300009553 | Bacteria | 1255 |
| 418 | Ga0123340_1040575 | 3300009763 | Bacteria | 2182 |
| 419 | Ga0123342_1032370 | 3300009766 | Bacteria | 2456 |
| 420 | Ga0105239_10002107 | 3300010375 | Bacteria | 25697 |
| 421 | Ga0105239_10007703 | 3300010375 | Bacteria | 12329 |
| 422 | Ga0105239_10039185 | 3300010375 | Bacteria | 5191 |
| 423 | Ga0105239_10122143 | 3300010375 | Bacteria | 2893 |
| 424 | Ga0105239_10243808 | 3300010375 | Bacteria | 2017 |
| 425 | Ga0105239_10301175 | 3300010375 | Bacteria | 1805 |
| 426 | Ga0105239_10307747 | 3300010375 | Bacteria | 1785 |
| 427 | Ga0105239_10343654 | 3300010375 | Bacteria | 1684 |
| 428 | Ga0105239_10374542 | 3300010375 | Bacteria | 1609 |
| 429 | Ga0105239_11306396 | 3300010375 | Bacteria | 837 |
| 430 | Ga0105246_10021121 | 3300011119 | Bacteria | 4186 |
| 431 | Ga0105246_10103356 | 3300011119 | Bacteria | 2079 |
| 432 | Ga0105246_10183024 | 3300011119 | Bacteria | 1615 |
| 433 | Ga0105246_10211017 | 3300011119 | Bacteria | 1516 |
| 434 | Ga0105246_10322074 | 3300011119 | Bacteria | 1256 |
| 435 | Ga0157338_1002466 | 3300012515 | Bacteria | 1454 |
| 436 | Ga0157371_10047155 | 3300013102 | Bacteria | 3063 |
| 437 | Ga0157370_10056251 | 3300013104 | Bacteria | 3744 |
| 438 | Ga0157370_10134148 | 3300013104 | Bacteria | 2308 |
| 439 | Ga0157369_10035139 | 3300013105 | Bacteria | 5497 |
| 440 | Ga0157369_10181288 | 3300013105 | Bacteria | 2215 |
| 441 | Ga0157369_10229048 | 3300013105 | Bacteria | 1943 |
| 442 | Ga0157374_10100093 | 3300013296 | Bacteria | 2778 |
| 443 | Ga0157374_10640703 | 3300013296 | Bacteria | 1074 |
| 444 | Ga0157378_10004511 | 3300013297 | Bacteria | 12212 |
| 445 | Ga0157378_10006489 | 3300013297 | Bacteria | 10226 |
| 446 | Ga0157378_10053222 | 3300013297 | Bacteria | 3604 |
| 447 | Ga0157378_10212835 | 3300013297 | Bacteria | 1833 |
| 448 | Ga0157378_10390105 | 3300013297 | Bacteria | 1369 |
| 449 | Ga0157378_10792357 | 3300013297 | Bacteria | 973 |
| 450 | Ga0163162_10000204 | 3300013306 | Bacteria | 54853 |
| 451 | Ga0163162_10004677 | 3300013306 | Bacteria | 13200 |
| 452 | Ga0163162_10049112 | 3300013306 | Bacteria | 4229 |
| 453 | Ga0163162_10118334 | 3300013306 | Bacteria | 2751 |
| 454 | Ga0163162_10544590 | 3300013306 | Bacteria | 1289 |
| 455 | Ga0157372_10514203 | 3300013307 | Bacteria | 1396 |
| 456 | Ga0157375_10006400 | 3300013308 | Bacteria | 10263 |
| 457 | Ga0157375_10024647 | 3300013308 | Bacteria | 5572 |
| 458 | Ga0157375_10041032 | 3300013308 | Bacteria | 4466 |
| 459 | Ga0157375_10057714 | 3300013308 | Bacteria | 3838 |
| 460 | Ga0157375_10794743 | 3300013308 | Bacteria | 1095 |
| 461 | Ga0163163_10828742 | 3300014325 | Bacteria | 988 |
| 462 | Ga0157380_10002708 | 3300014326 | Bacteria | 12017 |
| 463 | Ga0157380_10004478 | 3300014326 | Bacteria | 9681 |
| 464 | Ga0157380_10012997 | 3300014326 | Bacteria | 6053 |
| 465 | Ga0157380_10041949 | 3300014326 | Bacteria | 3574 |
| 466 | Ga0157380_10319433 | 3300014326 | Bacteria | 1439 |
| 467 | Ga0157380_10721693 | 3300014326 | Bacteria | 1004 |
| 468 | Ga0182008_10000774 | 3300014497 | Bacteria | 22409 |
| 469 | Ga0182008_10013499 | 3300014497 | Bacteria | 4295 |
| 470 | Ga0157377_10000107 | 3300014745 | Bacteria | 57351 |
| 471 | Ga0157377_10241541 | 3300014745 | Bacteria | 1166 |
| 472 | Ga0157379_10002672 | 3300014968 | Bacteria | 15018 |
| 473 | Ga0157379_10035395 | 3300014968 | Bacteria | 4452 |
| 474 | Ga0157379_10091786 | 3300014968 | Bacteria | 2724 |
| 475 | Ga0157379_10171246 | 3300014968 | Bacteria | 1960 |
| 476 | Ga0157379_10201941 | 3300014968 | Bacteria | 1798 |
| 477 | Ga0157379_10350293 | 3300014968 | Bacteria | 1352 |
| 478 | Ga0157379_10396532 | 3300014968 | Bacteria | 1268 |
| 479 | Ga0157379_10553319 | 3300014968 | Bacteria | 1071 |
| 480 | Ga0157379_10841194 | 3300014968 | Bacteria | 868 |
| 481 | Ga0157376_10093303 | 3300014969 | Bacteria | 2613 |
| 482 | Ga0157376_10232454 | 3300014969 | Bacteria | 1713 |
| 483 | Ga0157376_10389772 | 3300014969 | Bacteria | 1344 |
| 484 | Ga0157376_10402833 | 3300014969 | Bacteria | 1323 |
| 485 | Ga0182007_10004305 | 3300015262 | Bacteria | 6480 |
| 486 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 487 | Ga0183363_1026 | 3300015690 | Bacteria | 53052 |
| 488 | Ga0163161_10020746 | 3300017792 | Bacteria | 4613 |
| 489 | Ga0163161_10105260 | 3300017792 | Bacteria | 2104 |
| 490 | Ga0163161_10201719 | 3300017792 | Bacteria | 1533 |
| 491 | Ga0163161_10366484 | 3300017792 | Bacteria | 1149 |
| 492 | Ga0163161_10387294 | 3300017792 | Bacteria | 1118 |
| 493 | Ga0214544_1007335 | 3300021320 | Bacteria | 19472 |
| 494 | Ga0214542_1000027 | 3300021321 | Bacteria | 175107 |
| 495 | Ga0214543_1000047 | 3300021327 | Bacteria | 150894 |
| 496 | Ga0213873_10001600 | 3300021358 | Bacteria | 3780 |
| 497 | Ga0213873_10006410 | 3300021358 | Bacteria | 2314 |
| 498 | Ga0213874_10011559 | 3300021377 | Bacteria | 2240 |
| 499 | Ga0213874_10060082 | 3300021377 | Bacteria | 1188 |
| 500 | Ga0213876_10001084 | 3300021384 | Bacteria | 17452 |
| 501 | Ga0213876_10006877 | 3300021384 | Bacteria | 6200 |
| 502 | Ga0213876_10010546 | 3300021384 | Bacteria | 4952 |
| 503 | Ga0213875_10001310 | 3300021388 | Bacteria | 16493 |
| 504 | Ga0213875_10121679 | 3300021388 | Bacteria | 1220 |
| 505 | Ga0213875_10219999 | 3300021388 | Bacteria | 894 |
| 506 | Ga0209436_100043 | 3300025208 | Bacteria | 71870 |
| 507 | Ga0209436_100252 | 3300025208 | Bacteria | 24622 |
| 508 | Ga0209563_101905 | 3300025230 | Bacteria | 5047 |
| 509 | Ga0207427_101361 | 3300025231 | Bacteria | 9016 |
| 510 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 511 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 512 | Ga0209759_1000226 | 3300025256 | Bacteria | 84383 |
| 513 | Ga0209129_1001447 | 3300025258 | Bacteria | 13241 |
| 514 | Ga0209129_1001476 | 3300025258 | Bacteria | 13078 |
| 515 | Ga0209129_1001744 | 3300025258 | Bacteria | 11677 |
| 516 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 517 | Ga0209233_1000208 | 3300025261 | Bacteria | 115633 |
| 518 | Ga0209233_1007445 | 3300025261 | Bacteria | 3467 |
| 519 | Ga0209233_1011692 | 3300025261 | Bacteria | 2579 |
| 520 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 521 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 522 | Ga0209673_1000550 | 3300025273 | Bacteria | 60329 |
| 523 | Ga0209673_1002222 | 3300025273 | Bacteria | 14107 |
| 524 | Ga0209673_1012262 | 3300025273 | Bacteria | 3465 |
| 525 | Ga0209673_1015978 | 3300025273 | Bacteria | 2826 |
| 526 | Ga0209673_1058556 | 3300025273 | Bacteria | 974 |
| 527 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 528 | Ga0209130_1000075 | 3300025284 | Bacteria | 171698 |
| 529 | Ga0209130_1000144 | 3300025284 | Bacteria | 114000 |
| 530 | Ga0209130_1001459 | 3300025284 | Bacteria | 15538 |
| 531 | Ga0209130_1014845 | 3300025284 | Bacteria | 1940 |
| 532 | Ga0209130_1022823 | 3300025284 | Bacteria | 1389 |
| 533 | Ga0209675_1000577 | 3300025291 | Bacteria | 26469 |
| 534 | Ga0209675_1016073 | 3300025291 | Bacteria | 2194 |
| 535 | Ga0209676_1002745 | 3300025292 | Bacteria | 11797 |
| 536 | Ga0209676_1011940 | 3300025292 | Bacteria | 3458 |
| 537 | Ga0209025_1000747 | 3300025294 | Bacteria | 54721 |
| 538 | Ga0209025_1019972 | 3300025294 | Bacteria | 3692 |
| 539 | Ga0209025_1034575 | 3300025294 | Bacteria | 2303 |
| 540 | Ga0209025_1037564 | 3300025294 | Bacteria | 2146 |
| 541 | Ga0209025_1047418 | 3300025294 | Bacteria | 1754 |
| 542 | Ga0209564_1000278 | 3300025295 | Bacteria | 105405 |
| 543 | Ga0209564_1000365 | 3300025295 | Bacteria | 84031 |
| 544 | Ga0209564_1000558 | 3300025295 | Bacteria | 59623 |
| 545 | Ga0209564_1033341 | 3300025295 | Bacteria | 1533 |
| 546 | Ga0209758_1000070 | 3300025297 | Bacteria | 284093 |
| 547 | Ga0209758_1000706 | 3300025297 | Bacteria | 49585 |
| 548 | Ga0209758_1003235 | 3300025297 | Bacteria | 15130 |
| 549 | Ga0209758_1014914 | 3300025297 | Bacteria | 4078 |
| 550 | Ga0209758_1021677 | 3300025297 | Bacteria | 2986 |
| 551 | Ga0209758_1027676 | 3300025297 | Bacteria | 2416 |
| 552 | Ga0209050_1018895 | 3300025298 | Bacteria | 2651 |
| 553 | Ga0209256_1000315 | 3300025299 | Bacteria | 84048 |
| 554 | Ga0209256_1000411 | 3300025299 | Bacteria | 67351 |
| 555 | Ga0209256_1000718 | 3300025299 | Bacteria | 43876 |
| 556 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 557 | Ga0207426_1000126 | 3300025302 | Bacteria | 213341 |
| 558 | Ga0207426_1000163 | 3300025302 | Bacteria | 171698 |
| 559 | Ga0207426_1002369 | 3300025302 | Bacteria | 12212 |
| 560 | Ga0209051_1000176 | 3300025303 | Bacteria | 115875 |
| 561 | Ga0209051_1000241 | 3300025303 | Bacteria | 91816 |
| 562 | Ga0209051_1001845 | 3300025303 | Bacteria | 16708 |
| 563 | Ga0209051_1005280 | 3300025303 | Bacteria | 7613 |
| 564 | Ga0209051_1009714 | 3300025303 | Bacteria | 4930 |
| 565 | Ga0209051_1010914 | 3300025303 | Bacteria | 4535 |
| 566 | Ga0209051_1018933 | 3300025303 | Bacteria | 3026 |
| 567 | Ga0209051_1027372 | 3300025303 | Bacteria | 2274 |
| 568 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 569 | Ga0209257_1000296 | 3300025304 | Bacteria | 109517 |
| 570 | Ga0209257_1001085 | 3300025304 | Bacteria | 35621 |
| 571 | Ga0209257_1010756 | 3300025304 | Bacteria | 4555 |
| 572 | Ga0209257_1018952 | 3300025304 | Bacteria | 2616 |
| 573 | Ga0209257_1019528 | 3300025304 | Bacteria | 2547 |
| 574 | Ga0207697_10010156 | 3300025315 | Bacteria | 4037 |
| 575 | Ga0207682_10003824 | 3300025893 | Bacteria | 6462 |
| 576 | Ga0207692_10002105 | 3300025898 | Bacteria | 7597 |
| 577 | Ga0207642_10006968 | 3300025899 | Bacteria | 3789 |
| 578 | Ga0207642_10062734 | 3300025899 | Bacteria | 1735 |
| 579 | Ga0207642_10262657 | 3300025899 | Bacteria | 985 |
| 580 | Ga0207710_10016400 | 3300025900 | Bacteria | 3133 |
| 581 | Ga0207688_10014947 | 3300025901 | Bacteria | 4212 |
| 582 | Ga0207688_10021443 | 3300025901 | Bacteria | 3529 |
| 583 | Ga0207688_10066618 | 3300025901 | Bacteria | 2037 |
| 584 | Ga0207688_10107200 | 3300025901 | Bacteria | 1619 |
| 585 | Ga0207680_10000693 | 3300025903 | Bacteria | 15837 |
| 586 | Ga0207680_10275558 | 3300025903 | Bacteria | 1168 |
| 587 | Ga0207647_10043242 | 3300025904 | Bacteria | 2819 |
| 588 | Ga0207685_10034520 | 3300025905 | Bacteria | 1838 |
| 589 | Ga0207699_10017480 | 3300025906 | Bacteria | 3776 |
| 590 | Ga0207645_10001681 | 3300025907 | Bacteria | 18001 |
| 591 | Ga0207645_10012052 | 3300025907 | Bacteria | 5879 |
| 592 | Ga0207645_10149681 | 3300025907 | Bacteria | 1523 |
| 593 | Ga0207645_10259896 | 3300025907 | Bacteria | 1150 |
| 594 | Ga0207645_10366974 | 3300025907 | Bacteria | 965 |
| 595 | Ga0207643_10012550 | 3300025908 | Bacteria | 4577 |
| 596 | Ga0207643_10021802 | 3300025908 | Bacteria | 3524 |
| 597 | Ga0207705_10007543 | 3300025909 | Bacteria | 7994 |
| 598 | Ga0207705_10038277 | 3300025909 | Bacteria | 3433 |
| 599 | Ga0207705_10102103 | 3300025909 | Bacteria | 2111 |
| 600 | Ga0207705_10421710 | 3300025909 | Bacteria | 1033 |
| 601 | Ga0207654_10005276 | 3300025911 | Bacteria | 6526 |
| 602 | Ga0207654_10010388 | 3300025911 | Bacteria | 4739 |
| 603 | Ga0207654_10206933 | 3300025911 | Bacteria | 1295 |
| 604 | Ga0207707_10016219 | 3300025912 | Bacteria | 6500 |
| 605 | Ga0207695_10123128 | 3300025913 | Bacteria | 2559 |
| 606 | Ga0207695_10199422 | 3300025913 | Bacteria | 1916 |
| 607 | Ga0207671_10000098 | 3300025914 | Bacteria | 133010 |
| 608 | Ga0207671_10016385 | 3300025914 | Bacteria | 5761 |
| 609 | Ga0207671_10027171 | 3300025914 | Bacteria | 4279 |
| 610 | Ga0207671_10036385 | 3300025914 | Bacteria | 3651 |
| 611 | Ga0207671_10038267 | 3300025914 | Bacteria | 3555 |
| 612 | Ga0207671_10065373 | 3300025914 | Bacteria | 2705 |
| 613 | Ga0207671_10214649 | 3300025914 | Bacteria | 1506 |
| 614 | Ga0207671_10328979 | 3300025914 | Bacteria | 1210 |
| 615 | Ga0207693_10015759 | 3300025915 | Bacteria | 6057 |
| 616 | Ga0207663_10002594 | 3300025916 | Bacteria | 8693 |
| 617 | Ga0207660_10150888 | 3300025917 | Bacteria | 1785 |
| 618 | Ga0207662_10062892 | 3300025918 | Bacteria | 2231 |
| 619 | Ga0207657_10032176 | 3300025919 | Bacteria | 4742 |
| 620 | Ga0207657_10042901 | 3300025919 | Bacteria | 3988 |
| 621 | Ga0207657_10046890 | 3300025919 | Bacteria | 3783 |
| 622 | Ga0207657_10067886 | 3300025919 | Bacteria | 3031 |
| 623 | Ga0207649_10004269 | 3300025920 | Bacteria | 7778 |
| 624 | Ga0207652_10082409 | 3300025921 | Bacteria | 2815 |
| 625 | Ga0207652_10452232 | 3300025921 | Bacteria | 1158 |
| 626 | Ga0207681_10018257 | 3300025923 | Bacteria | 4418 |
| 627 | Ga0207681_10039810 | 3300025923 | Bacteria | 3123 |
| 628 | Ga0207681_10068503 | 3300025923 | Bacteria | 2465 |
| 629 | Ga0207681_10122552 | 3300025923 | Bacteria | 1909 |
| 630 | Ga0207681_10136522 | 3300025923 | Bacteria | 1821 |
| 631 | Ga0207681_10389484 | 3300025923 | Bacteria | 1123 |
| 632 | Ga0207681_10616992 | 3300025923 | Bacteria | 897 |
| 633 | Ga0207694_10069851 | 3300025924 | Bacteria | 2744 |
| 634 | Ga0207694_10100132 | 3300025924 | Bacteria | 2296 |
| 635 | Ga0207694_10275218 | 3300025924 | Bacteria | 1382 |
| 636 | Ga0207694_10383931 | 3300025924 | Bacteria | 1166 |
| 637 | Ga0207650_10017853 | 3300025925 | Bacteria | 4971 |
| 638 | Ga0207659_10002593 | 3300025926 | Bacteria | 10766 |
| 639 | Ga0207659_10071354 | 3300025926 | Bacteria | 2536 |
| 640 | Ga0207659_10085589 | 3300025926 | Bacteria | 2342 |
| 641 | Ga0207659_10178576 | 3300025926 | Bacteria | 1680 |
| 642 | Ga0207687_10003093 | 3300025927 | Bacteria | 11287 |
| 643 | Ga0207687_10007241 | 3300025927 | Bacteria | 7319 |
| 644 | Ga0207687_10050899 | 3300025927 | Bacteria | 2886 |
| 645 | Ga0207687_10265131 | 3300025927 | Bacteria | 1371 |
| 646 | Ga0207700_10031915 | 3300025928 | Bacteria | 3749 |
| 647 | Ga0207700_10038178 | 3300025928 | Bacteria | 3484 |
| 648 | Ga0207664_10006954 | 3300025929 | Bacteria | 7827 |
| 649 | Ga0207664_10132657 | 3300025929 | Bacteria | 2098 |
| 650 | Ga0207644_10006260 | 3300025931 | Bacteria | 7754 |
| 651 | Ga0207644_10018313 | 3300025931 | Bacteria | 4736 |
| 652 | Ga0207644_10045368 | 3300025931 | Bacteria | 3127 |
| 653 | Ga0207690_10016088 | 3300025932 | Bacteria | 4547 |
| 654 | Ga0207690_10139221 | 3300025932 | Bacteria | 1786 |
| 655 | Ga0207690_10474299 | 3300025932 | Bacteria | 1009 |
| 656 | Ga0207706_10003308 | 3300025933 | Bacteria | 15436 |
| 657 | Ga0207706_10022986 | 3300025933 | Bacteria | 5599 |
| 658 | Ga0207706_10184051 | 3300025933 | Bacteria | 1834 |
| 659 | Ga0207706_10193365 | 3300025933 | Bacteria | 1785 |
| 660 | Ga0207686_10002718 | 3300025934 | Bacteria | 9599 |
| 661 | Ga0207686_10015735 | 3300025934 | Bacteria | 4236 |
| 662 | Ga0207709_10001119 | 3300025935 | Bacteria | 19668 |
| 663 | Ga0207709_10005283 | 3300025935 | Bacteria | 7347 |
| 664 | Ga0207709_10024912 | 3300025935 | Bacteria | 3421 |
| 665 | Ga0207709_10059177 | 3300025935 | Bacteria | 2384 |
| 666 | Ga0207709_10113242 | 3300025935 | Bacteria | 1818 |
| 667 | Ga0207709_10119585 | 3300025935 | Bacteria | 1776 |
| 668 | Ga0207709_10145283 | 3300025935 | Bacteria | 1636 |
| 669 | Ga0207709_10309967 | 3300025935 | Bacteria | 1177 |
| 670 | Ga0207670_10005570 | 3300025936 | Bacteria | 6921 |
| 671 | Ga0207670_10009557 | 3300025936 | Bacteria | 5539 |
| 672 | Ga0207670_10292173 | 3300025936 | Bacteria | 1273 |
| 673 | Ga0207669_10024389 | 3300025937 | Bacteria | 3250 |
| 674 | Ga0207669_10024588 | 3300025937 | Bacteria | 3240 |
| 675 | Ga0207669_10025755 | 3300025937 | Bacteria | 3186 |
| 676 | Ga0207669_10029638 | 3300025937 | Bacteria | 3029 |
| 677 | Ga0207669_10062917 | 3300025937 | Bacteria | 2288 |
| 678 | Ga0207669_10174879 | 3300025937 | Bacteria | 1532 |
| 679 | Ga0207704_10001177 | 3300025938 | Bacteria | 11657 |
| 680 | Ga0207704_10009761 | 3300025938 | Bacteria | 4648 |
| 681 | Ga0207704_10044084 | 3300025938 | Bacteria | 2640 |
| 682 | Ga0207704_10209565 | 3300025938 | Bacteria | 1433 |
| 683 | Ga0207704_10344545 | 3300025938 | Bacteria | 1158 |
| 684 | Ga0207665_10005896 | 3300025939 | Bacteria | 8151 |
| 685 | Ga0207665_10112843 | 3300025939 | Bacteria | 1911 |
| 686 | Ga0207691_10003792 | 3300025940 | Bacteria | 14671 |
| 687 | Ga0207691_10035477 | 3300025940 | Bacteria | 4628 |
| 688 | Ga0207691_10099364 | 3300025940 | Bacteria | 2598 |
| 689 | Ga0207691_10208710 | 3300025940 | Bacteria | 1698 |
| 690 | Ga0207691_10216614 | 3300025940 | Bacteria | 1661 |
| 691 | Ga0207691_10239163 | 3300025940 | Bacteria | 1570 |
| 692 | Ga0207691_10655160 | 3300025940 | Bacteria | 887 |
| 693 | Ga0207711_10001117 | 3300025941 | Bacteria | 25666 |
| 694 | Ga0207711_10073953 | 3300025941 | Bacteria | 2963 |
| 695 | Ga0207711_10141307 | 3300025941 | Bacteria | 2166 |
| 696 | Ga0207689_10003529 | 3300025942 | Bacteria | 14293 |
| 697 | Ga0207689_10004524 | 3300025942 | Bacteria | 12591 |
| 698 | Ga0207689_10016932 | 3300025942 | Bacteria | 6166 |
| 699 | Ga0207689_10026403 | 3300025942 | Bacteria | 4862 |
| 700 | Ga0207689_10071557 | 3300025942 | Bacteria | 2848 |
| 701 | Ga0207689_10213752 | 3300025942 | Bacteria | 1593 |
| 702 | Ga0207661_10155033 | 3300025944 | Bacteria | 1983 |
| 703 | Ga0207679_10579823 | 3300025945 | Bacteria | 1009 |
| 704 | Ga0207667_10002257 | 3300025949 | Bacteria | 24224 |
| 705 | Ga0207667_10019765 | 3300025949 | Bacteria | 7508 |
| 706 | Ga0207667_10432121 | 3300025949 | Bacteria | 1339 |
| 707 | Ga0207651_10330865 | 3300025960 | Bacteria | 1277 |
| 708 | Ga0207651_10413170 | 3300025960 | Bacteria | 1150 |
| 709 | Ga0207712_10093622 | 3300025961 | Bacteria | 2218 |
| 710 | Ga0207712_10132278 | 3300025961 | Bacteria | 1903 |
| 711 | Ga0207712_10452389 | 3300025961 | Bacteria | 1089 |
| 712 | Ga0207712_10794292 | 3300025961 | Bacteria | 832 |
| 713 | Ga0207668_10004719 | 3300025972 | Bacteria | 8016 |
| 714 | Ga0207668_10007648 | 3300025972 | Bacteria | 6430 |
| 715 | Ga0207668_10022961 | 3300025972 | Bacteria | 4000 |
| 716 | Ga0207668_10054878 | 3300025972 | Bacteria | 2767 |
| 717 | Ga0207668_10091056 | 3300025972 | Bacteria | 2240 |
| 718 | Ga0207668_10107072 | 3300025972 | Bacteria | 2090 |
| 719 | Ga0207668_10148672 | 3300025972 | Bacteria | 1811 |
| 720 | Ga0207668_10252672 | 3300025972 | Bacteria | 1432 |
| 721 | Ga0207668_10325583 | 3300025972 | Bacteria | 1277 |
| 722 | Ga0207640_10004957 | 3300025981 | Bacteria | 7236 |
| 723 | Ga0207640_10163554 | 3300025981 | Bacteria | 1650 |
| 724 | Ga0207640_10218584 | 3300025981 | Bacteria | 1457 |
| 725 | Ga0207658_10001163 | 3300025986 | Bacteria | 21016 |
| 726 | Ga0207658_10002997 | 3300025986 | Bacteria | 12076 |
| 727 | Ga0207658_10154102 | 3300025986 | Bacteria | 1876 |
| 728 | Ga0207658_10471536 | 3300025986 | Bacteria | 1114 |
| 729 | Ga0207677_10000686 | 3300026023 | Bacteria | 20040 |
| 730 | Ga0207677_10081529 | 3300026023 | Bacteria | 2322 |
| 731 | Ga0207677_10148763 | 3300026023 | Bacteria | 1803 |
| 732 | Ga0207703_10000702 | 3300026035 | Bacteria | 33148 |
| 733 | Ga0207703_10148135 | 3300026035 | Bacteria | 2044 |
| 734 | Ga0207703_10322585 | 3300026035 | Bacteria | 1415 |
| 735 | Ga0207639_10004702 | 3300026041 | Bacteria | 9189 |
| 736 | Ga0207639_10017059 | 3300026041 | Bacteria | 5144 |
| 737 | Ga0207639_10043662 | 3300026041 | Bacteria | 3367 |
| 738 | Ga0207639_10197789 | 3300026041 | Bacteria | 1722 |
| 739 | Ga0207639_10228345 | 3300026041 | Bacteria | 1612 |
| 740 | Ga0207678_10055733 | 3300026067 | Bacteria | 3405 |
| 741 | Ga0207678_10139218 | 3300026067 | Bacteria | 2071 |
| 742 | Ga0207678_10239799 | 3300026067 | Bacteria | 1553 |
| 743 | Ga0207678_10368317 | 3300026067 | Bacteria | 1241 |
| 744 | Ga0207708_10023248 | 3300026075 | Bacteria | 4683 |
| 745 | Ga0207708_10063677 | 3300026075 | Bacteria | 2817 |
| 746 | Ga0207708_10174109 | 3300026075 | Bacteria | 1706 |
| 747 | Ga0207702_10020818 | 3300026078 | Bacteria | 5425 |
| 748 | Ga0207702_10021279 | 3300026078 | Bacteria | 5368 |
| 749 | Ga0207702_10080204 | 3300026078 | Bacteria | 2831 |
| 750 | Ga0207702_10085088 | 3300026078 | Bacteria | 2755 |
| 751 | Ga0207702_10091452 | 3300026078 | Bacteria | 2664 |
| 752 | Ga0207702_10258663 | 3300026078 | Bacteria | 1638 |
| 753 | Ga0207641_10000926 | 3300026088 | Bacteria | 30280 |
| 754 | Ga0207641_10135643 | 3300026088 | Bacteria | 2215 |
| 755 | Ga0207641_10167392 | 3300026088 | Bacteria | 2003 |
| 756 | Ga0207641_10330977 | 3300026088 | Bacteria | 1447 |
| 757 | Ga0207648_10000227 | 3300026089 | Bacteria | 60175 |
| 758 | Ga0207648_10001863 | 3300026089 | Bacteria | 23045 |
| 759 | Ga0207648_10004241 | 3300026089 | Bacteria | 14815 |
| 760 | Ga0207648_10027604 | 3300026089 | Bacteria | 5039 |
| 761 | Ga0207648_10052018 | 3300026089 | Bacteria | 3581 |
| 762 | Ga0207648_10077381 | 3300026089 | Bacteria | 2900 |
| 763 | Ga0207648_10137674 | 3300026089 | Bacteria | 2151 |
| 764 | Ga0207648_10152176 | 3300026089 | Bacteria | 2041 |
| 765 | Ga0207648_10182587 | 3300026089 | Bacteria | 1857 |
| 766 | Ga0207648_10209896 | 3300026089 | Bacteria | 1728 |
| 767 | Ga0207676_10000656 | 3300026095 | Bacteria | 27723 |
| 768 | Ga0207676_10055756 | 3300026095 | Bacteria | 3104 |
| 769 | Ga0207676_10171438 | 3300026095 | Bacteria | 1891 |
| 770 | Ga0207676_10220263 | 3300026095 | Bacteria | 1689 |
| 771 | Ga0207676_10406427 | 3300026095 | Bacteria | 1274 |
| 772 | Ga0207674_10026564 | 3300026116 | Bacteria | 6144 |
| 773 | Ga0207674_10196987 | 3300026116 | Bacteria | 1964 |
| 774 | Ga0207675_100001409 | 3300026118 | Bacteria | 24039 |
| 775 | Ga0207675_100003635 | 3300026118 | Bacteria | 15040 |
| 776 | Ga0207675_100004839 | 3300026118 | Bacteria | 12970 |
| 777 | Ga0207675_100005359 | 3300026118 | Bacteria | 12311 |
| 778 | Ga0207675_100025107 | 3300026118 | Bacteria | 5547 |
| 779 | Ga0207675_100040984 | 3300026118 | Bacteria | 4325 |
| 780 | Ga0207675_100063281 | 3300026118 | Bacteria | 3456 |
| 781 | Ga0207675_100131377 | 3300026118 | Bacteria | 2375 |
| 782 | Ga0207683_10000463 | 3300026121 | Bacteria | 37729 |
| 783 | Ga0207683_10028847 | 3300026121 | Bacteria | 4801 |
| 784 | Ga0207683_10041326 | 3300026121 | Bacteria | 4026 |
| 785 | Ga0207683_10049390 | 3300026121 | Bacteria | 3683 |
| 786 | Ga0207683_10059609 | 3300026121 | Bacteria | 3353 |
| 787 | Ga0207683_10116269 | 3300026121 | Bacteria | 2398 |
| 788 | Ga0207683_10360331 | 3300026121 | Bacteria | 1335 |
| 789 | Ga0207698_10008240 | 3300026142 | Bacteria | 6578 |
| 790 | Ga0207698_10015130 | 3300026142 | Bacteria | 5157 |
| 791 | Ga0207698_10139450 | 3300026142 | Bacteria | 2086 |
| 792 | Ga0207698_10210576 | 3300026142 | Bacteria | 1749 |
| 793 | Ga0207698_10216552 | 3300026142 | Bacteria | 1727 |
| 794 | Ga0207698_10412347 | 3300026142 | Bacteria | 1294 |
| 795 | Ga0209588_1024000 | 3300027671 | Bacteria | 1925 |
| 796 | Ga0209974_10014701 | 3300027876 | Bacteria | 2601 |
| 797 | Ga0207428_10000055 | 3300027907 | Bacteria | 166460 |
| 798 | Ga0207428_10198334 | 3300027907 | Bacteria | 1511 |
| 799 | Ga0207428_10373913 | 3300027907 | Bacteria | 1046 |
| 800 | Ga0268266_10001688 | 3300028379 | Bacteria | 25375 |
| 801 | Ga0268266_10004161 | 3300028379 | Bacteria | 13950 |
| 802 | Ga0268266_10013435 | 3300028379 | Bacteria | 7050 |
| 803 | Ga0268266_10014245 | 3300028379 | Bacteria | 6838 |
| 804 | Ga0268266_10022514 | 3300028379 | Bacteria | 5369 |
| 805 | Ga0268266_10268317 | 3300028379 | Bacteria | 1584 |
| 806 | Ga0268265_10019073 | 3300028380 | Bacteria | 4762 |
| 807 | Ga0268265_10020317 | 3300028380 | Bacteria | 4634 |
| 808 | Ga0268265_10031758 | 3300028380 | Bacteria | 3816 |
| 809 | Ga0268265_10036898 | 3300028380 | Bacteria | 3583 |
| 810 | Ga0268265_10045858 | 3300028380 | Bacteria | 3265 |
| 811 | Ga0268265_10060622 | 3300028380 | Bacteria | 2900 |
| 812 | Ga0268265_10120812 | 3300028380 | Bacteria | 2158 |
| 813 | Ga0268265_10487658 | 3300028380 | Bacteria | 1159 |
| 814 | Ga0268264_10027008 | 3300028381 | Bacteria | 4689 |
| 815 | Ga0268264_10031040 | 3300028381 | Bacteria | 4381 |
| 816 | Ga0268264_10050132 | 3300028381 | Bacteria | 3475 |
| 817 | Ga0268264_10102078 | 3300028381 | Bacteria | 2495 |
| 818 | Ga0268264_10146821 | 3300028381 | Bacteria | 2110 |
| 819 | Ga0268264_10245924 | 3300028381 | Bacteria | 1659 |
| 820 | Ga0268264_10359369 | 3300028381 | Bacteria | 1388 |
| 821 | Ga0268264_10395543 | 3300028381 | Bacteria | 1327 |
| 822 | Ga0307517_10000102 | 3300028786 | Bacteria | 123775 |
| 823 | Ga0307517_10091558 | 3300028786 | Bacteria | 2482 |
| 824 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 825 | Ga0307515_10000130 | 3300028794 | Bacteria | 179263 |
| 826 | Ga0307515_10005868 | 3300028794 | Bacteria | 24773 |
| 827 | Ga0307511_10062115 | 3300030521 | Bacteria | 2839 |
| 828 | Ga0307511_10105332 | 3300030521 | Bacteria | 1826 |
| 829 | Ga0307512_10066553 | 3300030522 | Bacteria | 2721 |
| 830 | Ga0265332_10044610 | 3300031238 | Bacteria | 1912 |
| 831 | Ga0265328_10075366 | 3300031239 | Bacteria | 1241 |
| 832 | Ga0265325_10033572 | 3300031241 | Bacteria | 2735 |
| 833 | Ga0265325_10090164 | 3300031241 | Bacteria | 1513 |
| 834 | Ga0265339_10001056 | 3300031249 | Bacteria | 20966 |
| 835 | Ga0265331_10024029 | 3300031250 | Bacteria | 3089 |
| 836 | Ga0265331_10027234 | 3300031250 | Bacteria | 2867 |
| 837 | Ga0265316_10102464 | 3300031344 | Bacteria | 2174 |
| 838 | Ga0307513_10004550 | 3300031456 | Bacteria | 18498 |
| 839 | Ga0307513_10006865 | 3300031456 | Bacteria | 14820 |
| 840 | Ga0307513_10011752 | 3300031456 | Bacteria | 10858 |
| 841 | Ga0307513_10161071 | 3300031456 | Bacteria | 2137 |
| 842 | Ga0307513_10207476 | 3300031456 | Bacteria | 1794 |
| 843 | Ga0307513_10237260 | 3300031456 | Bacteria | 1632 |
| 844 | Ga0307513_10412727 | 3300031456 | Bacteria | 1082 |
| 845 | Ga0307509_10020922 | 3300031507 | Bacteria | 7415 |
| 846 | Ga0307509_10077468 | 3300031507 | Bacteria | 3448 |
| 847 | Ga0307509_10382066 | 3300031507 | Bacteria | 1121 |
| 848 | Ga0307509_10434821 | 3300031507 | Bacteria | 1009 |
| 849 | Ga0307408_100009454 | 3300031548 | Bacteria | 6431 |
| 850 | Ga0307408_100190984 | 3300031548 | Bacteria | 1650 |
| 851 | Ga0307408_100223010 | 3300031548 | Bacteria | 1539 |
| 852 | Ga0307408_100306894 | 3300031548 | Bacteria | 1332 |
| 853 | Ga0307408_100589190 | 3300031548 | Bacteria | 986 |
| 854 | Ga0265313_10000044 | 3300031595 | Bacteria | 117063 |
| 855 | Ga0265313_10040982 | 3300031595 | Bacteria | 2285 |
| 856 | Ga0265313_10123276 | 3300031595 | Bacteria | 1128 |
| 857 | Ga0307508_10066442 | 3300031616 | Bacteria | 3175 |
| 858 | Ga0307508_10141035 | 3300031616 | Bacteria | 2014 |
| 859 | Ga0307508_10206694 | 3300031616 | Bacteria | 1564 |
| 860 | Ga0307508_10286396 | 3300031616 | Bacteria | 1241 |
| 861 | Ga0307508_10387937 | 3300031616 | Bacteria | 987 |
| 862 | Ga0265314_10060748 | 3300031711 | Bacteria | 2578 |
| 863 | Ga0265314_10072215 | 3300031711 | Bacteria | 2306 |
| 864 | Ga0265342_10037361 | 3300031712 | Bacteria | 2962 |
| 865 | Ga0307516_10002286 | 3300031730 | Bacteria | 25850 |
| 866 | Ga0307516_10003926 | 3300031730 | Bacteria | 18739 |
| 867 | Ga0307516_10020911 | 3300031730 | Bacteria | 6753 |
| 868 | Ga0307516_10042688 | 3300031730 | Bacteria | 4497 |
| 869 | Ga0307516_10047076 | 3300031730 | Bacteria | 4252 |
| 870 | Ga0307516_10130828 | 3300031730 | Bacteria | 2289 |
| 871 | Ga0307516_10155104 | 3300031730 | Bacteria | 2046 |
| 872 | Ga0307516_10345991 | 3300031730 | Bacteria | 1153 |
| 873 | Ga0307516_10349497 | 3300031730 | Bacteria | 1144 |
| 874 | Ga0307516_10421155 | 3300031730 | Bacteria | 993 |
| 875 | Ga0307405_10179969 | 3300031731 | Bacteria | 1517 |
| 876 | Ga0307410_10019322 | 3300031852 | Bacteria | 4142 |
| 877 | Ga0307410_10041221 | 3300031852 | Bacteria | 3044 |
| 878 | Ga0307410_10083488 | 3300031852 | Bacteria | 2250 |
| 879 | Ga0307410_10203151 | 3300031852 | Bacteria | 1514 |
| 880 | Ga0307410_10407633 | 3300031852 | Bacteria | 1100 |
| 881 | Ga0307406_10061645 | 3300031901 | Bacteria | 2423 |
| 882 | Ga0307406_10458268 | 3300031901 | Bacteria | 1025 |
| 883 | Ga0307406_10537513 | 3300031901 | Bacteria | 954 |
| 884 | Ga0307406_10613626 | 3300031901 | Bacteria | 898 |
| 885 | Ga0307412_10152043 | 3300031911 | Bacteria | 1709 |
| 886 | Ga0307412_10200185 | 3300031911 | Bacteria | 1516 |
| 887 | Ga0307412_10303683 | 3300031911 | Bacteria | 1263 |
| 888 | Ga0307412_10415584 | 3300031911 | Bacteria | 1099 |
| 889 | Ga0307409_100018544 | 3300031995 | Bacteria | 4682 |
| 890 | Ga0307409_100039177 | 3300031995 | Bacteria | 3514 |
| 891 | Ga0307409_100043282 | 3300031995 | Bacteria | 3380 |
| 892 | Ga0307416_100007618 | 3300032002 | Bacteria | 6907 |
| 893 | Ga0307416_100037447 | 3300032002 | Bacteria | 3733 |
| 894 | Ga0307416_100056078 | 3300032002 | Bacteria | 3177 |
| 895 | Ga0307416_100615651 | 3300032002 | Bacteria | 1167 |
| 896 | Ga0307416_100628839 | 3300032002 | Bacteria | 1156 |
| 897 | Ga0307414_10024513 | 3300032004 | Bacteria | 3849 |
| 898 | Ga0307414_10049458 | 3300032004 | Bacteria | 2907 |
| 899 | Ga0307414_10114087 | 3300032004 | Bacteria | 2064 |
| 900 | Ga0307414_10410036 | 3300032004 | Bacteria | 1179 |
| 901 | Ga0307411_10074874 | 3300032005 | Bacteria | 2309 |
| 902 | Ga0307411_10132876 | 3300032005 | Bacteria | 1822 |
| 903 | Ga0307415_100068726 | 3300032126 | Bacteria | 2481 |
| 904 | Ga0307507_10009514 | 3300033179 | Bacteria | 12901 |
| 905 | Ga0307510_10000403 | 3300033180 | Bacteria | 41043 |
| 906 | Ga0307510_10159973 | 3300033180 | Bacteria | 1851 |
| 907 | Ga0373930_0002314 | 3300034816 | Bacteria | 2940 |
| 908 | Ga0373958_0010594 | 3300034819 | Bacteria | 1541 |
| 909 | Ga0373959_0059970 | 3300034820 | Bacteria | 840 |
| 910 | Ga0373938_0021680 | 3300034957 | Bacteria | 1305 |
| 911 | Ga0373928_0025870 | 3300035084 | Bacteria | 1268 |
| 912 | Ga0373940_0001803 | 3300035088 | Bacteria | 3999 |
| 913 | Ga0373940_0013447 | 3300035088 | Bacteria | 1981 |
| 914 | Ga0373949_0035880 | 3300035090 | Bacteria | 1201 |
| 915 | Ga0373932_0065455 | 3300035112 | Bacteria | 1115 |
| 916 | Ga0373936_0058868 | 3300035113 | Bacteria | 1565 |
| 917 | Ga0373945_0075361 | 3300035116 | Bacteria | 1284 |
| 918 | Ga0373954_0065142 | 3300035118 | Bacteria | 1724 |
| 919 | Ga0373956_0088068 | 3300035119 | Bacteria | 1430 |
| 920 | Ga0373960_0108071 | 3300035121 | Bacteria | 909 |
| 921 | Ga0373943_0183297 | 3300035170 | Bacteria | 1152 |
| 922 | Ga0373943_0218080 | 3300035170 | Bacteria | 1062 |
| 923 | Ga0373943_0238149 | 3300035170 | Bacteria | 1019 |
| 924 | Ga0373946_0043305 | 3300035171 | Bacteria | 1854 |
| 925 | Ga0373955_0031994 | 3300035172 | Bacteria | 2758 |
| 926 | Ga0373955_0036165 | 3300035172 | Bacteria | 2619 |
| 927 | Ga0373942_0013968 | 3300035207 | Bacteria | 1937 |
| 928 | Ga0373962_0007243 | 3300035242 | Bacteria | 2715 |
| 929 | Ga0373924_0013697 | 3300035410 | Bacteria | 3051 |
| 930 | Ga0373931_0000221 | 3300035691 | Bacteria | 24293 |
| 931 | Ga0373931_0144426 | 3300035691 | Bacteria | 1382 |
| 932 | Ga0373931_0361801 | 3300035691 | Bacteria | 910 |
| 933 | Ga0373935_0001741 | 3300035692 | Bacteria | 12210 |
| 934 | Ga0373935_0029145 | 3300035692 | Bacteria | 3416 |
| 935 | Ga0373935_0059489 | 3300035692 | Bacteria | 2442 |
| 936 | Ga0373927_0000139 | 3300035695 | Bacteria | 56397 |
| 937 | Ga0373927_0001969 | 3300035695 | Bacteria | 15149 |
| 938 | Ga0373927_0021434 | 3300035695 | Bacteria | 4236 |
| 939 | Ga0373927_0021765 | 3300035695 | Bacteria | 4202 |
| 940 | Ga0373927_0028636 | 3300035695 | Bacteria | 3634 |
| 941 | Ga0373927_0151088 | 3300035695 | Bacteria | 1520 |
| 942 | Ga0373933_0007649 | 3300035724 | Bacteria | 5900 |
| 943 | Ga0373933_0041090 | 3300035724 | Bacteria | 2728 |
| 944 | Ga0373947_0001689 | 3300035725 | Bacteria | 13524 |
| 945 | Ga0373947_0023523 | 3300035725 | Bacteria | 3585 |
| 946 | Ga0373937_0009205 | 3300036401 | Bacteria | 8573 |
| 947 | Ga0373937_0039005 | 3300036401 | Bacteria | 4328 |
| 948 | Ga0373937_0050691 | 3300036401 | Bacteria | 3802 |
| 949 | Ga0373937_0061257 | 3300036401 | Bacteria | 3459 |
| 950 | Ga0373937_0177910 | 3300036401 | Bacteria | 1997 |
| 951 | Ga0373937_0689912 | 3300036401 | Bacteria | 967 |
| 952 | Ga0373925_0002233 | 3300037068 | Bacteria | 15725 |
| 953 | Ga0373925_0014218 | 3300037068 | Bacteria | 5759 |
| 954 | Ga0373925_0186614 | 3300037068 | Bacteria | 1644 |
| 955 | Ga0373925_0336393 | 3300037068 | Bacteria | 1224 |
| 956 | Ga0373925_0487456 | 3300037068 | Bacteria | 1011 |
| 957 | Ga0373925_0770095 | 3300037068 | Bacteria | 793 |
| 958 | Ga0395899_0027674 | 3300037312 | Bacteria | 4272 |
| 959 | Ga0395899_0116590 | 3300037312 | Bacteria | 1916 |
| 960 | Ga0395900_0029660 | 3300037418 | Bacteria | 5612 |
| 961 | Ga0395900_0091357 | 3300037418 | Bacteria | 3129 |
| 962 | Ga0395900_0095506 | 3300037418 | Bacteria | 3054 |
| 963 | Ga0395900_0217555 | 3300037418 | Bacteria | 1927 |
| 964 | Ga0395900_0376925 | 3300037418 | Bacteria | 1387 |
| 965 | Ga0395898_0088943 | 3300037466 | Bacteria | 2972 |
| 966 | Ga0395905_0000972 | 3300037471 | Bacteria | 36749 |
| 967 | Ga0395905_0001399 | 3300037471 | Bacteria | 29219 |
| 968 | Ga0395905_0021902 | 3300037471 | Bacteria | 6044 |
| 969 | Ga0395905_0079268 | 3300037471 | Bacteria | 3078 |
| 970 | Ga0395905_0083018 | 3300037471 | Bacteria | 3002 |
| 971 | Ga0395905_0169130 | 3300037471 | Bacteria | 2053 |
| 972 | Ga0395905_0888678 | 3300037471 | Bacteria | 794 |
| 973 | Ga0436364_0432791 | 3300037853 | Bacteria | 1460 |
| 974 | Ga0436364_1006337 | 3300037853 | Bacteria | 2505 |
| 975 | Ga0436364_1104972 | 3300037853 | Bacteria | 3261 |
| 976 | Ga0436364_1224731 | 3300037853 | Bacteria | 1368 |
| 977 | Ga0436364_1463980 | 3300037853 | Bacteria | 6279 |
| 978 | Ga0395901_0068908 | 3300038443 | Bacteria | 3684 |
| 979 | Ga0395901_0119894 | 3300038443 | Bacteria | 2764 |
| 980 | Ga0400483_085697 | 3300039062 | Bacteria | 5242 |
| 981 | Ga0400483_125610 | 3300039062 | Bacteria | 3336 |
| 982 | Ga0400483_202169 | 3300039062 | Bacteria | 8497 |
| 983 | Ga0436365_0080604 | 3300039437 | Bacteria | 50922 |
| 984 | Ga0436365_0095350 | 3300039437 | Bacteria | 3081 |
| 985 | Ga0436365_0291258 | 3300039437 | Bacteria | 51712 |
| 986 | Ga0436365_0484605 | 3300039437 | Bacteria | 1957 |
| 987 | Ga0436365_0528920 | 3300039437 | Bacteria | 1726 |
| 988 | Ga0436365_0709674 | 3300039437 | Bacteria | 6817 |
| 989 | Ga0436365_1106760 | 3300039437 | Bacteria | 2716 |
| 990 | Ga0436365_1107580 | 3300039437 | Bacteria | 3937 |
| 991 | Ga0436365_1113050 | 3300039437 | Bacteria | 4531 |
| 992 | Ga0436360_0806014 | 3300039438 | Bacteria | 1369 |
| 993 | Ga0436360_1247364 | 3300039438 | Bacteria | 2145 |
| 994 | Ga0436361_0316835 | 3300039447 | Bacteria | 2244 |
| 995 | Ga0436361_0438285 | 3300039447 | Bacteria | 2408 |
| 996 | Ga0436361_0655965 | 3300039447 | Bacteria | 2076 |
| 997 | Ga0436363_0250085 | 3300039450 | Bacteria | 26739 |
| 998 | Ga0436363_0470149 | 3300039450 | Bacteria | 2009 |
| 999 | Ga0436363_0691653 | 3300039450 | Bacteria | 2687 |
| 1000 | Ga0436363_0706677 | 3300039450 | Bacteria | 4790 |
| 1001 | Ga0436362_0039268 | 3300039453 | Bacteria | 3827 |
| 1002 | Ga0436362_1130295 | 3300039453 | Bacteria | 10966 |
| 1003 | Ga0439436_0007480 | 3300041404 | Bacteria | 3360 |
| 1004 | Ga0439439_0029003 | 3300041406 | Bacteria | 1404 |
| 1005 | Ga0439453_0000158 | 3300041408 | Bacteria | 6141 |
| 1006 | Ga0439465_0001656 | 3300041413 | Bacteria | 7272 |
| 1007 | Ga0439465_0005428 | 3300041413 | Bacteria | 4068 |
| 1008 | Ga0439465_0040068 | 3300041413 | Bacteria | 1513 |
| 1009 | Ga0451798_0384754 | 3300041458 | Bacteria | 1400 |
| 1010 | Ga0451855_1802886 | 3300041511 | Bacteria | 1509 |
| 1011 | Ga0439443_008804 | 3300042003 | Bacteria | 1433 |
| 1012 | Ga0439449_0037385 | 3300042007 | Bacteria | 1806 |
| 1013 | Ga0439449_0063712 | 3300042007 | Bacteria | 1360 |
| 1014 | Ga0439455_0022404 | 3300042012 | Bacteria | 1514 |
| 1015 | Ga0450920_003262 | 3300042122 | Bacteria | 2801 |
| 1016 | Ga0439458_0011139 | 3300042157 | Bacteria | 2009 |
| 1017 | Ga0439434_0017132 | 3300042435 | Bacteria | 2167 |
| 1018 | Ga0439435_0001732 | 3300042436 | Bacteria | 4136 |
| 1019 | Ga0439435_0036134 | 3300042436 | Bacteria | 1364 |
| 1020 | Ga0439460_0014937 | 3300042461 | Bacteria | 2048 |
| 1021 | Ga0450918_001827 | 3300042531 | Bacteria | 4141 |
| 1022 | Ga0466969_0003525 | 3300044656 | Bacteria | 8316 |
| 1023 | Ga0466966_0010452 | 3300044684 | Bacteria | 6165 |
| 1024 | Ga0466961_0005081 | 3300044693 | Bacteria | 8279 |
| 1025 | Ga0453684_0015661 | 3300044712 | Bacteria | 11951 |
| 1026 | Ga0453684_0418952 | 3300044712 | Bacteria | 1496 |
| 1027 | Ga0466959_0012816 | 3300045049 | Bacteria | 6066 |
| 1028 | Ga0451576_0294890 | 3300045051 | Bacteria | 1695 |
| 1029 | Ga0451576_0350453 | 3300045051 | Bacteria | 1546 |
| 1030 | Ga0466967_0096052 | 3300045976 | Bacteria | 2703 |
| 1031 | Ga0466967_0416290 | 3300045976 | Bacteria | 1309 |
| 1032 | Ga0495617_056816 | 3300046452 | Bacteria | 1297 |
| 1033 | Ga0495592_0057749 | 3300046454 | Bacteria | 2864 |
| 1034 | Ga0495592_0118533 | 3300046454 | Bacteria | 1865 |
| 1035 | Ga0495592_0216459 | 3300046454 | Bacteria | 1283 |
| 1036 | Ga0495603_0051016 | 3300046455 | Bacteria | 2459 |
| 1037 | Ga0495603_0130629 | 3300046455 | Bacteria | 1463 |
| 1038 | Ga0495603_0214800 | 3300046455 | Bacteria | 1110 |
| 1039 | Ga0495590_0007845 | 3300046457 | Bacteria | 4097 |
| 1040 | Ga0495590_0014862 | 3300046457 | Bacteria | 2837 |
| 1041 | Ga0495629_0089881 | 3300046459 | Bacteria | 2142 |
| 1042 | Ga0495638_0010023 | 3300046460 | Bacteria | 6606 |
| 1043 | Ga0495638_0019892 | 3300046460 | Bacteria | 4439 |
| 1044 | Ga0495638_0023502 | 3300046460 | Bacteria | 4030 |
| 1045 | Ga0495638_0052267 | 3300046460 | Bacteria | 2545 |
| 1046 | Ga0495638_0078706 | 3300046460 | Bacteria | 2005 |
| 1047 | Ga0495651_0099829 | 3300046462 | Bacteria | 2164 |
| 1048 | Ga0495651_0298201 | 3300046462 | Bacteria | 1082 |
| 1049 | Ga0495580_0044247 | 3300046472 | Bacteria | 3167 |
| 1050 | Ga0495605_0009156 | 3300046474 | Bacteria | 5570 |
| 1051 | Ga0495639_0009873 | 3300046475 | Bacteria | 4099 |
| 1052 | Ga0495639_0093753 | 3300046475 | Bacteria | 1411 |
| 1053 | Ga0495639_0128881 | 3300046475 | Bacteria | 1210 |
| 1054 | Ga0495662_0123159 | 3300046476 | Bacteria | 1273 |
| 1055 | Ga0495664_0001193 | 3300046477 | Bacteria | 13561 |
| 1056 | Ga0495664_0006956 | 3300046477 | Bacteria | 6264 |
| 1057 | Ga0495664_0010170 | 3300046477 | Bacteria | 5280 |
| 1058 | Ga0495664_0046765 | 3300046477 | Bacteria | 2568 |
| 1059 | Ga0495584_0040470 | 3300046491 | Bacteria | 2353 |
| 1060 | Ga0495584_0131277 | 3300046491 | Bacteria | 1271 |
| 1061 | Ga0495585_0023268 | 3300046492 | Bacteria | 3556 |
| 1062 | Ga0495585_0031741 | 3300046492 | Bacteria | 2997 |
| 1063 | Ga0495585_0057444 | 3300046492 | Bacteria | 2147 |
| 1064 | Ga0495594_0117183 | 3300046499 | Bacteria | 1504 |
| 1065 | Ga0495596_0018291 | 3300046500 | Bacteria | 2889 |
| 1066 | Ga0495607_0106584 | 3300046501 | Bacteria | 1492 |
| 1067 | Ga0495583_0073517 | 3300046506 | Bacteria | 1498 |
| 1068 | Ga0495606_0002308 | 3300046507 | Bacteria | 22483 |
| 1069 | Ga0495606_0242604 | 3300046507 | Bacteria | 1004 |
| 1070 | Ga0495608_0013378 | 3300046511 | Bacteria | 5691 |
| 1071 | Ga0495608_0091303 | 3300046511 | Bacteria | 1970 |
| 1072 | Ga0495610_0016205 | 3300046512 | Bacteria | 4302 |
| 1073 | Ga0495610_0021848 | 3300046512 | Bacteria | 3511 |
| 1074 | Ga0495610_0167975 | 3300046512 | Bacteria | 922 |
| 1075 | Ga0495616_0020982 | 3300046513 | Bacteria | 3546 |
| 1076 | Ga0495618_0087433 | 3300046514 | Bacteria | 1993 |
| 1077 | Ga0495620_0019783 | 3300046515 | Bacteria | 3301 |
| 1078 | Ga0495620_0027127 | 3300046515 | Bacteria | 2685 |
| 1079 | Ga0495620_0084744 | 3300046515 | Bacteria | 1278 |
| 1080 | Ga0495628_0040093 | 3300046516 | Bacteria | 3744 |
| 1081 | Ga0495628_0206249 | 3300046516 | Bacteria | 1480 |
| 1082 | Ga0495630_0002691 | 3300046517 | Bacteria | 12335 |
| 1083 | Ga0495630_0009681 | 3300046517 | Bacteria | 6932 |
| 1084 | Ga0495630_0179043 | 3300046517 | Bacteria | 1616 |
| 1085 | Ga0495631_0027363 | 3300046518 | Bacteria | 2610 |
| 1086 | Ga0495631_0161637 | 3300046518 | Bacteria | 961 |
| 1087 | Ga0495637_0048020 | 3300046520 | Bacteria | 1800 |
| 1088 | Ga0495643_0016345 | 3300046522 | Bacteria | 4358 |
| 1089 | Ga0495643_0016823 | 3300046522 | Bacteria | 4291 |
| 1090 | Ga0495643_0031187 | 3300046522 | Bacteria | 2968 |
| 1091 | Ga0495644_0031331 | 3300046523 | Bacteria | 2009 |
| 1092 | Ga0495644_0056906 | 3300046523 | Bacteria | 1469 |
| 1093 | Ga0495648_0019848 | 3300046524 | Bacteria | 4706 |
| 1094 | Ga0495648_0033917 | 3300046524 | Bacteria | 3329 |
| 1095 | Ga0495648_0165670 | 3300046524 | Bacteria | 1138 |
| 1096 | Ga0495666_0016302 | 3300046526 | Bacteria | 3701 |
| 1097 | Ga0495642_0021749 | 3300046528 | Bacteria | 2524 |
| 1098 | Ga0495642_0024106 | 3300046528 | Bacteria | 2406 |
| 1099 | Ga0495642_0036830 | 3300046528 | Bacteria | 1978 |
| 1100 | Ga0495654_0027025 | 3300046530 | Bacteria | 2945 |
| 1101 | Ga0495665_0010250 | 3300046531 | Bacteria | 5072 |
| 1102 | Ga0495665_0050823 | 3300046531 | Bacteria | 2197 |
| 1103 | Ga0495640_0030810 | 3300046533 | Bacteria | 3836 |
| 1104 | Ga0495640_0139113 | 3300046533 | Bacteria | 1566 |
| 1105 | Ga0495587_0054018 | 3300046536 | Bacteria | 2368 |
| 1106 | Ga0495598_0001316 | 3300046537 | Bacteria | 4867 |
| 1107 | Ga0495621_0028212 | 3300046539 | Bacteria | 1907 |
| 1108 | Ga0495621_0073041 | 3300046539 | Bacteria | 1267 |
| 1109 | Ga0495597_0011373 | 3300046542 | Bacteria | 4316 |
| 1110 | Ga0495597_0013824 | 3300046542 | Bacteria | 3858 |
| 1111 | Ga0495597_0060331 | 3300046542 | Bacteria | 1655 |
| 1112 | Ga0495645_0002601 | 3300046543 | Bacteria | 12270 |
| 1113 | Ga0495667_0012733 | 3300046559 | Bacteria | 5701 |
| 1114 | Ga0495667_0013502 | 3300046559 | Bacteria | 5526 |
| 1115 | Ga0495667_0186767 | 3300046559 | Bacteria | 1329 |
| 1116 | Ga0495656_0000201 | 3300046615 | Bacteria | 21369 |
| 1117 | Ga0495656_0001707 | 3300046615 | Bacteria | 7194 |
| 1118 | Ga0495656_0038424 | 3300046615 | Bacteria | 1982 |
| 1119 | Ga0495656_0069385 | 3300046615 | Bacteria | 1561 |
| 1120 | Ga0495668_0093858 | 3300046616 | Bacteria | 1643 |
| 1121 | Ga0495634_0032374 | 3300046642 | Bacteria | 3596 |
| 1122 | Ga0495611_0125277 | 3300046648 | Bacteria | 1198 |
| 1123 | Ga0495625_0003440 | 3300046660 | Bacteria | 15790 |
| 1124 | Ga0495625_0157101 | 3300046660 | Bacteria | 1525 |
| 1125 | Ga0495625_0209204 | 3300046660 | Bacteria | 1283 |
| 1126 | Ga0495635_0315518 | 3300046663 | Bacteria | 1047 |
| 1127 | Ga0495661_0111480 | 3300046665 | Bacteria | 1524 |
| 1128 | Ga0495588_0066318 | 3300046674 | Bacteria | 1873 |
| 1129 | Ga0495588_0218852 | 3300046674 | Bacteria | 1005 |
| 1130 | Ga0495657_0127373 | 3300046675 | Bacteria | 1598 |
| 1131 | Ga0495599_0014021 | 3300046678 | Bacteria | 4961 |
| 1132 | Ga0495623_0140356 | 3300046679 | Bacteria | 1438 |
| 1133 | Ga0495646_0034557 | 3300046680 | Bacteria | 3139 |
| 1134 | Ga0495646_0049579 | 3300046680 | Bacteria | 2548 |
| 1135 | Ga0495658_0086519 | 3300046683 | Bacteria | 1849 |
| 1136 | Ga0495658_0152836 | 3300046683 | Bacteria | 1419 |
| 1137 | Ga0495658_0169234 | 3300046683 | Bacteria | 1351 |
| 1138 | Ga0495669_0014685 | 3300046684 | Bacteria | 3348 |
| 1139 | Ga0495669_0068550 | 3300046684 | Bacteria | 1614 |
| 1140 | Ga0495613_0165200 | 3300046689 | Bacteria | 1573 |
| 1141 | Ga0495624_0084998 | 3300046690 | Bacteria | 1955 |
| 1142 | Ga0495670_0077621 | 3300046691 | Bacteria | 1688 |
| 1143 | Ga0495671_0013120 | 3300046692 | Bacteria | 4501 |
| 1144 | Ga0495649_0073721 | 3300046694 | Bacteria | 1829 |
| 1145 | Ga0495600_0014445 | 3300046809 | Bacteria | 4977 |
| 1146 | Ga0495600_0121970 | 3300046809 | Bacteria | 1695 |
| 1147 | Ga0495660_0068273 | 3300046810 | Bacteria | 1892 |
| 1148 | Ga0495581_0183313 | 3300047315 | Bacteria | 1224 |
| 1149 | Ga0495581_0358551 | 3300047315 | Bacteria | 851 |
| 1150 | Ga0495604_0017364 | 3300047317 | Bacteria | 5760 |
| 1151 | Ga0495604_0050776 | 3300047317 | Bacteria | 3219 |
| 1152 | Ga0495674_0003734 | 3300047319 | Bacteria | 14802 |
| 1153 | Ga0495674_0019590 | 3300047319 | Bacteria | 6277 |
| 1154 | Ga0495674_0066087 | 3300047319 | Bacteria | 3139 |
| 1155 | Ga0495674_0075206 | 3300047319 | Bacteria | 2907 |
| 1156 | Ga0495674_0635030 | 3300047319 | Bacteria | 843 |
| 1157 | Ga0495672_0120073 | 3300047320 | Bacteria | 1398 |
| 1158 | Ga0495676_0252845 | 3300047321 | Bacteria | 1201 |
| 1159 | Ga0495680_0318562 | 3300047322 | Bacteria | 1089 |
| 1160 | Ga0495687_000636 | 3300047443 | Bacteria | 40190 |
| 1161 | Ga0495687_053901 | 3300047443 | Bacteria | 1691 |
| 1162 | Ga0495675_0016558 | 3300047444 | Bacteria | 4664 |
| 1163 | Ga0495675_0243056 | 3300047444 | Bacteria | 1083 |
| 1164 | Ga0495677_0039577 | 3300047445 | Bacteria | 1723 |
| 1165 | Ga0495673_0019819 | 3300047469 | Bacteria | 3363 |
| 1166 | Ga0495684_0260261 | 3300047471 | Bacteria | 1259 |
| 1167 | Ga0495686_0001513 | 3300047472 | Bacteria | 25024 |
| 1168 | Ga0495686_0044699 | 3300047472 | Bacteria | 2803 |
| 1169 | Ga0495686_0050724 | 3300047472 | Bacteria | 2607 |
| 1170 | Ga0495686_0092606 | 3300047472 | Bacteria | 1833 |
| 1171 | Ga0495686_0122347 | 3300047472 | Bacteria | 1549 |
| 1172 | Ga0495593_0120701 | 3300047673 | Bacteria | 1334 |
| 1173 | Ga0495602_0004753 | 3300048088 | Bacteria | 14201 |
| 1174 | Ga0495602_0125217 | 3300048088 | Bacteria | 2060 |
| 1175 | Ga0495614_0138734 | 3300048089 | Bacteria | 1080 |
| 1176 | Ga0495614_0176856 | 3300048089 | Bacteria | 959 |
| 1177 | Ga0495615_0008681 | 3300048090 | Bacteria | 1974 |
| 1178 | Ga0495626_0028174 | 3300048091 | Bacteria | 2725 |
| 1179 | Ga0495626_0159647 | 3300048091 | Bacteria | 946 |
| 1180 | Ga0496100_0029263 | 3300048903 | Bacteria | 3405 |
| 1181 | Ga0496101_0088114 | 3300048904 | Bacteria | 2305 |
| 1182 | Ga0496101_0159819 | 3300048904 | Bacteria | 1728 |
| 1183 | Ga0496102_0003637 | 3300048905 | Bacteria | 13037 |
| 1184 | Ga0496102_0269043 | 3300048905 | Bacteria | 1607 |
| 1185 | Ga0496102_0371850 | 3300048905 | Bacteria | 1345 |
| 1186 | Ga0496102_0633484 | 3300048905 | Bacteria | 992 |
| 1187 | Ga0496104_0167233 | 3300048907 | Bacteria | 2108 |
| 1188 | Ga0496105_0003045 | 3300048908 | Bacteria | 12322 |
| 1189 | Ga0496105_0004996 | 3300048908 | Bacteria | 10039 |
| 1190 | Ga0496105_0377778 | 3300048908 | Bacteria | 1128 |
| 1191 | Ga0496106_0000089 | 3300048909 | Bacteria | 72356 |
| 1192 | Ga0496106_0000244 | 3300048909 | Bacteria | 37887 |
| 1193 | Ga0496106_0006866 | 3300048909 | Bacteria | 8425 |
| 1194 | Ga0496106_0070480 | 3300048909 | Bacteria | 2670 |
| 1195 | Ga0496106_0530957 | 3300048909 | Bacteria | 945 |
| 1196 | Ga0496106_0610108 | 3300048909 | Bacteria | 874 |
| 1197 | Ga0496107_0016369 | 3300048910 | Bacteria | 5204 |
| 1198 | Ga0496107_0458134 | 3300048910 | Bacteria | 947 |
| 1199 | Ga0496108_0035648 | 3300048911 | Bacteria | 4136 |
| 1200 | Ga0496108_0287346 | 3300048911 | Bacteria | 1432 |
| 1201 | Ga0496108_0661789 | 3300048911 | Bacteria | 907 |
| 1202 | Ga0496108_0698079 | 3300048911 | Bacteria | 880 |
| 1203 | Ga0496109_0006604 | 3300048912 | Bacteria | 9767 |
| 1204 | Ga0496109_0145378 | 3300048912 | Bacteria | 2218 |
| 1205 | Ga0496109_0456873 | 3300048912 | Bacteria | 1206 |
| 1206 | Ga0496109_0511747 | 3300048912 | Bacteria | 1133 |
| 1207 | Ga0496110_0001819 | 3300048913 | Bacteria | 15723 |
| 1208 | Ga0496110_0050345 | 3300048913 | Bacteria | 3657 |
| 1209 | Ga0496110_0085247 | 3300048913 | Bacteria | 2820 |
| 1210 | Ga0496110_0248324 | 3300048913 | Bacteria | 1619 |
| 1211 | Ga0496111_0143633 | 3300048914 | Bacteria | 1769 |
| 1212 | Ga0496112_0003238 | 3300048915 | Bacteria | 13412 |
| 1213 | Ga0496112_0012529 | 3300048915 | Bacteria | 7790 |
| 1214 | Ga0496112_0138882 | 3300048915 | Bacteria | 2400 |
| 1215 | Ga0496112_0145815 | 3300048915 | Bacteria | 2336 |
| 1216 | Ga0496113_0012993 | 3300048916 | Bacteria | 5618 |
| 1217 | Ga0496113_0140626 | 3300048916 | Bacteria | 1899 |
| 1218 | Ga0496114_0287786 | 3300048917 | Bacteria | 1449 |
| 1219 | Ga0496115_0033571 | 3300048918 | Bacteria | 4052 |
| 1220 | Ga0496115_0167400 | 3300048918 | Bacteria | 1818 |
| 1221 | Ga0496117_0051502 | 3300048920 | Bacteria | 2910 |
| 1222 | Ga0496117_0079523 | 3300048920 | Bacteria | 2160 |
| 1223 | Ga0496118_0004232 | 3300048921 | Bacteria | 17221 |
| 1224 | Ga0496118_0021785 | 3300048921 | Bacteria | 5627 |
| 1225 | Ga0496118_0027353 | 3300048921 | Bacteria | 4829 |
| 1226 | Ga0496118_0039503 | 3300048921 | Bacteria | 3764 |
| 1227 | Ga0496118_0049073 | 3300048921 | Bacteria | 3253 |
| 1228 | Ga0496118_0054398 | 3300048921 | Bacteria | 3032 |
| 1229 | Ga0496118_0146758 | 3300048921 | Bacteria | 1484 |
| 1230 | Ga0496118_0157581 | 3300048921 | Bacteria | 1410 |
| 1231 | Ga0496119_0030275 | 3300048922 | Bacteria | 3654 |
| 1232 | Ga0496119_0038482 | 3300048922 | Bacteria | 3090 |
| 1233 | Ga0496119_0075543 | 3300048922 | Bacteria | 1958 |
| 1234 | Ga0496120_0004296 | 3300048923 | Bacteria | 12080 |
| 1235 | Ga0496120_0060488 | 3300048923 | Bacteria | 2119 |
| 1236 | Ga0496121_0009702 | 3300048924 | Bacteria | 11021 |
| 1237 | Ga0496121_0012571 | 3300048924 | Bacteria | 9209 |
| 1238 | Ga0496121_0013490 | 3300048924 | Bacteria | 8771 |
| 1239 | Ga0496121_0016499 | 3300048924 | Bacteria | 7621 |
| 1240 | Ga0496121_0024781 | 3300048924 | Bacteria | 5722 |
| 1241 | Ga0496121_0035975 | 3300048924 | Bacteria | 4423 |
| 1242 | Ga0496121_0056807 | 3300048924 | Bacteria | 3248 |
| 1243 | Ga0496121_0059968 | 3300048924 | Bacteria | 3134 |
| 1244 | Ga0496121_0095041 | 3300048924 | Bacteria | 2317 |
| 1245 | Ga0496121_0095365 | 3300048924 | Bacteria | 2312 |
| 1246 | Ga0496121_0098369 | 3300048924 | Bacteria | 2264 |
| 1247 | Ga0496122_0116596 | 3300048925 | Bacteria | 1736 |
| 1248 | Ga0496123_0215154 | 3300048926 | Bacteria | 973 |
| 1249 | Ga0496124_0004856 | 3300048927 | Bacteria | 15458 |
| 1250 | Ga0496124_0016982 | 3300048927 | Bacteria | 6889 |
| 1251 | Ga0496124_0056724 | 3300048927 | Bacteria | 3302 |
| 1252 | Ga0496124_0187153 | 3300048927 | Bacteria | 1588 |
| 1253 | Ga0496124_0243589 | 3300048927 | Bacteria | 1335 |
| 1254 | Ga0496125_0002684 | 3300048928 | Bacteria | 22676 |
| 1255 | Ga0496125_0014515 | 3300048928 | Bacteria | 7668 |
| 1256 | Ga0496125_0040917 | 3300048928 | Bacteria | 3968 |
| 1257 | Ga0496125_0147210 | 3300048928 | Bacteria | 1625 |
| 1258 | Ga0496126_0001193 | 3300048929 | Bacteria | 42367 |
| 1259 | Ga0496126_0015119 | 3300048929 | Bacteria | 7773 |
| 1260 | Ga0496126_0019399 | 3300048929 | Bacteria | 6697 |
| 1261 | Ga0496126_0066929 | 3300048929 | Bacteria | 3211 |
| 1262 | Ga0496126_0148270 | 3300048929 | Bacteria | 2013 |
| 1263 | Ga0496126_0236359 | 3300048929 | Bacteria | 1528 |
| 1264 | Ga0496126_0339699 | 3300048929 | Bacteria | 1230 |
| 1265 | Ga0496126_0369161 | 3300048929 | Bacteria | 1170 |
| 1266 | Ga0495678_020140 | 3300049459 | Bacteria | 2960 |
| 1267 | Ga0501298_001895 | 3300049521 | Bacteria | 3113 |
| 1268 | Ga0501031_0000009 | 3300049568 | Bacteria | 155116 |
| 1269 | Ga0501031_0014617 | 3300049568 | Bacteria | 5103 |
| 1270 | Ga0501031_0018659 | 3300049568 | Bacteria | 4517 |
| 1271 | Ga0501032_0000017 | 3300049569 | Bacteria | 158303 |
| 1272 | Ga0501032_0042254 | 3300049569 | Bacteria | 3092 |
| 1273 | Ga0501032_0042410 | 3300049569 | Bacteria | 3086 |
| 1274 | Ga0501032_0055957 | 3300049569 | Bacteria | 2653 |
| 1275 | Ga0501032_0077697 | 3300049569 | Bacteria | 2210 |
| 1276 | Ga0501032_0116702 | 3300049569 | Bacteria | 1765 |
| 1277 | Ga0501032_0375624 | 3300049569 | Bacteria | 914 |
| 1278 | Ga0501033_0000029 | 3300049570 | Bacteria | 158294 |
| 1279 | Ga0501033_0000210 | 3300049570 | Bacteria | 55950 |
| 1280 | Ga0501033_0014151 | 3300049570 | Bacteria | 6065 |
| 1281 | Ga0501033_0029259 | 3300049570 | Bacteria | 4140 |
| 1282 | Ga0501033_0040867 | 3300049570 | Bacteria | 3462 |
| 1283 | Ga0501033_0050293 | 3300049570 | Bacteria | 3092 |
| 1284 | Ga0501033_0142089 | 3300049570 | Bacteria | 1735 |
| 1285 | Ga0501033_0226633 | 3300049570 | Bacteria | 1329 |
| 1286 | Ga0501034_0000102 | 3300049571 | Bacteria | 158302 |
| 1287 | Ga0501034_0010066 | 3300049571 | Bacteria | 9869 |
| 1288 | Ga0501034_0022378 | 3300049571 | Bacteria | 6443 |
| 1289 | Ga0501034_0058070 | 3300049571 | Bacteria | 3889 |
| 1290 | Ga0501034_0080355 | 3300049571 | Bacteria | 3263 |
| 1291 | Ga0501034_0111704 | 3300049571 | Bacteria | 2723 |
| 1292 | Ga0501034_0131166 | 3300049571 | Bacteria | 2489 |
| 1293 | Ga0501034_0138098 | 3300049571 | Bacteria | 2418 |
| 1294 | Ga0501034_0154056 | 3300049571 | Bacteria | 2273 |
| 1295 | Ga0501034_0185301 | 3300049571 | Bacteria | 2045 |
| 1296 | Ga0501036_0000011 | 3300049572 | Bacteria | 158302 |
| 1297 | Ga0501036_0028446 | 3300049572 | Bacteria | 4723 |
| 1298 | Ga0501036_0029066 | 3300049572 | Bacteria | 4672 |
| 1299 | Ga0501036_0112113 | 3300049572 | Bacteria | 2305 |
| 1300 | Ga0501036_0151100 | 3300049572 | Bacteria | 1959 |
| 1301 | Ga0501036_0167560 | 3300049572 | Bacteria | 1851 |
| 1302 | Ga0501036_0270847 | 3300049572 | Bacteria | 1422 |
| 1303 | Ga0501036_0308729 | 3300049572 | Bacteria | 1323 |
| 1304 | Ga0501036_0505528 | 3300049572 | Bacteria | 1005 |
| 1305 | Ga0501036_0580523 | 3300049572 | Bacteria | 931 |
| 1306 | Ga0501036_0754375 | 3300049572 | Bacteria | 803 |
| 1307 | Ga0501037_0000015 | 3300049573 | Bacteria | 161311 |
| 1308 | Ga0501037_0015564 | 3300049573 | Bacteria | 5597 |
| 1309 | Ga0501037_0036508 | 3300049573 | Bacteria | 3621 |
| 1310 | Ga0501037_0140858 | 3300049573 | Bacteria | 1726 |
| 1311 | Ga0501037_0154317 | 3300049573 | Bacteria | 1640 |
| 1312 | Ga0501037_0220141 | 3300049573 | Bacteria | 1336 |
| 1313 | Ga0501037_0226416 | 3300049573 | Bacteria | 1314 |
| 1314 | Ga0501038_0000016 | 3300049574 | Bacteria | 159150 |
| 1315 | Ga0501038_0016141 | 3300049574 | Bacteria | 6777 |
| 1316 | Ga0501038_0017713 | 3300049574 | Bacteria | 6438 |
| 1317 | Ga0501038_0043422 | 3300049574 | Bacteria | 3909 |
| 1318 | Ga0501038_0064206 | 3300049574 | Bacteria | 3132 |
| 1319 | Ga0501038_0071775 | 3300049574 | Bacteria | 2936 |
| 1320 | Ga0501038_0089947 | 3300049574 | Bacteria | 2574 |
| 1321 | Ga0501038_0093812 | 3300049574 | Bacteria | 2510 |
| 1322 | Ga0501038_0345032 | 3300049574 | Bacteria | 1161 |
| 1323 | Ga0501039_0000023 | 3300049575 | Bacteria | 158026 |
| 1324 | Ga0501039_0004433 | 3300049575 | Bacteria | 10598 |
| 1325 | Ga0501039_0028219 | 3300049575 | Bacteria | 4319 |
| 1326 | Ga0501039_0031181 | 3300049575 | Bacteria | 4109 |
| 1327 | Ga0501039_0119894 | 3300049575 | Bacteria | 2061 |
| 1328 | Ga0501039_0133599 | 3300049575 | Bacteria | 1948 |
| 1329 | Ga0501039_0325715 | 3300049575 | Bacteria | 1208 |
| 1330 | Ga0501039_0417542 | 3300049575 | Bacteria | 1054 |
| 1331 | Ga0501040_0008206 | 3300049576 | Bacteria | 6790 |
| 1332 | Ga0501040_0019932 | 3300049576 | Bacteria | 4465 |
| 1333 | Ga0501040_0026385 | 3300049576 | Bacteria | 3907 |
| 1334 | Ga0501040_0026743 | 3300049576 | Bacteria | 3881 |
| 1335 | Ga0501040_0148247 | 3300049576 | Bacteria | 1654 |
| 1336 | Ga0501040_0181154 | 3300049576 | Bacteria | 1494 |
| 1337 | Ga0501041_0025799 | 3300049577 | Bacteria | 3533 |
| 1338 | Ga0501041_0408741 | 3300049577 | Bacteria | 860 |
| 1339 | Ga0501042_0013408 | 3300049578 | Bacteria | 5577 |
| 1340 | Ga0501042_0013841 | 3300049578 | Bacteria | 5495 |
| 1341 | Ga0501043_0023532 | 3300049579 | Bacteria | 4832 |
| 1342 | Ga0501043_0032719 | 3300049579 | Bacteria | 4089 |
| 1343 | Ga0501043_0033981 | 3300049579 | Bacteria | 4011 |
| 1344 | Ga0501043_0035819 | 3300049579 | Bacteria | 3904 |
| 1345 | Ga0501043_0062648 | 3300049579 | Bacteria | 2920 |
| 1346 | Ga0501043_0098517 | 3300049579 | Bacteria | 2298 |
| 1347 | Ga0501043_0157612 | 3300049579 | Bacteria | 1775 |
| 1348 | Ga0501046_0025041 | 3300049580 | Bacteria | 4888 |
| 1349 | Ga0501046_0059780 | 3300049580 | Bacteria | 2984 |
| 1350 | Ga0501046_0174005 | 3300049580 | Bacteria | 1614 |
| 1351 | Ga0501047_0003203 | 3300049581 | Bacteria | 15516 |
| 1352 | Ga0501047_0026623 | 3300049581 | Bacteria | 5565 |
| 1353 | Ga0501047_0047340 | 3300049581 | Bacteria | 4155 |
| 1354 | Ga0501047_0048280 | 3300049581 | Bacteria | 4110 |
| 1355 | Ga0501047_0068877 | 3300049581 | Bacteria | 3408 |
| 1356 | Ga0501047_0075275 | 3300049581 | Bacteria | 3248 |
| 1357 | Ga0501047_0172479 | 3300049581 | Bacteria | 2031 |
| 1358 | Ga0501047_0396161 | 3300049581 | Bacteria | 1214 |
| 1359 | Ga0501048_0001620 | 3300049582 | Bacteria | 17135 |
| 1360 | Ga0501067_0058783 | 3300049583 | Bacteria | 2128 |
| 1361 | Ga0501067_0070588 | 3300049583 | Bacteria | 1934 |
| 1362 | Ga0501067_0257412 | 3300049583 | Bacteria | 972 |
| 1363 | Ga0501068_0009831 | 3300049584 | Bacteria | 5357 |
| 1364 | Ga0501068_0015059 | 3300049584 | Bacteria | 4434 |
| 1365 | Ga0501068_0016664 | 3300049584 | Bacteria | 4238 |
| 1366 | Ga0501068_0225359 | 3300049584 | Bacteria | 1192 |
| 1367 | Ga0501068_0251236 | 3300049584 | Bacteria | 1127 |
| 1368 | Ga0501069_0084739 | 3300049585 | Bacteria | 1788 |
| 1369 | Ga0501070_0018522 | 3300049586 | Bacteria | 5841 |
| 1370 | Ga0501070_0018945 | 3300049586 | Bacteria | 5773 |
| 1371 | Ga0501070_0020275 | 3300049586 | Bacteria | 5576 |
| 1372 | Ga0501070_0025557 | 3300049586 | Bacteria | 4953 |
| 1373 | Ga0501070_0037015 | 3300049586 | Bacteria | 4074 |
| 1374 | Ga0501070_0068629 | 3300049586 | Bacteria | 2935 |
| 1375 | Ga0501070_0133287 | 3300049586 | Bacteria | 2052 |
| 1376 | Ga0501070_0209466 | 3300049586 | Bacteria | 1600 |
| 1377 | Ga0501071_0017388 | 3300049587 | Bacteria | 4959 |
| 1378 | Ga0501071_0039620 | 3300049587 | Bacteria | 3371 |
| 1379 | Ga0501071_0050093 | 3300049587 | Bacteria | 3008 |
| 1380 | Ga0501071_0184284 | 3300049587 | Bacteria | 1565 |
| 1381 | Ga0501071_0205630 | 3300049587 | Bacteria | 1480 |
| 1382 | Ga0501071_0217406 | 3300049587 | Bacteria | 1438 |
| 1383 | Ga0501071_0315002 | 3300049587 | Bacteria | 1187 |
| 1384 | Ga0501072_0037641 | 3300049588 | Bacteria | 3794 |
| 1385 | Ga0501072_0049250 | 3300049588 | Bacteria | 3316 |
| 1386 | Ga0501072_0083812 | 3300049588 | Bacteria | 2527 |
| 1387 | Ga0501073_0005813 | 3300049589 | Bacteria | 9217 |
| 1388 | Ga0501073_0008806 | 3300049589 | Bacteria | 7463 |
| 1389 | Ga0501073_0019992 | 3300049589 | Bacteria | 4829 |
| 1390 | Ga0501073_0042901 | 3300049589 | Bacteria | 3191 |
| 1391 | Ga0501073_0066141 | 3300049589 | Bacteria | 2520 |
| 1392 | Ga0501073_0073408 | 3300049589 | Bacteria | 2382 |
| 1393 | Ga0501073_0077498 | 3300049589 | Bacteria | 2313 |
| 1394 | Ga0501073_0138474 | 3300049589 | Bacteria | 1687 |
| 1395 | Ga0501074_0047062 | 3300049590 | Bacteria | 3118 |
| 1396 | Ga0501074_0060169 | 3300049590 | Bacteria | 2736 |
| 1397 | Ga0501074_0065331 | 3300049590 | Bacteria | 2619 |
| 1398 | Ga0501074_0155968 | 3300049590 | Bacteria | 1631 |
| 1399 | Ga0501074_0165729 | 3300049590 | Bacteria | 1578 |
| 1400 | Ga0501074_0385325 | 3300049590 | Bacteria | 994 |
| 1401 | Ga0501075_0000163 | 3300049591 | Bacteria | 34323 |
| 1402 | Ga0501075_0020817 | 3300049591 | Bacteria | 4775 |
| 1403 | Ga0501075_0087012 | 3300049591 | Bacteria | 2368 |
| 1404 | Ga0501076_0000053 | 3300049592 | Bacteria | 56853 |
| 1405 | Ga0501076_0011116 | 3300049592 | Bacteria | 6697 |
| 1406 | Ga0501076_0025466 | 3300049592 | Bacteria | 4578 |
| 1407 | Ga0501076_0152505 | 3300049592 | Bacteria | 1880 |
| 1408 | Ga0501076_0227431 | 3300049592 | Bacteria | 1525 |
| 1409 | Ga0501076_0322436 | 3300049592 | Bacteria | 1267 |
| 1410 | Ga0501077_0015654 | 3300049593 | Bacteria | 4777 |
| 1411 | Ga0501077_0039624 | 3300049593 | Bacteria | 3002 |
| 1412 | Ga0501077_0137745 | 3300049593 | Bacteria | 1548 |
| 1413 | Ga0501077_0399241 | 3300049593 | Bacteria | 879 |
| 1414 | Ga0501257_006345 | 3300049686 | Bacteria | 2624 |
| 1415 | Ga0501079_0014659 | 3300049741 | Bacteria | 5977 |
| 1416 | Ga0501079_0035053 | 3300049741 | Bacteria | 3861 |
| 1417 | Ga0501079_0045986 | 3300049741 | Bacteria | 3368 |
| 1418 | Ga0501079_0305361 | 3300049741 | Bacteria | 1245 |
| 1419 | Ga0501079_0394709 | 3300049741 | Bacteria | 1085 |
| 1420 | Ga0501079_0406008 | 3300049741 | Bacteria | 1069 |
| 1421 | Ga0501080_0021292 | 3300049742 | Bacteria | 6001 |
| 1422 | Ga0501080_0033395 | 3300049742 | Bacteria | 4802 |
| 1423 | Ga0501080_0034299 | 3300049742 | Bacteria | 4737 |
| 1424 | Ga0501080_0036427 | 3300049742 | Bacteria | 4592 |
| 1425 | Ga0501080_0044767 | 3300049742 | Bacteria | 4119 |
| 1426 | Ga0501080_0053973 | 3300049742 | Bacteria | 3742 |
| 1427 | Ga0501080_0073436 | 3300049742 | Bacteria | 3182 |
| 1428 | Ga0501080_0212505 | 3300049742 | Bacteria | 1773 |
| 1429 | Ga0501081_0005369 | 3300049743 | Bacteria | 8270 |
| 1430 | Ga0501081_0074096 | 3300049743 | Bacteria | 2375 |
| 1431 | Ga0501081_0102062 | 3300049743 | Bacteria | 2029 |
| 1432 | Ga0501081_0326101 | 3300049743 | Bacteria | 1129 |
| 1433 | Ga0501083_0031312 | 3300049744 | Bacteria | 3651 |
| 1434 | Ga0501083_0057902 | 3300049744 | Bacteria | 2594 |
| 1435 | Ga0501083_0072113 | 3300049744 | Bacteria | 2296 |
| 1436 | Ga0501083_0137946 | 3300049744 | Bacteria | 1597 |
| 1437 | Ga0501083_0374056 | 3300049744 | Bacteria | 926 |
| 1438 | Ga0501035_0000038 | 3300049822 | Bacteria | 158818 |
| 1439 | Ga0501035_0003069 | 3300049822 | Bacteria | 16026 |
| 1440 | Ga0501035_0025834 | 3300049822 | Bacteria | 5381 |
| 1441 | Ga0501035_0076163 | 3300049822 | Bacteria | 2967 |
| 1442 | Ga0501035_0105264 | 3300049822 | Bacteria | 2473 |
| 1443 | Ga0501035_0194557 | 3300049822 | Bacteria | 1742 |
| 1444 | Ga0501035_0198470 | 3300049822 | Bacteria | 1722 |
| 1445 | Ga0501035_0259307 | 3300049822 | Bacteria | 1474 |
| 1446 | Ga0501035_0500299 | 3300049822 | Bacteria | 1000 |
| 1447 | Ga0501035_0518539 | 3300049822 | Bacteria | 979 |
| 1448 | Ga0501044_0000046 | 3300049823 | Bacteria | 146812 |
| 1449 | Ga0501044_0028299 | 3300049823 | Bacteria | 5915 |
| 1450 | Ga0501044_0060853 | 3300049823 | Bacteria | 3864 |
| 1451 | Ga0501044_0085509 | 3300049823 | Bacteria | 3187 |
| 1452 | Ga0501044_0155718 | 3300049823 | Bacteria | 2264 |
| 1453 | Ga0501044_0165843 | 3300049823 | Bacteria | 2183 |
| 1454 | Ga0501044_0223045 | 3300049823 | Bacteria | 1835 |
| 1455 | Ga0501044_0574492 | 3300049823 | Bacteria | 1022 |
| 1456 | Ga0501045_0026735 | 3300049824 | Bacteria | 4153 |
| 1457 | Ga0501045_0033596 | 3300049824 | Bacteria | 3719 |
| 1458 | Ga0501045_0126575 | 3300049824 | Bacteria | 1898 |
| 1459 | Ga0501045_0195777 | 3300049824 | Bacteria | 1506 |
| 1460 | Ga0501045_0243791 | 3300049824 | Bacteria | 1338 |
| 1461 | Ga0501045_0530819 | 3300049824 | Bacteria | 873 |
| 1462 | nmdc:mga03n38_24270_c1 | 3300050490 | Bacteria | 2477 |
| 1463 | nmdc:mga03n38_299517_c1 | 3300050490 | Bacteria | 863 |
| 1464 | nmdc:mga00v17_46612_c1 | 3300050491 | Bacteria | 2623 |
| 1465 | nmdc:mga00v17_68047_c1 | 3300050491 | Bacteria | 2201 |
| 1466 | nmdc:mga00v17_78770_c1 | 3300050491 | Bacteria | 2054 |
| 1467 | nmdc:mga0yw44_104110_c1 | 3300050492 | Bacteria | 1811 |
| 1468 | nmdc:mga0yw44_114611_c1 | 3300050492 | Bacteria | 1730 |
| 1469 | nmdc:mga0yw44_17726_c1 | 3300050492 | Bacteria | 3883 |
| 1470 | nmdc:mga0yw44_5085_c1 | 3300050492 | Bacteria | 6149 |
| 1471 | nmdc:mga0yw44_71757_c1 | 3300050492 | Bacteria | 2151 |
| 1472 | nmdc:mga0yw44_7481_c1 | 3300050492 | Bacteria | 5379 |
| 1473 | nmdc:mga0yw44_8283_c1 | 3300050492 | Bacteria | 5167 |
| 1474 | nmdc:mga0k408_137152_c1 | 3300050493 | Bacteria | 1454 |
| 1475 | nmdc:mga0k408_1436_c1 | 3300050493 | Bacteria | 12900 |
| 1476 | nmdc:mga0k408_37877_c1 | 3300050493 | Bacteria | 2769 |
| 1477 | nmdc:mga0k408_4087_c1 | 3300050493 | Bacteria | 7746 |
| 1478 | nmdc:mga06z11_10062_c1 | 3300050494 | Bacteria | 4013 |
| 1479 | nmdc:mga06z11_18996_c1 | 3300050494 | Bacteria | 3151 |
| 1480 | nmdc:mga06z11_96099_c1 | 3300050494 | Bacteria | 1618 |
| 1481 | nmdc:mga04h51_141771_c1 | 3300050495 | Bacteria | 912 |
| 1482 | nmdc:mga04h51_3374_c1 | 3300050495 | Bacteria | 3879 |
| 1483 | nmdc:mga07m45_15562_c1 | 3300050496 | Bacteria | 4062 |
| 1484 | nmdc:mga07m45_38336_c1 | 3300050496 | Bacteria | 2674 |
| 1485 | nmdc:mga05p37_155007_c1 | 3300050507 | Bacteria | 2800 |
| 1486 | nmdc:mga05p37_233069_c1 | 3300050507 | Bacteria | 2217 |
| 1487 | nmdc:mga09592_244179_c1 | 3300050508 | Bacteria | 1556 |
| 1488 | nmdc:mga0qj67_49363_c1 | 3300050509 | Bacteria | 3327 |
| 1489 | nmdc:mga06r32_3096_c1 | 3300050510 | Bacteria | 14894 |
| 1490 | nmdc:mga06r32_76935_c1 | 3300050510 | Bacteria | 3241 |
| 1491 | nmdc:mga08y16_212436_c1 | 3300050511 | Bacteria | 2004 |
| 1492 | nmdc:mga08y16_473803_c1 | 3300050511 | Bacteria | 1274 |
| 1493 | nmdc:mga08y16_595_c1 | 3300050511 | Bacteria | 33721 |
| 1494 | nmdc:mga08y16_955572_c1 | 3300050511 | Bacteria | 840 |
| 1495 | nmdc:mga0n895_71252_c1 | 3300050512 | Bacteria | 3446 |
| 1496 | nmdc:mga0n895_782_c1 | 3300050512 | Bacteria | 22642 |
| 1497 | nmdc:mga0rr50_24139_c1 | 3300050513 | Bacteria | 4207 |
| 1498 | nmdc:mga0a205_216920_c1 | 3300050515 | Bacteria | 1800 |
| 1499 | nmdc:mga0a205_377503_c1 | 3300050515 | Bacteria | 1283 |
| 1500 | nmdc:mga0a205_6389_c1 | 3300050515 | Bacteria | 10647 |
| 1501 | nmdc:mga0sz30_2709_c1 | 3300050516 | Bacteria | 6320 |
| 1502 | nmdc:mga0sz30_42656_c1 | 3300050516 | Bacteria | 1909 |
| 1503 | nmdc:mga0sz30_51037_c1 | 3300050516 | Bacteria | 1754 |
| 1504 | Ga0495601_0000401 | 3300053077 | Bacteria | 22929 |
| 1505 | Ga0495601_0041759 | 3300053077 | Bacteria | 2876 |
| 1506 | Ga0495612_0004593 | 3300053078 | Bacteria | 5724 |
| 1507 | Ga0500635_0001263 | 3300053080 | Bacteria | 6038 |
| 1508 | Ga0495655_0006637 | 3300053083 | Bacteria | 2115 |
| 1509 | Ga0495595_0028715 | 3300053084 | Bacteria | 2486 |
| 1510 | Ga0495619_0021683 | 3300053085 | Bacteria | 4104 |
| 1511 | Ga0495619_0065107 | 3300053085 | Bacteria | 2431 |
| 1512 | Ga0495619_0086737 | 3300053085 | Bacteria | 2116 |
| 1513 | Ga0495619_0119100 | 3300053085 | Bacteria | 1809 |
| 1514 | Ga0500578_0039666 | 3300053086 | Bacteria | 3026 |
| 1515 | Ga0500643_051840 | 3300053087 | Bacteria | 1171 |
| 1516 | Ga0500644_0034129 | 3300053088 | Bacteria | 1639 |
| 1517 | Ga0500646_0017535 | 3300053090 | Bacteria | 1878 |
| 1518 | Ga0500647_0006028 | 3300053091 | Bacteria | 5097 |
| 1519 | Ga0500647_0106100 | 3300053091 | Bacteria | 1339 |
| 1520 | Ga0500583_0016915 | 3300053092 | Bacteria | 2923 |
| 1521 | Ga0500651_0048095 | 3300053093 | Bacteria | 2680 |
| 1522 | Ga0500566_0007888 | 3300053094 | Bacteria | 6303 |
| 1523 | Ga0500566_0031098 | 3300053094 | Bacteria | 3113 |
| 1524 | Ga0500566_0158317 | 3300053094 | Bacteria | 1183 |
| 1525 | Ga0500641_0152109 | 3300053096 | Bacteria | 999 |
| 1526 | Ga0500650_0033296 | 3300053098 | Bacteria | 2350 |
| 1527 | Ga0500555_003111 | 3300053103 | Bacteria | 4735 |
| 1528 | Ga0500555_012168 | 3300053103 | Bacteria | 2474 |
| 1529 | Ga0500556_0024413 | 3300053104 | Bacteria | 1986 |
| 1530 | Ga0500562_006674 | 3300053108 | Bacteria | 2908 |
| 1531 | Ga0500562_079513 | 3300053108 | Bacteria | 887 |
| 1532 | Ga0500572_024060 | 3300053111 | Bacteria | 1640 |
| 1533 | Ga0500592_008699 | 3300053116 | Bacteria | 1612 |
| 1534 | Ga0500594_0004484 | 3300053118 | Bacteria | 3078 |
| 1535 | Ga0500594_0047780 | 3300053118 | Bacteria | 1195 |
| 1536 | Ga0500595_000266 | 3300053119 | Bacteria | 34654 |
| 1537 | Ga0500595_001200 | 3300053119 | Bacteria | 14322 |
| 1538 | Ga0500595_015995 | 3300053119 | Bacteria | 2802 |
| 1539 | Ga0500595_020314 | 3300053119 | Bacteria | 2393 |
| 1540 | Ga0500595_028672 | 3300053119 | Bacteria | 1896 |
| 1541 | Ga0500608_063462 | 3300053122 | Bacteria | 1763 |
| 1542 | Ga0500608_117175 | 3300053122 | Bacteria | 1213 |
| 1543 | Ga0500614_043074 | 3300053123 | Bacteria | 1155 |
| 1544 | Ga0500642_0000900 | 3300053130 | Bacteria | 8630 |
| 1545 | Ga0500642_0065334 | 3300053130 | Bacteria | 1643 |
| 1546 | Ga0500642_0129993 | 3300053130 | Bacteria | 1180 |
| 1547 | Ga0500658_0007094 | 3300053134 | Bacteria | 4146 |
| 1548 | Ga0500658_0016918 | 3300053134 | Bacteria | 2719 |
| 1549 | Ga0500658_0113384 | 3300053134 | Bacteria | 1195 |
| 1550 | Ga0500561_0044642 | 3300053137 | Bacteria | 1185 |
| 1551 | Ga0500568_0000415 | 3300053139 | Bacteria | 32506 |
| 1552 | Ga0500568_0001174 | 3300053139 | Bacteria | 17524 |
| 1553 | Ga0500573_0060387 | 3300053140 | Bacteria | 2171 |
| 1554 | Ga0500577_0068019 | 3300053142 | Bacteria | 1389 |
| 1555 | Ga0500577_0105596 | 3300053142 | Bacteria | 1156 |
| 1556 | Ga0500588_0001609 | 3300053146 | Bacteria | 4352 |
| 1557 | Ga0500588_0007470 | 3300053146 | Bacteria | 2520 |
| 1558 | Ga0500603_021372 | 3300053150 | Bacteria | 1591 |
| 1559 | Ga0500604_0009878 | 3300053151 | Bacteria | 2545 |
| 1560 | Ga0500604_0019145 | 3300053151 | Bacteria | 1914 |
| 1561 | Ga0500616_0002694 | 3300053153 | Bacteria | 14436 |
| 1562 | Ga0500616_0055477 | 3300053153 | Bacteria | 2072 |
| 1563 | Ga0500616_0088404 | 3300053153 | Bacteria | 1540 |
| 1564 | Ga0500616_0208982 | 3300053153 | Bacteria | 859 |
| 1565 | Ga0500619_122099 | 3300053154 | Bacteria | 888 |
| 1566 | Ga0500620_000234 | 3300053155 | Bacteria | 11002 |
| 1567 | Ga0500622_0000646 | 3300053156 | Bacteria | 31129 |
| 1568 | Ga0500622_0000772 | 3300053156 | Bacteria | 27803 |
| 1569 | Ga0500622_0059991 | 3300053156 | Bacteria | 1942 |
| 1570 | Ga0500622_0084763 | 3300053156 | Bacteria | 1582 |
| 1571 | Ga0500627_0006268 | 3300053158 | Bacteria | 4036 |
| 1572 | Ga0500627_0032262 | 3300053158 | Bacteria | 2206 |
| 1573 | Ga0500627_0073122 | 3300053158 | Bacteria | 1520 |
| 1574 | Ga0500627_0079467 | 3300053158 | Bacteria | 1460 |
| 1575 | Ga0500627_0099687 | 3300053158 | Bacteria | 1303 |
| 1576 | Ga0500627_0236847 | 3300053158 | Bacteria | 811 |
| 1577 | Ga0500630_121514 | 3300053159 | Bacteria | 1156 |
| 1578 | Ga0500633_0030142 | 3300053160 | Bacteria | 1741 |
| 1579 | Ga0500634_0037402 | 3300053161 | Bacteria | 2639 |
| 1580 | Ga0500634_0062976 | 3300053161 | Bacteria | 1963 |
| 1581 | Ga0500638_158005 | 3300053162 | Bacteria | 1001 |
| 1582 | Ga0500639_004632 | 3300053163 | Bacteria | 6991 |
| 1583 | Ga0500639_089488 | 3300053163 | Bacteria | 1536 |
| 1584 | Ga0500636_0011613 | 3300053177 | Bacteria | 5156 |
| 1585 | Ga0500636_0044811 | 3300053177 | Bacteria | 2608 |
| 1586 | Ga0500636_0050905 | 3300053177 | Bacteria | 2435 |
| 1587 | Ga0500636_0121702 | 3300053177 | Bacteria | 1463 |
| 1588 | Ga0500636_0166768 | 3300053177 | Bacteria | 1195 |
| 1589 | Ga0500636_0237738 | 3300053177 | Bacteria | 938 |
| 1590 | Ga0500637_0060181 | 3300053178 | Bacteria | 2174 |
| 1591 | Ga0500611_003636 | 3300053727 | Bacteria | 1999 |
| 1592 | Ga0500645_030897 | 3300053730 | Bacteria | 1610 |
| 1593 | Ga0500609_004076 | 3300053731 | Bacteria | 2032 |
| 1594 | Ga0500609_012380 | 3300053731 | Bacteria | 1153 |
| 1595 | Ga0500609_027406 | 3300053731 | Bacteria | 781 |
| 1596 | Ga0500596_015532 | 3300053735 | Bacteria | 1143 |
| 1597 | Ga0500587_000428 | 3300053739 | Bacteria | 4934 |
| 1598 | Ga0501084_0007550 | 3300054114 | Bacteria | 8968 |
| 1599 | Ga0501084_0018918 | 3300054114 | Bacteria | 5734 |
| 1600 | Ga0501084_0074772 | 3300054114 | Bacteria | 2838 |
| 1601 | Ga0501084_0144096 | 3300054114 | Bacteria | 2006 |
| 1602 | Ga0501084_0189154 | 3300054114 | Bacteria | 1737 |
| 1603 | Ga0501084_0724310 | 3300054114 | Bacteria | 838 |
| 1604 | Ga0500661_008047 | 3300055283 | Bacteria | 1942 |
| 1605 | Ga0590075_003951 | 3300059424 | Bacteria | 3512 |
| 1606 | Ga0501082_0032387 | 3300060353 | Bacteria | 4508 |
| 1607 | Ga0501082_0060048 | 3300060353 | Bacteria | 3275 |
| 1608 | Ga0501082_0062878 | 3300060353 | Bacteria | 3196 |
| 1609 | Ga0501082_0097519 | 3300060353 | Bacteria | 2541 |
| 1610 | Ga0501082_0108271 | 3300060353 | Bacteria | 2405 |
| 1611 | Ga0501082_0403043 | 3300060353 | Bacteria | 1194 |
| 1612 | Ga0501082_0538073 | 3300060353 | Bacteria | 1021 |
| 1613 | Ga0530510_0000093 | 3300061734 | Bacteria | 48352 |
| 1614 | Ga0530510_0013400 | 3300061734 | Bacteria | 5765 |
| 1615 | Ga0530510_0040966 | 3300061734 | Bacteria | 3344 |
| 1616 | Ga0530510_0047637 | 3300061734 | Bacteria | 3097 |
| 1617 | Ga0530510_0182661 | 3300061734 | Bacteria | 1555 |
| 1618 | 2509390254 | 2509276021 | Bacteria | 7634384 |
| 1619 | 2513927193 | 2513237146 | Bacteria | 7166346 |
| 1620 | 2588517406 | 2588253730 | Bacteria | 6881675 |
| 1621 | 2599415368 | 2599185170 | Bacteria | 7295545 |
| 1622 | 2805926745 | 2802429605 | Bacteria | 6875453 |
| 1623 | 2838671678 | 2838668709 | Bacteria | 6671819 |
| 1624 | 2838704357 | 2838701080 | Bacteria | 6669771 |
| 1625 | 2842149576 | 2842146304 | Bacteria | 5957337 |
| 1626 | 2842254259 | 2842250916 | Bacteria | 6579627 |
| 1627 | 2842285276 | 2842285085 | Bacteria | 6011953 |
| 1628 | 2842402635 | 2842402390 | Bacteria | 6681310 |
| 1629 | 2842409993 | 2842409023 | Bacteria | 6687331 |
| 1630 | 2842416642 | 2842415677 | Bacteria | 6596907 |
| 1631 | 2842436806 | 2842434925 | Bacteria | 6502746 |
| 1632 | 2904581789 | 2904578770 | Bacteria | 5302906 |
| 1633 | 2919123456 | 2919119836 | Bacteria | 5208557 |
| 1634 | 2932795588 | 2932794094 | Bacteria | 7915132 |
| 1635 | 2932807816 | 2932801729 | Bacteria | 7987968 |
| 1636 | 2935885993 | 2935883170 | Bacteria | 7964738 |
| 1637 | 2937854458 | 2937848649 | Bacteria | 6983481 |
| 1638 | 2970540791 | 2970540015 | Bacteria | 6977556 |
| 1639 | 2977924153 | 2977922695 | Bacteria | 6956781 |
| 1640 | 2977991745 | 2977986579 | Bacteria | 6581278 |
| 1641 | 2996891769 | 2996887358 | Bacteria | 5795980 |
| 1642 | 2996897971 | 2996893221 | Bacteria | 5823108 |
| 1643 | 3000140742 | 3000135777 | Bacteria | 6891109 |
| 1644 | 3004215888 | 3004211236 | Bacteria | 7417683 |
| 1645 | 3004221946 | 3004218560 | Bacteria | 7421728 |
| 1646 | 8005263099 | 8005258706 | Bacteria | 6184835 |
| 1647 | 8005289733 | 8005289223 | Bacteria | 6634003 |
| 1648 | 8005326296 | 8005321885 | Bacteria | 5795980 |
| 1649 | 8005433375 | 8005430974 | Bacteria | 6689030 |
| 1650 | 8005630117 | 8005626139 | Bacteria | 6534237 |
| 1651 | 8016589698 | 8016583857 | Bacteria | 10421953 |
| 1652 | 8024501281 | 8024501048 | Bacteria | 6427847 |
| 1653 | 8049298039 | 8049293176 | Bacteria | 6128433 |
| 1654 | 8057579364 | 8057575449 | Bacteria | 7367519 |
| 1655 | nmdc:mga03n38_42252_c1 | |||
| 1656 | JGI24740J21852_10040824 | |||
| 1657 | JGI25158J39367_1000548 | |||
| 1658 | JGI25157J39369_1001276 | |||
| 1659 | JGI25152J39213_1005130 | |||
| 1660 | JGI25152J39213_1006776 | |||
| 1661 | JGI25150J39212_1007959 | |||
| 1662 | JGI25159J45721_1000012 | |||
| 1663 | JGI25159J45721_1001972 | |||
| 1664 | JGI25151J46595_10005842 | |||
| 1665 | JGI25406J46586_10005327 | |||
| 1666 | JGI25165J46597_1000015 | |||
| 1667 | JGI25165J46597_1002828 | |||
| 1668 | JGI25153J46596_10000033 | |||
| 1669 | JGI25153J46596_10000047 | |||
| 1670 | JGI25153J46596_10024486 | |||
| 1671 | rootH2_10079132 | |||
| 1672 | JGI25160J50197_1000042 | |||
| 1673 | JGI25160J50197_1000068 | |||
| 1674 | JGI25160J50197_1006678 | |||
| 1675 | JGI25161J50226_1000048 | |||
| 1676 | JGI25161J50226_1000254 | |||
| 1677 | JGI25161J50226_1002172 | |||
| 1678 | Ga0055542_1000406 | |||
| 1679 | Ga0055526_1003068 | |||
| 1680 | Ga0055526_1003780 | |||
| 1681 | Ga0055526_1005774 | |||
| 1682 | Ga0055524_1022164 | |||
| 1683 | Ga0055536_1007787 | |||
| 1684 | Ga0055536_1009742 | |||
| 1685 | Ga0055534_1002995 | |||
| 1686 | Ga0055528_1000081 | |||
| 1687 | Ga0055528_1002961 | |||
| 1688 | Ga0055528_1010205 | |||
| 1689 | Ga0055530_10023412 | |||
| 1690 | Ga0055540_1005863 | |||
| 1691 | Ga0055540_1007063 | |||
| 1692 | Ga0055531_10000775 | |||
| 1693 | Ga0055531_10020004 | |||
| 1694 | Ga0055543_1000031 | |||
| 1695 | Ga0055543_1000046 | |||
| 1696 | Ga0055543_1000452 | |||
| 1697 | Ga0065165_1000174 | |||
| 1698 | Ga0065165_1000175 | |||
| 1699 | Ga0065165_1016574 | |||
| 1700 | Ga0065704_10243647 | |||
| 1701 | Ga0065712_10084375 | |||
| 1702 | Ga0065715_10005719 | |||
| 1703 | Ga0070658_10072794 | |||
| 1704 | Ga0070658_10121171 | |||
| 1705 | Ga0070676_10001690 | |||
| 1706 | Ga0070676_10032420 | |||
| 1707 | Ga0070690_100000104 | |||
| 1708 | Ga0070690_100006691 | |||
| 1709 | Ga0070690_100093173 | |||
| 1710 | Ga0070690_100115124 | |||
| 1711 | Ga0070670_100234182 | |||
| 1712 | Ga0070677_10006920 | |||
| 1713 | Ga0070677_10087821 | |||
| 1714 | Ga0068869_100006830 | |||
| 1715 | Ga0068869_100010468 | |||
| 1716 | Ga0068869_100013291 | |||
| 1717 | Ga0068869_100037678 | |||
| 1718 | Ga0068869_100045381 | |||
| 1719 | Ga0068869_100195193 | |||
| 1720 | Ga0070666_10003654 | |||
| 1721 | Ga0070666_10266559 | |||
| 1722 | Ga0070666_10374691 | |||
| 1723 | Ga0070680_100106467 | |||
| 1724 | Ga0070680_100140641 | |||
| 1725 | Ga0068868_100001028 | |||
| 1726 | Ga0068868_100002870 | |||
| 1727 | Ga0068868_100020673 | |||
| 1728 | Ga0068868_100028159 | |||
| 1729 | Ga0068868_100101056 | |||
| 1730 | Ga0070660_100021992 | |||
| 1731 | Ga0070660_100027337 | |||
| 1732 | Ga0070660_100160073 | |||
| 1733 | Ga0070689_100002051 | |||
| 1734 | Ga0070689_100039569 | |||
| 1735 | Ga0070689_100262363 | |||
| 1736 | Ga0070691_10032040 | |||
| 1737 | Ga0070687_100375729 | |||
| 1738 | Ga0070661_100003782 | |||
| 1739 | Ga0070661_100135355 | |||
| 1740 | Ga0070668_100004957 | |||
| 1741 | Ga0070668_100021056 | |||
| 1742 | Ga0070668_100060860 | |||
| 1743 | Ga0070668_100423111 | |||
| 1744 | Ga0070669_100007652 | |||
| 1745 | Ga0070669_100047893 | |||
| 1746 | Ga0070669_100058280 | |||
| 1747 | Ga0070669_100107389 | |||
| 1748 | Ga0070669_100124903 | |||
| 1749 | Ga0070669_100232146 | |||
| 1750 | Ga0070675_100002408 | |||
| 1751 | Ga0070675_100011906 | |||
| 1752 | Ga0070675_100174674 | |||
| 1753 | Ga0070671_100009046 | |||
| 1754 | Ga0070671_100012205 | |||
| 1755 | Ga0070671_100022921 | |||
| 1756 | Ga0070671_100050547 | |||
| 1757 | Ga0070671_100420339 | |||
| 1758 | Ga0070674_100014204 | |||
| 1759 | Ga0070674_100017014 | |||
| 1760 | Ga0070674_100018973 | |||
| 1761 | Ga0070674_100060883 | |||
| 1762 | Ga0070674_100283065 | |||
| 1763 | Ga0070674_100326663 | |||
| 1764 | Ga0070674_100353166 | |||
| 1765 | Ga0070674_100422101 | |||
| 1766 | Ga0070673_100008458 | |||
| 1767 | Ga0070673_100028973 | |||
| 1768 | Ga0070673_100338482 | |||
| 1769 | Ga0070688_100160781 | |||
| 1770 | Ga0070688_100422618 | |||
| 1771 | Ga0070659_100040241 | |||
| 1772 | Ga0070659_100056900 | |||
| 1773 | Ga0070659_100181776 | |||
| 1774 | Ga0070659_100573082 | |||
| 1775 | Ga0070667_100010392 | |||
| 1776 | Ga0070667_100040888 | |||
| 1777 | Ga0070667_100136027 | |||
| 1778 | Ga0070667_100429243 | |||
| 1779 | Ga0070709_10012841 | |||
| 1780 | Ga0070714_100005358 | |||
| 1781 | Ga0070713_100100618 | |||
| 1782 | Ga0070713_100399502 | |||
| 1783 | Ga0070710_10001811 | |||
| 1784 | Ga0070701_10000723 | |||
| 1785 | Ga0070711_100000775 | |||
| 1786 | Ga0070711_100215371 | |||
| 1787 | Ga0070700_100043222 | |||
| 1788 | Ga0070700_100453120 | |||
| 1789 | Ga0070694_100049626 | |||
| 1790 | Ga0070663_100256134 | |||
| 1791 | Ga0070663_100299082 | |||
| 1792 | Ga0070663_100416249 | |||
| 1793 | Ga0070678_100003442 | |||
| 1794 | Ga0070678_100030637 | |||
| 1795 | Ga0070678_100032986 | |||
| 1796 | Ga0070678_100036530 | |||
| 1797 | Ga0070678_100124938 | |||
| 1798 | Ga0070662_100072730 | |||
| 1799 | Ga0070662_100124422 | |||
| 1800 | Ga0070662_100128016 | |||
| 1801 | Ga0070681_10673650 | |||
| 1802 | Ga0068867_100000091 | |||
| 1803 | Ga0068867_100010378 | |||
| 1804 | Ga0068867_100035822 | |||
| 1805 | Ga0068867_100039441 | |||
| 1806 | Ga0068867_100040970 | |||
| 1807 | Ga0068867_100056274 | |||
| 1808 | Ga0068867_100104180 | |||
| 1809 | Ga0068867_100213062 | |||
| 1810 | Ga0070685_10147600 | |||
| 1811 | Ga0070685_10356336 | |||
| 1812 | Ga0070706_100154516 | |||
| 1813 | Ga0070706_100239790 | |||
| 1814 | Ga0070707_100251578 | |||
| 1815 | Ga0070679_100515053 | |||
| 1816 | Ga0070684_100214762 | |||
| 1817 | Ga0068853_100000533 | |||
| 1818 | Ga0068853_100008721 | |||
| 1819 | Ga0068853_100062492 | |||
| 1820 | Ga0068853_100392547 | |||
| 1821 | Ga0070672_100004518 | |||
| 1822 | Ga0070672_100006066 | |||
| 1823 | Ga0070672_100091402 | |||
| 1824 | Ga0070672_100133529 | |||
| 1825 | Ga0070672_100194448 | |||
| 1826 | Ga0070686_100001185 | |||
| 1827 | Ga0070695_100012848 | |||
| 1828 | Ga0070695_100567310 | |||
| 1829 | Ga0070696_100003912 | |||
| 1830 | Ga0070665_100011966 | |||
| 1831 | Ga0070665_100021983 | |||
| 1832 | Ga0070665_100026315 | |||
| 1833 | Ga0070665_100228629 | |||
| 1834 | Ga0070665_100284493 | |||
| 1835 | Ga0070665_100408231 | |||
| 1836 | Ga0070665_100834977 | |||
| 1837 | Ga0070704_100130432 | |||
| 1838 | Ga0068855_100059452 | |||
| 1839 | Ga0068855_100138782 | |||
| 1840 | Ga0070664_100035788 | |||
| 1841 | Ga0068857_100007296 | |||
| 1842 | Ga0068857_100049797 | |||
| 1843 | Ga0068854_100006614 | |||
| 1844 | Ga0068854_100111128 | |||
| 1845 | Ga0068854_100367257 | |||
| 1846 | Ga0068854_100448352 | |||
| 1847 | Ga0068856_100030869 | |||
| 1848 | Ga0068856_100105689 | |||
| 1849 | Ga0068856_100170805 | |||
| 1850 | Ga0068856_100209837 | |||
| 1851 | Ga0068856_100252995 | |||
| 1852 | Ga0068856_100320316 | |||
| 1853 | Ga0068856_100528222 | |||
| 1854 | Ga0070702_100000465 | |||
| 1855 | Ga0070702_100181716 | |||
| 1856 | Ga0070702_100187663 | |||
| 1857 | Ga0068852_100004682 | |||
| 1858 | Ga0068852_100018895 | |||
| 1859 | Ga0068852_100038314 | |||
| 1860 | Ga0068852_100518076 | |||
| 1861 | Ga0068852_100523866 | |||
| 1862 | Ga0068852_100898063 | |||
| 1863 | Ga0068859_100004139 | |||
| 1864 | Ga0068859_100024768 | |||
| 1865 | Ga0068859_100066366 | |||
| 1866 | Ga0068859_100258096 | |||
| 1867 | Ga0068859_100281564 | |||
| 1868 | Ga0068859_100407028 | |||
| 1869 | Ga0068864_100017958 | |||
| 1870 | Ga0068864_100124212 | |||
| 1871 | Ga0068864_100180333 | |||
| 1872 | Ga0068864_100270219 | |||
| 1873 | Ga0068864_100350494 | |||
| 1874 | Ga0068866_10002429 | |||
| 1875 | Ga0068866_10042055 | |||
| 1876 | Ga0068866_10052992 | |||
| 1877 | Ga0068866_10105319 | |||
| 1878 | Ga0068861_100002134 | |||
| 1879 | Ga0068861_100004235 | |||
| 1880 | Ga0068861_100015953 | |||
| 1881 | Ga0068861_100067724 | |||
| 1882 | Ga0068861_100077139 | |||
| 1883 | Ga0068861_100188954 | |||
| 1884 | Ga0068861_100413072 | |||
| 1885 | Ga0068851_10158537 | |||
| 1886 | Ga0068870_10121037 | |||
| 1887 | Ga0068870_10170422 | |||
| 1888 | Ga0068863_100057708 | |||
| 1889 | Ga0068863_100156268 | |||
| 1890 | Ga0068863_100192197 | |||
| 1891 | Ga0068863_100218540 | |||
| 1892 | Ga0068858_100000679 | |||
| 1893 | Ga0068858_100000774 | |||
| 1894 | Ga0068858_100039707 | |||
| 1895 | Ga0068858_100062433 | |||
| 1896 | Ga0068858_100113932 | |||
| 1897 | Ga0068858_100208795 | |||
| 1898 | Ga0068858_100257248 | |||
| 1899 | Ga0068858_100294160 | |||
| 1900 | Ga0068860_100005264 | |||
| 1901 | Ga0068860_100021326 | |||
| 1902 | Ga0068860_100114065 | |||
| 1903 | Ga0068860_100398874 | |||
| 1904 | Ga0068860_100473424 | |||
| 1905 | Ga0068862_100004858 | |||
| 1906 | Ga0068862_100037860 | |||
| 1907 | Ga0068862_100039976 | |||
| 1908 | Ga0068862_100053778 | |||
| 1909 | Ga0068862_100155416 | |||
| 1910 | Ga0068862_100204281 | |||
| 1911 | Ga0068862_100470055 | |||
| 1912 | Ga0068862_100644166 | |||
| 1913 | Ga0081455_10033573 | |||
| 1914 | Ga0081538_10037477 | |||
| 1915 | Ga0081540_1007796 | |||
| 1916 | Ga0081540_1018556 | |||
| 1917 | Ga0081540_1028680 | |||
| 1918 | Ga0081540_1034711 | |||
| 1919 | Ga0081539_10001065 | |||
| 1920 | Ga0081539_10002462 | |||
| 1921 | Ga0070717_10049598 | |||
| 1922 | Ga0070717_10060157 | |||
| 1923 | Ga0070717_10174840 | |||
| 1924 | Ga0070717_10521222 | |||
| 1925 | Ga0075365_10001077 | |||
| 1926 | Ga0075365_10005631 | |||
| 1927 | Ga0075365_10015495 | |||
| 1928 | Ga0075365_10028179 | |||
| 1929 | Ga0075365_10033264 | |||
| 1930 | Ga0075365_10051810 | |||
| 1931 | Ga0075365_10057918 | |||
| 1932 | Ga0075365_10077386 | |||
| 1933 | Ga0075365_10086523 | |||
| 1934 | Ga0075365_10162450 | |||
| 1935 | Ga0075365_10187535 | |||
| 1936 | Ga0075368_10000497 | |||
| 1937 | Ga0075363_100019120 | |||
| 1938 | Ga0075363_100034775 | |||
| 1939 | Ga0075364_10043362 | |||
| 1940 | Ga0075364_10053411 | |||
| 1941 | Ga0075364_10093419 | |||
| 1942 | Ga0075364_10126716 | |||
| 1943 | Ga0075364_10145322 | |||
| 1944 | Ga0075432_10161255 | |||
| 1945 | Ga0070715_10052960 | |||
| 1946 | Ga0070716_100002789 | |||
| 1947 | Ga0070716_100060583 | |||
| 1948 | Ga0075362_10015521 | |||
| 1949 | Ga0075362_10076585 | |||
| 1950 | Ga0075367_10005545 | |||
| 1951 | Ga0075367_10029428 | |||
| 1952 | Ga0075367_10102443 | |||
| 1953 | Ga0075367_10241541 | |||
| 1954 | Ga0075369_10000668 | |||
| 1955 | Ga0075369_10003981 | |||
| 1956 | Ga0075369_10007492 | |||
| 1957 | Ga0075369_10100272 | |||
| 1958 | Ga0075369_10123852 | |||
| 1959 | Ga0075366_10001925 | |||
| 1960 | Ga0075366_10032269 | |||
| 1961 | Ga0075366_10083112 | |||
| 1962 | Ga0075366_10155636 | |||
| 1963 | Ga0075366_10207258 | |||
| 1964 | Ga0097621_100014601 | |||
| 1965 | Ga0097621_100023403 | |||
| 1966 | Ga0097621_100027531 | |||
| 1967 | Ga0097621_100141217 | |||
| 1968 | Ga0097621_100182239 | |||
| 1969 | Ga0097621_100585443 | |||
| 1970 | Ga0075370_10003750 | |||
| 1971 | Ga0075370_10012857 | |||
| 1972 | Ga0075370_10014816 | |||
| 1973 | Ga0075370_10076779 | |||
| 1974 | Ga0068871_100072151 | |||
| 1975 | Ga0068871_100117432 | |||
| 1976 | Ga0075428_100297821 | |||
| 1977 | Ga0075428_100385730 | |||
| 1978 | Ga0075430_100056046 | |||
| 1979 | Ga0075430_100289627 | |||
| 1980 | Ga0075431_100008686 | |||
| 1981 | Ga0075431_100014607 | |||
| 1982 | Ga0075431_100802983 | |||
| 1983 | Ga0075433_10004359 | |||
| 1984 | Ga0075433_10111317 | |||
| 1985 | Ga0075433_10246146 | |||
| 1986 | Ga0075434_100001107 | |||
| 1987 | Ga0075434_100080113 | |||
| 1988 | Ga0075434_100716813 | |||
| 1989 | Ga0075429_100162181 | |||
| 1990 | Ga0075429_100315527 | |||
| 1991 | Ga0068865_100002181 | |||
| 1992 | Ga0068865_100005350 | |||
| 1993 | Ga0068865_100006891 | |||
| 1994 | Ga0068865_100043120 | |||
| 1995 | Ga0068865_100057693 | |||
| 1996 | Ga0097620_100004139 | |||
| 1997 | Ga0097620_100024768 | |||
| 1998 | Ga0097620_100066364 | |||
| 1999 | Ga0097620_100239842 | |||
| 2000 | Ga0097620_100258095 | |||
| 2001 | Ga0097620_100281543 | |||
| 2002 | Ga0097620_100407008 | |||
| 2003 | Ga0075435_100084847 | |||
| 2004 | Ga0075435_100096110 | |||
| 2005 | Ga0099795_10197466 | |||
| 2006 | Ga0105240_10030702 | |||
| 2007 | Ga0105240_10188585 | |||
| 2008 | Ga0105240_10193464 | |||
| 2009 | Ga0105240_10317039 | |||
| 2010 | Ga0105240_10445115 | |||
| 2011 | Ga0105240_10470161 | |||
| 2012 | Ga0111539_10000090 | |||
| 2013 | Ga0111539_10095317 | |||
| 2014 | Ga0111539_10106388 | |||
| 2015 | Ga0111539_10228537 | |||
| 2016 | Ga0111539_10594395 | |||
| 2017 | Ga0111539_10741676 | |||
| 2018 | Ga0111539_11228693 | |||
| 2019 | Ga0105245_10008017 | |||
| 2020 | Ga0105245_10063580 | |||
| 2021 | Ga0105245_10091787 | |||
| 2022 | Ga0105245_10413657 | |||
| 2023 | Ga0105245_10444206 | |||
| 2024 | Ga0105245_10470834 | |||
| 2025 | Ga0105245_10577174 | |||
| 2026 | Ga0105247_10006831 | |||
| 2027 | Ga0105247_10146901 | |||
| 2028 | Ga0105247_10398480 | |||
| 2029 | Ga0114129_10179262 | |||
| 2030 | Ga0114129_10271647 | |||
| 2031 | Ga0114129_10286300 | |||
| 2032 | Ga0105243_10000959 | |||
| 2033 | Ga0105243_10015761 | |||
| 2034 | Ga0105243_10105952 | |||
| 2035 | Ga0105243_10155973 | |||
| 2036 | Ga0105243_10182807 | |||
| 2037 | Ga0105243_10292051 | |||
| 2038 | Ga0105243_10616879 | |||
| 2039 | Ga0105241_10002442 | |||
| 2040 | Ga0105241_10113365 | |||
| 2041 | Ga0105241_10292450 | |||
| 2042 | Ga0105242_10002489 | |||
| 2043 | Ga0105242_10193932 | |||
| 2044 | Ga0105248_10000901 | |||
| 2045 | Ga0105248_10013900 | |||
| 2046 | Ga0105248_10015246 | |||
| 2047 | Ga0105248_10019917 | |||
| 2048 | Ga0105248_10060349 | |||
| 2049 | Ga0105248_10479903 | |||
| 2050 | Ga0105237_10000174 | |||
| 2051 | Ga0105237_10009955 | |||
| 2052 | Ga0105237_10018733 | |||
| 2053 | Ga0105237_10034874 | |||
| 2054 | Ga0105237_10035664 | |||
| 2055 | Ga0105237_10043232 | |||
| 2056 | Ga0105237_10049540 | |||
| 2057 | Ga0105237_10186456 | |||
| 2058 | Ga0105237_10364295 | |||
| 2059 | Ga0105237_10403976 | |||
| 2060 | Ga0105237_10673565 | |||
| 2061 | Ga0105238_10010957 | |||
| 2062 | Ga0105238_10029974 | |||
| 2063 | Ga0105238_10033358 | |||
| 2064 | Ga0105238_10045923 | |||
| 2065 | Ga0105238_10487166 | |||
| 2066 | Ga0105249_10049194 | |||
| 2067 | Ga0105249_10185849 | |||
| 2068 | Ga0105249_10247261 | |||
| 2069 | Ga0105249_10400273 | |||
| 2070 | Ga0105249_10444825 | |||
| 2071 | Ga0105249_10504884 | |||
| 2072 | Ga0123340_1040575 | |||
| 2073 | Ga0123342_1032370 | |||
| 2074 | Ga0105239_10002107 | |||
| 2075 | Ga0105239_10007703 | |||
| 2076 | Ga0105239_10039185 | |||
| 2077 | Ga0105239_10122143 | |||
| 2078 | Ga0105239_10243808 | |||
| 2079 | Ga0105239_10301175 | |||
| 2080 | Ga0105239_10307747 | |||
| 2081 | Ga0105239_10343654 | |||
| 2082 | Ga0105239_10374542 | |||
| 2083 | Ga0105239_11306396 | |||
| 2084 | Ga0105246_10021121 | |||
| 2085 | Ga0105246_10103356 | |||
| 2086 | Ga0105246_10183024 | |||
| 2087 | Ga0105246_10211017 | |||
| 2088 | Ga0105246_10322074 | |||
| 2089 | Ga0157338_1002466 | |||
| 2090 | Ga0157371_10047155 | |||
| 2091 | Ga0157370_10056251 | |||
| 2092 | Ga0157370_10134148 | |||
| 2093 | Ga0157369_10035139 | |||
| 2094 | Ga0157369_10181288 | |||
| 2095 | Ga0157369_10229048 | |||
| 2096 | Ga0157374_10100093 | |||
| 2097 | Ga0157374_10640703 | |||
| 2098 | Ga0157378_10004511 | |||
| 2099 | Ga0157378_10006489 | |||
| 2100 | Ga0157378_10053222 | |||
| 2101 | Ga0157378_10212835 | |||
| 2102 | Ga0157378_10390105 | |||
| 2103 | Ga0157378_10792357 | |||
| 2104 | Ga0163162_10000204 | |||
| 2105 | Ga0163162_10004677 | |||
| 2106 | Ga0163162_10049112 | |||
| 2107 | Ga0163162_10118334 | |||
| 2108 | Ga0163162_10544590 | |||
| 2109 | Ga0157372_10514203 | |||
| 2110 | Ga0157375_10006400 | |||
| 2111 | Ga0157375_10024647 | |||
| 2112 | Ga0157375_10041032 | |||
| 2113 | Ga0157375_10057714 | |||
| 2114 | Ga0157375_10794743 | |||
| 2115 | Ga0163163_10828742 | |||
| 2116 | Ga0157380_10002708 | |||
| 2117 | Ga0157380_10004478 | |||
| 2118 | Ga0157380_10012997 | |||
| 2119 | Ga0157380_10041949 | |||
| 2120 | Ga0157380_10319433 | |||
| 2121 | Ga0157380_10721693 | |||
| 2122 | Ga0182008_10000774 | |||
| 2123 | Ga0182008_10013499 | |||
| 2124 | Ga0157377_10000107 | |||
| 2125 | Ga0157377_10241541 | |||
| 2126 | Ga0157379_10002672 | |||
| 2127 | Ga0157379_10035395 | |||
| 2128 | Ga0157379_10091786 | |||
| 2129 | Ga0157379_10171246 | |||
| 2130 | Ga0157379_10201941 | |||
| 2131 | Ga0157379_10350293 | |||
| 2132 | Ga0157379_10396532 | |||
| 2133 | Ga0157379_10553319 | |||
| 2134 | Ga0157379_10841194 | |||
| 2135 | Ga0157376_10093303 | |||
| 2136 | Ga0157376_10232454 | |||
| 2137 | Ga0157376_10389772 | |||
| 2138 | Ga0157376_10402833 | |||
| 2139 | Ga0182007_10004305 | |||
| 2140 | Ga0183362_10001 | |||
| 2141 | Ga0183363_1026 | |||
| 2142 | Ga0163161_10020746 | |||
| 2143 | Ga0163161_10105260 | |||
| 2144 | Ga0163161_10201719 | |||
| 2145 | Ga0163161_10366484 | |||
| 2146 | Ga0163161_10387294 | |||
| 2147 | Ga0214544_1007335 | |||
| 2148 | Ga0214542_1000027 | |||
| 2149 | Ga0214543_1000047 | |||
| 2150 | Ga0213873_10001600 | |||
| 2151 | Ga0213873_10006410 | |||
| 2152 | Ga0213874_10011559 | |||
| 2153 | Ga0213874_10060082 | |||
| 2154 | Ga0213876_10001084 | |||
| 2155 | Ga0213876_10006877 | |||
| 2156 | Ga0213876_10010546 | |||
| 2157 | Ga0213875_10001310 | |||
| 2158 | Ga0213875_10121679 | |||
| 2159 | Ga0213875_10219999 | |||
| 2160 | Ga0209436_100043 | |||
| 2161 | Ga0209436_100252 | |||
| 2162 | Ga0209563_101905 | |||
| 2163 | Ga0207427_101361 | |||
| 2164 | Ga0209026_1000025 | |||
| 2165 | Ga0209148_1000181 | |||
| 2166 | Ga0209759_1000226 | |||
| 2167 | Ga0209129_1001447 | |||
| 2168 | Ga0209129_1001476 | |||
| 2169 | Ga0209129_1001744 | |||
| 2170 | Ga0209233_1000010 | |||
| 2171 | Ga0209233_1000208 | |||
| 2172 | Ga0209233_1007445 | |||
| 2173 | Ga0209233_1011692 | |||
| 2174 | Ga0209455_1000127 | |||
| 2175 | Ga0209673_1000025 | |||
| 2176 | Ga0209673_1000550 | |||
| 2177 | Ga0209673_1002222 | |||
| 2178 | Ga0209673_1012262 | |||
| 2179 | Ga0209673_1015978 | |||
| 2180 | Ga0209673_1058556 | |||
| 2181 | Ga0209130_1000023 | |||
| 2182 | Ga0209130_1000075 | |||
| 2183 | Ga0209130_1000144 | |||
| 2184 | Ga0209130_1001459 | |||
| 2185 | Ga0209130_1014845 | |||
| 2186 | Ga0209130_1022823 | |||
| 2187 | Ga0209675_1000577 | |||
| 2188 | Ga0209675_1016073 | |||
| 2189 | Ga0209676_1002745 | |||
| 2190 | Ga0209676_1011940 | |||
| 2191 | Ga0209025_1000747 | |||
| 2192 | Ga0209025_1019972 | |||
| 2193 | Ga0209025_1034575 | |||
| 2194 | Ga0209025_1037564 | |||
| 2195 | Ga0209025_1047418 | |||
| 2196 | Ga0209564_1000278 | |||
| 2197 | Ga0209564_1000365 | |||
| 2198 | Ga0209564_1000558 | |||
| 2199 | Ga0209564_1033341 | |||
| 2200 | Ga0209758_1000070 | |||
| 2201 | Ga0209758_1000706 | |||
| 2202 | Ga0209758_1003235 | |||
| 2203 | Ga0209758_1014914 | |||
| 2204 | Ga0209758_1021677 | |||
| 2205 | Ga0209758_1027676 | |||
| 2206 | Ga0209050_1018895 | |||
| 2207 | Ga0209256_1000315 | |||
| 2208 | Ga0209256_1000411 | |||
| 2209 | Ga0209256_1000718 | |||
| 2210 | Ga0207426_1000087 | |||
| 2211 | Ga0207426_1000126 | |||
| 2212 | Ga0207426_1000163 | |||
| 2213 | Ga0207426_1002369 | |||
| 2214 | Ga0209051_1000176 | |||
| 2215 | Ga0209051_1000241 | |||
| 2216 | Ga0209051_1001845 | |||
| 2217 | Ga0209051_1005280 | |||
| 2218 | Ga0209051_1009714 | |||
| 2219 | Ga0209051_1010914 | |||
| 2220 | Ga0209051_1018933 | |||
| 2221 | Ga0209051_1027372 | |||
| 2222 | Ga0209257_1000015 | |||
| 2223 | Ga0209257_1000296 | |||
| 2224 | Ga0209257_1001085 | |||
| 2225 | Ga0209257_1010756 | |||
| 2226 | Ga0209257_1018952 | |||
| 2227 | Ga0209257_1019528 | |||
| 2228 | Ga0207697_10010156 | |||
| 2229 | Ga0207682_10003824 | |||
| 2230 | Ga0207692_10002105 | |||
| 2231 | Ga0207642_10006968 | |||
| 2232 | Ga0207642_10062734 | |||
| 2233 | Ga0207642_10262657 | |||
| 2234 | Ga0207710_10016400 | |||
| 2235 | Ga0207688_10014947 | |||
| 2236 | Ga0207688_10021443 | |||
| 2237 | Ga0207688_10066618 | |||
| 2238 | Ga0207688_10107200 | |||
| 2239 | Ga0207680_10000693 | |||
| 2240 | Ga0207680_10275558 | |||
| 2241 | Ga0207647_10043242 | |||
| 2242 | Ga0207685_10034520 | |||
| 2243 | Ga0207699_10017480 | |||
| 2244 | Ga0207645_10001681 | |||
| 2245 | Ga0207645_10012052 | |||
| 2246 | Ga0207645_10149681 | |||
| 2247 | Ga0207645_10259896 | |||
| 2248 | Ga0207645_10366974 | |||
| 2249 | Ga0207643_10012550 | |||
| 2250 | Ga0207643_10021802 | |||
| 2251 | Ga0207705_10007543 | |||
| 2252 | Ga0207705_10038277 | |||
| 2253 | Ga0207705_10102103 | |||
| 2254 | Ga0207705_10421710 | |||
| 2255 | Ga0207654_10005276 | |||
| 2256 | Ga0207654_10010388 | |||
| 2257 | Ga0207654_10206933 | |||
| 2258 | Ga0207707_10016219 | |||
| 2259 | Ga0207695_10123128 | |||
| 2260 | Ga0207695_10199422 | |||
| 2261 | Ga0207671_10000098 | |||
| 2262 | Ga0207671_10016385 | |||
| 2263 | Ga0207671_10027171 | |||
| 2264 | Ga0207671_10036385 | |||
| 2265 | Ga0207671_10038267 | |||
| 2266 | Ga0207671_10065373 | |||
| 2267 | Ga0207671_10214649 | |||
| 2268 | Ga0207671_10328979 | |||
| 2269 | Ga0207693_10015759 | |||
| 2270 | Ga0207663_10002594 | |||
| 2271 | Ga0207660_10150888 | |||
| 2272 | Ga0207662_10062892 | |||
| 2273 | Ga0207657_10032176 | |||
| 2274 | Ga0207657_10042901 | |||
| 2275 | Ga0207657_10046890 | |||
| 2276 | Ga0207657_10067886 | |||
| 2277 | Ga0207649_10004269 | |||
| 2278 | Ga0207652_10082409 | |||
| 2279 | Ga0207652_10452232 | |||
| 2280 | Ga0207681_10018257 | |||
| 2281 | Ga0207681_10039810 | |||
| 2282 | Ga0207681_10068503 | |||
| 2283 | Ga0207681_10122552 | |||
| 2284 | Ga0207681_10136522 | |||
| 2285 | Ga0207681_10389484 | |||
| 2286 | Ga0207681_10616992 | |||
| 2287 | Ga0207694_10069851 | |||
| 2288 | Ga0207694_10100132 | |||
| 2289 | Ga0207694_10275218 | |||
| 2290 | Ga0207694_10383931 | |||
| 2291 | Ga0207650_10017853 | |||
| 2292 | Ga0207659_10002593 | |||
| 2293 | Ga0207659_10071354 | |||
| 2294 | Ga0207659_10085589 | |||
| 2295 | Ga0207659_10178576 | |||
| 2296 | Ga0207687_10003093 | |||
| 2297 | Ga0207687_10007241 | |||
| 2298 | Ga0207687_10050899 | |||
| 2299 | Ga0207687_10265131 | |||
| 2300 | Ga0207700_10031915 | |||
| 2301 | Ga0207700_10038178 | |||
| 2302 | Ga0207664_10006954 | |||
| 2303 | Ga0207664_10132657 | |||
| 2304 | Ga0207644_10006260 | |||
| 2305 | Ga0207644_10018313 | |||
| 2306 | Ga0207644_10045368 | |||
| 2307 | Ga0207690_10016088 | |||
| 2308 | Ga0207690_10139221 | |||
| 2309 | Ga0207690_10474299 | |||
| 2310 | Ga0207706_10003308 | |||
| 2311 | Ga0207706_10022986 | |||
| 2312 | Ga0207706_10184051 | |||
| 2313 | Ga0207706_10193365 | |||
| 2314 | Ga0207686_10002718 | |||
| 2315 | Ga0207686_10015735 | |||
| 2316 | Ga0207709_10001119 | |||
| 2317 | Ga0207709_10005283 | |||
| 2318 | Ga0207709_10024912 | |||
| 2319 | Ga0207709_10059177 | |||
| 2320 | Ga0207709_10113242 | |||
| 2321 | Ga0207709_10119585 | |||
| 2322 | Ga0207709_10145283 | |||
| 2323 | Ga0207709_10309967 | |||
| 2324 | Ga0207670_10005570 | |||
| 2325 | Ga0207670_10009557 | |||
| 2326 | Ga0207670_10292173 | |||
| 2327 | Ga0207669_10024389 | |||
| 2328 | Ga0207669_10024588 | |||
| 2329 | Ga0207669_10025755 | |||
| 2330 | Ga0207669_10029638 | |||
| 2331 | Ga0207669_10062917 | |||
| 2332 | Ga0207669_10174879 | |||
| 2333 | Ga0207704_10001177 | |||
| 2334 | Ga0207704_10009761 | |||
| 2335 | Ga0207704_10044084 | |||
| 2336 | Ga0207704_10209565 | |||
| 2337 | Ga0207704_10344545 | |||
| 2338 | Ga0207665_10005896 | |||
| 2339 | Ga0207665_10112843 | |||
| 2340 | Ga0207691_10003792 | |||
| 2341 | Ga0207691_10035477 | |||
| 2342 | Ga0207691_10099364 | |||
| 2343 | Ga0207691_10208710 | |||
| 2344 | Ga0207691_10216614 | |||
| 2345 | Ga0207691_10239163 | |||
| 2346 | Ga0207691_10655160 | |||
| 2347 | Ga0207711_10001117 | |||
| 2348 | Ga0207711_10073953 | |||
| 2349 | Ga0207711_10141307 | |||
| 2350 | Ga0207689_10003529 | |||
| 2351 | Ga0207689_10004524 | |||
| 2352 | Ga0207689_10016932 | |||
| 2353 | Ga0207689_10026403 | |||
| 2354 | Ga0207689_10071557 | |||
| 2355 | Ga0207689_10213752 | |||
| 2356 | Ga0207661_10155033 | |||
| 2357 | Ga0207679_10579823 | |||
| 2358 | Ga0207667_10002257 | |||
| 2359 | Ga0207667_10019765 | |||
| 2360 | Ga0207667_10432121 | |||
| 2361 | Ga0207651_10330865 | |||
| 2362 | Ga0207651_10413170 | |||
| 2363 | Ga0207712_10093622 | |||
| 2364 | Ga0207712_10132278 | |||
| 2365 | Ga0207712_10452389 | |||
| 2366 | Ga0207712_10794292 | |||
| 2367 | Ga0207668_10004719 | |||
| 2368 | Ga0207668_10007648 | |||
| 2369 | Ga0207668_10022961 | |||
| 2370 | Ga0207668_10054878 | |||
| 2371 | Ga0207668_10091056 | |||
| 2372 | Ga0207668_10107072 | |||
| 2373 | Ga0207668_10148672 | |||
| 2374 | Ga0207668_10252672 | |||
| 2375 | Ga0207668_10325583 | |||
| 2376 | Ga0207640_10004957 | |||
| 2377 | Ga0207640_10163554 | |||
| 2378 | Ga0207640_10218584 | |||
| 2379 | Ga0207658_10001163 | |||
| 2380 | Ga0207658_10002997 | |||
| 2381 | Ga0207658_10154102 | |||
| 2382 | Ga0207658_10471536 | |||
| 2383 | Ga0207677_10000686 | |||
| 2384 | Ga0207677_10081529 | |||
| 2385 | Ga0207677_10148763 | |||
| 2386 | Ga0207703_10000702 | |||
| 2387 | Ga0207703_10148135 | |||
| 2388 | Ga0207703_10322585 | |||
| 2389 | Ga0207639_10004702 | |||
| 2390 | Ga0207639_10017059 | |||
| 2391 | Ga0207639_10043662 | |||
| 2392 | Ga0207639_10197789 | |||
| 2393 | Ga0207639_10228345 | |||
| 2394 | Ga0207678_10055733 | |||
| 2395 | Ga0207678_10139218 | |||
| 2396 | Ga0207678_10239799 | |||
| 2397 | Ga0207678_10368317 | |||
| 2398 | Ga0207708_10023248 | |||
| 2399 | Ga0207708_10063677 | |||
| 2400 | Ga0207708_10174109 | |||
| 2401 | Ga0207702_10020818 | |||
| 2402 | Ga0207702_10021279 | |||
| 2403 | Ga0207702_10080204 | |||
| 2404 | Ga0207702_10085088 | |||
| 2405 | Ga0207702_10091452 | |||
| 2406 | Ga0207702_10258663 | |||
| 2407 | Ga0207641_10000926 | |||
| 2408 | Ga0207641_10135643 | |||
| 2409 | Ga0207641_10167392 | |||
| 2410 | Ga0207641_10330977 | |||
| 2411 | Ga0207648_10000227 | |||
| 2412 | Ga0207648_10001863 | |||
| 2413 | Ga0207648_10004241 | |||
| 2414 | Ga0207648_10027604 | |||
| 2415 | Ga0207648_10052018 | |||
| 2416 | Ga0207648_10077381 | |||
| 2417 | Ga0207648_10137674 | |||
| 2418 | Ga0207648_10152176 | |||
| 2419 | Ga0207648_10182587 | |||
| 2420 | Ga0207648_10209896 | |||
| 2421 | Ga0207676_10000656 | |||
| 2422 | Ga0207676_10055756 | |||
| 2423 | Ga0207676_10171438 | |||
| 2424 | Ga0207676_10220263 | |||
| 2425 | Ga0207676_10406427 | |||
| 2426 | Ga0207674_10026564 | |||
| 2427 | Ga0207674_10196987 | |||
| 2428 | Ga0207675_100001409 | |||
| 2429 | Ga0207675_100003635 | |||
| 2430 | Ga0207675_100004839 | |||
| 2431 | Ga0207675_100005359 | |||
| 2432 | Ga0207675_100025107 | |||
| 2433 | Ga0207675_100040984 | |||
| 2434 | Ga0207675_100063281 | |||
| 2435 | Ga0207675_100131377 | |||
| 2436 | Ga0207683_10000463 | |||
| 2437 | Ga0207683_10028847 | |||
| 2438 | Ga0207683_10041326 | |||
| 2439 | Ga0207683_10049390 | |||
| 2440 | Ga0207683_10059609 | |||
| 2441 | Ga0207683_10116269 | |||
| 2442 | Ga0207683_10360331 | |||
| 2443 | Ga0207698_10008240 | |||
| 2444 | Ga0207698_10015130 | |||
| 2445 | Ga0207698_10139450 | |||
| 2446 | Ga0207698_10210576 | |||
| 2447 | Ga0207698_10216552 | |||
| 2448 | Ga0207698_10412347 | |||
| 2449 | Ga0209588_1024000 | |||
| 2450 | Ga0209974_10014701 | |||
| 2451 | Ga0207428_10000055 | |||
| 2452 | Ga0207428_10198334 | |||
| 2453 | Ga0207428_10373913 | |||
| 2454 | Ga0268266_10001688 | |||
| 2455 | Ga0268266_10004161 | |||
| 2456 | Ga0268266_10013435 | |||
| 2457 | Ga0268266_10014245 | |||
| 2458 | Ga0268266_10022514 | |||
| 2459 | Ga0268266_10268317 | |||
| 2460 | Ga0268265_10019073 | |||
| 2461 | Ga0268265_10020317 | |||
| 2462 | Ga0268265_10031758 | |||
| 2463 | Ga0268265_10036898 | |||
| 2464 | Ga0268265_10045858 | |||
| 2465 | Ga0268265_10060622 | |||
| 2466 | Ga0268265_10120812 | |||
| 2467 | Ga0268265_10487658 | |||
| 2468 | Ga0268264_10027008 | |||
| 2469 | Ga0268264_10031040 | |||
| 2470 | Ga0268264_10050132 | |||
| 2471 | Ga0268264_10102078 | |||
| 2472 | Ga0268264_10146821 | |||
| 2473 | Ga0268264_10245924 | |||
| 2474 | Ga0268264_10359369 | |||
| 2475 | Ga0268264_10395543 | |||
| 2476 | Ga0307517_10000102 | |||
| 2477 | Ga0307517_10091558 | |||
| 2478 | Ga0307515_10000026 | |||
| 2479 | Ga0307515_10000130 | |||
| 2480 | Ga0307515_10005868 | |||
| 2481 | Ga0307511_10062115 | |||
| 2482 | Ga0307511_10105332 | |||
| 2483 | Ga0307512_10066553 | |||
| 2484 | Ga0265332_10044610 | |||
| 2485 | Ga0265328_10075366 | |||
| 2486 | Ga0265325_10033572 | |||
| 2487 | Ga0265325_10090164 | |||
| 2488 | Ga0265339_10001056 | |||
| 2489 | Ga0265331_10024029 | |||
| 2490 | Ga0265331_10027234 | |||
| 2491 | Ga0265316_10102464 | |||
| 2492 | Ga0307513_10004550 | |||
| 2493 | Ga0307513_10006865 | |||
| 2494 | Ga0307513_10011752 | |||
| 2495 | Ga0307513_10161071 | |||
| 2496 | Ga0307513_10207476 | |||
| 2497 | Ga0307513_10237260 | |||
| 2498 | Ga0307513_10412727 | |||
| 2499 | Ga0307509_10020922 | |||
| 2500 | Ga0307509_10077468 | |||
| 2501 | Ga0307509_10382066 | |||
| 2502 | Ga0307509_10434821 | |||
| 2503 | Ga0307408_100009454 | |||
| 2504 | Ga0307408_100190984 | |||
| 2505 | Ga0307408_100223010 | |||
| 2506 | Ga0307408_100306894 | |||
| 2507 | Ga0307408_100589190 | |||
| 2508 | Ga0265313_10000044 | |||
| 2509 | Ga0265313_10040982 | |||
| 2510 | Ga0265313_10123276 | |||
| 2511 | Ga0307508_10066442 | |||
| 2512 | Ga0307508_10141035 | |||
| 2513 | Ga0307508_10206694 | |||
| 2514 | Ga0307508_10286396 | |||
| 2515 | Ga0307508_10387937 | |||
| 2516 | Ga0265314_10060748 | |||
| 2517 | Ga0265314_10072215 | |||
| 2518 | Ga0265342_10037361 | |||
| 2519 | Ga0307516_10002286 | |||
| 2520 | Ga0307516_10003926 | |||
| 2521 | Ga0307516_10020911 | |||
| 2522 | Ga0307516_10042688 | |||
| 2523 | Ga0307516_10047076 | |||
| 2524 | Ga0307516_10130828 | |||
| 2525 | Ga0307516_10155104 | |||
| 2526 | Ga0307516_10345991 | |||
| 2527 | Ga0307516_10349497 | |||
| 2528 | Ga0307516_10421155 | |||
| 2529 | Ga0307405_10179969 | |||
| 2530 | Ga0307410_10019322 | |||
| 2531 | Ga0307410_10041221 | |||
| 2532 | Ga0307410_10083488 | |||
| 2533 | Ga0307410_10203151 | |||
| 2534 | Ga0307410_10407633 | |||
| 2535 | Ga0307406_10061645 | |||
| 2536 | Ga0307406_10458268 | |||
| 2537 | Ga0307406_10537513 | |||
| 2538 | Ga0307406_10613626 | |||
| 2539 | Ga0307412_10152043 | |||
| 2540 | Ga0307412_10200185 | |||
| 2541 | Ga0307412_10303683 | |||
| 2542 | Ga0307412_10415584 | |||
| 2543 | Ga0307409_100018544 | |||
| 2544 | Ga0307409_100039177 | |||
| 2545 | Ga0307409_100043282 | |||
| 2546 | Ga0307416_100007618 | |||
| 2547 | Ga0307416_100037447 | |||
| 2548 | Ga0307416_100056078 | |||
| 2549 | Ga0307416_100615651 | |||
| 2550 | Ga0307416_100628839 | |||
| 2551 | Ga0307414_10024513 | |||
| 2552 | Ga0307414_10049458 | |||
| 2553 | Ga0307414_10114087 | |||
| 2554 | Ga0307414_10410036 | |||
| 2555 | Ga0307411_10074874 | |||
| 2556 | Ga0307411_10132876 | |||
| 2557 | Ga0307415_100068726 | |||
| 2558 | Ga0307507_10009514 | |||
| 2559 | Ga0307510_10000403 | |||
| 2560 | Ga0307510_10159973 | |||
| 2561 | Ga0373930_0002314 | |||
| 2562 | Ga0373958_0010594 | |||
| 2563 | Ga0373959_0059970 | |||
| 2564 | Ga0373938_0021680 | |||
| 2565 | Ga0373928_0025870 | |||
| 2566 | Ga0373940_0001803 | |||
| 2567 | Ga0373940_0013447 | |||
| 2568 | Ga0373949_0035880 | |||
| 2569 | Ga0373932_0065455 | |||
| 2570 | Ga0373936_0058868 | |||
| 2571 | Ga0373945_0075361 | |||
| 2572 | Ga0373954_0065142 | |||
| 2573 | Ga0373956_0088068 | |||
| 2574 | Ga0373960_0108071 | |||
| 2575 | Ga0373943_0183297 | |||
| 2576 | Ga0373943_0218080 | |||
| 2577 | Ga0373943_0238149 | |||
| 2578 | Ga0373946_0043305 | |||
| 2579 | Ga0373955_0031994 | |||
| 2580 | Ga0373955_0036165 | |||
| 2581 | Ga0373942_0013968 | |||
| 2582 | Ga0373962_0007243 | |||
| 2583 | Ga0373924_0013697 | |||
| 2584 | Ga0373931_0000221 | |||
| 2585 | Ga0373931_0144426 | |||
| 2586 | Ga0373931_0361801 | |||
| 2587 | Ga0373935_0001741 | |||
| 2588 | Ga0373935_0029145 | |||
| 2589 | Ga0373935_0059489 | |||
| 2590 | Ga0373927_0000139 | |||
| 2591 | Ga0373927_0001969 | |||
| 2592 | Ga0373927_0021434 | |||
| 2593 | Ga0373927_0021765 | |||
| 2594 | Ga0373927_0028636 | |||
| 2595 | Ga0373927_0151088 | |||
| 2596 | Ga0373933_0007649 | |||
| 2597 | Ga0373933_0041090 | |||
| 2598 | Ga0373947_0001689 | |||
| 2599 | Ga0373947_0023523 | |||
| 2600 | Ga0373937_0009205 | |||
| 2601 | Ga0373937_0039005 | |||
| 2602 | Ga0373937_0050691 | |||
| 2603 | Ga0373937_0061257 | |||
| 2604 | Ga0373937_0177910 | |||
| 2605 | Ga0373937_0689912 | |||
| 2606 | Ga0373925_0002233 | |||
| 2607 | Ga0373925_0014218 | |||
| 2608 | Ga0373925_0186614 | |||
| 2609 | Ga0373925_0336393 | |||
| 2610 | Ga0373925_0487456 | |||
| 2611 | Ga0373925_0770095 | |||
| 2612 | Ga0395899_0027674 | |||
| 2613 | Ga0395899_0116590 | |||
| 2614 | Ga0395900_0029660 | |||
| 2615 | Ga0395900_0091357 | |||
| 2616 | Ga0395900_0095506 | |||
| 2617 | Ga0395900_0217555 | |||
| 2618 | Ga0395900_0376925 | |||
| 2619 | Ga0395898_0088943 | |||
| 2620 | Ga0395905_0000972 | |||
| 2621 | Ga0395905_0001399 | |||
| 2622 | Ga0395905_0021902 | |||
| 2623 | Ga0395905_0079268 | |||
| 2624 | Ga0395905_0083018 | |||
| 2625 | Ga0395905_0169130 | |||
| 2626 | Ga0395905_0888678 | |||
| 2627 | Ga0436364_0432791 | |||
| 2628 | Ga0436364_1006337 | |||
| 2629 | Ga0436364_1104972 | |||
| 2630 | Ga0436364_1224731 | |||
| 2631 | Ga0436364_1463980 | |||
| 2632 | Ga0395901_0068908 | |||
| 2633 | Ga0395901_0119894 | |||
| 2634 | Ga0400483_085697 | |||
| 2635 | Ga0400483_125610 | |||
| 2636 | Ga0400483_202169 | |||
| 2637 | Ga0436365_0080604 | |||
| 2638 | Ga0436365_0095350 | |||
| 2639 | Ga0436365_0291258 | |||
| 2640 | Ga0436365_0484605 | |||
| 2641 | Ga0436365_0528920 | |||
| 2642 | Ga0436365_0709674 | |||
| 2643 | Ga0436365_1106760 | |||
| 2644 | Ga0436365_1107580 | |||
| 2645 | Ga0436365_1113050 | |||
| 2646 | Ga0436360_0806014 | |||
| 2647 | Ga0436360_1247364 | |||
| 2648 | Ga0436361_0316835 | |||
| 2649 | Ga0436361_0438285 | |||
| 2650 | Ga0436361_0655965 | |||
| 2651 | Ga0436363_0250085 | |||
| 2652 | Ga0436363_0470149 | |||
| 2653 | Ga0436363_0691653 | |||
| 2654 | Ga0436363_0706677 | |||
| 2655 | Ga0436362_0039268 | |||
| 2656 | Ga0436362_1130295 | |||
| 2657 | Ga0439436_0007480 | |||
| 2658 | Ga0439439_0029003 | |||
| 2659 | Ga0439453_0000158 | |||
| 2660 | Ga0439465_0001656 | |||
| 2661 | Ga0439465_0005428 | |||
| 2662 | Ga0439465_0040068 | |||
| 2663 | Ga0451798_0384754 | |||
| 2664 | Ga0451855_1802886 | |||
| 2665 | Ga0439443_008804 | |||
| 2666 | Ga0439449_0037385 | |||
| 2667 | Ga0439449_0063712 | |||
| 2668 | Ga0439455_0022404 | |||
| 2669 | Ga0450920_003262 | |||
| 2670 | Ga0439458_0011139 | |||
| 2671 | Ga0439434_0017132 | |||
| 2672 | Ga0439435_0001732 | |||
| 2673 | Ga0439435_0036134 | |||
| 2674 | Ga0439460_0014937 | |||
| 2675 | Ga0450918_001827 | |||
| 2676 | Ga0466969_0003525 | |||
| 2677 | Ga0466966_0010452 | |||
| 2678 | Ga0466961_0005081 | |||
| 2679 | Ga0453684_0015661 | |||
| 2680 | Ga0453684_0418952 | |||
| 2681 | Ga0466959_0012816 | |||
| 2682 | Ga0451576_0294890 | |||
| 2683 | Ga0451576_0350453 | |||
| 2684 | Ga0466967_0096052 | |||
| 2685 | Ga0466967_0416290 | |||
| 2686 | Ga0495617_056816 | |||
| 2687 | Ga0495592_0057749 | |||
| 2688 | Ga0495592_0118533 | |||
| 2689 | Ga0495592_0216459 | |||
| 2690 | Ga0495603_0051016 | |||
| 2691 | Ga0495603_0130629 | |||
| 2692 | Ga0495603_0214800 | |||
| 2693 | Ga0495590_0007845 | |||
| 2694 | Ga0495590_0014862 | |||
| 2695 | Ga0495629_0089881 | |||
| 2696 | Ga0495638_0010023 | |||
| 2697 | Ga0495638_0019892 | |||
| 2698 | Ga0495638_0023502 | |||
| 2699 | Ga0495638_0052267 | |||
| 2700 | Ga0495638_0078706 | |||
| 2701 | Ga0495651_0099829 | |||
| 2702 | Ga0495651_0298201 | |||
| 2703 | Ga0495580_0044247 | |||
| 2704 | Ga0495605_0009156 | |||
| 2705 | Ga0495639_0009873 | |||
| 2706 | Ga0495639_0093753 | |||
| 2707 | Ga0495639_0128881 | |||
| 2708 | Ga0495662_0123159 | |||
| 2709 | Ga0495664_0001193 | |||
| 2710 | Ga0495664_0006956 | |||
| 2711 | Ga0495664_0010170 | |||
| 2712 | Ga0495664_0046765 | |||
| 2713 | Ga0495584_0040470 | |||
| 2714 | Ga0495584_0131277 | |||
| 2715 | Ga0495585_0023268 | |||
| 2716 | Ga0495585_0031741 | |||
| 2717 | Ga0495585_0057444 | |||
| 2718 | Ga0495594_0117183 | |||
| 2719 | Ga0495596_0018291 | |||
| 2720 | Ga0495607_0106584 | |||
| 2721 | Ga0495583_0073517 | |||
| 2722 | Ga0495606_0002308 | |||
| 2723 | Ga0495606_0242604 | |||
| 2724 | Ga0495608_0013378 | |||
| 2725 | Ga0495608_0091303 | |||
| 2726 | Ga0495610_0016205 | |||
| 2727 | Ga0495610_0021848 | |||
| 2728 | Ga0495610_0167975 | |||
| 2729 | Ga0495616_0020982 | |||
| 2730 | Ga0495618_0087433 | |||
| 2731 | Ga0495620_0019783 | |||
| 2732 | Ga0495620_0027127 | |||
| 2733 | Ga0495620_0084744 | |||
| 2734 | Ga0495628_0040093 | |||
| 2735 | Ga0495628_0206249 | |||
| 2736 | Ga0495630_0002691 | |||
| 2737 | Ga0495630_0009681 | |||
| 2738 | Ga0495630_0179043 | |||
| 2739 | Ga0495631_0027363 | |||
| 2740 | Ga0495631_0161637 | |||
| 2741 | Ga0495637_0048020 | |||
| 2742 | Ga0495643_0016345 | |||
| 2743 | Ga0495643_0016823 | |||
| 2744 | Ga0495643_0031187 | |||
| 2745 | Ga0495644_0031331 | |||
| 2746 | Ga0495644_0056906 | |||
| 2747 | Ga0495648_0019848 | |||
| 2748 | Ga0495648_0033917 | |||
| 2749 | Ga0495648_0165670 | |||
| 2750 | Ga0495666_0016302 | |||
| 2751 | Ga0495642_0021749 | |||
| 2752 | Ga0495642_0024106 | |||
| 2753 | Ga0495642_0036830 | |||
| 2754 | Ga0495654_0027025 | |||
| 2755 | Ga0495665_0010250 | |||
| 2756 | Ga0495665_0050823 | |||
| 2757 | Ga0495640_0030810 | |||
| 2758 | Ga0495640_0139113 | |||
| 2759 | Ga0495587_0054018 | |||
| 2760 | Ga0495598_0001316 | |||
| 2761 | Ga0495621_0028212 | |||
| 2762 | Ga0495621_0073041 | |||
| 2763 | Ga0495597_0011373 | |||
| 2764 | Ga0495597_0013824 | |||
| 2765 | Ga0495597_0060331 | |||
| 2766 | Ga0495645_0002601 | |||
| 2767 | Ga0495667_0012733 | |||
| 2768 | Ga0495667_0013502 | |||
| 2769 | Ga0495667_0186767 | |||
| 2770 | Ga0495656_0000201 | |||
| 2771 | Ga0495656_0001707 | |||
| 2772 | Ga0495656_0038424 | |||
| 2773 | Ga0495656_0069385 | |||
| 2774 | Ga0495668_0093858 | |||
| 2775 | Ga0495634_0032374 | |||
| 2776 | Ga0495611_0125277 | |||
| 2777 | Ga0495625_0003440 | |||
| 2778 | Ga0495625_0157101 | |||
| 2779 | Ga0495625_0209204 | |||
| 2780 | Ga0495635_0315518 | |||
| 2781 | Ga0495661_0111480 | |||
| 2782 | Ga0495588_0066318 | |||
| 2783 | Ga0495588_0218852 | |||
| 2784 | Ga0495657_0127373 | |||
| 2785 | Ga0495599_0014021 | |||
| 2786 | Ga0495623_0140356 | |||
| 2787 | Ga0495646_0034557 | |||
| 2788 | Ga0495646_0049579 | |||
| 2789 | Ga0495658_0086519 | |||
| 2790 | Ga0495658_0152836 | |||
| 2791 | Ga0495658_0169234 | |||
| 2792 | Ga0495669_0014685 | |||
| 2793 | Ga0495669_0068550 | |||
| 2794 | Ga0495613_0165200 | |||
| 2795 | Ga0495624_0084998 | |||
| 2796 | Ga0495670_0077621 | |||
| 2797 | Ga0495671_0013120 | |||
| 2798 | Ga0495649_0073721 | |||
| 2799 | Ga0495600_0014445 | |||
| 2800 | Ga0495600_0121970 | |||
| 2801 | Ga0495660_0068273 | |||
| 2802 | Ga0495581_0183313 | |||
| 2803 | Ga0495581_0358551 | |||
| 2804 | Ga0495604_0017364 | |||
| 2805 | Ga0495604_0050776 | |||
| 2806 | Ga0495674_0003734 | |||
| 2807 | Ga0495674_0019590 | |||
| 2808 | Ga0495674_0066087 | |||
| 2809 | Ga0495674_0075206 | |||
| 2810 | Ga0495674_0635030 | |||
| 2811 | Ga0495672_0120073 | |||
| 2812 | Ga0495676_0252845 | |||
| 2813 | Ga0495680_0318562 | |||
| 2814 | Ga0495687_000636 | |||
| 2815 | Ga0495687_053901 | |||
| 2816 | Ga0495675_0016558 | |||
| 2817 | Ga0495675_0243056 | |||
| 2818 | Ga0495677_0039577 | |||
| 2819 | Ga0495673_0019819 | |||
| 2820 | Ga0495684_0260261 | |||
| 2821 | Ga0495686_0001513 | |||
| 2822 | Ga0495686_0044699 | |||
| 2823 | Ga0495686_0050724 | |||
| 2824 | Ga0495686_0092606 | |||
| 2825 | Ga0495686_0122347 | |||
| 2826 | Ga0495593_0120701 | |||
| 2827 | Ga0495602_0004753 | |||
| 2828 | Ga0495602_0125217 | |||
| 2829 | Ga0495614_0138734 | |||
| 2830 | Ga0495614_0176856 | |||
| 2831 | Ga0495615_0008681 | |||
| 2832 | Ga0495626_0028174 | |||
| 2833 | Ga0495626_0159647 | |||
| 2834 | Ga0496100_0029263 | |||
| 2835 | Ga0496101_0088114 | |||
| 2836 | Ga0496101_0159819 | |||
| 2837 | Ga0496102_0003637 | |||
| 2838 | Ga0496102_0269043 | |||
| 2839 | Ga0496102_0371850 | |||
| 2840 | Ga0496102_0633484 | |||
| 2841 | Ga0496104_0167233 | |||
| 2842 | Ga0496105_0003045 | |||
| 2843 | Ga0496105_0004996 | |||
| 2844 | Ga0496105_0377778 | |||
| 2845 | Ga0496106_0000089 | |||
| 2846 | Ga0496106_0000244 | |||
| 2847 | Ga0496106_0006866 | |||
| 2848 | Ga0496106_0070480 | |||
| 2849 | Ga0496106_0530957 | |||
| 2850 | Ga0496106_0610108 | |||
| 2851 | Ga0496107_0016369 | |||
| 2852 | Ga0496107_0458134 | |||
| 2853 | Ga0496108_0035648 | |||
| 2854 | Ga0496108_0287346 | |||
| 2855 | Ga0496108_0661789 | |||
| 2856 | Ga0496108_0698079 | |||
| 2857 | Ga0496109_0006604 | |||
| 2858 | Ga0496109_0145378 | |||
| 2859 | Ga0496109_0456873 | |||
| 2860 | Ga0496109_0511747 | |||
| 2861 | Ga0496110_0001819 | |||
| 2862 | Ga0496110_0050345 | |||
| 2863 | Ga0496110_0085247 | |||
| 2864 | Ga0496110_0248324 | |||
| 2865 | Ga0496111_0143633 | |||
| 2866 | Ga0496112_0003238 | |||
| 2867 | Ga0496112_0012529 | |||
| 2868 | Ga0496112_0138882 | |||
| 2869 | Ga0496112_0145815 | |||
| 2870 | Ga0496113_0012993 | |||
| 2871 | Ga0496113_0140626 | |||
| 2872 | Ga0496114_0287786 | |||
| 2873 | Ga0496115_0033571 | |||
| 2874 | Ga0496115_0167400 | |||
| 2875 | Ga0496117_0051502 | |||
| 2876 | Ga0496117_0079523 | |||
| 2877 | Ga0496118_0004232 | |||
| 2878 | Ga0496118_0021785 | |||
| 2879 | Ga0496118_0027353 | |||
| 2880 | Ga0496118_0039503 | |||
| 2881 | Ga0496118_0049073 | |||
| 2882 | Ga0496118_0054398 | |||
| 2883 | Ga0496118_0146758 | |||
| 2884 | Ga0496118_0157581 | |||
| 2885 | Ga0496119_0030275 | |||
| 2886 | Ga0496119_0038482 | |||
| 2887 | Ga0496119_0075543 | |||
| 2888 | Ga0496120_0004296 | |||
| 2889 | Ga0496120_0060488 | |||
| 2890 | Ga0496121_0009702 | |||
| 2891 | Ga0496121_0012571 | |||
| 2892 | Ga0496121_0013490 | |||
| 2893 | Ga0496121_0016499 | |||
| 2894 | Ga0496121_0024781 | |||
| 2895 | Ga0496121_0035975 | |||
| 2896 | Ga0496121_0056807 | |||
| 2897 | Ga0496121_0059968 | |||
| 2898 | Ga0496121_0095041 | |||
| 2899 | Ga0496121_0095365 | |||
| 2900 | Ga0496121_0098369 | |||
| 2901 | Ga0496122_0116596 | |||
| 2902 | Ga0496123_0215154 | |||
| 2903 | Ga0496124_0004856 | |||
| 2904 | Ga0496124_0016982 | |||
| 2905 | Ga0496124_0056724 | |||
| 2906 | Ga0496124_0187153 | |||
| 2907 | Ga0496124_0243589 | |||
| 2908 | Ga0496125_0002684 | |||
| 2909 | Ga0496125_0014515 | |||
| 2910 | Ga0496125_0040917 | |||
| 2911 | Ga0496125_0147210 | |||
| 2912 | Ga0496126_0001193 | |||
| 2913 | Ga0496126_0015119 | |||
| 2914 | Ga0496126_0019399 | |||
| 2915 | Ga0496126_0066929 | |||
| 2916 | Ga0496126_0148270 | |||
| 2917 | Ga0496126_0236359 | |||
| 2918 | Ga0496126_0339699 | |||
| 2919 | Ga0496126_0369161 | |||
| 2920 | Ga0495678_020140 | |||
| 2921 | Ga0501298_001895 | |||
| 2922 | Ga0501031_0000009 | |||
| 2923 | Ga0501031_0014617 | |||
| 2924 | Ga0501031_0018659 | |||
| 2925 | Ga0501032_0000017 | |||
| 2926 | Ga0501032_0042254 | |||
| 2927 | Ga0501032_0042410 | |||
| 2928 | Ga0501032_0055957 | |||
| 2929 | Ga0501032_0077697 | |||
| 2930 | Ga0501032_0116702 | |||
| 2931 | Ga0501032_0375624 | |||
| 2932 | Ga0501033_0000029 | |||
| 2933 | Ga0501033_0000210 | |||
| 2934 | Ga0501033_0014151 | |||
| 2935 | Ga0501033_0029259 | |||
| 2936 | Ga0501033_0040867 | |||
| 2937 | Ga0501033_0050293 | |||
| 2938 | Ga0501033_0142089 | |||
| 2939 | Ga0501033_0226633 | |||
| 2940 | Ga0501034_0000102 | |||
| 2941 | Ga0501034_0010066 | |||
| 2942 | Ga0501034_0022378 | |||
| 2943 | Ga0501034_0058070 | |||
| 2944 | Ga0501034_0080355 | |||
| 2945 | Ga0501034_0111704 | |||
| 2946 | Ga0501034_0131166 | |||
| 2947 | Ga0501034_0138098 | |||
| 2948 | Ga0501034_0154056 | |||
| 2949 | Ga0501034_0185301 | |||
| 2950 | Ga0501036_0000011 | |||
| 2951 | Ga0501036_0028446 | |||
| 2952 | Ga0501036_0029066 | |||
| 2953 | Ga0501036_0112113 | |||
| 2954 | Ga0501036_0151100 | |||
| 2955 | Ga0501036_0167560 | |||
| 2956 | Ga0501036_0270847 | |||
| 2957 | Ga0501036_0308729 | |||
| 2958 | Ga0501036_0505528 | |||
| 2959 | Ga0501036_0580523 | |||
| 2960 | Ga0501036_0754375 | |||
| 2961 | Ga0501037_0000015 | |||
| 2962 | Ga0501037_0015564 | |||
| 2963 | Ga0501037_0036508 | |||
| 2964 | Ga0501037_0140858 | |||
| 2965 | Ga0501037_0154317 | |||
| 2966 | Ga0501037_0220141 | |||
| 2967 | Ga0501037_0226416 | |||
| 2968 | Ga0501038_0000016 | |||
| 2969 | Ga0501038_0016141 | |||
| 2970 | Ga0501038_0017713 | |||
| 2971 | Ga0501038_0043422 | |||
| 2972 | Ga0501038_0064206 | |||
| 2973 | Ga0501038_0071775 | |||
| 2974 | Ga0501038_0089947 | |||
| 2975 | Ga0501038_0093812 | |||
| 2976 | Ga0501038_0345032 | |||
| 2977 | Ga0501039_0000023 | |||
| 2978 | Ga0501039_0004433 | |||
| 2979 | Ga0501039_0028219 | |||
| 2980 | Ga0501039_0031181 | |||
| 2981 | Ga0501039_0119894 | |||
| 2982 | Ga0501039_0133599 | |||
| 2983 | Ga0501039_0325715 | |||
| 2984 | Ga0501039_0417542 | |||
| 2985 | Ga0501040_0008206 | |||
| 2986 | Ga0501040_0019932 | |||
| 2987 | Ga0501040_0026385 | |||
| 2988 | Ga0501040_0026743 | |||
| 2989 | Ga0501040_0148247 | |||
| 2990 | Ga0501040_0181154 | |||
| 2991 | Ga0501041_0025799 | |||
| 2992 | Ga0501041_0408741 | |||
| 2993 | Ga0501042_0013408 | |||
| 2994 | Ga0501042_0013841 | |||
| 2995 | Ga0501043_0023532 | |||
| 2996 | Ga0501043_0032719 | |||
| 2997 | Ga0501043_0033981 | |||
| 2998 | Ga0501043_0035819 | |||
| 2999 | Ga0501043_0062648 | |||
| 3000 | Ga0501043_0098517 | |||
| 3001 | Ga0501043_0157612 | |||
| 3002 | Ga0501046_0025041 | |||
| 3003 | Ga0501046_0059780 | |||
| 3004 | Ga0501046_0174005 | |||
| 3005 | Ga0501047_0003203 | |||
| 3006 | Ga0501047_0026623 | |||
| 3007 | Ga0501047_0047340 | |||
| 3008 | Ga0501047_0048280 | |||
| 3009 | Ga0501047_0068877 | |||
| 3010 | Ga0501047_0075275 | |||
| 3011 | Ga0501047_0172479 | |||
| 3012 | Ga0501047_0396161 | |||
| 3013 | Ga0501048_0001620 | |||
| 3014 | Ga0501067_0058783 | |||
| 3015 | Ga0501067_0070588 | |||
| 3016 | Ga0501067_0257412 | |||
| 3017 | Ga0501068_0009831 | |||
| 3018 | Ga0501068_0015059 | |||
| 3019 | Ga0501068_0016664 | |||
| 3020 | Ga0501068_0225359 | |||
| 3021 | Ga0501068_0251236 | |||
| 3022 | Ga0501069_0084739 | |||
| 3023 | Ga0501070_0018522 | |||
| 3024 | Ga0501070_0018945 | |||
| 3025 | Ga0501070_0020275 | |||
| 3026 | Ga0501070_0025557 | |||
| 3027 | Ga0501070_0037015 | |||
| 3028 | Ga0501070_0068629 | |||
| 3029 | Ga0501070_0133287 | |||
| 3030 | Ga0501070_0209466 | |||
| 3031 | Ga0501071_0017388 | |||
| 3032 | Ga0501071_0039620 | |||
| 3033 | Ga0501071_0050093 | |||
| 3034 | Ga0501071_0184284 | |||
| 3035 | Ga0501071_0205630 | |||
| 3036 | Ga0501071_0217406 | |||
| 3037 | Ga0501071_0315002 | |||
| 3038 | Ga0501072_0037641 | |||
| 3039 | Ga0501072_0049250 | |||
| 3040 | Ga0501072_0083812 | |||
| 3041 | Ga0501073_0005813 | |||
| 3042 | Ga0501073_0008806 | |||
| 3043 | Ga0501073_0019992 | |||
| 3044 | Ga0501073_0042901 | |||
| 3045 | Ga0501073_0066141 | |||
| 3046 | Ga0501073_0073408 | |||
| 3047 | Ga0501073_0077498 | |||
| 3048 | Ga0501073_0138474 | |||
| 3049 | Ga0501074_0047062 | |||
| 3050 | Ga0501074_0060169 | |||
| 3051 | Ga0501074_0065331 | |||
| 3052 | Ga0501074_0155968 | |||
| 3053 | Ga0501074_0165729 | |||
| 3054 | Ga0501074_0385325 | |||
| 3055 | Ga0501075_0000163 | |||
| 3056 | Ga0501075_0020817 | |||
| 3057 | Ga0501075_0087012 | |||
| 3058 | Ga0501076_0000053 | |||
| 3059 | Ga0501076_0011116 | |||
| 3060 | Ga0501076_0025466 | |||
| 3061 | Ga0501076_0152505 | |||
| 3062 | Ga0501076_0227431 | |||
| 3063 | Ga0501076_0322436 | |||
| 3064 | Ga0501077_0015654 | |||
| 3065 | Ga0501077_0039624 | |||
| 3066 | Ga0501077_0137745 | |||
| 3067 | Ga0501077_0399241 | |||
| 3068 | Ga0501257_006345 | |||
| 3069 | Ga0501079_0014659 | |||
| 3070 | Ga0501079_0035053 | |||
| 3071 | Ga0501079_0045986 | |||
| 3072 | Ga0501079_0305361 | |||
| 3073 | Ga0501079_0394709 | |||
| 3074 | Ga0501079_0406008 | |||
| 3075 | Ga0501080_0021292 | |||
| 3076 | Ga0501080_0033395 | |||
| 3077 | Ga0501080_0034299 | |||
| 3078 | Ga0501080_0036427 | |||
| 3079 | Ga0501080_0044767 | |||
| 3080 | Ga0501080_0053973 | |||
| 3081 | Ga0501080_0073436 | |||
| 3082 | Ga0501080_0212505 | |||
| 3083 | Ga0501081_0005369 | |||
| 3084 | Ga0501081_0074096 | |||
| 3085 | Ga0501081_0102062 | |||
| 3086 | Ga0501081_0326101 | |||
| 3087 | Ga0501083_0031312 | |||
| 3088 | Ga0501083_0057902 | |||
| 3089 | Ga0501083_0072113 | |||
| 3090 | Ga0501083_0137946 | |||
| 3091 | Ga0501083_0374056 | |||
| 3092 | Ga0501035_0000038 | |||
| 3093 | Ga0501035_0003069 | |||
| 3094 | Ga0501035_0025834 | |||
| 3095 | Ga0501035_0076163 | |||
| 3096 | Ga0501035_0105264 | |||
| 3097 | Ga0501035_0194557 | |||
| 3098 | Ga0501035_0198470 | |||
| 3099 | Ga0501035_0259307 | |||
| 3100 | Ga0501035_0500299 | |||
| 3101 | Ga0501035_0518539 | |||
| 3102 | Ga0501044_0000046 | |||
| 3103 | Ga0501044_0028299 | |||
| 3104 | Ga0501044_0060853 | |||
| 3105 | Ga0501044_0085509 | |||
| 3106 | Ga0501044_0155718 | |||
| 3107 | Ga0501044_0165843 | |||
| 3108 | Ga0501044_0223045 | |||
| 3109 | Ga0501044_0574492 | |||
| 3110 | Ga0501045_0026735 | |||
| 3111 | Ga0501045_0033596 | |||
| 3112 | Ga0501045_0126575 | |||
| 3113 | Ga0501045_0195777 | |||
| 3114 | Ga0501045_0243791 | |||
| 3115 | Ga0501045_0530819 | |||
| 3116 | nmdc:mga03n38_24270_c1 | |||
| 3117 | nmdc:mga03n38_299517_c1 | |||
| 3118 | nmdc:mga00v17_46612_c1 | |||
| 3119 | nmdc:mga00v17_68047_c1 | |||
| 3120 | nmdc:mga00v17_78770_c1 | |||
| 3121 | nmdc:mga0yw44_104110_c1 | |||
| 3122 | nmdc:mga0yw44_114611_c1 | |||
| 3123 | nmdc:mga0yw44_17726_c1 | |||
| 3124 | nmdc:mga0yw44_5085_c1 | |||
| 3125 | nmdc:mga0yw44_71757_c1 | |||
| 3126 | nmdc:mga0yw44_7481_c1 | |||
| 3127 | nmdc:mga0yw44_8283_c1 | |||
| 3128 | nmdc:mga0k408_137152_c1 | |||
| 3129 | nmdc:mga0k408_1436_c1 | |||
| 3130 | nmdc:mga0k408_37877_c1 | |||
| 3131 | nmdc:mga0k408_4087_c1 | |||
| 3132 | nmdc:mga06z11_10062_c1 | |||
| 3133 | nmdc:mga06z11_18996_c1 | |||
| 3134 | nmdc:mga06z11_96099_c1 | |||
| 3135 | nmdc:mga04h51_141771_c1 | |||
| 3136 | nmdc:mga04h51_3374_c1 | |||
| 3137 | nmdc:mga07m45_15562_c1 | |||
| 3138 | nmdc:mga07m45_38336_c1 | |||
| 3139 | nmdc:mga05p37_155007_c1 | |||
| 3140 | nmdc:mga05p37_233069_c1 | |||
| 3141 | nmdc:mga09592_244179_c1 | |||
| 3142 | nmdc:mga0qj67_49363_c1 | |||
| 3143 | nmdc:mga06r32_3096_c1 | |||
| 3144 | nmdc:mga06r32_76935_c1 | |||
| 3145 | nmdc:mga08y16_212436_c1 | |||
| 3146 | nmdc:mga08y16_473803_c1 | |||
| 3147 | nmdc:mga08y16_595_c1 | |||
| 3148 | nmdc:mga08y16_955572_c1 | |||
| 3149 | nmdc:mga0n895_71252_c1 | |||
| 3150 | nmdc:mga0n895_782_c1 | |||
| 3151 | nmdc:mga0rr50_24139_c1 | |||
| 3152 | nmdc:mga0a205_216920_c1 | |||
| 3153 | nmdc:mga0a205_377503_c1 | |||
| 3154 | nmdc:mga0a205_6389_c1 | |||
| 3155 | nmdc:mga0sz30_2709_c1 | |||
| 3156 | nmdc:mga0sz30_42656_c1 | |||
| 3157 | nmdc:mga0sz30_51037_c1 | |||
| 3158 | Ga0495601_0000401 | |||
| 3159 | Ga0495601_0041759 | |||
| 3160 | Ga0495612_0004593 | |||
| 3161 | Ga0500635_0001263 | |||
| 3162 | Ga0495655_0006637 | |||
| 3163 | Ga0495595_0028715 | |||
| 3164 | Ga0495619_0021683 | |||
| 3165 | Ga0495619_0065107 | |||
| 3166 | Ga0495619_0086737 | |||
| 3167 | Ga0495619_0119100 | |||
| 3168 | Ga0500578_0039666 | |||
| 3169 | Ga0500643_051840 | |||
| 3170 | Ga0500644_0034129 | |||
| 3171 | Ga0500646_0017535 | |||
| 3172 | Ga0500647_0006028 | |||
| 3173 | Ga0500647_0106100 | |||
| 3174 | Ga0500583_0016915 | |||
| 3175 | Ga0500651_0048095 | |||
| 3176 | Ga0500566_0007888 | |||
| 3177 | Ga0500566_0031098 | |||
| 3178 | Ga0500566_0158317 | |||
| 3179 | Ga0500641_0152109 | |||
| 3180 | Ga0500650_0033296 | |||
| 3181 | Ga0500555_003111 | |||
| 3182 | Ga0500555_012168 | |||
| 3183 | Ga0500556_0024413 | |||
| 3184 | Ga0500562_006674 | |||
| 3185 | Ga0500562_079513 | |||
| 3186 | Ga0500572_024060 | |||
| 3187 | Ga0500592_008699 | |||
| 3188 | Ga0500594_0004484 | |||
| 3189 | Ga0500594_0047780 | |||
| 3190 | Ga0500595_000266 | |||
| 3191 | Ga0500595_001200 | |||
| 3192 | Ga0500595_015995 | |||
| 3193 | Ga0500595_020314 | |||
| 3194 | Ga0500595_028672 | |||
| 3195 | Ga0500608_063462 | |||
| 3196 | Ga0500608_117175 | |||
| 3197 | Ga0500614_043074 | |||
| 3198 | Ga0500642_0000900 | |||
| 3199 | Ga0500642_0065334 | |||
| 3200 | Ga0500642_0129993 | |||
| 3201 | Ga0500658_0007094 | |||
| 3202 | Ga0500658_0016918 | |||
| 3203 | Ga0500658_0113384 | |||
| 3204 | Ga0500561_0044642 | |||
| 3205 | Ga0500568_0000415 | |||
| 3206 | Ga0500568_0001174 | |||
| 3207 | Ga0500573_0060387 | |||
| 3208 | Ga0500577_0068019 | |||
| 3209 | Ga0500577_0105596 | |||
| 3210 | Ga0500588_0001609 | |||
| 3211 | Ga0500588_0007470 | |||
| 3212 | Ga0500603_021372 | |||
| 3213 | Ga0500604_0009878 | |||
| 3214 | Ga0500604_0019145 | |||
| 3215 | Ga0500616_0002694 | |||
| 3216 | Ga0500616_0055477 | |||
| 3217 | Ga0500616_0088404 | |||
| 3218 | Ga0500616_0208982 | |||
| 3219 | Ga0500619_122099 | |||
| 3220 | Ga0500620_000234 | |||
| 3221 | Ga0500622_0000646 | |||
| 3222 | Ga0500622_0000772 | |||
| 3223 | Ga0500622_0059991 | |||
| 3224 | Ga0500622_0084763 | |||
| 3225 | Ga0500627_0006268 | |||
| 3226 | Ga0500627_0032262 | |||
| 3227 | Ga0500627_0073122 | |||
| 3228 | Ga0500627_0079467 | |||
| 3229 | Ga0500627_0099687 | |||
| 3230 | Ga0500627_0236847 | |||
| 3231 | Ga0500630_121514 | |||
| 3232 | Ga0500633_0030142 | |||
| 3233 | Ga0500634_0037402 | |||
| 3234 | Ga0500634_0062976 | |||
| 3235 | Ga0500638_158005 | |||
| 3236 | Ga0500639_004632 | |||
| 3237 | Ga0500639_089488 | |||
| 3238 | Ga0500636_0011613 | |||
| 3239 | Ga0500636_0044811 | |||
| 3240 | Ga0500636_0050905 | |||
| 3241 | Ga0500636_0121702 | |||
| 3242 | Ga0500636_0166768 | |||
| 3243 | Ga0500636_0237738 | |||
| 3244 | Ga0500637_0060181 | |||
| 3245 | Ga0500611_003636 | |||
| 3246 | Ga0500645_030897 | |||
| 3247 | Ga0500609_004076 | |||
| 3248 | Ga0500609_012380 | |||
| 3249 | Ga0500609_027406 | |||
| 3250 | Ga0500596_015532 | |||
| 3251 | Ga0500587_000428 | |||
| 3252 | Ga0501084_0007550 | |||
| 3253 | Ga0501084_0018918 | |||
| 3254 | Ga0501084_0074772 | |||
| 3255 | Ga0501084_0144096 | |||
| 3256 | Ga0501084_0189154 | |||
| 3257 | Ga0501084_0724310 | |||
| 3258 | Ga0500661_008047 | |||
| 3259 | Ga0590075_003951 | |||
| 3260 | Ga0501082_0032387 | |||
| 3261 | Ga0501082_0060048 | |||
| 3262 | Ga0501082_0062878 | |||
| 3263 | Ga0501082_0097519 | |||
| 3264 | Ga0501082_0108271 | |||
| 3265 | Ga0501082_0403043 | |||
| 3266 | Ga0501082_0538073 | |||
| 3267 | Ga0530510_0000093 | |||
| 3268 | Ga0530510_0013400 | |||
| 3269 | Ga0530510_0040966 | |||
| 3270 | Ga0530510_0047637 | |||
| 3271 | Ga0530510_0182661 | |||
| 3272 | 2509390254 | |||
| 3273 | 2513927193 | |||
| 3274 | 2588517406 | |||
| 3275 | 2599415368 | |||
| 3276 | 2805926745 | |||
| 3277 | 2838671678 | |||
| 3278 | 2838704357 | |||
| 3279 | 2842149576 | |||
| 3280 | 2842254259 | |||
| 3281 | 2842285276 | |||
| 3282 | 2842402635 | |||
| 3283 | 2842409993 | |||
| 3284 | 2842416642 | |||
| 3285 | 2842436806 | |||
| 3286 | 2904581789 | |||
| 3287 | 2919123456 | |||
| 3288 | 2932795588 | |||
| 3289 | 2932807816 | |||
| 3290 | 2935885993 | |||
| 3291 | 2937854458 | |||
| 3292 | 2970540791 | |||
| 3293 | 2977924153 | |||
| 3294 | 2977991745 | |||
| 3295 | 2996891769 | |||
| 3296 | 2996897971 | |||
| 3297 | 3000140742 | |||
| 3298 | 3004215888 | |||
| 3299 | 3004221946 | |||
| 3300 | 8005263099 | |||
| 3301 | 8005289733 | |||
| 3302 | 8005326296 | |||
| 3303 | 8005433375 | |||
| 3304 | 8005630117 | |||
| 3305 | 8016589698 | |||
| 3306 | 8024501281 | |||
| 3307 | 8049298039 | |||
| 3308 | 8057579364 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9186 | 4 | 228 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9087 | 3 | 228 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.8861 | 1 | 226 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8827 | 2 | 228 |
| 2ihy-assembly1.cif.gz_A | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.8814 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6BEX0_1_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9759 | 1 | 241 | 3.40.50.300 |
| af_P77509_7_245_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9503 | 2 | 238 | 3.40.50.300 |
| af_P37388_2_240_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9494 | 1 | 241 | 3.40.50.300 |
| af_P37388_2_240_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9455 | 1 | 241 | 3.40.50.300 |
| af_P77257_8_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9372 | 2 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3AXL3-F1-model_v4 | deleted | 0.9934 | 1 | 246 |
|
| AF-A0A0Q6QFP7-F1-model_v4 | ABC transporter ATP-binding protein | 0.993 | 2 | 246 |
GO:0005524
GO:0016887 |
| AF-A0A0Q6QFP7-F1-model_v4 | ABC transporter ATP-binding protein | 0.985 | 2 | 246 |
GO:0005524
GO:0016887 |
| AF-A0A3R7AWQ6-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9789 | 2 | 242 |
GO:0005524
GO:0016887 |
| AF-A0A2P7BRZ9-F1-model_v4 | ABC transporter ATP-binding protein | 0.9757 | 2 | 242 |
GO:0005524
GO:0016887 |