F495228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1655 | 555 | 3308 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0165760|Ga0496102_0165760_274_1602 |
| Length | 442 |
| Sequence | VDVDEAGLGCVVGHLGSLGPGGPWSSSHGSSRTSGFAAQGTAALADPDGPTPDVPTQLNLMTMRALFEDEHEQFRETVRRFIEKEMAPNFDRWEAAGVADREMYRKAGEIGLLGMAVPEQYGGGGVDDFRYNLVILEEVQRAGMGGAGLGITLHNDIVLPYFLTYCDDAQRDRWLPGIVSGDLITAIAMTEPGIGSDLASMSTSAIRDGDDYVVNGAKTFITNGINSDLVVTAVKTDPSERHRGISLLVLERGMEGFERGRNLAKVGMHSQDTAELFFTDVRVPVANRLGLEGDGFRYLVSNLPQERLSIAASGVAAARAALDWTLEYTKERRAFGQPINSFQHSRFVLAEMATEVEIGQTFVDACVLELNAGTLTAEKAAMAKWWCTELQKRAVDHGVQLHGGYGYMTEYPIARAYTDARVTTIYGGTTEIMKEIIGRSLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 238 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 239 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 240 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 241 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 280 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 281 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 284 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 285 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 286 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 287 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 290 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 291 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 292 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 293 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 294 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 296 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 297 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 298 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 299 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 300 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 301 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 302 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 310 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 311 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 312 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 313 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 402 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 428 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 429 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 430 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 431 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 436 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 440 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 458 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 460 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 461 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 463 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 464 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 466 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 468 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 471 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 472 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 473 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 474 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 475 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 476 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 477 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 478 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 479 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 480 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 481 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 482 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 483 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 484 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 485 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 486 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 487 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 488 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 489 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 490 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 491 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 492 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 493 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 494 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 495 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 496 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 497 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 498 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 499 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 500 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 501 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 502 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 503 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 504 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 505 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 506 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 507 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 508 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 509 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 510 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 511 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 512 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 513 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 514 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 515 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 516 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 517 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 518 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 519 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 520 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 521 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 522 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 523 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 524 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 525 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 526 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 527 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 528 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 529 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 530 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 531 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 532 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 533 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 534 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 535 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 536 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 537 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 538 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 539 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 540 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 541 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 542 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 543 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 544 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 545 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 546 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 547 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 548 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 549 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 550 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 551 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 552 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 553 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 554 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 555 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.23 |
| Metatranscriptomes | 0.91 |
| Isolates | 5.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.06 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 0.79 |
| Rhizoplane | 5.86 |
| Rhizosphere | 82.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0165760 | 3300048905 | Bacteria | 2079 |
| 2 | LJQas_1005422 | 3300000549 | Bacteria | 1620 |
| 3 | JGI24752J21851_1000031 | 3300001976 | Bacteria | 16764 |
| 4 | JGI25151J46595_10001297 | 3300003187 | Bacteria | 17528 |
| 5 | JGI25151J46595_10001914 | 3300003187 | Bacteria | 13217 |
| 6 | JGI25151J46595_10002376 | 3300003187 | Bacteria | 11424 |
| 7 | JGI25151J46595_10003056 | 3300003187 | Bacteria | 9468 |
| 8 | JGI25151J46595_10003287 | 3300003187 | Bacteria | 8984 |
| 9 | JGI25151J46595_10018537 | 3300003187 | Bacteria | 2984 |
| 10 | JGI25406J46586_10000099 | 3300003203 | Bacteria | 38165 |
| 11 | JGI25406J46586_10001854 | 3300003203 | Bacteria | 9929 |
| 12 | rootH1_10192437 | 3300003316 | Bacteria | 1430 |
| 13 | Ga0006562J51391_1016962 | 3300003578 | Bacteria | 1857 |
| 14 | Ga0006562J51391_1041968 | 3300003578 | Bacteria | 1291 |
| 15 | Ga0055538_1000283 | 3300003751 | Bacteria | 25962 |
| 16 | Ga0055532_1000229 | 3300003758 | Bacteria | 42014 |
| 17 | Ga0055536_1022910 | 3300003781 | Bacteria | 1849 |
| 18 | Ga0058692_1000001 | 3300003856 | Bacteria | 834230 |
| 19 | Ga0058692_1000063 | 3300003856 | Bacteria | 93069 |
| 20 | Ga0065714_10080014 | 3300005288 | Bacteria | 2471 |
| 21 | Ga0065704_10003837 | 3300005289 | Bacteria | 4474 |
| 22 | Ga0065704_10010176 | 3300005289 | Bacteria | 2830 |
| 23 | Ga0065704_10077027 | 3300005289 | Bacteria | 4883 |
| 24 | Ga0065707_10084189 | 3300005295 | Bacteria | 7555 |
| 25 | Ga0065707_10118720 | 3300005295 | Bacteria | 2178 |
| 26 | Ga0070658_10026316 | 3300005327 | Bacteria | 4666 |
| 27 | Ga0070676_10041771 | 3300005328 | Bacteria | 2660 |
| 28 | Ga0070676_10099977 | 3300005328 | Bacteria | 1790 |
| 29 | Ga0070683_100007853 | 3300005329 | Bacteria | 9036 |
| 30 | Ga0070683_100024318 | 3300005329 | Bacteria | 5425 |
| 31 | Ga0070683_100254800 | 3300005329 | Bacteria | 1669 |
| 32 | Ga0070690_100027158 | 3300005330 | Bacteria | 3537 |
| 33 | Ga0070690_100171394 | 3300005330 | Bacteria | 1494 |
| 34 | Ga0070670_100000072 | 3300005331 | Bacteria | 102029 |
| 35 | Ga0070670_100119174 | 3300005331 | Bacteria | 2276 |
| 36 | Ga0070670_100144088 | 3300005331 | Bacteria | 2061 |
| 37 | Ga0070677_10023288 | 3300005333 | Bacteria | 2292 |
| 38 | Ga0068869_100028234 | 3300005334 | Bacteria | 3920 |
| 39 | Ga0068869_100081247 | 3300005334 | Bacteria | 2420 |
| 40 | Ga0070666_10050020 | 3300005335 | Bacteria | 2811 |
| 41 | Ga0070666_10129546 | 3300005335 | Bacteria | 1752 |
| 42 | Ga0070680_100000261 | 3300005336 | Bacteria | 34740 |
| 43 | Ga0070680_100017787 | 3300005336 | Bacteria | 5607 |
| 44 | Ga0070680_100069143 | 3300005336 | Bacteria | 2899 |
| 45 | Ga0070680_100107679 | 3300005336 | Bacteria | 2318 |
| 46 | Ga0070680_100240839 | 3300005336 | Bacteria | 1529 |
| 47 | Ga0068868_100002141 | 3300005338 | Bacteria | 13628 |
| 48 | Ga0068868_100019874 | 3300005338 | Bacteria | 5038 |
| 49 | Ga0070660_100012370 | 3300005339 | Bacteria | 6092 |
| 50 | Ga0070660_100026559 | 3300005339 | Bacteria | 4312 |
| 51 | Ga0070660_100224956 | 3300005339 | Bacteria | 1526 |
| 52 | Ga0070689_100036774 | 3300005340 | Bacteria | 3743 |
| 53 | Ga0070691_10011061 | 3300005341 | Bacteria | 4122 |
| 54 | Ga0070691_10033980 | 3300005341 | Bacteria | 2399 |
| 55 | Ga0070687_100018616 | 3300005343 | Bacteria | 3216 |
| 56 | Ga0070687_100055083 | 3300005343 | Bacteria | 2075 |
| 57 | Ga0070687_100058624 | 3300005343 | Bacteria | 2023 |
| 58 | Ga0070661_100068424 | 3300005344 | Bacteria | 2609 |
| 59 | Ga0070661_100097130 | 3300005344 | Bacteria | 2187 |
| 60 | Ga0070692_10071974 | 3300005345 | Bacteria | 1843 |
| 61 | Ga0070668_100001049 | 3300005347 | Bacteria | 19395 |
| 62 | Ga0070668_100005680 | 3300005347 | Bacteria | 9248 |
| 63 | Ga0070668_100057236 | 3300005347 | Bacteria | 3012 |
| 64 | Ga0070668_100087008 | 3300005347 | Bacteria | 2458 |
| 65 | Ga0070669_100005928 | 3300005353 | Bacteria | 8817 |
| 66 | Ga0070669_100016997 | 3300005353 | Bacteria | 5194 |
| 67 | Ga0070669_100050975 | 3300005353 | Bacteria | 3024 |
| 68 | Ga0070669_100113457 | 3300005353 | Bacteria | 2059 |
| 69 | Ga0070675_100000935 | 3300005354 | Bacteria | 20796 |
| 70 | Ga0070675_100028702 | 3300005354 | Bacteria | 4479 |
| 71 | Ga0070671_100000969 | 3300005355 | Bacteria | 21018 |
| 72 | Ga0070671_100015123 | 3300005355 | Bacteria | 6233 |
| 73 | Ga0070671_100019608 | 3300005355 | Bacteria | 5506 |
| 74 | Ga0070671_100027586 | 3300005355 | Bacteria | 4675 |
| 75 | Ga0070671_100118565 | 3300005355 | Bacteria | 2226 |
| 76 | Ga0070674_100027421 | 3300005356 | Bacteria | 3732 |
| 77 | Ga0070673_100031261 | 3300005364 | Bacteria | 3993 |
| 78 | Ga0070673_100051522 | 3300005364 | Bacteria | 3225 |
| 79 | Ga0070688_100048884 | 3300005365 | Bacteria | 2630 |
| 80 | Ga0070659_100003482 | 3300005366 | Bacteria | 11205 |
| 81 | Ga0070659_100073290 | 3300005366 | Bacteria | 2725 |
| 82 | Ga0070659_100140338 | 3300005366 | Bacteria | 1967 |
| 83 | Ga0070667_100000746 | 3300005367 | Bacteria | 31099 |
| 84 | Ga0070667_100012821 | 3300005367 | Bacteria | 6927 |
| 85 | Ga0070667_100021378 | 3300005367 | Bacteria | 5373 |
| 86 | Ga0070703_10013487 | 3300005406 | Bacteria | 2322 |
| 87 | Ga0070709_10000727 | 3300005434 | Bacteria | 18619 |
| 88 | Ga0070709_10001186 | 3300005434 | Bacteria | 14341 |
| 89 | Ga0070709_10001840 | 3300005434 | Bacteria | 11510 |
| 90 | Ga0070709_10014473 | 3300005434 | Bacteria | 4463 |
| 91 | Ga0070709_10052770 | 3300005434 | Bacteria | 2557 |
| 92 | Ga0070709_10063900 | 3300005434 | Bacteria | 2352 |
| 93 | Ga0070709_10168283 | 3300005434 | Bacteria | 1529 |
| 94 | Ga0070714_100000601 | 3300005435 | Bacteria | 25736 |
| 95 | Ga0070714_100007663 | 3300005435 | Bacteria | 8407 |
| 96 | Ga0070714_100034070 | 3300005435 | Bacteria | 4263 |
| 97 | Ga0070714_100057419 | 3300005435 | Bacteria | 3332 |
| 98 | Ga0070713_100008515 | 3300005436 | Bacteria | 7279 |
| 99 | Ga0070713_100020320 | 3300005436 | Bacteria | 5089 |
| 100 | Ga0070713_100053270 | 3300005436 | Bacteria | 3352 |
| 101 | Ga0070713_100061729 | 3300005436 | Bacteria | 3136 |
| 102 | Ga0070713_100075790 | 3300005436 | Bacteria | 2854 |
| 103 | Ga0070713_100099046 | 3300005436 | Bacteria | 2521 |
| 104 | Ga0070713_100141823 | 3300005436 | Bacteria | 2129 |
| 105 | Ga0070710_10000225 | 3300005437 | Bacteria | 26402 |
| 106 | Ga0070710_10000234 | 3300005437 | Bacteria | 25949 |
| 107 | Ga0070710_10000408 | 3300005437 | Bacteria | 20191 |
| 108 | Ga0070710_10004952 | 3300005437 | Bacteria | 6303 |
| 109 | Ga0070710_10024459 | 3300005437 | Bacteria | 3186 |
| 110 | Ga0070710_10039025 | 3300005437 | Bacteria | 2611 |
| 111 | Ga0070710_10040416 | 3300005437 | Bacteria | 2571 |
| 112 | Ga0070711_100000428 | 3300005439 | Bacteria | 21935 |
| 113 | Ga0070711_100000526 | 3300005439 | Bacteria | 19854 |
| 114 | Ga0070711_100001089 | 3300005439 | Bacteria | 14524 |
| 115 | Ga0070711_100001574 | 3300005439 | Bacteria | 12551 |
| 116 | Ga0070711_100032364 | 3300005439 | Bacteria | 3476 |
| 117 | Ga0070705_100012199 | 3300005440 | Bacteria | 4362 |
| 118 | Ga0070705_100043448 | 3300005440 | Bacteria | 2575 |
| 119 | Ga0070705_100052962 | 3300005440 | Bacteria | 2373 |
| 120 | Ga0070700_100002856 | 3300005441 | Bacteria | 8860 |
| 121 | Ga0070694_100029011 | 3300005444 | Bacteria | 3607 |
| 122 | Ga0070694_100065923 | 3300005444 | Bacteria | 2483 |
| 123 | Ga0070708_100004853 | 3300005445 | Bacteria | 10615 |
| 124 | Ga0070663_100001262 | 3300005455 | Bacteria | 13900 |
| 125 | Ga0070663_100002450 | 3300005455 | Bacteria | 10453 |
| 126 | Ga0070678_100068784 | 3300005456 | Bacteria | 2641 |
| 127 | Ga0070662_100037024 | 3300005457 | Bacteria | 3456 |
| 128 | Ga0070662_100123912 | 3300005457 | Bacteria | 1984 |
| 129 | Ga0070681_10000079 | 3300005458 | Bacteria | 71936 |
| 130 | Ga0070681_10057401 | 3300005458 | Bacteria | 3873 |
| 131 | Ga0070681_10077913 | 3300005458 | Bacteria | 3271 |
| 132 | Ga0070681_10186803 | 3300005458 | Bacteria | 1993 |
| 133 | Ga0070681_10240551 | 3300005458 | Bacteria | 1724 |
| 134 | Ga0070685_10203052 | 3300005466 | Bacteria | 1289 |
| 135 | Ga0070706_100001191 | 3300005467 | Bacteria | 27870 |
| 136 | Ga0070706_100012100 | 3300005467 | Bacteria | 8008 |
| 137 | Ga0070706_100023248 | 3300005467 | Bacteria | 5710 |
| 138 | Ga0070706_100023878 | 3300005467 | Bacteria | 5630 |
| 139 | Ga0070706_100117704 | 3300005467 | Bacteria | 2475 |
| 140 | Ga0070707_100000563 | 3300005468 | Bacteria | 37248 |
| 141 | Ga0070707_100001915 | 3300005468 | Bacteria | 19953 |
| 142 | Ga0070707_100009169 | 3300005468 | Bacteria | 9180 |
| 143 | Ga0070707_100015399 | 3300005468 | Bacteria | 7175 |
| 144 | Ga0070707_100024691 | 3300005468 | Bacteria | 5695 |
| 145 | Ga0070707_100042973 | 3300005468 | Bacteria | 4327 |
| 146 | Ga0070707_100109691 | 3300005468 | Bacteria | 2676 |
| 147 | Ga0070707_100133074 | 3300005468 | Bacteria | 2419 |
| 148 | Ga0070707_100169209 | 3300005468 | Bacteria | 2130 |
| 149 | Ga0070698_100000280 | 3300005471 | Bacteria | 51955 |
| 150 | Ga0070698_100000592 | 3300005471 | Bacteria | 38966 |
| 151 | Ga0070698_100000647 | 3300005471 | Bacteria | 37248 |
| 152 | Ga0070698_100006462 | 3300005471 | Bacteria | 12717 |
| 153 | Ga0070698_100008349 | 3300005471 | Bacteria | 11193 |
| 154 | Ga0070698_100013896 | 3300005471 | Bacteria | 8516 |
| 155 | Ga0070698_100017952 | 3300005471 | Bacteria | 7451 |
| 156 | Ga0070698_100083485 | 3300005471 | Bacteria | 3183 |
| 157 | Ga0070698_100093440 | 3300005471 | Bacteria | 2987 |
| 158 | Ga0070699_100000149 | 3300005518 | Bacteria | 66121 |
| 159 | Ga0070699_100268449 | 3300005518 | Bacteria | 1527 |
| 160 | Ga0070679_100000056 | 3300005530 | Bacteria | 83790 |
| 161 | Ga0070679_100019580 | 3300005530 | Bacteria | 6585 |
| 162 | Ga0070684_100004005 | 3300005535 | Bacteria | 11150 |
| 163 | Ga0070684_100071856 | 3300005535 | Bacteria | 3045 |
| 164 | Ga0070684_100086865 | 3300005535 | Bacteria | 2776 |
| 165 | Ga0070684_100134362 | 3300005535 | Bacteria | 2233 |
| 166 | Ga0070684_100154934 | 3300005535 | Bacteria | 2077 |
| 167 | Ga0070684_100183608 | 3300005535 | Bacteria | 1902 |
| 168 | Ga0070697_100000222 | 3300005536 | Bacteria | 46798 |
| 169 | Ga0070697_100119837 | 3300005536 | Bacteria | 2200 |
| 170 | Ga0070697_100250938 | 3300005536 | Bacteria | 1513 |
| 171 | Ga0068853_100042114 | 3300005539 | Bacteria | 3903 |
| 172 | Ga0068853_100234628 | 3300005539 | Bacteria | 1679 |
| 173 | Ga0068853_100298155 | 3300005539 | Bacteria | 1489 |
| 174 | Ga0070672_100010102 | 3300005543 | Bacteria | 6536 |
| 175 | Ga0070686_100024100 | 3300005544 | Bacteria | 3645 |
| 176 | Ga0070695_100004596 | 3300005545 | Bacteria | 8100 |
| 177 | Ga0070695_100032163 | 3300005545 | Bacteria | 3279 |
| 178 | Ga0070695_100081324 | 3300005545 | Bacteria | 2143 |
| 179 | Ga0070695_100193948 | 3300005545 | Bacteria | 1447 |
| 180 | Ga0070696_100010621 | 3300005546 | Bacteria | 6167 |
| 181 | Ga0070696_100045553 | 3300005546 | Bacteria | 3039 |
| 182 | Ga0070696_100052323 | 3300005546 | Bacteria | 2841 |
| 183 | Ga0070693_100009751 | 3300005547 | Bacteria | 4785 |
| 184 | Ga0070693_100011397 | 3300005547 | Bacteria | 4478 |
| 185 | Ga0070693_100040158 | 3300005547 | Bacteria | 2625 |
| 186 | Ga0070665_100055258 | 3300005548 | Bacteria | 3982 |
| 187 | Ga0070665_100318480 | 3300005548 | Bacteria | 1559 |
| 188 | Ga0070665_100425573 | 3300005548 | Bacteria | 1336 |
| 189 | Ga0070704_100035963 | 3300005549 | Bacteria | 3370 |
| 190 | Ga0070704_100051187 | 3300005549 | Bacteria | 2907 |
| 191 | Ga0070704_100056813 | 3300005549 | Bacteria | 2780 |
| 192 | Ga0070704_100074806 | 3300005549 | Bacteria | 2472 |
| 193 | Ga0070704_100077506 | 3300005549 | Bacteria | 2435 |
| 194 | Ga0068855_100007525 | 3300005563 | Bacteria | 13183 |
| 195 | Ga0070664_100000402 | 3300005564 | Bacteria | 32165 |
| 196 | Ga0070664_100014689 | 3300005564 | Bacteria | 6394 |
| 197 | Ga0070664_100215100 | 3300005564 | Bacteria | 1718 |
| 198 | Ga0068857_100010684 | 3300005577 | Bacteria | 7986 |
| 199 | Ga0068857_100028644 | 3300005577 | Bacteria | 4914 |
| 200 | Ga0068857_100077797 | 3300005577 | Bacteria | 2960 |
| 201 | Ga0068857_100095592 | 3300005577 | Bacteria | 2662 |
| 202 | Ga0068857_100125796 | 3300005577 | Bacteria | 2309 |
| 203 | Ga0068854_100002153 | 3300005578 | Bacteria | 12088 |
| 204 | Ga0068854_100009528 | 3300005578 | Bacteria | 6269 |
| 205 | Ga0068856_100018569 | 3300005614 | Bacteria | 6738 |
| 206 | Ga0068856_100029701 | 3300005614 | Bacteria | 5340 |
| 207 | Ga0068856_100096372 | 3300005614 | Bacteria | 2947 |
| 208 | Ga0070702_100031728 | 3300005615 | Bacteria | 2893 |
| 209 | Ga0070702_100104153 | 3300005615 | Bacteria | 1746 |
| 210 | Ga0070702_100150879 | 3300005615 | Bacteria | 1492 |
| 211 | Ga0068852_100021347 | 3300005616 | Bacteria | 5169 |
| 212 | Ga0068852_100036367 | 3300005616 | Bacteria | 4119 |
| 213 | Ga0068852_100081232 | 3300005616 | Bacteria | 2877 |
| 214 | Ga0068852_100220995 | 3300005616 | Bacteria | 1801 |
| 215 | Ga0068859_100013427 | 3300005617 | Bacteria | 8212 |
| 216 | Ga0068859_100095026 | 3300005617 | Bacteria | 3033 |
| 217 | Ga0068859_100104974 | 3300005617 | Bacteria | 2885 |
| 218 | Ga0068859_100116526 | 3300005617 | Bacteria | 2736 |
| 219 | Ga0068859_100143667 | 3300005617 | Bacteria | 2460 |
| 220 | Ga0068864_100000019 | 3300005618 | Bacteria | 271650 |
| 221 | Ga0068864_100000038 | 3300005618 | Bacteria | 181005 |
| 222 | Ga0068864_100022161 | 3300005618 | Bacteria | 5326 |
| 223 | Ga0068864_100055644 | 3300005618 | Bacteria | 3416 |
| 224 | Ga0068864_100095729 | 3300005618 | Bacteria | 2626 |
| 225 | Ga0068866_10023473 | 3300005718 | Bacteria | 2871 |
| 226 | Ga0068866_10030458 | 3300005718 | Bacteria | 2590 |
| 227 | Ga0068861_100005613 | 3300005719 | Bacteria | 8504 |
| 228 | Ga0068861_100036062 | 3300005719 | Bacteria | 3667 |
| 229 | Ga0068861_100224450 | 3300005719 | Bacteria | 1590 |
| 230 | Ga0068870_10044825 | 3300005840 | Bacteria | 2312 |
| 231 | Ga0068870_10160202 | 3300005840 | Bacteria | 1334 |
| 232 | Ga0068863_100000026 | 3300005841 | Bacteria | 185590 |
| 233 | Ga0068863_100000104 | 3300005841 | Bacteria | 90766 |
| 234 | Ga0068863_100023034 | 3300005841 | Bacteria | 5952 |
| 235 | Ga0068863_100026479 | 3300005841 | Bacteria | 5532 |
| 236 | Ga0068863_100038287 | 3300005841 | Bacteria | 4562 |
| 237 | Ga0068863_100055667 | 3300005841 | Bacteria | 3745 |
| 238 | Ga0068863_100078450 | 3300005841 | Bacteria | 3127 |
| 239 | Ga0068858_100000061 | 3300005842 | Bacteria | 113998 |
| 240 | Ga0068858_100009842 | 3300005842 | Bacteria | 9090 |
| 241 | Ga0068858_100018641 | 3300005842 | Bacteria | 6497 |
| 242 | Ga0068858_100293361 | 3300005842 | Bacteria | 1550 |
| 243 | Ga0068860_100025917 | 3300005843 | Bacteria | 5657 |
| 244 | Ga0068860_100144017 | 3300005843 | Bacteria | 2292 |
| 245 | Ga0068860_100156066 | 3300005843 | Bacteria | 2199 |
| 246 | Ga0068862_100000279 | 3300005844 | Bacteria | 56941 |
| 247 | Ga0068862_100005914 | 3300005844 | Bacteria | 10187 |
| 248 | Ga0068862_100018828 | 3300005844 | Bacteria | 5754 |
| 249 | Ga0081455_10006019 | 3300005937 | Bacteria | 13143 |
| 250 | Ga0081455_10010606 | 3300005937 | Bacteria | 9323 |
| 251 | Ga0081455_10012222 | 3300005937 | Bacteria | 8573 |
| 252 | Ga0081455_10040682 | 3300005937 | Bacteria | 4097 |
| 253 | Ga0081455_10100803 | 3300005937 | Bacteria | 2319 |
| 254 | Ga0081455_10205544 | 3300005937 | Bacteria | 1471 |
| 255 | Ga0081538_10001179 | 3300005981 | Bacteria | 27583 |
| 256 | Ga0081540_1001050 | 3300005983 | Bacteria | 24617 |
| 257 | Ga0081540_1001110 | 3300005983 | Bacteria | 23850 |
| 258 | Ga0081540_1002720 | 3300005983 | Bacteria | 14387 |
| 259 | Ga0081539_10000183 | 3300005985 | Bacteria | 148051 |
| 260 | Ga0081539_10003736 | 3300005985 | Bacteria | 18107 |
| 261 | Ga0081539_10013047 | 3300005985 | Bacteria | 6302 |
| 262 | Ga0081539_10155366 | 3300005985 | Bacteria | 1096 |
| 263 | Ga0070717_10001939 | 3300006028 | Bacteria | 14431 |
| 264 | Ga0070717_10020874 | 3300006028 | Bacteria | 5157 |
| 265 | Ga0070717_10051249 | 3300006028 | Bacteria | 3396 |
| 266 | Ga0070717_10058473 | 3300006028 | Bacteria | 3188 |
| 267 | Ga0070717_10065448 | 3300006028 | Bacteria | 3022 |
| 268 | Ga0070717_10090203 | 3300006028 | Bacteria | 2586 |
| 269 | Ga0070717_10127910 | 3300006028 | Bacteria | 2182 |
| 270 | Ga0070717_10145010 | 3300006028 | Bacteria | 2050 |
| 271 | Ga0075365_10021633 | 3300006038 | Bacteria | 4015 |
| 272 | Ga0075365_10034701 | 3300006038 | Bacteria | 3259 |
| 273 | Ga0075365_10042756 | 3300006038 | Bacteria | 2964 |
| 274 | Ga0075365_10047169 | 3300006038 | Bacteria | 2831 |
| 275 | Ga0075365_10145120 | 3300006038 | Bacteria | 1649 |
| 276 | Ga0075364_10054781 | 3300006051 | Bacteria | 2608 |
| 277 | Ga0070715_10008016 | 3300006163 | Bacteria | 3663 |
| 278 | Ga0070715_10022431 | 3300006163 | Bacteria | 2462 |
| 279 | Ga0070716_100001419 | 3300006173 | Bacteria | 10643 |
| 280 | Ga0070716_100009855 | 3300006173 | Bacteria | 4775 |
| 281 | Ga0070716_100041749 | 3300006173 | Bacteria | 2557 |
| 282 | Ga0070716_100134387 | 3300006173 | Bacteria | 1568 |
| 283 | Ga0070716_100152432 | 3300006173 | Bacteria | 1488 |
| 284 | Ga0070712_100000151 | 3300006175 | Bacteria | 37005 |
| 285 | Ga0070712_100018301 | 3300006175 | Bacteria | 4548 |
| 286 | Ga0070712_100077823 | 3300006175 | Bacteria | 2392 |
| 287 | Ga0070712_100078117 | 3300006175 | Bacteria | 2388 |
| 288 | Ga0070712_100118895 | 3300006175 | Bacteria | 1985 |
| 289 | Ga0070712_100136035 | 3300006175 | Bacteria | 1868 |
| 290 | Ga0097621_100056583 | 3300006237 | Bacteria | 3204 |
| 291 | Ga0075370_10004043 | 3300006353 | Bacteria | 7051 |
| 292 | Ga0075370_10100818 | 3300006353 | Bacteria | 1671 |
| 293 | Ga0068871_100039518 | 3300006358 | Bacteria | 3776 |
| 294 | Ga0068871_100092724 | 3300006358 | Bacteria | 2519 |
| 295 | Ga0075428_100171501 | 3300006844 | Bacteria | 2351 |
| 296 | Ga0075428_100464928 | 3300006844 | Bacteria | 1354 |
| 297 | Ga0075428_100483770 | 3300006844 | Bacteria | 1325 |
| 298 | Ga0075430_100045529 | 3300006846 | Bacteria | 3706 |
| 299 | Ga0075431_100000341 | 3300006847 | Bacteria | 36704 |
| 300 | Ga0075431_100000800 | 3300006847 | Bacteria | 27517 |
| 301 | Ga0075431_100010582 | 3300006847 | Bacteria | 9276 |
| 302 | Ga0075431_100207211 | 3300006847 | Bacteria | 2004 |
| 303 | Ga0075431_100283634 | 3300006847 | Bacteria | 1677 |
| 304 | Ga0075433_10068651 | 3300006852 | Bacteria | 3112 |
| 305 | Ga0075434_100026312 | 3300006871 | Bacteria | 5698 |
| 306 | Ga0075434_100050538 | 3300006871 | Bacteria | 4130 |
| 307 | Ga0075434_100204005 | 3300006871 | Bacteria | 1997 |
| 308 | Ga0075429_100023407 | 3300006880 | Bacteria | 5360 |
| 309 | Ga0075436_100017334 | 3300006914 | Bacteria | 4930 |
| 310 | Ga0075436_100043069 | 3300006914 | Bacteria | 3112 |
| 311 | Ga0075436_100126404 | 3300006914 | Bacteria | 1791 |
| 312 | Ga0097620_100013427 | 3300006931 | Bacteria | 8212 |
| 313 | Ga0097620_100095023 | 3300006931 | Bacteria | 3033 |
| 314 | Ga0097620_100104974 | 3300006931 | Bacteria | 2885 |
| 315 | Ga0097620_100116513 | 3300006931 | Bacteria | 2736 |
| 316 | Ga0097620_100143669 | 3300006931 | Bacteria | 2460 |
| 317 | Ga0075435_100006251 | 3300007076 | Bacteria | 8409 |
| 318 | Ga0075435_100016534 | 3300007076 | Bacteria | 5563 |
| 319 | Ga0075435_100026937 | 3300007076 | Bacteria | 4491 |
| 320 | Ga0105251_10000905 | 3300009011 | Bacteria | 26609 |
| 321 | Ga0105251_10007705 | 3300009011 | Bacteria | 6578 |
| 322 | Ga0105251_10019101 | 3300009011 | Bacteria | 3628 |
| 323 | Ga0105251_10029432 | 3300009011 | Bacteria | 2766 |
| 324 | Ga0105251_10039953 | 3300009011 | Bacteria | 2289 |
| 325 | Ga0105244_10001754 | 3300009036 | Bacteria | 17039 |
| 326 | Ga0105244_10005044 | 3300009036 | Bacteria | 8882 |
| 327 | Ga0105244_10005353 | 3300009036 | Bacteria | 8543 |
| 328 | Ga0105250_10000642 | 3300009092 | Bacteria | 22235 |
| 329 | Ga0105250_10001851 | 3300009092 | Bacteria | 11018 |
| 330 | Ga0105250_10016467 | 3300009092 | Bacteria | 3011 |
| 331 | Ga0105250_10053938 | 3300009092 | Bacteria | 1612 |
| 332 | Ga0105240_10093238 | 3300009093 | Bacteria | 3676 |
| 333 | Ga0105240_10185438 | 3300009093 | Bacteria | 2451 |
| 334 | Ga0105240_10203795 | 3300009093 | Bacteria | 2317 |
| 335 | Ga0111539_10000944 | 3300009094 | Bacteria | 38074 |
| 336 | Ga0111539_10017082 | 3300009094 | Bacteria | 8981 |
| 337 | Ga0111539_10054923 | 3300009094 | Bacteria | 4736 |
| 338 | Ga0111539_10086300 | 3300009094 | Bacteria | 3688 |
| 339 | Ga0111539_10113334 | 3300009094 | Bacteria | 3181 |
| 340 | Ga0111539_10113709 | 3300009094 | Bacteria | 3175 |
| 341 | Ga0105245_10011337 | 3300009098 | Bacteria | 7762 |
| 342 | Ga0105245_10036871 | 3300009098 | Bacteria | 4345 |
| 343 | Ga0105245_10090808 | 3300009098 | Bacteria | 2810 |
| 344 | Ga0105247_10000251 | 3300009101 | Bacteria | 49900 |
| 345 | Ga0105247_10008026 | 3300009101 | Bacteria | 6450 |
| 346 | Ga0105247_10019843 | 3300009101 | Bacteria | 4037 |
| 347 | Ga0105247_10056251 | 3300009101 | Bacteria | 2429 |
| 348 | Ga0114129_10006787 | 3300009147 | Bacteria | 16254 |
| 349 | Ga0114129_10008886 | 3300009147 | Bacteria | 14325 |
| 350 | Ga0114129_10018930 | 3300009147 | Bacteria | 9810 |
| 351 | Ga0114129_10030723 | 3300009147 | Bacteria | 7597 |
| 352 | Ga0114129_10655607 | 3300009147 | Bacteria | 1354 |
| 353 | Ga0114129_10664763 | 3300009147 | Bacteria | 1343 |
| 354 | Ga0105243_10000010 | 3300009148 | Bacteria | 316672 |
| 355 | Ga0105243_10000155 | 3300009148 | Bacteria | 78612 |
| 356 | Ga0105243_10009892 | 3300009148 | Bacteria | 7251 |
| 357 | Ga0105243_10080826 | 3300009148 | Bacteria | 2652 |
| 358 | Ga0105243_10095464 | 3300009148 | Bacteria | 2457 |
| 359 | Ga0105243_10096414 | 3300009148 | Bacteria | 2447 |
| 360 | Ga0105241_10043770 | 3300009174 | Bacteria | 3391 |
| 361 | Ga0105241_10097509 | 3300009174 | Bacteria | 2331 |
| 362 | Ga0105242_10028818 | 3300009176 | Bacteria | 4422 |
| 363 | Ga0105242_10047973 | 3300009176 | Bacteria | 3469 |
| 364 | Ga0105242_10087236 | 3300009176 | Bacteria | 2620 |
| 365 | Ga0105242_10108327 | 3300009176 | Bacteria | 2364 |
| 366 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 367 | Ga0105248_10020029 | 3300009177 | Bacteria | 7407 |
| 368 | Ga0105248_10028137 | 3300009177 | Bacteria | 6260 |
| 369 | Ga0105248_10034717 | 3300009177 | Bacteria | 5642 |
| 370 | Ga0105248_10085006 | 3300009177 | Bacteria | 3560 |
| 371 | Ga0105248_10445446 | 3300009177 | Bacteria | 1459 |
| 372 | Ga0105237_10000681 | 3300009545 | Bacteria | 47030 |
| 373 | Ga0105237_10015085 | 3300009545 | Bacteria | 8051 |
| 374 | Ga0105237_10017247 | 3300009545 | Bacteria | 7488 |
| 375 | Ga0105237_10046841 | 3300009545 | Bacteria | 4348 |
| 376 | Ga0105237_10050938 | 3300009545 | Bacteria | 4160 |
| 377 | Ga0105237_10063603 | 3300009545 | Bacteria | 3687 |
| 378 | Ga0105237_10077247 | 3300009545 | Bacteria | 3320 |
| 379 | Ga0105238_10068561 | 3300009551 | Bacteria | 3548 |
| 380 | Ga0105249_10000048 | 3300009553 | Bacteria | 172137 |
| 381 | Ga0105249_10000305 | 3300009553 | Bacteria | 49977 |
| 382 | Ga0105249_10001408 | 3300009553 | Bacteria | 21068 |
| 383 | Ga0105249_10017159 | 3300009553 | Bacteria | 6426 |
| 384 | Ga0105249_10070021 | 3300009553 | Bacteria | 3238 |
| 385 | Ga0105249_10119965 | 3300009553 | Bacteria | 2498 |
| 386 | Ga0105249_10134540 | 3300009553 | Bacteria | 2364 |
| 387 | Ga0105239_10003066 | 3300010375 | Bacteria | 20762 |
| 388 | Ga0105239_10066734 | 3300010375 | Bacteria | 3952 |
| 389 | Ga0105239_10078462 | 3300010375 | Bacteria | 3634 |
| 390 | Ga0105239_10174362 | 3300010375 | Bacteria | 2405 |
| 391 | Ga0105239_10263549 | 3300010375 | Bacteria | 1937 |
| 392 | Ga0105239_10338014 | 3300010375 | Bacteria | 1699 |
| 393 | Ga0105246_10001817 | 3300011119 | Bacteria | 12785 |
| 394 | Ga0105246_10009585 | 3300011119 | Bacteria | 5968 |
| 395 | Ga0105246_10037415 | 3300011119 | Bacteria | 3257 |
| 396 | Ga0105246_10117137 | 3300011119 | Bacteria | 1968 |
| 397 | Ga0157373_10043419 | 3300013100 | Bacteria | 3211 |
| 398 | Ga0157373_10057099 | 3300013100 | Bacteria | 2769 |
| 399 | Ga0157371_10032330 | 3300013102 | Bacteria | 3766 |
| 400 | Ga0157371_10033162 | 3300013102 | Bacteria | 3712 |
| 401 | Ga0157371_10068432 | 3300013102 | Bacteria | 2513 |
| 402 | Ga0157371_10107024 | 3300013102 | Bacteria | 1984 |
| 403 | Ga0157371_10115375 | 3300013102 | Bacteria | 1907 |
| 404 | Ga0157370_10048914 | 3300013104 | Bacteria | 4050 |
| 405 | Ga0157370_10124500 | 3300013104 | Bacteria | 2407 |
| 406 | Ga0157370_10157510 | 3300013104 | Bacteria | 2113 |
| 407 | Ga0157369_10028383 | 3300013105 | Bacteria | 6193 |
| 408 | Ga0157369_10053243 | 3300013105 | Bacteria | 4375 |
| 409 | Ga0157369_10080438 | 3300013105 | Bacteria | 3489 |
| 410 | Ga0157369_10110381 | 3300013105 | Bacteria | 2924 |
| 411 | Ga0171462_1002 | 3300013250 | Bacteria | 1052134 |
| 412 | Ga0157374_10029225 | 3300013296 | Bacteria | 4988 |
| 413 | Ga0157378_10041354 | 3300013297 | Bacteria | 4088 |
| 414 | Ga0163162_10024165 | 3300013306 | Bacteria | 5997 |
| 415 | Ga0163162_10056847 | 3300013306 | Bacteria | 3940 |
| 416 | Ga0163162_10224878 | 3300013306 | Bacteria | 2006 |
| 417 | Ga0163162_10477674 | 3300013306 | Bacteria | 1378 |
| 418 | Ga0157375_10010788 | 3300013308 | Bacteria | 8049 |
| 419 | Ga0157375_10048566 | 3300013308 | Bacteria | 4152 |
| 420 | Ga0157375_10091051 | 3300013308 | Bacteria | 3110 |
| 421 | Ga0157375_10489359 | 3300013308 | Bacteria | 1395 |
| 422 | Ga0163163_10179161 | 3300014325 | Bacteria | 2166 |
| 423 | Ga0163163_10325178 | 3300014325 | Bacteria | 1592 |
| 424 | Ga0157380_10007550 | 3300014326 | Bacteria | 7725 |
| 425 | Ga0157380_10173779 | 3300014326 | Bacteria | 1885 |
| 426 | Ga0157380_10310741 | 3300014326 | Bacteria | 1457 |
| 427 | Ga0182008_10002889 | 3300014497 | Bacteria | 10629 |
| 428 | Ga0157377_10131214 | 3300014745 | Bacteria | 1530 |
| 429 | Ga0157379_10015692 | 3300014968 | Bacteria | 6656 |
| 430 | Ga0157379_10017157 | 3300014968 | Bacteria | 6376 |
| 431 | Ga0157379_10244541 | 3300014968 | Bacteria | 1628 |
| 432 | Ga0157376_10031970 | 3300014969 | Bacteria | 4221 |
| 433 | Ga0182006_1000214 | 3300015261 | Bacteria | 56285 |
| 434 | Ga0163161_10012381 | 3300017792 | Bacteria | 5922 |
| 435 | Ga0163161_10042245 | 3300017792 | Bacteria | 3278 |
| 436 | Ga0163161_10044709 | 3300017792 | Bacteria | 3191 |
| 437 | Ga0163161_10159331 | 3300017792 | Bacteria | 1720 |
| 438 | Ga0197907_11483172 | 3300020069 | Bacteria | 1572 |
| 439 | Ga0206356_11001745 | 3300020070 | Bacteria | 1575 |
| 440 | Ga0206356_11711657 | 3300020070 | Bacteria | 3391 |
| 441 | Ga0206351_10051467 | 3300020077 | Bacteria | 1568 |
| 442 | Ga0206354_10117409 | 3300020081 | Bacteria | 1440 |
| 443 | Ga0206354_10807169 | 3300020081 | Bacteria | 2016 |
| 444 | Ga0206354_11645157 | 3300020081 | Bacteria | 2199 |
| 445 | Ga0206353_11721640 | 3300020082 | Bacteria | 3142 |
| 446 | Ga0213873_10000130 | 3300021358 | Bacteria | 14226 |
| 447 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 448 | Ga0213876_10001915 | 3300021384 | Bacteria | 12500 |
| 449 | Ga0213876_10046411 | 3300021384 | Bacteria | 2297 |
| 450 | Ga0213875_10000174 | 3300021388 | Bacteria | 67979 |
| 451 | Ga0213875_10001334 | 3300021388 | Bacteria | 16255 |
| 452 | Ga0213875_10004336 | 3300021388 | Bacteria | 7814 |
| 453 | Ga0213875_10029575 | 3300021388 | Bacteria | 2598 |
| 454 | Ga0213875_10051292 | 3300021388 | Bacteria | 1933 |
| 455 | Ga0224712_10011188 | 3300022467 | Bacteria | 2774 |
| 456 | Ga0209784_100105 | 3300025224 | Bacteria | 98262 |
| 457 | Ga0209566_100178 | 3300025225 | Bacteria | 69170 |
| 458 | Ga0209147_100160 | 3300025229 | Bacteria | 90883 |
| 459 | Ga0209676_1000833 | 3300025292 | Bacteria | 39972 |
| 460 | Ga0209676_1001081 | 3300025292 | Bacteria | 30764 |
| 461 | Ga0209025_1000107 | 3300025294 | Bacteria | 222387 |
| 462 | Ga0209025_1000945 | 3300025294 | Bacteria | 44061 |
| 463 | Ga0209025_1001134 | 3300025294 | Bacteria | 38133 |
| 464 | Ga0209025_1001208 | 3300025294 | Bacteria | 36263 |
| 465 | Ga0209025_1001403 | 3300025294 | Bacteria | 31984 |
| 466 | Ga0209025_1001415 | 3300025294 | Bacteria | 31780 |
| 467 | Ga0209025_1007148 | 3300025294 | Bacteria | 8433 |
| 468 | Ga0209025_1016229 | 3300025294 | Bacteria | 4418 |
| 469 | Ga0207696_1001447 | 3300025711 | Bacteria | 12882 |
| 470 | Ga0207696_1002892 | 3300025711 | Bacteria | 8083 |
| 471 | Ga0207696_1004519 | 3300025711 | Bacteria | 5976 |
| 472 | Ga0207655_1000612 | 3300025728 | Bacteria | 43148 |
| 473 | Ga0207655_1000947 | 3300025728 | Bacteria | 30071 |
| 474 | Ga0207655_1001468 | 3300025728 | Bacteria | 21769 |
| 475 | Ga0207655_1001487 | 3300025728 | Bacteria | 21477 |
| 476 | Ga0207655_1004432 | 3300025728 | Bacteria | 9957 |
| 477 | Ga0207655_1004629 | 3300025728 | Bacteria | 9661 |
| 478 | Ga0207655_1025039 | 3300025728 | Bacteria | 2907 |
| 479 | Ga0207713_1001490 | 3300025735 | Bacteria | 18513 |
| 480 | Ga0207713_1002830 | 3300025735 | Bacteria | 12207 |
| 481 | Ga0207713_1003575 | 3300025735 | Bacteria | 10501 |
| 482 | Ga0207713_1003827 | 3300025735 | Bacteria | 10070 |
| 483 | Ga0207692_10000421 | 3300025898 | Bacteria | 14851 |
| 484 | Ga0207692_10001282 | 3300025898 | Bacteria | 9329 |
| 485 | Ga0207692_10003061 | 3300025898 | Bacteria | 6492 |
| 486 | Ga0207692_10005915 | 3300025898 | Bacteria | 4935 |
| 487 | Ga0207692_10006481 | 3300025898 | Bacteria | 4746 |
| 488 | Ga0207692_10006566 | 3300025898 | Bacteria | 4723 |
| 489 | Ga0207692_10019402 | 3300025898 | Bacteria | 3072 |
| 490 | Ga0207692_10062047 | 3300025898 | Bacteria | 1939 |
| 491 | Ga0207692_10078831 | 3300025898 | Bacteria | 1756 |
| 492 | Ga0207692_10082230 | 3300025898 | Bacteria | 1725 |
| 493 | Ga0207642_10054531 | 3300025899 | Bacteria | 1824 |
| 494 | Ga0207710_10000005 | 3300025900 | Bacteria | 607066 |
| 495 | Ga0207710_10000009 | 3300025900 | Bacteria | 485205 |
| 496 | Ga0207710_10027386 | 3300025900 | Bacteria | 2467 |
| 497 | Ga0207688_10000991 | 3300025901 | Bacteria | 14486 |
| 498 | Ga0207688_10006904 | 3300025901 | Bacteria | 6179 |
| 499 | Ga0207688_10009574 | 3300025901 | Bacteria | 5275 |
| 500 | Ga0207647_10022112 | 3300025904 | Bacteria | 4230 |
| 501 | Ga0207647_10038435 | 3300025904 | Bacteria | 3026 |
| 502 | Ga0207685_10004419 | 3300025905 | Bacteria | 3571 |
| 503 | Ga0207685_10030921 | 3300025905 | Bacteria | 1912 |
| 504 | Ga0207685_10041816 | 3300025905 | Bacteria | 1717 |
| 505 | Ga0207685_10048846 | 3300025905 | Bacteria | 1623 |
| 506 | Ga0207699_10000093 | 3300025906 | Bacteria | 65868 |
| 507 | Ga0207699_10000284 | 3300025906 | Bacteria | 27725 |
| 508 | Ga0207699_10000662 | 3300025906 | Bacteria | 16542 |
| 509 | Ga0207699_10001582 | 3300025906 | Bacteria | 10795 |
| 510 | Ga0207699_10005863 | 3300025906 | Bacteria | 5910 |
| 511 | Ga0207699_10017060 | 3300025906 | Bacteria | 3812 |
| 512 | Ga0207699_10020355 | 3300025906 | Bacteria | 3554 |
| 513 | Ga0207699_10091957 | 3300025906 | Bacteria | 1906 |
| 514 | Ga0207699_10094877 | 3300025906 | Bacteria | 1880 |
| 515 | Ga0207645_10009910 | 3300025907 | Bacteria | 6564 |
| 516 | Ga0207643_10008182 | 3300025908 | Bacteria | 5613 |
| 517 | Ga0207643_10012512 | 3300025908 | Bacteria | 4585 |
| 518 | Ga0207705_10146877 | 3300025909 | Bacteria | 1765 |
| 519 | Ga0207684_10001772 | 3300025910 | Bacteria | 22781 |
| 520 | Ga0207684_10004720 | 3300025910 | Bacteria | 12781 |
| 521 | Ga0207684_10008252 | 3300025910 | Bacteria | 9272 |
| 522 | Ga0207684_10009745 | 3300025910 | Bacteria | 8472 |
| 523 | Ga0207684_10014241 | 3300025910 | Bacteria | 6862 |
| 524 | Ga0207654_10222854 | 3300025911 | Bacteria | 1252 |
| 525 | Ga0207707_10000103 | 3300025912 | Bacteria | 83766 |
| 526 | Ga0207707_10091743 | 3300025912 | Bacteria | 2655 |
| 527 | Ga0207707_10210546 | 3300025912 | Bacteria | 1693 |
| 528 | Ga0207695_10120527 | 3300025913 | Bacteria | 2592 |
| 529 | Ga0207695_10145102 | 3300025913 | Bacteria | 2318 |
| 530 | Ga0207695_10296735 | 3300025913 | Bacteria | 1508 |
| 531 | Ga0207671_10006846 | 3300025914 | Bacteria | 10060 |
| 532 | Ga0207671_10015047 | 3300025914 | Bacteria | 6081 |
| 533 | Ga0207671_10038462 | 3300025914 | Bacteria | 3546 |
| 534 | Ga0207671_10052534 | 3300025914 | Bacteria | 3020 |
| 535 | Ga0207671_10158968 | 3300025914 | Bacteria | 1749 |
| 536 | Ga0207693_10000132 | 3300025915 | Bacteria | 67726 |
| 537 | Ga0207693_10001324 | 3300025915 | Bacteria | 21935 |
| 538 | Ga0207693_10003617 | 3300025915 | Bacteria | 13200 |
| 539 | Ga0207693_10020370 | 3300025915 | Bacteria | 5276 |
| 540 | Ga0207693_10029138 | 3300025915 | Bacteria | 4363 |
| 541 | Ga0207693_10082483 | 3300025915 | Bacteria | 2518 |
| 542 | Ga0207693_10191902 | 3300025915 | Bacteria | 1607 |
| 543 | Ga0207663_10000336 | 3300025916 | Bacteria | 20570 |
| 544 | Ga0207663_10002893 | 3300025916 | Bacteria | 8294 |
| 545 | Ga0207663_10003266 | 3300025916 | Bacteria | 7910 |
| 546 | Ga0207663_10007631 | 3300025916 | Bacteria | 5622 |
| 547 | Ga0207663_10020136 | 3300025916 | Bacteria | 3774 |
| 548 | Ga0207663_10025482 | 3300025916 | Bacteria | 3420 |
| 549 | Ga0207663_10081312 | 3300025916 | Bacteria | 2121 |
| 550 | Ga0207660_10000257 | 3300025917 | Bacteria | 34559 |
| 551 | Ga0207662_10002153 | 3300025918 | Bacteria | 9810 |
| 552 | Ga0207662_10002244 | 3300025918 | Bacteria | 9651 |
| 553 | Ga0207662_10008170 | 3300025918 | Bacteria | 5722 |
| 554 | Ga0207657_10006511 | 3300025919 | Bacteria | 12098 |
| 555 | Ga0207657_10014772 | 3300025919 | Bacteria | 7603 |
| 556 | Ga0207657_10022199 | 3300025919 | Bacteria | 5951 |
| 557 | Ga0207657_10184560 | 3300025919 | Bacteria | 1685 |
| 558 | Ga0207649_10080394 | 3300025920 | Bacteria | 2108 |
| 559 | Ga0207652_10000256 | 3300025921 | Bacteria | 55346 |
| 560 | Ga0207652_10031578 | 3300025921 | Bacteria | 4449 |
| 561 | Ga0207652_10072673 | 3300025921 | Bacteria | 2991 |
| 562 | Ga0207646_10000075 | 3300025922 | Bacteria | 136316 |
| 563 | Ga0207646_10015421 | 3300025922 | Bacteria | 7218 |
| 564 | Ga0207646_10017449 | 3300025922 | Bacteria | 6716 |
| 565 | Ga0207646_10057499 | 3300025922 | Bacteria | 3475 |
| 566 | Ga0207646_10080270 | 3300025922 | Bacteria | 2917 |
| 567 | Ga0207646_10182212 | 3300025922 | Bacteria | 1897 |
| 568 | Ga0207681_10021318 | 3300025923 | Bacteria | 4117 |
| 569 | Ga0207650_10000116 | 3300025925 | Bacteria | 104652 |
| 570 | Ga0207650_10052964 | 3300025925 | Bacteria | 3007 |
| 571 | Ga0207659_10098405 | 3300025926 | Bacteria | 2200 |
| 572 | Ga0207659_10106030 | 3300025926 | Bacteria | 2127 |
| 573 | Ga0207687_10005129 | 3300025927 | Bacteria | 8686 |
| 574 | Ga0207700_10000103 | 3300025928 | Bacteria | 51803 |
| 575 | Ga0207700_10002220 | 3300025928 | Bacteria | 11146 |
| 576 | Ga0207700_10034685 | 3300025928 | Bacteria | 3625 |
| 577 | Ga0207700_10049537 | 3300025928 | Bacteria | 3125 |
| 578 | Ga0207700_10060223 | 3300025928 | Bacteria | 2874 |
| 579 | Ga0207700_10073786 | 3300025928 | Bacteria | 2636 |
| 580 | Ga0207700_10096707 | 3300025928 | Bacteria | 2345 |
| 581 | Ga0207700_10122798 | 3300025928 | Bacteria | 2108 |
| 582 | Ga0207700_10154778 | 3300025928 | Bacteria | 1898 |
| 583 | Ga0207700_10189588 | 3300025928 | Bacteria | 1727 |
| 584 | Ga0207700_10291627 | 3300025928 | Bacteria | 1406 |
| 585 | Ga0207664_10000533 | 3300025929 | Bacteria | 27072 |
| 586 | Ga0207664_10000556 | 3300025929 | Bacteria | 26167 |
| 587 | Ga0207664_10003071 | 3300025929 | Bacteria | 11091 |
| 588 | Ga0207664_10004341 | 3300025929 | Bacteria | 9604 |
| 589 | Ga0207664_10019976 | 3300025929 | Bacteria | 4959 |
| 590 | Ga0207664_10028924 | 3300025929 | Bacteria | 4217 |
| 591 | Ga0207664_10030465 | 3300025929 | Bacteria | 4119 |
| 592 | Ga0207664_10051508 | 3300025929 | Bacteria | 3251 |
| 593 | Ga0207664_10062833 | 3300025929 | Bacteria | 2966 |
| 594 | Ga0207664_10177398 | 3300025929 | Bacteria | 1827 |
| 595 | Ga0207644_10005148 | 3300025931 | Bacteria | 8544 |
| 596 | Ga0207644_10007134 | 3300025931 | Bacteria | 7281 |
| 597 | Ga0207644_10093215 | 3300025931 | Bacteria | 2248 |
| 598 | Ga0207690_10040941 | 3300025932 | Bacteria | 3033 |
| 599 | Ga0207706_10000852 | 3300025933 | Bacteria | 31410 |
| 600 | Ga0207706_10013671 | 3300025933 | Bacteria | 7368 |
| 601 | Ga0207706_10057206 | 3300025933 | Bacteria | 3436 |
| 602 | Ga0207706_10074067 | 3300025933 | Bacteria | 2994 |
| 603 | Ga0207686_10103163 | 3300025934 | Bacteria | 1908 |
| 604 | Ga0207686_10137525 | 3300025934 | Bacteria | 1684 |
| 605 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 606 | Ga0207709_10105690 | 3300025935 | Bacteria | 1871 |
| 607 | Ga0207709_10131806 | 3300025935 | Bacteria | 1705 |
| 608 | Ga0207665_10000110 | 3300025939 | Bacteria | 53827 |
| 609 | Ga0207665_10000836 | 3300025939 | Bacteria | 20786 |
| 610 | Ga0207665_10003439 | 3300025939 | Bacteria | 10589 |
| 611 | Ga0207665_10006149 | 3300025939 | Bacteria | 7973 |
| 612 | Ga0207665_10048553 | 3300025939 | Bacteria | 2850 |
| 613 | Ga0207665_10049003 | 3300025939 | Bacteria | 2838 |
| 614 | Ga0207665_10113935 | 3300025939 | Bacteria | 1903 |
| 615 | Ga0207665_10210750 | 3300025939 | Bacteria | 1419 |
| 616 | Ga0207691_10009921 | 3300025940 | Bacteria | 9142 |
| 617 | Ga0207691_10023464 | 3300025940 | Bacteria | 5808 |
| 618 | Ga0207691_10025511 | 3300025940 | Bacteria | 5548 |
| 619 | Ga0207691_10090507 | 3300025940 | Bacteria | 2742 |
| 620 | Ga0207711_10000021 | 3300025941 | Bacteria | 355952 |
| 621 | Ga0207711_10008827 | 3300025941 | Bacteria | 8428 |
| 622 | Ga0207711_10018068 | 3300025941 | Bacteria | 5863 |
| 623 | Ga0207711_10104916 | 3300025941 | Bacteria | 2505 |
| 624 | Ga0207689_10001908 | 3300025942 | Bacteria | 19711 |
| 625 | Ga0207689_10009281 | 3300025942 | Bacteria | 8504 |
| 626 | Ga0207689_10015339 | 3300025942 | Bacteria | 6486 |
| 627 | Ga0207689_10032937 | 3300025942 | Bacteria | 4307 |
| 628 | Ga0207661_10183331 | 3300025944 | Bacteria | 1830 |
| 629 | Ga0207679_10040889 | 3300025945 | Bacteria | 3321 |
| 630 | Ga0207679_10190171 | 3300025945 | Bacteria | 1706 |
| 631 | Ga0207679_10194987 | 3300025945 | Bacteria | 1687 |
| 632 | Ga0207667_10007694 | 3300025949 | Bacteria | 12896 |
| 633 | Ga0207667_10029360 | 3300025949 | Bacteria | 5964 |
| 634 | Ga0207667_10050910 | 3300025949 | Bacteria | 4368 |
| 635 | Ga0207667_10154310 | 3300025949 | Bacteria | 2363 |
| 636 | Ga0207667_10267137 | 3300025949 | Bacteria | 1749 |
| 637 | Ga0207712_10000148 | 3300025961 | Bacteria | 72568 |
| 638 | Ga0207712_10001509 | 3300025961 | Bacteria | 15781 |
| 639 | Ga0207712_10018892 | 3300025961 | Bacteria | 4496 |
| 640 | Ga0207668_10004092 | 3300025972 | Bacteria | 8569 |
| 641 | Ga0207668_10157608 | 3300025972 | Bacteria | 1765 |
| 642 | Ga0207640_10002707 | 3300025981 | Bacteria | 9484 |
| 643 | Ga0207658_10000555 | 3300025986 | Bacteria | 33908 |
| 644 | Ga0207658_10015000 | 3300025986 | Bacteria | 5313 |
| 645 | Ga0207658_10130302 | 3300025986 | Bacteria | 2020 |
| 646 | Ga0207677_10013523 | 3300026023 | Bacteria | 4733 |
| 647 | Ga0207677_10138169 | 3300026023 | Bacteria | 1861 |
| 648 | Ga0207703_10000149 | 3300026035 | Bacteria | 80168 |
| 649 | Ga0207703_10012392 | 3300026035 | Bacteria | 6645 |
| 650 | Ga0207703_10183402 | 3300026035 | Bacteria | 1848 |
| 651 | Ga0207639_10023938 | 3300026041 | Bacteria | 4413 |
| 652 | Ga0207639_10196246 | 3300026041 | Bacteria | 1728 |
| 653 | Ga0207678_10002509 | 3300026067 | Bacteria | 16704 |
| 654 | Ga0207678_10008904 | 3300026067 | Bacteria | 8835 |
| 655 | Ga0207678_10034232 | 3300026067 | Bacteria | 4425 |
| 656 | Ga0207678_10042538 | 3300026067 | Bacteria | 3934 |
| 657 | Ga0207678_10067322 | 3300026067 | Bacteria | 3074 |
| 658 | Ga0207678_10319843 | 3300026067 | Bacteria | 1335 |
| 659 | Ga0207708_10006195 | 3300026075 | Bacteria | 8866 |
| 660 | Ga0207708_10036612 | 3300026075 | Bacteria | 3737 |
| 661 | Ga0207708_10108336 | 3300026075 | Bacteria | 2155 |
| 662 | Ga0207702_10024238 | 3300026078 | Bacteria | 5034 |
| 663 | Ga0207702_10031911 | 3300026078 | Bacteria | 4394 |
| 664 | Ga0207702_10056729 | 3300026078 | Bacteria | 3326 |
| 665 | Ga0207641_10000005 | 3300026088 | Bacteria | 470841 |
| 666 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 667 | Ga0207648_10130635 | 3300026089 | Bacteria | 2211 |
| 668 | Ga0207676_10000019 | 3300026095 | Bacteria | 305653 |
| 669 | Ga0207676_10000049 | 3300026095 | Bacteria | 133695 |
| 670 | Ga0207674_10003114 | 3300026116 | Bacteria | 20468 |
| 671 | Ga0207674_10024371 | 3300026116 | Bacteria | 6468 |
| 672 | Ga0207674_10033349 | 3300026116 | Bacteria | 5392 |
| 673 | Ga0207674_10083656 | 3300026116 | Bacteria | 3191 |
| 674 | Ga0207674_10092626 | 3300026116 | Bacteria | 3011 |
| 675 | Ga0207674_10266163 | 3300026116 | Bacteria | 1661 |
| 676 | Ga0207675_100003405 | 3300026118 | Bacteria | 15530 |
| 677 | Ga0207675_100013383 | 3300026118 | Bacteria | 7655 |
| 678 | Ga0207675_100114121 | 3300026118 | Bacteria | 2551 |
| 679 | Ga0207675_100571901 | 3300026118 | Bacteria | 1131 |
| 680 | Ga0207683_10001681 | 3300026121 | Bacteria | 19802 |
| 681 | Ga0207683_10001732 | 3300026121 | Bacteria | 19433 |
| 682 | Ga0207683_10093430 | 3300026121 | Bacteria | 2680 |
| 683 | Ga0207698_10016317 | 3300026142 | Bacteria | 5003 |
| 684 | Ga0207698_10019935 | 3300026142 | Bacteria | 4604 |
| 685 | Ga0207698_10038915 | 3300026142 | Bacteria | 3518 |
| 686 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 687 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 688 | Ga0207428_10089450 | 3300027907 | Bacteria | 2393 |
| 689 | Ga0207428_10177711 | 3300027907 | Bacteria | 1609 |
| 690 | Ga0207428_10260813 | 3300027907 | Bacteria | 1291 |
| 691 | Ga0268266_10038719 | 3300028379 | Bacteria | 4059 |
| 692 | Ga0268266_10060121 | 3300028379 | Bacteria | 3275 |
| 693 | Ga0268265_10000165 | 3300028380 | Bacteria | 80699 |
| 694 | Ga0268265_10112618 | 3300028380 | Bacteria | 2225 |
| 695 | Ga0268265_10152037 | 3300028380 | Bacteria | 1953 |
| 696 | Ga0268264_10059779 | 3300028381 | Bacteria | 3194 |
| 697 | Ga0268264_10158808 | 3300028381 | Bacteria | 2034 |
| 698 | Ga0268264_10230455 | 3300028381 | Bacteria | 1710 |
| 699 | Ga0268264_10340054 | 3300028381 | Bacteria | 1425 |
| 700 | Ga0268264_10390934 | 3300028381 | Bacteria | 1334 |
| 701 | Ga0265319_1004182 | 3300028563 | Bacteria | 7227 |
| 702 | Ga0265334_10057558 | 3300028573 | Bacteria | 1473 |
| 703 | Ga0265318_10002515 | 3300028577 | Bacteria | 9735 |
| 704 | Ga0265336_10000005 | 3300028666 | Bacteria | 399349 |
| 705 | Ga0265336_10008838 | 3300028666 | Bacteria | 3512 |
| 706 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 707 | Ga0265338_10010903 | 3300028800 | Bacteria | 10576 |
| 708 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 709 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 710 | Ga0265762_1006823 | 3300030760 | Bacteria | 2040 |
| 711 | Ga0265760_10036986 | 3300031090 | Bacteria | 1449 |
| 712 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 713 | Ga0265339_10037585 | 3300031249 | Bacteria | 2705 |
| 714 | Ga0265327_10048452 | 3300031251 | Bacteria | 2235 |
| 715 | Ga0265327_10061873 | 3300031251 | Bacteria | 1907 |
| 716 | Ga0265327_10090003 | 3300031251 | Bacteria | 1498 |
| 717 | Ga0265316_10236769 | 3300031344 | Bacteria | 1343 |
| 718 | Ga0307513_10007758 | 3300031456 | Bacteria | 13855 |
| 719 | Ga0307513_10105448 | 3300031456 | Bacteria | 2828 |
| 720 | Ga0307509_10000004 | 3300031507 | Bacteria | 535507 |
| 721 | Ga0307408_100000387 | 3300031548 | Bacteria | 40174 |
| 722 | Ga0307408_100271656 | 3300031548 | Bacteria | 1408 |
| 723 | Ga0316575_10016255 | 3300031665 | Bacteria | 2814 |
| 724 | Ga0316579_10119735 | 3300031691 | Bacteria | 1265 |
| 725 | Ga0316576_10002159 | 3300031727 | Bacteria | 11090 |
| 726 | Ga0316576_10004942 | 3300031727 | Bacteria | 8070 |
| 727 | Ga0316576_10014931 | 3300031727 | Bacteria | 5197 |
| 728 | Ga0316576_10023559 | 3300031727 | Bacteria | 4290 |
| 729 | Ga0316576_10058201 | 3300031727 | Bacteria | 2827 |
| 730 | Ga0316576_10220302 | 3300031727 | Bacteria | 1427 |
| 731 | Ga0316578_10008294 | 3300031728 | Bacteria | 5278 |
| 732 | Ga0316578_10011678 | 3300031728 | Bacteria | 4607 |
| 733 | Ga0316578_10027510 | 3300031728 | Bacteria | 3214 |
| 734 | Ga0316577_10005905 | 3300031733 | Bacteria | 6445 |
| 735 | Ga0307413_10092852 | 3300031824 | Bacteria | 1971 |
| 736 | Ga0307409_100049254 | 3300031995 | Bacteria | 3211 |
| 737 | Ga0307409_100106607 | 3300031995 | Bacteria | 2339 |
| 738 | Ga0307416_100237259 | 3300032002 | Bacteria | 1764 |
| 739 | Ga0373930_0002746 | 3300034816 | Bacteria | 2745 |
| 740 | Ga0373959_0006108 | 3300034820 | Bacteria | 1991 |
| 741 | Ga0373959_0009144 | 3300034820 | Bacteria | 1702 |
| 742 | Ga0373926_0009320 | 3300035083 | Bacteria | 3278 |
| 743 | Ga0373928_0000501 | 3300035084 | Bacteria | 7713 |
| 744 | Ga0373929_0008922 | 3300035085 | Bacteria | 1853 |
| 745 | Ga0373934_0000074 | 3300035086 | Bacteria | 34573 |
| 746 | Ga0373934_0004420 | 3300035086 | Bacteria | 5192 |
| 747 | Ga0373934_0011417 | 3300035086 | Bacteria | 3341 |
| 748 | Ga0373934_0013932 | 3300035086 | Bacteria | 3042 |
| 749 | Ga0373934_0025762 | 3300035086 | Bacteria | 2279 |
| 750 | Ga0373944_0002708 | 3300035089 | Bacteria | 4521 |
| 751 | Ga0373944_0012433 | 3300035089 | Bacteria | 2346 |
| 752 | Ga0373949_0022946 | 3300035090 | Bacteria | 1442 |
| 753 | Ga0373951_0007038 | 3300035091 | Bacteria | 2563 |
| 754 | Ga0373951_0031416 | 3300035091 | Bacteria | 1252 |
| 755 | Ga0373952_0008979 | 3300035092 | Bacteria | 1906 |
| 756 | Ga0373923_0003312 | 3300035111 | Bacteria | 5143 |
| 757 | Ga0373923_0007133 | 3300035111 | Bacteria | 3913 |
| 758 | Ga0373923_0067947 | 3300035111 | Bacteria | 1525 |
| 759 | Ga0373923_0070525 | 3300035111 | Bacteria | 1500 |
| 760 | Ga0373923_0107184 | 3300035111 | Bacteria | 1237 |
| 761 | Ga0373932_0000217 | 3300035112 | Bacteria | 17000 |
| 762 | Ga0373932_0003244 | 3300035112 | Bacteria | 3937 |
| 763 | Ga0373932_0011995 | 3300035112 | Bacteria | 2128 |
| 764 | Ga0373936_0000119 | 3300035113 | Bacteria | 27899 |
| 765 | Ga0373936_0001254 | 3300035113 | Bacteria | 9160 |
| 766 | Ga0373936_0003910 | 3300035113 | Bacteria | 5612 |
| 767 | Ga0373936_0088890 | 3300035113 | Bacteria | 1293 |
| 768 | Ga0373939_0005890 | 3300035114 | Bacteria | 2933 |
| 769 | Ga0373941_0031976 | 3300035115 | Bacteria | 1572 |
| 770 | Ga0373945_0000755 | 3300035116 | Bacteria | 9443 |
| 771 | Ga0373953_0001822 | 3300035117 | Bacteria | 6292 |
| 772 | Ga0373953_0008422 | 3300035117 | Bacteria | 3502 |
| 773 | Ga0373953_0015121 | 3300035117 | Bacteria | 2789 |
| 774 | Ga0373953_0056397 | 3300035117 | Bacteria | 1597 |
| 775 | Ga0373954_0008571 | 3300035118 | Bacteria | 4495 |
| 776 | Ga0373954_0009201 | 3300035118 | Bacteria | 4346 |
| 777 | Ga0373954_0034572 | 3300035118 | Bacteria | 2341 |
| 778 | Ga0373954_0054112 | 3300035118 | Bacteria | 1887 |
| 779 | Ga0373956_0001407 | 3300035119 | Bacteria | 9949 |
| 780 | Ga0373956_0020403 | 3300035119 | Bacteria | 2819 |
| 781 | Ga0373957_0000056 | 3300035120 | Bacteria | 28254 |
| 782 | Ga0373957_0002119 | 3300035120 | Bacteria | 5579 |
| 783 | Ga0373957_0040416 | 3300035120 | Bacteria | 1753 |
| 784 | Ga0373957_0087385 | 3300035120 | Bacteria | 1235 |
| 785 | Ga0373960_0010364 | 3300035121 | Bacteria | 2275 |
| 786 | Ga0373943_0008618 | 3300035170 | Bacteria | 4572 |
| 787 | Ga0373943_0030676 | 3300035170 | Bacteria | 2546 |
| 788 | Ga0373943_0044748 | 3300035170 | Bacteria | 2155 |
| 789 | Ga0373943_0076988 | 3300035170 | Bacteria | 1702 |
| 790 | Ga0373943_0098645 | 3300035170 | Bacteria | 1524 |
| 791 | Ga0373943_0100093 | 3300035170 | Bacteria | 1515 |
| 792 | Ga0373946_0001411 | 3300035171 | Bacteria | 8333 |
| 793 | Ga0373955_0004271 | 3300035172 | Bacteria | 6312 |
| 794 | Ga0373955_0013253 | 3300035172 | Bacteria | 3981 |
| 795 | Ga0373955_0096568 | 3300035172 | Bacteria | 1691 |
| 796 | Ga0373955_0140777 | 3300035172 | Bacteria | 1414 |
| 797 | Ga0373942_0002905 | 3300035207 | Bacteria | 4064 |
| 798 | Ga0373962_0025291 | 3300035242 | Bacteria | 1594 |
| 799 | Ga0316574_0006801 | 3300035398 | Bacteria | 6215 |
| 800 | Ga0316574_0011379 | 3300035398 | Bacteria | 5056 |
| 801 | Ga0316574_0011947 | 3300035398 | Bacteria | 4952 |
| 802 | Ga0316574_0035842 | 3300035398 | Bacteria | 3034 |
| 803 | Ga0316574_0126126 | 3300035398 | Bacteria | 1646 |
| 804 | Ga0373924_0000088 | 3300035410 | Bacteria | 25289 |
| 805 | Ga0373924_0002191 | 3300035410 | Bacteria | 6543 |
| 806 | Ga0373924_0003031 | 3300035410 | Bacteria | 5726 |
| 807 | Ga0373924_0003240 | 3300035410 | Bacteria | 5570 |
| 808 | Ga0373931_0000005 | 3300035691 | Bacteria | 480485 |
| 809 | Ga0373931_0000027 | 3300035691 | Bacteria | 123672 |
| 810 | Ga0373931_0002914 | 3300035691 | Bacteria | 7634 |
| 811 | Ga0373931_0149047 | 3300035691 | Bacteria | 1362 |
| 812 | Ga0373931_0154931 | 3300035691 | Bacteria | 1338 |
| 813 | Ga0373935_0004208 | 3300035692 | Bacteria | 8433 |
| 814 | Ga0373935_0009981 | 3300035692 | Bacteria | 5687 |
| 815 | Ga0373935_0011653 | 3300035692 | Bacteria | 5280 |
| 816 | Ga0373935_0080562 | 3300035692 | Bacteria | 2115 |
| 817 | Ga0373927_0022062 | 3300035695 | Bacteria | 4172 |
| 818 | Ga0373927_0248107 | 3300035695 | Bacteria | 1170 |
| 819 | Ga0373933_0000005 | 3300035724 | Bacteria | 128820 |
| 820 | Ga0373933_0033741 | 3300035724 | Bacteria | 2979 |
| 821 | Ga0373933_0071890 | 3300035724 | Bacteria | 2106 |
| 822 | Ga0373947_0000220 | 3300035725 | Bacteria | 32120 |
| 823 | Ga0373947_0090298 | 3300035725 | Bacteria | 1909 |
| 824 | Ga0373937_0000278 | 3300036401 | Bacteria | 48828 |
| 825 | Ga0373937_0054255 | 3300036401 | Bacteria | 3677 |
| 826 | Ga0373937_0079557 | 3300036401 | Bacteria | 3029 |
| 827 | Ga0373937_0189654 | 3300036401 | Bacteria | 1931 |
| 828 | Ga0372808_000663 | 3300036459 | Bacteria | 2966 |
| 829 | Ga0372808_001740 | 3300036459 | Bacteria | 2350 |
| 830 | Ga0316582_0010895 | 3300036647 | Bacteria | 5004 |
| 831 | Ga0316582_0095040 | 3300036647 | Bacteria | 1967 |
| 832 | Ga0316584_0003409 | 3300036712 | Bacteria | 10313 |
| 833 | Ga0316584_0004433 | 3300036712 | Bacteria | 9296 |
| 834 | Ga0316584_0008628 | 3300036712 | Bacteria | 7028 |
| 835 | Ga0316584_0050522 | 3300036712 | Bacteria | 3109 |
| 836 | Ga0316584_0102651 | 3300036712 | Bacteria | 2141 |
| 837 | Ga0373925_0041858 | 3300037068 | Bacteria | 3397 |
| 838 | Ga0373925_0055558 | 3300037068 | Bacteria | 2964 |
| 839 | Ga0436364_0033704 | 3300037853 | Bacteria | 1710 |
| 840 | Ga0436364_0509088 | 3300037853 | Bacteria | 1565 |
| 841 | Ga0436364_0604875 | 3300037853 | Bacteria | 15615 |
| 842 | Ga0436364_0676163 | 3300037853 | Bacteria | 64006 |
| 843 | Ga0436364_0757834 | 3300037853 | Bacteria | 1263 |
| 844 | Ga0436364_0786042 | 3300037853 | Bacteria | 20160 |
| 845 | Ga0436364_0802940 | 3300037853 | Bacteria | 6735 |
| 846 | Ga0436364_1227141 | 3300037853 | Bacteria | 4136 |
| 847 | Ga0436364_1456387 | 3300037853 | Bacteria | 1888 |
| 848 | Ga0436364_1464045 | 3300037853 | Bacteria | 3338 |
| 849 | Ga0395901_0060605 | 3300038443 | Bacteria | 3938 |
| 850 | Ga0400485_02355 | 3300038735 | Bacteria | 4319 |
| 851 | Ga0400483_058289 | 3300039062 | Bacteria | 9230 |
| 852 | Ga0400483_215395 | 3300039062 | Bacteria | 9338 |
| 853 | Ga0400483_232124 | 3300039062 | Bacteria | 10279 |
| 854 | Ga0400483_245537 | 3300039062 | Bacteria | 4243 |
| 855 | Ga0237816_01881 | 3300039145 | Bacteria | 1672 |
| 856 | Ga0436365_0012902 | 3300039437 | Bacteria | 1185 |
| 857 | Ga0436365_0075484 | 3300039437 | Bacteria | 13035 |
| 858 | Ga0436365_0758715 | 3300039437 | Bacteria | 2292 |
| 859 | Ga0436365_1202098 | 3300039437 | Bacteria | 19080 |
| 860 | Ga0436361_0374946 | 3300039447 | Bacteria | 3283 |
| 861 | Ga0436361_1186958 | 3300039447 | Bacteria | 1328 |
| 862 | Ga0436362_0035386 | 3300039453 | Bacteria | 9973 |
| 863 | Ga0436362_0131109 | 3300039453 | Bacteria | 1777 |
| 864 | Ga0439447_043708 | 3300041407 | Bacteria | 1085 |
| 865 | Ga0439466_0021474 | 3300041411 | Bacteria | 2287 |
| 866 | Ga0439465_0053120 | 3300041413 | Bacteria | 1331 |
| 867 | Ga0451791_1300260 | 3300041451 | Bacteria | 2966 |
| 868 | Ga0451843_0067489 | 3300041509 | Bacteria | 1551 |
| 869 | Ga0451843_1574986 | 3300041509 | Bacteria | 1340 |
| 870 | Ga0439445_0031973 | 3300042004 | Bacteria | 1370 |
| 871 | Ga0439432_032374 | 3300042006 | Bacteria | 1686 |
| 872 | Ga0439449_0001300 | 3300042007 | Bacteria | 9777 |
| 873 | Ga0439450_014046 | 3300042008 | Bacteria | 1618 |
| 874 | Ga0439452_019347 | 3300042010 | Bacteria | 1802 |
| 875 | Ga0439457_022828 | 3300042014 | Bacteria | 1385 |
| 876 | Ga0439440_0002061 | 3300042993 | Bacteria | 3749 |
| 877 | Ga0466969_0002027 | 3300044656 | Bacteria | 10820 |
| 878 | Ga0466969_0016901 | 3300044656 | Bacteria | 3815 |
| 879 | Ga0466972_0002652 | 3300044658 | Bacteria | 8856 |
| 880 | Ga0466965_0000829 | 3300044683 | Bacteria | 11695 |
| 881 | Ga0466965_0003566 | 3300044683 | Bacteria | 6843 |
| 882 | Ga0466966_0011220 | 3300044684 | Bacteria | 5945 |
| 883 | Ga0466966_0023668 | 3300044684 | Bacteria | 4020 |
| 884 | Ga0466966_0068845 | 3300044684 | Bacteria | 2221 |
| 885 | Ga0466961_0018481 | 3300044693 | Bacteria | 4484 |
| 886 | Ga0466963_0005494 | 3300044694 | Bacteria | 7421 |
| 887 | Ga0466963_0015101 | 3300044694 | Bacteria | 4775 |
| 888 | Ga0466963_0027405 | 3300044694 | Bacteria | 3648 |
| 889 | Ga0466963_0039987 | 3300044694 | Bacteria | 3073 |
| 890 | Ga0466963_0052033 | 3300044694 | Bacteria | 2716 |
| 891 | Ga0466963_0105466 | 3300044694 | Bacteria | 1932 |
| 892 | Ga0466963_0134633 | 3300044694 | Bacteria | 1709 |
| 893 | Ga0466964_0029818 | 3300044706 | Bacteria | 2156 |
| 894 | Ga0466971_0092278 | 3300044719 | Bacteria | 1387 |
| 895 | Ga0466968_0002914 | 3300044735 | Bacteria | 6321 |
| 896 | Ga0466968_0035557 | 3300044735 | Bacteria | 2085 |
| 897 | Ga0466970_0054126 | 3300044765 | Bacteria | 2143 |
| 898 | Ga0466957_0007518 | 3300044842 | Bacteria | 6156 |
| 899 | Ga0466957_0157063 | 3300044842 | Bacteria | 1475 |
| 900 | Ga0466959_0017904 | 3300045049 | Bacteria | 5197 |
| 901 | Ga0466959_0124003 | 3300045049 | Bacteria | 1834 |
| 902 | Ga0466958_0185212 | 3300045836 | Bacteria | 1322 |
| 903 | Ga0466967_0012564 | 3300045976 | Bacteria | 6486 |
| 904 | Ga0466967_0019489 | 3300045976 | Bacteria | 5455 |
| 905 | Ga0466967_0024982 | 3300045976 | Bacteria | 4919 |
| 906 | Ga0466967_0089070 | 3300045976 | Bacteria | 2802 |
| 907 | Ga0466967_0089880 | 3300045976 | Bacteria | 2789 |
| 908 | Ga0466967_0111096 | 3300045976 | Bacteria | 2518 |
| 909 | Ga0466967_0621354 | 3300045976 | Bacteria | 1067 |
| 910 | Ga0495627_000110 | 3300046453 | Bacteria | 101742 |
| 911 | Ga0495592_0000010 | 3300046454 | Bacteria | 157001 |
| 912 | Ga0495592_0006585 | 3300046454 | Bacteria | 8655 |
| 913 | Ga0495592_0012104 | 3300046454 | Bacteria | 6544 |
| 914 | Ga0495592_0027319 | 3300046454 | Bacteria | 4327 |
| 915 | Ga0495592_0043975 | 3300046454 | Bacteria | 3339 |
| 916 | Ga0495592_0052562 | 3300046454 | Bacteria | 3024 |
| 917 | Ga0495592_0137810 | 3300046454 | Bacteria | 1700 |
| 918 | Ga0495603_0003396 | 3300046455 | Bacteria | 9478 |
| 919 | Ga0495603_0018742 | 3300046455 | Bacteria | 4188 |
| 920 | Ga0495629_0003600 | 3300046459 | Bacteria | 11706 |
| 921 | Ga0495629_0004898 | 3300046459 | Bacteria | 10049 |
| 922 | Ga0495629_0012270 | 3300046459 | Bacteria | 6206 |
| 923 | Ga0495641_0004957 | 3300046461 | Bacteria | 9200 |
| 924 | Ga0495641_0008522 | 3300046461 | Bacteria | 6236 |
| 925 | Ga0495641_0013408 | 3300046461 | Bacteria | 4506 |
| 926 | Ga0495641_0040339 | 3300046461 | Bacteria | 2171 |
| 927 | Ga0495641_0064342 | 3300046461 | Bacteria | 1652 |
| 928 | Ga0495651_0000006 | 3300046462 | Bacteria | 171575 |
| 929 | Ga0495651_0006392 | 3300046462 | Bacteria | 9017 |
| 930 | Ga0495651_0016070 | 3300046462 | Bacteria | 5796 |
| 931 | Ga0495651_0017225 | 3300046462 | Bacteria | 5599 |
| 932 | Ga0495651_0031182 | 3300046462 | Bacteria | 4158 |
| 933 | Ga0495651_0035502 | 3300046462 | Bacteria | 3880 |
| 934 | Ga0495651_0053979 | 3300046462 | Bacteria | 3092 |
| 935 | Ga0495651_0106132 | 3300046462 | Bacteria | 2082 |
| 936 | Ga0495653_0016641 | 3300046463 | Bacteria | 5985 |
| 937 | Ga0495653_0028100 | 3300046463 | Bacteria | 4501 |
| 938 | Ga0495653_0041667 | 3300046463 | Bacteria | 3582 |
| 939 | Ga0495653_0059979 | 3300046463 | Bacteria | 2884 |
| 940 | Ga0495653_0062265 | 3300046463 | Bacteria | 2819 |
| 941 | Ga0495653_0064751 | 3300046463 | Bacteria | 2753 |
| 942 | Ga0495653_0076719 | 3300046463 | Bacteria | 2483 |
| 943 | Ga0495653_0088750 | 3300046463 | Bacteria | 2267 |
| 944 | Ga0495653_0108270 | 3300046463 | Bacteria | 2001 |
| 945 | Ga0495653_0121353 | 3300046463 | Bacteria | 1862 |
| 946 | Ga0495580_0011635 | 3300046472 | Bacteria | 6805 |
| 947 | Ga0495580_0081125 | 3300046472 | Bacteria | 2261 |
| 948 | Ga0495580_0101173 | 3300046472 | Bacteria | 2004 |
| 949 | Ga0495580_0101941 | 3300046472 | Bacteria | 1996 |
| 950 | Ga0495582_0002548 | 3300046473 | Bacteria | 10144 |
| 951 | Ga0495582_0003759 | 3300046473 | Bacteria | 8558 |
| 952 | Ga0495582_0143380 | 3300046473 | Bacteria | 1354 |
| 953 | Ga0495639_0016401 | 3300046475 | Bacteria | 3216 |
| 954 | Ga0495662_0000649 | 3300046476 | Bacteria | 16301 |
| 955 | Ga0495662_0001170 | 3300046476 | Bacteria | 12942 |
| 956 | Ga0495662_0003177 | 3300046476 | Bacteria | 8297 |
| 957 | Ga0495662_0009850 | 3300046476 | Bacteria | 4694 |
| 958 | Ga0495662_0015376 | 3300046476 | Bacteria | 3717 |
| 959 | Ga0495664_0044348 | 3300046477 | Bacteria | 2635 |
| 960 | Ga0495664_0069108 | 3300046477 | Bacteria | 2108 |
| 961 | Ga0495594_0013981 | 3300046499 | Bacteria | 4202 |
| 962 | Ga0495607_0086639 | 3300046501 | Bacteria | 1707 |
| 963 | Ga0495607_0103113 | 3300046501 | Bacteria | 1524 |
| 964 | Ga0495608_0000243 | 3300046511 | Bacteria | 39556 |
| 965 | Ga0495608_0000955 | 3300046511 | Bacteria | 20371 |
| 966 | Ga0495608_0012153 | 3300046511 | Bacteria | 5983 |
| 967 | Ga0495608_0013781 | 3300046511 | Bacteria | 5609 |
| 968 | Ga0495608_0047023 | 3300046511 | Bacteria | 2870 |
| 969 | Ga0495608_0062595 | 3300046511 | Bacteria | 2444 |
| 970 | Ga0495608_0071773 | 3300046511 | Bacteria | 2259 |
| 971 | Ga0495608_0109376 | 3300046511 | Bacteria | 1777 |
| 972 | Ga0495608_0132923 | 3300046511 | Bacteria | 1591 |
| 973 | Ga0495610_0000013 | 3300046512 | Bacteria | 465872 |
| 974 | Ga0495616_0000032 | 3300046513 | Bacteria | 130692 |
| 975 | Ga0495618_0001036 | 3300046514 | Bacteria | 19045 |
| 976 | Ga0495618_0040927 | 3300046514 | Bacteria | 2917 |
| 977 | Ga0495618_0065699 | 3300046514 | Bacteria | 2305 |
| 978 | Ga0495620_0006077 | 3300046515 | Bacteria | 6677 |
| 979 | Ga0495628_0000566 | 3300046516 | Bacteria | 33950 |
| 980 | Ga0495628_0009608 | 3300046516 | Bacteria | 8252 |
| 981 | Ga0495628_0010807 | 3300046516 | Bacteria | 7732 |
| 982 | Ga0495628_0162672 | 3300046516 | Bacteria | 1695 |
| 983 | Ga0495628_0176461 | 3300046516 | Bacteria | 1618 |
| 984 | Ga0495630_0006721 | 3300046517 | Bacteria | 8194 |
| 985 | Ga0495630_0034365 | 3300046517 | Bacteria | 3786 |
| 986 | Ga0495630_0047622 | 3300046517 | Bacteria | 3207 |
| 987 | Ga0495630_0048699 | 3300046517 | Bacteria | 3171 |
| 988 | Ga0495630_0078485 | 3300046517 | Bacteria | 2489 |
| 989 | Ga0495630_0183914 | 3300046517 | Bacteria | 1594 |
| 990 | Ga0495630_0202682 | 3300046517 | Bacteria | 1514 |
| 991 | Ga0495643_0094826 | 3300046522 | Bacteria | 1535 |
| 992 | Ga0495663_0000041 | 3300046525 | Bacteria | 63505 |
| 993 | Ga0495663_0012611 | 3300046525 | Bacteria | 2356 |
| 994 | Ga0495666_0015344 | 3300046526 | Bacteria | 3814 |
| 995 | Ga0495666_0051407 | 3300046526 | Bacteria | 1980 |
| 996 | Ga0495666_0079308 | 3300046526 | Bacteria | 1554 |
| 997 | Ga0495652_0000415 | 3300046529 | Bacteria | 49757 |
| 998 | Ga0495652_0003238 | 3300046529 | Bacteria | 16225 |
| 999 | Ga0495652_0014498 | 3300046529 | Bacteria | 7074 |
| 1000 | Ga0495652_0017823 | 3300046529 | Bacteria | 6337 |
| 1001 | Ga0495652_0032816 | 3300046529 | Bacteria | 4537 |
| 1002 | Ga0495652_0131791 | 3300046529 | Bacteria | 1978 |
| 1003 | Ga0495665_0003630 | 3300046531 | Bacteria | 8374 |
| 1004 | Ga0495665_0032011 | 3300046531 | Bacteria | 2813 |
| 1005 | Ga0495640_0014491 | 3300046533 | Bacteria | 5961 |
| 1006 | Ga0495640_0021723 | 3300046533 | Bacteria | 4703 |
| 1007 | Ga0495640_0027072 | 3300046533 | Bacteria | 4138 |
| 1008 | Ga0495640_0050138 | 3300046533 | Bacteria | 2877 |
| 1009 | Ga0495640_0098754 | 3300046533 | Bacteria | 1919 |
| 1010 | Ga0495586_0001504 | 3300046535 | Bacteria | 12869 |
| 1011 | Ga0495586_0009784 | 3300046535 | Bacteria | 5104 |
| 1012 | Ga0495586_0053888 | 3300046535 | Bacteria | 2179 |
| 1013 | Ga0495587_0000049 | 3300046536 | Bacteria | 104756 |
| 1014 | Ga0495587_0011091 | 3300046536 | Bacteria | 5716 |
| 1015 | Ga0495587_0059565 | 3300046536 | Bacteria | 2240 |
| 1016 | Ga0495587_0072640 | 3300046536 | Bacteria | 1999 |
| 1017 | Ga0495645_0007547 | 3300046543 | Bacteria | 7565 |
| 1018 | Ga0495645_0026918 | 3300046543 | Bacteria | 4176 |
| 1019 | Ga0495645_0048487 | 3300046543 | Bacteria | 3093 |
| 1020 | Ga0495645_0057004 | 3300046543 | Bacteria | 2837 |
| 1021 | Ga0495645_0079474 | 3300046543 | Bacteria | 2355 |
| 1022 | Ga0495645_0098882 | 3300046543 | Bacteria | 2076 |
| 1023 | Ga0495667_0000041 | 3300046559 | Bacteria | 124884 |
| 1024 | Ga0495667_0001387 | 3300046559 | Bacteria | 15949 |
| 1025 | Ga0495667_0005665 | 3300046559 | Bacteria | 8451 |
| 1026 | Ga0495667_0006595 | 3300046559 | Bacteria | 7880 |
| 1027 | Ga0495667_0020456 | 3300046559 | Bacteria | 4464 |
| 1028 | Ga0495667_0095863 | 3300046559 | Bacteria | 1920 |
| 1029 | Ga0495667_0102530 | 3300046559 | Bacteria | 1850 |
| 1030 | Ga0495668_0007996 | 3300046616 | Bacteria | 6665 |
| 1031 | Ga0495634_0003643 | 3300046642 | Bacteria | 12289 |
| 1032 | Ga0495634_0018131 | 3300046642 | Bacteria | 5014 |
| 1033 | Ga0495634_0077598 | 3300046642 | Bacteria | 2178 |
| 1034 | Ga0495634_0202145 | 3300046642 | Bacteria | 1234 |
| 1035 | Ga0495625_0000911 | 3300046660 | Bacteria | 39772 |
| 1036 | Ga0495625_0076269 | 3300046660 | Bacteria | 2344 |
| 1037 | Ga0495635_0006189 | 3300046663 | Bacteria | 8338 |
| 1038 | Ga0495635_0008669 | 3300046663 | Bacteria | 7101 |
| 1039 | Ga0495635_0012396 | 3300046663 | Bacteria | 5974 |
| 1040 | Ga0495635_0057977 | 3300046663 | Bacteria | 2664 |
| 1041 | Ga0495635_0059571 | 3300046663 | Bacteria | 2625 |
| 1042 | Ga0495661_0149716 | 3300046665 | Bacteria | 1262 |
| 1043 | Ga0495657_0000126 | 3300046675 | Bacteria | 68659 |
| 1044 | Ga0495657_0001156 | 3300046675 | Bacteria | 23145 |
| 1045 | Ga0495657_0001976 | 3300046675 | Bacteria | 17474 |
| 1046 | Ga0495657_0008646 | 3300046675 | Bacteria | 7769 |
| 1047 | Ga0495657_0026456 | 3300046675 | Bacteria | 4107 |
| 1048 | Ga0495657_0042552 | 3300046675 | Bacteria | 3100 |
| 1049 | Ga0495657_0051433 | 3300046675 | Bacteria | 2766 |
| 1050 | Ga0495657_0078154 | 3300046675 | Bacteria | 2145 |
| 1051 | Ga0495657_0096449 | 3300046675 | Bacteria | 1890 |
| 1052 | Ga0495599_0000208 | 3300046678 | Bacteria | 38561 |
| 1053 | Ga0495599_0001775 | 3300046678 | Bacteria | 12511 |
| 1054 | Ga0495599_0018711 | 3300046678 | Bacteria | 4316 |
| 1055 | Ga0495599_0018766 | 3300046678 | Bacteria | 4310 |
| 1056 | Ga0495599_0038666 | 3300046678 | Bacteria | 2998 |
| 1057 | Ga0495599_0049461 | 3300046678 | Bacteria | 2635 |
| 1058 | Ga0495599_0108324 | 3300046678 | Bacteria | 1731 |
| 1059 | Ga0495599_0148868 | 3300046678 | Bacteria | 1451 |
| 1060 | Ga0495623_0000080 | 3300046679 | Bacteria | 57432 |
| 1061 | Ga0495623_0031511 | 3300046679 | Bacteria | 3408 |
| 1062 | Ga0495623_0067957 | 3300046679 | Bacteria | 2223 |
| 1063 | Ga0495623_0070471 | 3300046679 | Bacteria | 2178 |
| 1064 | Ga0495623_0076412 | 3300046679 | Bacteria | 2078 |
| 1065 | Ga0495646_0010008 | 3300046680 | Bacteria | 6029 |
| 1066 | Ga0495646_0065778 | 3300046680 | Bacteria | 2145 |
| 1067 | Ga0495646_0093322 | 3300046680 | Bacteria | 1734 |
| 1068 | Ga0495647_0001573 | 3300046681 | Bacteria | 7044 |
| 1069 | Ga0495647_0015118 | 3300046681 | Bacteria | 2699 |
| 1070 | Ga0495647_0032207 | 3300046681 | Bacteria | 1953 |
| 1071 | Ga0495658_0005908 | 3300046683 | Bacteria | 6008 |
| 1072 | Ga0495658_0015267 | 3300046683 | Bacteria | 3938 |
| 1073 | Ga0495658_0211687 | 3300046683 | Bacteria | 1211 |
| 1074 | Ga0495669_0005687 | 3300046684 | Bacteria | 5200 |
| 1075 | Ga0495613_0000845 | 3300046689 | Bacteria | 23540 |
| 1076 | Ga0495613_0004976 | 3300046689 | Bacteria | 9981 |
| 1077 | Ga0495613_0107782 | 3300046689 | Bacteria | 2009 |
| 1078 | Ga0495613_0125773 | 3300046689 | Bacteria | 1839 |
| 1079 | Ga0495624_0021883 | 3300046690 | Bacteria | 4235 |
| 1080 | Ga0495624_0056784 | 3300046690 | Bacteria | 2462 |
| 1081 | Ga0495624_0090776 | 3300046690 | Bacteria | 1885 |
| 1082 | Ga0495671_0000862 | 3300046692 | Bacteria | 21694 |
| 1083 | Ga0495589_0010318 | 3300046794 | Bacteria | 4852 |
| 1084 | Ga0495589_0018316 | 3300046794 | Bacteria | 3591 |
| 1085 | Ga0495600_0002375 | 3300046809 | Bacteria | 10763 |
| 1086 | Ga0495600_0007334 | 3300046809 | Bacteria | 6738 |
| 1087 | Ga0495600_0007516 | 3300046809 | Bacteria | 6670 |
| 1088 | Ga0495600_0037708 | 3300046809 | Bacteria | 3143 |
| 1089 | Ga0495600_0064147 | 3300046809 | Bacteria | 2401 |
| 1090 | Ga0495600_0106200 | 3300046809 | Bacteria | 1829 |
| 1091 | Ga0495600_0184292 | 3300046809 | Bacteria | 1345 |
| 1092 | Ga0495581_0000351 | 3300047315 | Bacteria | 22939 |
| 1093 | Ga0495581_0000521 | 3300047315 | Bacteria | 19689 |
| 1094 | Ga0495581_0005105 | 3300047315 | Bacteria | 7602 |
| 1095 | Ga0495581_0036056 | 3300047315 | Bacteria | 2861 |
| 1096 | Ga0495604_0000110 | 3300047317 | Bacteria | 68659 |
| 1097 | Ga0495604_0011376 | 3300047317 | Bacteria | 7062 |
| 1098 | Ga0495604_0016743 | 3300047317 | Bacteria | 5864 |
| 1099 | Ga0495604_0017187 | 3300047317 | Bacteria | 5787 |
| 1100 | Ga0495604_0023947 | 3300047317 | Bacteria | 4873 |
| 1101 | Ga0495604_0116430 | 3300047317 | Bacteria | 1940 |
| 1102 | Ga0495674_0018851 | 3300047319 | Bacteria | 6417 |
| 1103 | Ga0495674_0034272 | 3300047319 | Bacteria | 4592 |
| 1104 | Ga0495674_0113178 | 3300047319 | Bacteria | 2298 |
| 1105 | Ga0495674_0218663 | 3300047319 | Bacteria | 1575 |
| 1106 | Ga0495672_0000459 | 3300047320 | Bacteria | 48101 |
| 1107 | Ga0495676_0023169 | 3300047321 | Bacteria | 5392 |
| 1108 | Ga0495676_0026844 | 3300047321 | Bacteria | 4948 |
| 1109 | Ga0495676_0039795 | 3300047321 | Bacteria | 3889 |
| 1110 | Ga0495676_0133979 | 3300047321 | Bacteria | 1784 |
| 1111 | Ga0495680_0000470 | 3300047322 | Bacteria | 45402 |
| 1112 | Ga0495680_0016062 | 3300047322 | Bacteria | 6437 |
| 1113 | Ga0495680_0018088 | 3300047322 | Bacteria | 5996 |
| 1114 | Ga0495680_0054190 | 3300047322 | Bacteria | 3115 |
| 1115 | Ga0495680_0054251 | 3300047322 | Bacteria | 3113 |
| 1116 | Ga0495680_0132445 | 3300047322 | Bacteria | 1831 |
| 1117 | Ga0495680_0140073 | 3300047322 | Bacteria | 1770 |
| 1118 | Ga0495680_0154501 | 3300047322 | Bacteria | 1670 |
| 1119 | Ga0495680_0172957 | 3300047322 | Bacteria | 1563 |
| 1120 | Ga0495675_0001308 | 3300047444 | Bacteria | 15081 |
| 1121 | Ga0495675_0012268 | 3300047444 | Bacteria | 5394 |
| 1122 | Ga0495675_0012301 | 3300047444 | Bacteria | 5387 |
| 1123 | Ga0495675_0045652 | 3300047444 | Bacteria | 2790 |
| 1124 | Ga0495685_009173 | 3300047447 | Bacteria | 3299 |
| 1125 | Ga0495685_018896 | 3300047447 | Bacteria | 2366 |
| 1126 | Ga0495684_0007979 | 3300047471 | Bacteria | 8181 |
| 1127 | Ga0495684_0015817 | 3300047471 | Bacteria | 5807 |
| 1128 | Ga0495684_0016585 | 3300047471 | Bacteria | 5674 |
| 1129 | Ga0495684_0044762 | 3300047471 | Bacteria | 3387 |
| 1130 | Ga0495684_0081883 | 3300047471 | Bacteria | 2449 |
| 1131 | Ga0495684_0116175 | 3300047471 | Bacteria | 2017 |
| 1132 | Ga0495684_0176765 | 3300047471 | Bacteria | 1584 |
| 1133 | Ga0495593_0002534 | 3300047673 | Bacteria | 10972 |
| 1134 | Ga0495593_0008687 | 3300047673 | Bacteria | 5903 |
| 1135 | Ga0495593_0012098 | 3300047673 | Bacteria | 4940 |
| 1136 | Ga0495602_0000345 | 3300048088 | Bacteria | 42944 |
| 1137 | Ga0495602_0017183 | 3300048088 | Bacteria | 7254 |
| 1138 | Ga0495602_0049716 | 3300048088 | Bacteria | 3753 |
| 1139 | Ga0495602_0116355 | 3300048088 | Bacteria | 2160 |
| 1140 | Ga0495602_0286427 | 3300048088 | Bacteria | 1211 |
| 1141 | Ga0496100_0011379 | 3300048903 | Bacteria | 5064 |
| 1142 | Ga0496100_0034446 | 3300048903 | Bacteria | 3178 |
| 1143 | Ga0496100_0044118 | 3300048903 | Bacteria | 2854 |
| 1144 | Ga0496101_0011569 | 3300048904 | Bacteria | 5859 |
| 1145 | Ga0496101_0029917 | 3300048904 | Bacteria | 3812 |
| 1146 | Ga0496101_0061222 | 3300048904 | Bacteria | 2733 |
| 1147 | Ga0496101_0072304 | 3300048904 | Bacteria | 2531 |
| 1148 | Ga0496102_0000121 | 3300048905 | Bacteria | 112133 |
| 1149 | Ga0496102_0017751 | 3300048905 | Bacteria | 6237 |
| 1150 | Ga0496102_0018389 | 3300048905 | Bacteria | 6141 |
| 1151 | Ga0496102_0032155 | 3300048905 | Bacteria | 4713 |
| 1152 | Ga0496102_0107091 | 3300048905 | Bacteria | 2602 |
| 1153 | Ga0496102_0191357 | 3300048905 | Bacteria | 1928 |
| 1154 | Ga0496103_0000224 | 3300048906 | Bacteria | 55730 |
| 1155 | Ga0496103_0005303 | 3300048906 | Bacteria | 7733 |
| 1156 | Ga0496103_0025461 | 3300048906 | Bacteria | 3576 |
| 1157 | Ga0496103_0039407 | 3300048906 | Bacteria | 2903 |
| 1158 | Ga0496103_0133196 | 3300048906 | Bacteria | 1588 |
| 1159 | Ga0496103_0145545 | 3300048906 | Bacteria | 1517 |
| 1160 | Ga0496104_0004532 | 3300048907 | Bacteria | 12107 |
| 1161 | Ga0496104_0006922 | 3300048907 | Bacteria | 10002 |
| 1162 | Ga0496104_0007859 | 3300048907 | Bacteria | 9455 |
| 1163 | Ga0496104_0011347 | 3300048907 | Bacteria | 7974 |
| 1164 | Ga0496104_0016014 | 3300048907 | Bacteria | 6807 |
| 1165 | Ga0496104_0033156 | 3300048907 | Bacteria | 4808 |
| 1166 | Ga0496104_0077574 | 3300048907 | Bacteria | 3165 |
| 1167 | Ga0496105_0007753 | 3300048908 | Bacteria | 8329 |
| 1168 | Ga0496105_0025217 | 3300048908 | Bacteria | 4837 |
| 1169 | Ga0496105_0031764 | 3300048908 | Bacteria | 4330 |
| 1170 | Ga0496105_0044914 | 3300048908 | Bacteria | 3645 |
| 1171 | Ga0496105_0055772 | 3300048908 | Bacteria | 3262 |
| 1172 | Ga0496105_0091186 | 3300048908 | Bacteria | 2517 |
| 1173 | Ga0496105_0177619 | 3300048908 | Bacteria | 1744 |
| 1174 | Ga0496106_0051571 | 3300048909 | Bacteria | 3102 |
| 1175 | Ga0496106_0080505 | 3300048909 | Bacteria | 2501 |
| 1176 | Ga0496106_0106791 | 3300048909 | Bacteria | 2176 |
| 1177 | Ga0496106_0171546 | 3300048909 | Bacteria | 1719 |
| 1178 | Ga0496107_0012475 | 3300048910 | Bacteria | 5931 |
| 1179 | Ga0496107_0023821 | 3300048910 | Bacteria | 4327 |
| 1180 | Ga0496107_0039362 | 3300048910 | Bacteria | 3391 |
| 1181 | Ga0496108_0013234 | 3300048911 | Bacteria | 6724 |
| 1182 | Ga0496108_0015337 | 3300048911 | Bacteria | 6251 |
| 1183 | Ga0496108_0023390 | 3300048911 | Bacteria | 5084 |
| 1184 | Ga0496108_0239178 | 3300048911 | Bacteria | 1579 |
| 1185 | Ga0496109_0010382 | 3300048912 | Bacteria | 7953 |
| 1186 | Ga0496109_0017894 | 3300048912 | Bacteria | 6219 |
| 1187 | Ga0496109_0031113 | 3300048912 | Bacteria | 4787 |
| 1188 | Ga0496109_0048341 | 3300048912 | Bacteria | 3871 |
| 1189 | Ga0496109_0107561 | 3300048912 | Bacteria | 2591 |
| 1190 | Ga0496110_0000640 | 3300048913 | Bacteria | 23997 |
| 1191 | Ga0496110_0003291 | 3300048913 | Bacteria | 12331 |
| 1192 | Ga0496110_0010185 | 3300048913 | Bacteria | 7639 |
| 1193 | Ga0496110_0011073 | 3300048913 | Bacteria | 7364 |
| 1194 | Ga0496110_0014565 | 3300048913 | Bacteria | 6534 |
| 1195 | Ga0496110_0061335 | 3300048913 | Bacteria | 3318 |
| 1196 | Ga0496110_0077614 | 3300048913 | Bacteria | 2955 |
| 1197 | Ga0496110_0284975 | 3300048913 | Bacteria | 1504 |
| 1198 | Ga0496110_0325162 | 3300048913 | Bacteria | 1401 |
| 1199 | Ga0496110_0352531 | 3300048913 | Bacteria | 1340 |
| 1200 | Ga0496111_0010632 | 3300048914 | Bacteria | 6185 |
| 1201 | Ga0496111_0033772 | 3300048914 | Bacteria | 3650 |
| 1202 | Ga0496111_0050523 | 3300048914 | Bacteria | 3000 |
| 1203 | Ga0496111_0073792 | 3300048914 | Bacteria | 2484 |
| 1204 | Ga0496111_0114534 | 3300048914 | Bacteria | 1988 |
| 1205 | Ga0496111_0115037 | 3300048914 | Bacteria | 1983 |
| 1206 | Ga0496112_0002361 | 3300048915 | Bacteria | 15165 |
| 1207 | Ga0496112_0027178 | 3300048915 | Bacteria | 5517 |
| 1208 | Ga0496112_0068395 | 3300048915 | Bacteria | 3507 |
| 1209 | Ga0496112_0143814 | 3300048915 | Bacteria | 2354 |
| 1210 | Ga0496112_0170150 | 3300048915 | Bacteria | 2144 |
| 1211 | Ga0496113_0026225 | 3300048916 | Bacteria | 4164 |
| 1212 | Ga0496113_0115992 | 3300048916 | Bacteria | 2089 |
| 1213 | Ga0496113_0184209 | 3300048916 | Bacteria | 1655 |
| 1214 | Ga0496114_0000840 | 3300048917 | Bacteria | 23001 |
| 1215 | Ga0496114_0001257 | 3300048917 | Bacteria | 19194 |
| 1216 | Ga0496114_0002103 | 3300048917 | Bacteria | 15142 |
| 1217 | Ga0496114_0009000 | 3300048917 | Bacteria | 7915 |
| 1218 | Ga0496114_0019711 | 3300048917 | Bacteria | 5467 |
| 1219 | Ga0496114_0062677 | 3300048917 | Bacteria | 3112 |
| 1220 | Ga0496114_0093864 | 3300048917 | Bacteria | 2552 |
| 1221 | Ga0496114_0129640 | 3300048917 | Bacteria | 2177 |
| 1222 | Ga0496114_0148994 | 3300048917 | Bacteria | 2029 |
| 1223 | Ga0496114_0239133 | 3300048917 | Bacteria | 1596 |
| 1224 | Ga0496114_0245293 | 3300048917 | Bacteria | 1576 |
| 1225 | Ga0496114_0334493 | 3300048917 | Bacteria | 1339 |
| 1226 | Ga0496115_0016938 | 3300048918 | Bacteria | 5559 |
| 1227 | Ga0496115_0024948 | 3300048918 | Bacteria | 4651 |
| 1228 | Ga0496115_0034855 | 3300048918 | Bacteria | 3978 |
| 1229 | Ga0496115_0049785 | 3300048918 | Bacteria | 3355 |
| 1230 | Ga0496115_0051318 | 3300048918 | Bacteria | 3307 |
| 1231 | Ga0496115_0087035 | 3300048918 | Bacteria | 2549 |
| 1232 | Ga0496115_0088232 | 3300048918 | Bacteria | 2532 |
| 1233 | Ga0496115_0125518 | 3300048918 | Bacteria | 2114 |
| 1234 | Ga0496115_0169186 | 3300048918 | Bacteria | 1807 |
| 1235 | Ga0496116_0001687 | 3300048919 | Bacteria | 24198 |
| 1236 | Ga0496116_0002425 | 3300048919 | Bacteria | 19649 |
| 1237 | Ga0496117_0022116 | 3300048920 | Bacteria | 5109 |
| 1238 | Ga0496117_0045443 | 3300048920 | Bacteria | 3171 |
| 1239 | Ga0496118_0000322 | 3300048921 | Bacteria | 82886 |
| 1240 | Ga0496118_0000462 | 3300048921 | Bacteria | 67416 |
| 1241 | Ga0496118_0031380 | 3300048921 | Bacteria | 4406 |
| 1242 | Ga0496118_0044709 | 3300048921 | Bacteria | 3465 |
| 1243 | Ga0496118_0172570 | 3300048921 | Bacteria | 1319 |
| 1244 | Ga0496119_0000104 | 3300048922 | Bacteria | 121325 |
| 1245 | Ga0496120_0002351 | 3300048923 | Bacteria | 19430 |
| 1246 | Ga0496121_0006448 | 3300048924 | Bacteria | 14558 |
| 1247 | Ga0496121_0009278 | 3300048924 | Bacteria | 11348 |
| 1248 | Ga0496121_0028527 | 3300048924 | Bacteria | 5192 |
| 1249 | Ga0496121_0111659 | 3300048924 | Bacteria | 2084 |
| 1250 | Ga0496121_0134614 | 3300048924 | Bacteria | 1843 |
| 1251 | Ga0496121_0297850 | 3300048924 | Bacteria | 1096 |
| 1252 | Ga0496123_0002402 | 3300048926 | Bacteria | 23389 |
| 1253 | Ga0496124_0000459 | 3300048927 | Bacteria | 70625 |
| 1254 | Ga0496125_0030253 | 3300048928 | Bacteria | 4847 |
| 1255 | Ga0496125_0053137 | 3300048928 | Bacteria | 3325 |
| 1256 | Ga0496126_0000037 | 3300048929 | Bacteria | 353425 |
| 1257 | Ga0496126_0000999 | 3300048929 | Bacteria | 48191 |
| 1258 | Ga0496126_0004694 | 3300048929 | Bacteria | 16143 |
| 1259 | Ga0496126_0005936 | 3300048929 | Bacteria | 13766 |
| 1260 | Ga0496126_0075454 | 3300048929 | Bacteria | 2992 |
| 1261 | Ga0496126_0231817 | 3300048929 | Bacteria | 1547 |
| 1262 | Ga0501294_005152 | 3300049517 | Bacteria | 1235 |
| 1263 | Ga0501031_0000485 | 3300049568 | Bacteria | 23163 |
| 1264 | Ga0501031_0022708 | 3300049568 | Bacteria | 4090 |
| 1265 | Ga0501031_0163834 | 3300049568 | Bacteria | 1453 |
| 1266 | Ga0501032_0000424 | 3300049569 | Bacteria | 35024 |
| 1267 | Ga0501032_0008084 | 3300049569 | Bacteria | 7668 |
| 1268 | Ga0501033_0016983 | 3300049570 | Bacteria | 5502 |
| 1269 | Ga0501033_0061288 | 3300049570 | Bacteria | 2773 |
| 1270 | Ga0501033_0066414 | 3300049570 | Bacteria | 2652 |
| 1271 | Ga0501033_0170713 | 3300049570 | Bacteria | 1562 |
| 1272 | Ga0501034_0000339 | 3300049571 | Bacteria | 81769 |
| 1273 | Ga0501034_0011396 | 3300049571 | Bacteria | 9220 |
| 1274 | Ga0501034_0026673 | 3300049571 | Bacteria | 5879 |
| 1275 | Ga0501034_0027747 | 3300049571 | Bacteria | 5757 |
| 1276 | Ga0501034_0029476 | 3300049571 | Bacteria | 5578 |
| 1277 | Ga0501034_0116918 | 3300049571 | Bacteria | 2654 |
| 1278 | Ga0501034_0120428 | 3300049571 | Bacteria | 2611 |
| 1279 | Ga0501034_0168887 | 3300049571 | Bacteria | 2155 |
| 1280 | Ga0501034_0198045 | 3300049571 | Bacteria | 1968 |
| 1281 | Ga0501036_0005274 | 3300049572 | Bacteria | 10456 |
| 1282 | Ga0501036_0026339 | 3300049572 | Bacteria | 4907 |
| 1283 | Ga0501036_0108991 | 3300049572 | Bacteria | 2340 |
| 1284 | Ga0501036_0124055 | 3300049572 | Bacteria | 2181 |
| 1285 | Ga0501037_0003342 | 3300049573 | Bacteria | 11657 |
| 1286 | Ga0501037_0043187 | 3300049573 | Bacteria | 3313 |
| 1287 | Ga0501037_0049439 | 3300049573 | Bacteria | 3079 |
| 1288 | Ga0501037_0050557 | 3300049573 | Bacteria | 3042 |
| 1289 | Ga0501038_0007562 | 3300049574 | Bacteria | 10018 |
| 1290 | Ga0501038_0021944 | 3300049574 | Bacteria | 5726 |
| 1291 | Ga0501038_0028260 | 3300049574 | Bacteria | 4983 |
| 1292 | Ga0501038_0035688 | 3300049574 | Bacteria | 4365 |
| 1293 | Ga0501038_0104806 | 3300049574 | Bacteria | 2350 |
| 1294 | Ga0501038_0127699 | 3300049574 | Bacteria | 2091 |
| 1295 | Ga0501038_0161269 | 3300049574 | Bacteria | 1822 |
| 1296 | Ga0501038_0253855 | 3300049574 | Bacteria | 1392 |
| 1297 | Ga0501039_0000966 | 3300049575 | Bacteria | 20946 |
| 1298 | Ga0501039_0001751 | 3300049575 | Bacteria | 16011 |
| 1299 | Ga0501039_0016350 | 3300049575 | Bacteria | 5686 |
| 1300 | Ga0501039_0025475 | 3300049575 | Bacteria | 4545 |
| 1301 | Ga0501039_0028102 | 3300049575 | Bacteria | 4327 |
| 1302 | Ga0501039_0096987 | 3300049575 | Bacteria | 2299 |
| 1303 | Ga0501039_0318269 | 3300049575 | Bacteria | 1223 |
| 1304 | Ga0501040_0000581 | 3300049576 | Bacteria | 22265 |
| 1305 | Ga0501040_0002936 | 3300049576 | Bacteria | 11026 |
| 1306 | Ga0501040_0003290 | 3300049576 | Bacteria | 10442 |
| 1307 | Ga0501040_0010682 | 3300049576 | Bacteria | 6005 |
| 1308 | Ga0501040_0017049 | 3300049576 | Bacteria | 4817 |
| 1309 | Ga0501040_0029162 | 3300049576 | Bacteria | 3724 |
| 1310 | Ga0501041_0009664 | 3300049577 | Bacteria | 5685 |
| 1311 | Ga0501041_0012306 | 3300049577 | Bacteria | 5068 |
| 1312 | Ga0501041_0039741 | 3300049577 | Bacteria | 2855 |
| 1313 | Ga0501041_0052236 | 3300049577 | Bacteria | 2491 |
| 1314 | Ga0501041_0132853 | 3300049577 | Bacteria | 1550 |
| 1315 | Ga0501041_0164675 | 3300049577 | Bacteria | 1387 |
| 1316 | Ga0501042_0001049 | 3300049578 | Bacteria | 15762 |
| 1317 | Ga0501042_0004432 | 3300049578 | Bacteria | 8956 |
| 1318 | Ga0501042_0005589 | 3300049578 | Bacteria | 8103 |
| 1319 | Ga0501042_0006659 | 3300049578 | Bacteria | 7528 |
| 1320 | Ga0501042_0010012 | 3300049578 | Bacteria | 6340 |
| 1321 | Ga0501042_0019346 | 3300049578 | Bacteria | 4726 |
| 1322 | Ga0501042_0028106 | 3300049578 | Bacteria | 3958 |
| 1323 | Ga0501042_0053785 | 3300049578 | Bacteria | 2872 |
| 1324 | Ga0501042_0101067 | 3300049578 | Bacteria | 2074 |
| 1325 | Ga0501042_0154025 | 3300049578 | Bacteria | 1658 |
| 1326 | Ga0501043_0012258 | 3300049579 | Bacteria | 6702 |
| 1327 | Ga0501043_0019067 | 3300049579 | Bacteria | 5386 |
| 1328 | Ga0501046_0005483 | 3300049580 | Bacteria | 11339 |
| 1329 | Ga0501046_0008010 | 3300049580 | Bacteria | 9235 |
| 1330 | Ga0501046_0017525 | 3300049580 | Bacteria | 5973 |
| 1331 | Ga0501046_0028814 | 3300049580 | Bacteria | 4518 |
| 1332 | Ga0501046_0031002 | 3300049580 | Bacteria | 4338 |
| 1333 | Ga0501046_0078648 | 3300049580 | Bacteria | 2551 |
| 1334 | Ga0501047_0000601 | 3300049581 | Bacteria | 38282 |
| 1335 | Ga0501047_0001963 | 3300049581 | Bacteria | 19747 |
| 1336 | Ga0501047_0003093 | 3300049581 | Bacteria | 15792 |
| 1337 | Ga0501047_0037282 | 3300049581 | Bacteria | 4701 |
| 1338 | Ga0501047_0096977 | 3300049581 | Bacteria | 2827 |
| 1339 | Ga0501047_0133398 | 3300049581 | Bacteria | 2363 |
| 1340 | Ga0501047_0217953 | 3300049581 | Bacteria | 1765 |
| 1341 | Ga0501048_0001137 | 3300049582 | Bacteria | 19970 |
| 1342 | Ga0501048_0016878 | 3300049582 | Bacteria | 5383 |
| 1343 | Ga0501048_0023764 | 3300049582 | Bacteria | 4476 |
| 1344 | Ga0501048_0029364 | 3300049582 | Bacteria | 3988 |
| 1345 | Ga0501048_0037709 | 3300049582 | Bacteria | 3471 |
| 1346 | Ga0501048_0074323 | 3300049582 | Bacteria | 2398 |
| 1347 | Ga0501048_0075556 | 3300049582 | Bacteria | 2377 |
| 1348 | Ga0501048_0082044 | 3300049582 | Bacteria | 2274 |
| 1349 | Ga0501067_0029205 | 3300049583 | Bacteria | 3056 |
| 1350 | Ga0501068_0025615 | 3300049584 | Bacteria | 3470 |
| 1351 | Ga0501068_0050086 | 3300049584 | Bacteria | 2524 |
| 1352 | Ga0501068_0054389 | 3300049584 | Bacteria | 2425 |
| 1353 | Ga0501068_0167417 | 3300049584 | Bacteria | 1386 |
| 1354 | Ga0501069_0000089 | 3300049585 | Bacteria | 43912 |
| 1355 | Ga0501069_0005202 | 3300049585 | Bacteria | 6763 |
| 1356 | Ga0501069_0008959 | 3300049585 | Bacteria | 5279 |
| 1357 | Ga0501069_0116590 | 3300049585 | Bacteria | 1523 |
| 1358 | Ga0501070_0000008 | 3300049586 | Bacteria | 199963 |
| 1359 | Ga0501070_0001203 | 3300049586 | Bacteria | 23173 |
| 1360 | Ga0501070_0017196 | 3300049586 | Bacteria | 6070 |
| 1361 | Ga0501070_0054912 | 3300049586 | Bacteria | 3302 |
| 1362 | Ga0501070_0065034 | 3300049586 | Bacteria | 3020 |
| 1363 | Ga0501070_0189953 | 3300049586 | Bacteria | 1689 |
| 1364 | Ga0501071_0001866 | 3300049587 | Bacteria | 12495 |
| 1365 | Ga0501071_0003038 | 3300049587 | Bacteria | 10392 |
| 1366 | Ga0501071_0003173 | 3300049587 | Bacteria | 10224 |
| 1367 | Ga0501071_0007247 | 3300049587 | Bacteria | 7261 |
| 1368 | Ga0501071_0020290 | 3300049587 | Bacteria | 4617 |
| 1369 | Ga0501071_0065614 | 3300049587 | Bacteria | 2636 |
| 1370 | Ga0501072_0001968 | 3300049588 | Bacteria | 15315 |
| 1371 | Ga0501072_0002597 | 3300049588 | Bacteria | 13541 |
| 1372 | Ga0501072_0007326 | 3300049588 | Bacteria | 8369 |
| 1373 | Ga0501072_0009139 | 3300049588 | Bacteria | 7525 |
| 1374 | Ga0501072_0018044 | 3300049588 | Bacteria | 5426 |
| 1375 | Ga0501072_0022975 | 3300049588 | Bacteria | 4841 |
| 1376 | Ga0501072_0025611 | 3300049588 | Bacteria | 4595 |
| 1377 | Ga0501072_0056152 | 3300049588 | Bacteria | 3103 |
| 1378 | Ga0501072_0096587 | 3300049588 | Bacteria | 2348 |
| 1379 | Ga0501072_0125836 | 3300049588 | Bacteria | 2042 |
| 1380 | Ga0501072_0161244 | 3300049588 | Bacteria | 1789 |
| 1381 | Ga0501074_0022034 | 3300049590 | Bacteria | 4628 |
| 1382 | Ga0501074_0038358 | 3300049590 | Bacteria | 3473 |
| 1383 | Ga0501074_0102731 | 3300049590 | Bacteria | 2046 |
| 1384 | Ga0501075_0000895 | 3300049591 | Bacteria | 18813 |
| 1385 | Ga0501075_0002183 | 3300049591 | Bacteria | 12942 |
| 1386 | Ga0501075_0006676 | 3300049591 | Bacteria | 7958 |
| 1387 | Ga0501075_0013675 | 3300049591 | Bacteria | 5797 |
| 1388 | Ga0501075_0022349 | 3300049591 | Bacteria | 4619 |
| 1389 | Ga0501075_0148205 | 3300049591 | Bacteria | 1789 |
| 1390 | Ga0501075_0174122 | 3300049591 | Bacteria | 1642 |
| 1391 | Ga0501076_0001798 | 3300049592 | Bacteria | 14548 |
| 1392 | Ga0501076_0002273 | 3300049592 | Bacteria | 13140 |
| 1393 | Ga0501076_0002738 | 3300049592 | Bacteria | 12202 |
| 1394 | Ga0501076_0004824 | 3300049592 | Bacteria | 9624 |
| 1395 | Ga0501076_0045646 | 3300049592 | Bacteria | 3460 |
| 1396 | Ga0501076_0076524 | 3300049592 | Bacteria | 2684 |
| 1397 | Ga0501076_0078451 | 3300049592 | Bacteria | 2650 |
| 1398 | Ga0501076_0104808 | 3300049592 | Bacteria | 2282 |
| 1399 | Ga0501076_0120304 | 3300049592 | Bacteria | 2126 |
| 1400 | Ga0501076_0202792 | 3300049592 | Bacteria | 1620 |
| 1401 | Ga0501077_0003196 | 3300049593 | Bacteria | 9872 |
| 1402 | Ga0501077_0005440 | 3300049593 | Bacteria | 7750 |
| 1403 | Ga0501077_0025113 | 3300049593 | Bacteria | 3784 |
| 1404 | Ga0501077_0033857 | 3300049593 | Bacteria | 3252 |
| 1405 | Ga0501077_0205902 | 3300049593 | Bacteria | 1250 |
| 1406 | Ga0501198_004370 | 3300049649 | Bacteria | 1962 |
| 1407 | Ga0501217_005828 | 3300049661 | Bacteria | 2591 |
| 1408 | Ga0501235_023528 | 3300049669 | Bacteria | 1374 |
| 1409 | Ga0501249_000117 | 3300049679 | Bacteria | 24631 |
| 1410 | Ga0501079_0004718 | 3300049741 | Bacteria | 10089 |
| 1411 | Ga0501079_0008561 | 3300049741 | Bacteria | 7762 |
| 1412 | Ga0501079_0009798 | 3300049741 | Bacteria | 7266 |
| 1413 | Ga0501079_0106805 | 3300049741 | Bacteria | 2172 |
| 1414 | Ga0501079_0129740 | 3300049741 | Bacteria | 1961 |
| 1415 | Ga0501079_0189018 | 3300049741 | Bacteria | 1607 |
| 1416 | Ga0501080_0012185 | 3300049742 | Bacteria | 7878 |
| 1417 | Ga0501080_0018696 | 3300049742 | Bacteria | 6413 |
| 1418 | Ga0501080_0074250 | 3300049742 | Bacteria | 3163 |
| 1419 | Ga0501080_0092571 | 3300049742 | Bacteria | 2808 |
| 1420 | Ga0501080_0107899 | 3300049742 | Bacteria | 2580 |
| 1421 | Ga0501080_0146369 | 3300049742 | Bacteria | 2184 |
| 1422 | Ga0501080_0347985 | 3300049742 | Bacteria | 1339 |
| 1423 | Ga0501081_0005016 | 3300049743 | Bacteria | 8522 |
| 1424 | Ga0501081_0008789 | 3300049743 | Bacteria | 6565 |
| 1425 | Ga0501081_0027685 | 3300049743 | Bacteria | 3822 |
| 1426 | Ga0501081_0027709 | 3300049743 | Bacteria | 3820 |
| 1427 | Ga0501081_0030670 | 3300049743 | Bacteria | 3641 |
| 1428 | Ga0501081_0234164 | 3300049743 | Bacteria | 1338 |
| 1429 | Ga0501081_0251147 | 3300049743 | Bacteria | 1291 |
| 1430 | Ga0501083_0000408 | 3300049744 | Bacteria | 27403 |
| 1431 | Ga0501083_0009305 | 3300049744 | Bacteria | 6935 |
| 1432 | Ga0501083_0019807 | 3300049744 | Bacteria | 4683 |
| 1433 | Ga0501281_00002 | 3300049777 | Bacteria | 40846 |
| 1434 | Ga0501035_0004302 | 3300049822 | Bacteria | 13526 |
| 1435 | Ga0501035_0010123 | 3300049822 | Bacteria | 8752 |
| 1436 | Ga0501035_0018495 | 3300049822 | Bacteria | 6420 |
| 1437 | Ga0501035_0026910 | 3300049822 | Bacteria | 5258 |
| 1438 | Ga0501035_0060451 | 3300049822 | Bacteria | 3373 |
| 1439 | Ga0501035_0069525 | 3300049822 | Bacteria | 3121 |
| 1440 | Ga0501035_0078324 | 3300049822 | Bacteria | 2920 |
| 1441 | Ga0501035_0130017 | 3300049822 | Bacteria | 2196 |
| 1442 | Ga0501035_0155576 | 3300049822 | Bacteria | 1982 |
| 1443 | Ga0501044_0001813 | 3300049823 | Bacteria | 24900 |
| 1444 | Ga0501044_0008299 | 3300049823 | Bacteria | 11385 |
| 1445 | Ga0501044_0010153 | 3300049823 | Bacteria | 10234 |
| 1446 | Ga0501044_0012648 | 3300049823 | Bacteria | 9138 |
| 1447 | Ga0501044_0016106 | 3300049823 | Bacteria | 8036 |
| 1448 | Ga0501044_0378393 | 3300049823 | Bacteria | 1331 |
| 1449 | Ga0501045_0000725 | 3300049824 | Bacteria | 20990 |
| 1450 | Ga0501045_0003204 | 3300049824 | Bacteria | 11188 |
| 1451 | Ga0501045_0003364 | 3300049824 | Bacteria | 10954 |
| 1452 | Ga0501045_0013023 | 3300049824 | Bacteria | 5863 |
| 1453 | Ga0501045_0025509 | 3300049824 | Bacteria | 4250 |
| 1454 | Ga0501045_0066501 | 3300049824 | Bacteria | 2646 |
| 1455 | Ga0501045_0078470 | 3300049824 | Bacteria | 2434 |
| 1456 | Ga0501045_0171973 | 3300049824 | Bacteria | 1613 |
| 1457 | Ga0501204_000446 | 3300049850 | Bacteria | 3579 |
| 1458 | nmdc:mga03n38_97111_c1 | 3300050490 | Bacteria | 1414 |
| 1459 | nmdc:mga0yw44_117309_c1 | 3300050492 | Bacteria | 1711 |
| 1460 | nmdc:mga0yw44_1691_c1 | 3300050492 | Bacteria | 8928 |
| 1461 | nmdc:mga0yw44_2005_c1 | 3300050492 | Bacteria | 6190 |
| 1462 | nmdc:mga0yw44_2625_c1 | 3300050492 | Bacteria | 7734 |
| 1463 | nmdc:mga0yw44_33385_c1 | 3300050492 | Bacteria | 3006 |
| 1464 | nmdc:mga0yw44_48520_c1 | 3300050492 | Bacteria | 2560 |
| 1465 | nmdc:mga07m45_6297_c1 | 3300050496 | Bacteria | 5994 |
| 1466 | nmdc:mga05p37_213038_c1 | 3300050507 | Bacteria | 2334 |
| 1467 | nmdc:mga05p37_2208_c1 | 3300050507 | Bacteria | 22673 |
| 1468 | nmdc:mga05p37_30113_c1 | 3300050507 | Bacteria | 6623 |
| 1469 | nmdc:mga05p37_47073_c1 | 3300050507 | Bacteria | 5304 |
| 1470 | nmdc:mga09592_135167_c1 | 3300050508 | Bacteria | 2124 |
| 1471 | nmdc:mga09592_33032_c1 | 3300050508 | Bacteria | 4317 |
| 1472 | nmdc:mga0qj67_181720_c1 | 3300050509 | Bacteria | 1708 |
| 1473 | nmdc:mga0qj67_20395_c1 | 3300050509 | Bacteria | 5074 |
| 1474 | nmdc:mga0qj67_66004_c1 | 3300050509 | Bacteria | 2882 |
| 1475 | nmdc:mga0qj67_8448_c1 | 3300050509 | Bacteria | 7641 |
| 1476 | nmdc:mga06r32_107748_c1 | 3300050510 | Bacteria | 2739 |
| 1477 | nmdc:mga06r32_12374_c1 | 3300050510 | Bacteria | 7697 |
| 1478 | nmdc:mga06r32_158411_c1 | 3300050510 | Bacteria | 2246 |
| 1479 | nmdc:mga06r32_30013_c1 | 3300050510 | Bacteria | 5100 |
| 1480 | nmdc:mga08y16_155061_c1 | 3300050511 | Bacteria | 2380 |
| 1481 | nmdc:mga08y16_169045_c1 | 3300050511 | Bacteria | 2271 |
| 1482 | nmdc:mga08y16_451430_c1 | 3300050511 | Bacteria | 1311 |
| 1483 | nmdc:mga08y16_49670_c1 | 3300050511 | Bacteria | 4390 |
| 1484 | nmdc:mga08y16_72585_c1 | 3300050511 | Bacteria | 3586 |
| 1485 | nmdc:mga0n895_15173_c1 | 3300050512 | Bacteria | 7021 |
| 1486 | nmdc:mga0n895_196045_c1 | 3300050512 | Bacteria | 2051 |
| 1487 | nmdc:mga0n895_235323_c1 | 3300050512 | Bacteria | 1859 |
| 1488 | nmdc:mga0n895_3276_c1 | 3300050512 | Bacteria | 12993 |
| 1489 | nmdc:mga0rr50_125550_c1 | 3300050513 | Bacteria | 2049 |
| 1490 | nmdc:mga0rr50_23084_c1 | 3300050513 | Bacteria | 4283 |
| 1491 | nmdc:mga0rr50_335318_c1 | 3300050513 | Bacteria | 1270 |
| 1492 | nmdc:mga0rr50_62699_c1 | 3300050513 | Bacteria | 2806 |
| 1493 | nmdc:mga0rr50_92352_c1 | 3300050513 | Bacteria | 2360 |
| 1494 | nmdc:mga08x19_223708_c1 | 3300050514 | Bacteria | 1294 |
| 1495 | nmdc:mga08x19_264524_c1 | 3300050514 | Bacteria | 1189 |
| 1496 | nmdc:mga08x19_4090_c1 | 3300050514 | Bacteria | 8656 |
| 1497 | nmdc:mga08x19_4_c1 | 3300050514 | Bacteria | 335979 |
| 1498 | nmdc:mga0a205_116864_c1 | 3300050515 | Bacteria | 2566 |
| 1499 | nmdc:mga0a205_258698_c1 | 3300050515 | Bacteria | 1619 |
| 1500 | Ga0495601_0004240 | 3300053077 | Bacteria | 8277 |
| 1501 | Ga0495601_0020581 | 3300053077 | Bacteria | 4031 |
| 1502 | Ga0495601_0026317 | 3300053077 | Bacteria | 3591 |
| 1503 | Ga0495601_0043337 | 3300053077 | Bacteria | 2826 |
| 1504 | Ga0495601_0104454 | 3300053077 | Bacteria | 1831 |
| 1505 | Ga0495612_0003194 | 3300053078 | Bacteria | 6789 |
| 1506 | Ga0495612_0017040 | 3300053078 | Bacteria | 2910 |
| 1507 | Ga0495612_0052197 | 3300053078 | Bacteria | 1682 |
| 1508 | Ga0500610_0000152 | 3300053079 | Bacteria | 20704 |
| 1509 | Ga0495595_0000800 | 3300053084 | Bacteria | 11997 |
| 1510 | Ga0495595_0018875 | 3300053084 | Bacteria | 2985 |
| 1511 | Ga0495595_0024185 | 3300053084 | Bacteria | 2681 |
| 1512 | Ga0495595_0062865 | 3300053084 | Bacteria | 1742 |
| 1513 | Ga0495595_0096053 | 3300053084 | Bacteria | 1426 |
| 1514 | Ga0495619_0005129 | 3300053085 | Bacteria | 8315 |
| 1515 | Ga0495619_0008855 | 3300053085 | Bacteria | 6362 |
| 1516 | Ga0495619_0016896 | 3300053085 | Bacteria | 4622 |
| 1517 | Ga0495619_0158383 | 3300053085 | Bacteria | 1563 |
| 1518 | Ga0500643_000188 | 3300053087 | Bacteria | 59049 |
| 1519 | Ga0500641_0065901 | 3300053096 | Bacteria | 1516 |
| 1520 | Ga0500650_0000017 | 3300053098 | Bacteria | 70720 |
| 1521 | Ga0500593_000100 | 3300053117 | Bacteria | 32734 |
| 1522 | Ga0500593_014489 | 3300053117 | Bacteria | 3384 |
| 1523 | Ga0500658_0000047 | 3300053134 | Bacteria | 66543 |
| 1524 | Ga0500568_0000011 | 3300053139 | Bacteria | 248947 |
| 1525 | Ga0500604_0008326 | 3300053151 | Bacteria | 2751 |
| 1526 | Ga0500604_0009663 | 3300053151 | Bacteria | 2571 |
| 1527 | Ga0500616_0000905 | 3300053153 | Bacteria | 32539 |
| 1528 | Ga0500616_0001088 | 3300053153 | Bacteria | 28313 |
| 1529 | Ga0500622_0001774 | 3300053156 | Bacteria | 16503 |
| 1530 | Ga0500622_0011034 | 3300053156 | Bacteria | 4931 |
| 1531 | Ga0500627_0007069 | 3300053158 | Bacteria | 3877 |
| 1532 | Ga0500627_0046820 | 3300053158 | Bacteria | 1875 |
| 1533 | Ga0500596_002176 | 3300053735 | Bacteria | 3883 |
| 1534 | Ga0501084_0000086 | 3300054114 | Bacteria | 66940 |
| 1535 | Ga0501084_0002919 | 3300054114 | Bacteria | 13834 |
| 1536 | Ga0501084_0007402 | 3300054114 | Bacteria | 9050 |
| 1537 | Ga0501084_0024187 | 3300054114 | Bacteria | 5067 |
| 1538 | Ga0501084_0033145 | 3300054114 | Bacteria | 4320 |
| 1539 | Ga0501084_0049068 | 3300054114 | Bacteria | 3533 |
| 1540 | Ga0501084_0068412 | 3300054114 | Bacteria | 2973 |
| 1541 | Ga0501084_0076326 | 3300054114 | Bacteria | 2809 |
| 1542 | Ga0501082_0010656 | 3300060353 | Bacteria | 7914 |
| 1543 | Ga0501082_0012946 | 3300060353 | Bacteria | 7171 |
| 1544 | Ga0501082_0017891 | 3300060353 | Bacteria | 6105 |
| 1545 | Ga0501082_0020755 | 3300060353 | Bacteria | 5664 |
| 1546 | Ga0501082_0033862 | 3300060353 | Bacteria | 4406 |
| 1547 | Ga0501082_0039827 | 3300060353 | Bacteria | 4054 |
| 1548 | Ga0501082_0130332 | 3300060353 | Bacteria | 2182 |
| 1549 | Ga0466962_0015510 | 3300061719 | Bacteria | 3675 |
| 1550 | Ga0466962_0017966 | 3300061719 | Bacteria | 3403 |
| 1551 | Ga0530510_0001548 | 3300061734 | Bacteria | 15504 |
| 1552 | Ga0530510_0001995 | 3300061734 | Bacteria | 13994 |
| 1553 | Ga0530510_0003428 | 3300061734 | Bacteria | 10903 |
| 1554 | Ga0530510_0006008 | 3300061734 | Bacteria | 8424 |
| 1555 | Ga0530510_0012291 | 3300061734 | Bacteria | 6011 |
| 1556 | Ga0530510_0013569 | 3300061734 | Bacteria | 5730 |
| 1557 | Ga0530510_0136535 | 3300061734 | Bacteria | 1806 |
| 1558 | 2501940916 | 2501939600 | Bacteria | 6907073 |
| 1559 | 2506867910 | 2506783011 | Bacteria | 5323186 |
| 1560 | 2508678411 | 2508501039 | Bacteria | 9978592 |
| 1561 | 2523384783 | 2523231044 | Bacteria | 6434991 |
| 1562 | 2548692936 | 2547132424 | Bacteria | 8348532 |
| 1563 | 2552746647 | 2551306352 | Bacteria | 3873115 |
| 1564 | 2552748084 | 2551306352 | Bacteria | 3873115 |
| 1565 | 2595088439 | 2593339131 | Bacteria | 5116855 |
| 1566 | 2626636376 | 2626541554 | Bacteria | 7741902 |
| 1567 | 2640733522 | 2639762793 | Bacteria | 3943681 |
| 1568 | 2640734984 | 2639762793 | Bacteria | 3943681 |
| 1569 | 2644361825 | 2643221665 | Bacteria | 4699229 |
| 1570 | 2671838875 | 2671180195 | Bacteria | 9757215 |
| 1571 | 2672334260 | 2671180330 | Bacteria | 5521719 |
| 1572 | 2676201324 | 2675902999 | Bacteria | 9438463 |
| 1573 | 2678230558 | 2675903507 | Bacteria | 3737791 |
| 1574 | 2678231882 | 2675903507 | Bacteria | 3737791 |
| 1575 | 2689995690 | 2687453743 | Bacteria | 8361025 |
| 1576 | 2738709073 | 2738541275 | Bacteria | 4830863 |
| 1577 | 2738837937 | 2738541299 | Bacteria | 4020721 |
| 1578 | 2738847498 | 2738541301 | Bacteria | 4834102 |
| 1579 | 2738863227 | 2738541304 | Bacteria | 4833665 |
| 1580 | 2739231013 | 2738543010 | Bacteria | 5583595 |
| 1581 | 2739268153 | 2738543017 | Bacteria | 4271950 |
| 1582 | 2739295745 | 2738543022 | Bacteria | 4835059 |
| 1583 | 2739357423 | 2738543033 | Bacteria | 4833336 |
| 1584 | 2745160634 | 2744054655 | Bacteria | 3552603 |
| 1585 | 2757565484 | 2757320391 | Bacteria | 4746095 |
| 1586 | 2774388911 | 2773857761 | Bacteria | 3837365 |
| 1587 | 2774389592 | 2773857761 | Bacteria | 3837365 |
| 1588 | 2774436704 | 2773857770 | Bacteria | 3911866 |
| 1589 | 2774439797 | 2773857770 | Bacteria | 3911866 |
| 1590 | 2774845900 | 2773857921 | Bacteria | 9435764 |
| 1591 | 2774857031 | 2773857922 | Bacteria | 9757215 |
| 1592 | 2774904332 | 2773857933 | Bacteria | 5818019 |
| 1593 | 2774905752 | 2773857933 | Bacteria | 5818019 |
| 1594 | 2774905893 | 2773857933 | Bacteria | 5818019 |
| 1595 | 2777762820 | 2775507177 | Bacteria | 4384303 |
| 1596 | 2777763903 | 2775507177 | Bacteria | 4384303 |
| 1597 | 2777837009 | 2775507192 | Bacteria | 4622234 |
| 1598 | 2791211710 | 2788500588 | Bacteria | 4584915 |
| 1599 | 2816865838 | 2816332186 | Bacteria | 5331395 |
| 1600 | 2819628639 | 2818991451 | Bacteria | 4697364 |
| 1601 | 2842685863 | 2842682962 | Bacteria | 5589973 |
| 1602 | 2849142075 | 2849139964 | Bacteria | 5613304 |
| 1603 | 2852674059 | 2852673933 | Bacteria | 3347676 |
| 1604 | 2856861817 | 2856858025 | Bacteria | 7255264 |
| 1605 | 2857581761 | 2857581216 | Bacteria | 5522813 |
| 1606 | 2857585902 | 2857581216 | Bacteria | 5522813 |
| 1607 | 2857588220 | 2857586860 | Bacteria | 4354574 |
| 1608 | 2857592049 | 2857591370 | Bacteria | 6569758 |
| 1609 | 2862292997 | 2862290372 | Bacteria | 7471434 |
| 1610 | 2862575416 | 2862574272 | Bacteria | 10567477 |
| 1611 | 2867508492 | 2867507094 | Bacteria | 6506033 |
| 1612 | 2894776755 | 2894772417 | Bacteria | 5305674 |
| 1613 | 2898907217 | 2898907183 | Bacteria | 4067722 |
| 1614 | 2904609068 | 2904606771 | Bacteria | 4684500 |
| 1615 | 2912727207 | 2912723979 | Bacteria | 8557534 |
| 1616 | 2915359925 | 2915358134 | Bacteria | 6050864 |
| 1617 | 2916699715 | 2916699645 | Bacteria | 3568996 |
| 1618 | 2919183069 | 2919182534 | Bacteria | 3907101 |
| 1619 | 2919183459 | 2919182534 | Bacteria | 3907101 |
| 1620 | 2919506965 | 2919506607 | Bacteria | 3392955 |
| 1621 | 2919508598 | 2919506607 | Bacteria | 3392955 |
| 1622 | 2919717854 | 2919713450 | Bacteria | 7431245 |
| 1623 | 2928102157 | 2928100450 | Bacteria | 4837635 |
| 1624 | 2928510666 | 2928510474 | Bacteria | 4815308 |
| 1625 | 2928517940 | 2928515477 | Bacteria | 4448421 |
| 1626 | 2928962401 | 2928959182 | Bacteria | 4725774 |
| 1627 | 2929186610 | 2929183550 | Bacteria | 6377511 |
| 1628 | 2929201291 | 2929199973 | Bacteria | 7260745 |
| 1629 | 2929212719 | 2929212328 | Bacteria | 7708288 |
| 1630 | 2936342873 | 2936340661 | Bacteria | 5139038 |
| 1631 | 2936364301 | 2936361878 | Bacteria | 5632809 |
| 1632 | 2939597928 | 2939593269 | Bacteria | 4798695 |
| 1633 | 2954692323 | 2954691527 | Bacteria | 10720516 |
| 1634 | 2954707389 | 2954701450 | Bacteria | 10834262 |
| 1635 | 2977259176 | 2977254563 | Bacteria | 4828420 |
| 1636 | 2984569529 | 2984568884 | Bacteria | 3884413 |
| 1637 | 2990280205 | 2990275345 | Bacteria | 4887158 |
| 1638 | 2995464186 | 2995463766 | Bacteria | 8577691 |
| 1639 | 3001893021 | 3001892409 | Bacteria | 6328293 |
| 1640 | 3001895645 | 3001892409 | Bacteria | 6328293 |
| 1641 | 3003006308 | 3002998708 | Bacteria | 11715108 |
| 1642 | 3006829265 | 3006826541 | Bacteria | 4678913 |
| 1643 | 3006978211 | 3006973921 | Bacteria | 4423788 |
| 1644 | 649812415 | 649633069 | Bacteria | 6962533 |
| 1645 | 8002779564 | 8002775197 | Bacteria | 10728764 |
| 1646 | 8022793391 | 8022792930 | Bacteria | 5693794 |
| 1647 | 8033233388 | 8033232454 | Bacteria | 3202805 |
| 1648 | 8033233553 | 8033232454 | Bacteria | 3202805 |
| 1649 | 8046355932 | 8046352972 | Bacteria | 3613806 |
| 1650 | 8047713229 | 8047710418 | Bacteria | 11023148 |
| 1651 | 8055532291 | 8055531788 | Bacteria | 5249694 |
| 1652 | 8055910058 | 8055909800 | Bacteria | 7278581 |
| 1653 | 8057587118 | 8057582654 | Bacteria | 5218944 |
| 1654 | 8057634880 | 8057632132 | Bacteria | 4726859 |
| 1655 | Ga0496102_0165760 | |||
| 1656 | LJQas_1005422 | |||
| 1657 | JGI24752J21851_1000031 | |||
| 1658 | JGI25151J46595_10001297 | |||
| 1659 | JGI25151J46595_10001914 | |||
| 1660 | JGI25151J46595_10002376 | |||
| 1661 | JGI25151J46595_10003056 | |||
| 1662 | JGI25151J46595_10003287 | |||
| 1663 | JGI25151J46595_10018537 | |||
| 1664 | JGI25406J46586_10000099 | |||
| 1665 | JGI25406J46586_10001854 | |||
| 1666 | rootH1_10192437 | |||
| 1667 | Ga0006562J51391_1016962 | |||
| 1668 | Ga0006562J51391_1041968 | |||
| 1669 | Ga0055538_1000283 | |||
| 1670 | Ga0055532_1000229 | |||
| 1671 | Ga0055536_1022910 | |||
| 1672 | Ga0058692_1000001 | |||
| 1673 | Ga0058692_1000063 | |||
| 1674 | Ga0065714_10080014 | |||
| 1675 | Ga0065704_10003837 | |||
| 1676 | Ga0065704_10010176 | |||
| 1677 | Ga0065704_10077027 | |||
| 1678 | Ga0065707_10084189 | |||
| 1679 | Ga0065707_10118720 | |||
| 1680 | Ga0070658_10026316 | |||
| 1681 | Ga0070676_10041771 | |||
| 1682 | Ga0070676_10099977 | |||
| 1683 | Ga0070683_100007853 | |||
| 1684 | Ga0070683_100024318 | |||
| 1685 | Ga0070683_100254800 | |||
| 1686 | Ga0070690_100027158 | |||
| 1687 | Ga0070690_100171394 | |||
| 1688 | Ga0070670_100000072 | |||
| 1689 | Ga0070670_100119174 | |||
| 1690 | Ga0070670_100144088 | |||
| 1691 | Ga0070677_10023288 | |||
| 1692 | Ga0068869_100028234 | |||
| 1693 | Ga0068869_100081247 | |||
| 1694 | Ga0070666_10050020 | |||
| 1695 | Ga0070666_10129546 | |||
| 1696 | Ga0070680_100000261 | |||
| 1697 | Ga0070680_100017787 | |||
| 1698 | Ga0070680_100069143 | |||
| 1699 | Ga0070680_100107679 | |||
| 1700 | Ga0070680_100240839 | |||
| 1701 | Ga0068868_100002141 | |||
| 1702 | Ga0068868_100019874 | |||
| 1703 | Ga0070660_100012370 | |||
| 1704 | Ga0070660_100026559 | |||
| 1705 | Ga0070660_100224956 | |||
| 1706 | Ga0070689_100036774 | |||
| 1707 | Ga0070691_10011061 | |||
| 1708 | Ga0070691_10033980 | |||
| 1709 | Ga0070687_100018616 | |||
| 1710 | Ga0070687_100055083 | |||
| 1711 | Ga0070687_100058624 | |||
| 1712 | Ga0070661_100068424 | |||
| 1713 | Ga0070661_100097130 | |||
| 1714 | Ga0070692_10071974 | |||
| 1715 | Ga0070668_100001049 | |||
| 1716 | Ga0070668_100005680 | |||
| 1717 | Ga0070668_100057236 | |||
| 1718 | Ga0070668_100087008 | |||
| 1719 | Ga0070669_100005928 | |||
| 1720 | Ga0070669_100016997 | |||
| 1721 | Ga0070669_100050975 | |||
| 1722 | Ga0070669_100113457 | |||
| 1723 | Ga0070675_100000935 | |||
| 1724 | Ga0070675_100028702 | |||
| 1725 | Ga0070671_100000969 | |||
| 1726 | Ga0070671_100015123 | |||
| 1727 | Ga0070671_100019608 | |||
| 1728 | Ga0070671_100027586 | |||
| 1729 | Ga0070671_100118565 | |||
| 1730 | Ga0070674_100027421 | |||
| 1731 | Ga0070673_100031261 | |||
| 1732 | Ga0070673_100051522 | |||
| 1733 | Ga0070688_100048884 | |||
| 1734 | Ga0070659_100003482 | |||
| 1735 | Ga0070659_100073290 | |||
| 1736 | Ga0070659_100140338 | |||
| 1737 | Ga0070667_100000746 | |||
| 1738 | Ga0070667_100012821 | |||
| 1739 | Ga0070667_100021378 | |||
| 1740 | Ga0070703_10013487 | |||
| 1741 | Ga0070709_10000727 | |||
| 1742 | Ga0070709_10001186 | |||
| 1743 | Ga0070709_10001840 | |||
| 1744 | Ga0070709_10014473 | |||
| 1745 | Ga0070709_10052770 | |||
| 1746 | Ga0070709_10063900 | |||
| 1747 | Ga0070709_10168283 | |||
| 1748 | Ga0070714_100000601 | |||
| 1749 | Ga0070714_100007663 | |||
| 1750 | Ga0070714_100034070 | |||
| 1751 | Ga0070714_100057419 | |||
| 1752 | Ga0070713_100008515 | |||
| 1753 | Ga0070713_100020320 | |||
| 1754 | Ga0070713_100053270 | |||
| 1755 | Ga0070713_100061729 | |||
| 1756 | Ga0070713_100075790 | |||
| 1757 | Ga0070713_100099046 | |||
| 1758 | Ga0070713_100141823 | |||
| 1759 | Ga0070710_10000225 | |||
| 1760 | Ga0070710_10000234 | |||
| 1761 | Ga0070710_10000408 | |||
| 1762 | Ga0070710_10004952 | |||
| 1763 | Ga0070710_10024459 | |||
| 1764 | Ga0070710_10039025 | |||
| 1765 | Ga0070710_10040416 | |||
| 1766 | Ga0070711_100000428 | |||
| 1767 | Ga0070711_100000526 | |||
| 1768 | Ga0070711_100001089 | |||
| 1769 | Ga0070711_100001574 | |||
| 1770 | Ga0070711_100032364 | |||
| 1771 | Ga0070705_100012199 | |||
| 1772 | Ga0070705_100043448 | |||
| 1773 | Ga0070705_100052962 | |||
| 1774 | Ga0070700_100002856 | |||
| 1775 | Ga0070694_100029011 | |||
| 1776 | Ga0070694_100065923 | |||
| 1777 | Ga0070708_100004853 | |||
| 1778 | Ga0070663_100001262 | |||
| 1779 | Ga0070663_100002450 | |||
| 1780 | Ga0070678_100068784 | |||
| 1781 | Ga0070662_100037024 | |||
| 1782 | Ga0070662_100123912 | |||
| 1783 | Ga0070681_10000079 | |||
| 1784 | Ga0070681_10057401 | |||
| 1785 | Ga0070681_10077913 | |||
| 1786 | Ga0070681_10186803 | |||
| 1787 | Ga0070681_10240551 | |||
| 1788 | Ga0070685_10203052 | |||
| 1789 | Ga0070706_100001191 | |||
| 1790 | Ga0070706_100012100 | |||
| 1791 | Ga0070706_100023248 | |||
| 1792 | Ga0070706_100023878 | |||
| 1793 | Ga0070706_100117704 | |||
| 1794 | Ga0070707_100000563 | |||
| 1795 | Ga0070707_100001915 | |||
| 1796 | Ga0070707_100009169 | |||
| 1797 | Ga0070707_100015399 | |||
| 1798 | Ga0070707_100024691 | |||
| 1799 | Ga0070707_100042973 | |||
| 1800 | Ga0070707_100109691 | |||
| 1801 | Ga0070707_100133074 | |||
| 1802 | Ga0070707_100169209 | |||
| 1803 | Ga0070698_100000280 | |||
| 1804 | Ga0070698_100000592 | |||
| 1805 | Ga0070698_100000647 | |||
| 1806 | Ga0070698_100006462 | |||
| 1807 | Ga0070698_100008349 | |||
| 1808 | Ga0070698_100013896 | |||
| 1809 | Ga0070698_100017952 | |||
| 1810 | Ga0070698_100083485 | |||
| 1811 | Ga0070698_100093440 | |||
| 1812 | Ga0070699_100000149 | |||
| 1813 | Ga0070699_100268449 | |||
| 1814 | Ga0070679_100000056 | |||
| 1815 | Ga0070679_100019580 | |||
| 1816 | Ga0070684_100004005 | |||
| 1817 | Ga0070684_100071856 | |||
| 1818 | Ga0070684_100086865 | |||
| 1819 | Ga0070684_100134362 | |||
| 1820 | Ga0070684_100154934 | |||
| 1821 | Ga0070684_100183608 | |||
| 1822 | Ga0070697_100000222 | |||
| 1823 | Ga0070697_100119837 | |||
| 1824 | Ga0070697_100250938 | |||
| 1825 | Ga0068853_100042114 | |||
| 1826 | Ga0068853_100234628 | |||
| 1827 | Ga0068853_100298155 | |||
| 1828 | Ga0070672_100010102 | |||
| 1829 | Ga0070686_100024100 | |||
| 1830 | Ga0070695_100004596 | |||
| 1831 | Ga0070695_100032163 | |||
| 1832 | Ga0070695_100081324 | |||
| 1833 | Ga0070695_100193948 | |||
| 1834 | Ga0070696_100010621 | |||
| 1835 | Ga0070696_100045553 | |||
| 1836 | Ga0070696_100052323 | |||
| 1837 | Ga0070693_100009751 | |||
| 1838 | Ga0070693_100011397 | |||
| 1839 | Ga0070693_100040158 | |||
| 1840 | Ga0070665_100055258 | |||
| 1841 | Ga0070665_100318480 | |||
| 1842 | Ga0070665_100425573 | |||
| 1843 | Ga0070704_100035963 | |||
| 1844 | Ga0070704_100051187 | |||
| 1845 | Ga0070704_100056813 | |||
| 1846 | Ga0070704_100074806 | |||
| 1847 | Ga0070704_100077506 | |||
| 1848 | Ga0068855_100007525 | |||
| 1849 | Ga0070664_100000402 | |||
| 1850 | Ga0070664_100014689 | |||
| 1851 | Ga0070664_100215100 | |||
| 1852 | Ga0068857_100010684 | |||
| 1853 | Ga0068857_100028644 | |||
| 1854 | Ga0068857_100077797 | |||
| 1855 | Ga0068857_100095592 | |||
| 1856 | Ga0068857_100125796 | |||
| 1857 | Ga0068854_100002153 | |||
| 1858 | Ga0068854_100009528 | |||
| 1859 | Ga0068856_100018569 | |||
| 1860 | Ga0068856_100029701 | |||
| 1861 | Ga0068856_100096372 | |||
| 1862 | Ga0070702_100031728 | |||
| 1863 | Ga0070702_100104153 | |||
| 1864 | Ga0070702_100150879 | |||
| 1865 | Ga0068852_100021347 | |||
| 1866 | Ga0068852_100036367 | |||
| 1867 | Ga0068852_100081232 | |||
| 1868 | Ga0068852_100220995 | |||
| 1869 | Ga0068859_100013427 | |||
| 1870 | Ga0068859_100095026 | |||
| 1871 | Ga0068859_100104974 | |||
| 1872 | Ga0068859_100116526 | |||
| 1873 | Ga0068859_100143667 | |||
| 1874 | Ga0068864_100000019 | |||
| 1875 | Ga0068864_100000038 | |||
| 1876 | Ga0068864_100022161 | |||
| 1877 | Ga0068864_100055644 | |||
| 1878 | Ga0068864_100095729 | |||
| 1879 | Ga0068866_10023473 | |||
| 1880 | Ga0068866_10030458 | |||
| 1881 | Ga0068861_100005613 | |||
| 1882 | Ga0068861_100036062 | |||
| 1883 | Ga0068861_100224450 | |||
| 1884 | Ga0068870_10044825 | |||
| 1885 | Ga0068870_10160202 | |||
| 1886 | Ga0068863_100000026 | |||
| 1887 | Ga0068863_100000104 | |||
| 1888 | Ga0068863_100023034 | |||
| 1889 | Ga0068863_100026479 | |||
| 1890 | Ga0068863_100038287 | |||
| 1891 | Ga0068863_100055667 | |||
| 1892 | Ga0068863_100078450 | |||
| 1893 | Ga0068858_100000061 | |||
| 1894 | Ga0068858_100009842 | |||
| 1895 | Ga0068858_100018641 | |||
| 1896 | Ga0068858_100293361 | |||
| 1897 | Ga0068860_100025917 | |||
| 1898 | Ga0068860_100144017 | |||
| 1899 | Ga0068860_100156066 | |||
| 1900 | Ga0068862_100000279 | |||
| 1901 | Ga0068862_100005914 | |||
| 1902 | Ga0068862_100018828 | |||
| 1903 | Ga0081455_10006019 | |||
| 1904 | Ga0081455_10010606 | |||
| 1905 | Ga0081455_10012222 | |||
| 1906 | Ga0081455_10040682 | |||
| 1907 | Ga0081455_10100803 | |||
| 1908 | Ga0081455_10205544 | |||
| 1909 | Ga0081538_10001179 | |||
| 1910 | Ga0081540_1001050 | |||
| 1911 | Ga0081540_1001110 | |||
| 1912 | Ga0081540_1002720 | |||
| 1913 | Ga0081539_10000183 | |||
| 1914 | Ga0081539_10003736 | |||
| 1915 | Ga0081539_10013047 | |||
| 1916 | Ga0081539_10155366 | |||
| 1917 | Ga0070717_10001939 | |||
| 1918 | Ga0070717_10020874 | |||
| 1919 | Ga0070717_10051249 | |||
| 1920 | Ga0070717_10058473 | |||
| 1921 | Ga0070717_10065448 | |||
| 1922 | Ga0070717_10090203 | |||
| 1923 | Ga0070717_10127910 | |||
| 1924 | Ga0070717_10145010 | |||
| 1925 | Ga0075365_10021633 | |||
| 1926 | Ga0075365_10034701 | |||
| 1927 | Ga0075365_10042756 | |||
| 1928 | Ga0075365_10047169 | |||
| 1929 | Ga0075365_10145120 | |||
| 1930 | Ga0075364_10054781 | |||
| 1931 | Ga0070715_10008016 | |||
| 1932 | Ga0070715_10022431 | |||
| 1933 | Ga0070716_100001419 | |||
| 1934 | Ga0070716_100009855 | |||
| 1935 | Ga0070716_100041749 | |||
| 1936 | Ga0070716_100134387 | |||
| 1937 | Ga0070716_100152432 | |||
| 1938 | Ga0070712_100000151 | |||
| 1939 | Ga0070712_100018301 | |||
| 1940 | Ga0070712_100077823 | |||
| 1941 | Ga0070712_100078117 | |||
| 1942 | Ga0070712_100118895 | |||
| 1943 | Ga0070712_100136035 | |||
| 1944 | Ga0097621_100056583 | |||
| 1945 | Ga0075370_10004043 | |||
| 1946 | Ga0075370_10100818 | |||
| 1947 | Ga0068871_100039518 | |||
| 1948 | Ga0068871_100092724 | |||
| 1949 | Ga0075428_100171501 | |||
| 1950 | Ga0075428_100464928 | |||
| 1951 | Ga0075428_100483770 | |||
| 1952 | Ga0075430_100045529 | |||
| 1953 | Ga0075431_100000341 | |||
| 1954 | Ga0075431_100000800 | |||
| 1955 | Ga0075431_100010582 | |||
| 1956 | Ga0075431_100207211 | |||
| 1957 | Ga0075431_100283634 | |||
| 1958 | Ga0075433_10068651 | |||
| 1959 | Ga0075434_100026312 | |||
| 1960 | Ga0075434_100050538 | |||
| 1961 | Ga0075434_100204005 | |||
| 1962 | Ga0075429_100023407 | |||
| 1963 | Ga0075436_100017334 | |||
| 1964 | Ga0075436_100043069 | |||
| 1965 | Ga0075436_100126404 | |||
| 1966 | Ga0097620_100013427 | |||
| 1967 | Ga0097620_100095023 | |||
| 1968 | Ga0097620_100104974 | |||
| 1969 | Ga0097620_100116513 | |||
| 1970 | Ga0097620_100143669 | |||
| 1971 | Ga0075435_100006251 | |||
| 1972 | Ga0075435_100016534 | |||
| 1973 | Ga0075435_100026937 | |||
| 1974 | Ga0105251_10000905 | |||
| 1975 | Ga0105251_10007705 | |||
| 1976 | Ga0105251_10019101 | |||
| 1977 | Ga0105251_10029432 | |||
| 1978 | Ga0105251_10039953 | |||
| 1979 | Ga0105244_10001754 | |||
| 1980 | Ga0105244_10005044 | |||
| 1981 | Ga0105244_10005353 | |||
| 1982 | Ga0105250_10000642 | |||
| 1983 | Ga0105250_10001851 | |||
| 1984 | Ga0105250_10016467 | |||
| 1985 | Ga0105250_10053938 | |||
| 1986 | Ga0105240_10093238 | |||
| 1987 | Ga0105240_10185438 | |||
| 1988 | Ga0105240_10203795 | |||
| 1989 | Ga0111539_10000944 | |||
| 1990 | Ga0111539_10017082 | |||
| 1991 | Ga0111539_10054923 | |||
| 1992 | Ga0111539_10086300 | |||
| 1993 | Ga0111539_10113334 | |||
| 1994 | Ga0111539_10113709 | |||
| 1995 | Ga0105245_10011337 | |||
| 1996 | Ga0105245_10036871 | |||
| 1997 | Ga0105245_10090808 | |||
| 1998 | Ga0105247_10000251 | |||
| 1999 | Ga0105247_10008026 | |||
| 2000 | Ga0105247_10019843 | |||
| 2001 | Ga0105247_10056251 | |||
| 2002 | Ga0114129_10006787 | |||
| 2003 | Ga0114129_10008886 | |||
| 2004 | Ga0114129_10018930 | |||
| 2005 | Ga0114129_10030723 | |||
| 2006 | Ga0114129_10655607 | |||
| 2007 | Ga0114129_10664763 | |||
| 2008 | Ga0105243_10000010 | |||
| 2009 | Ga0105243_10000155 | |||
| 2010 | Ga0105243_10009892 | |||
| 2011 | Ga0105243_10080826 | |||
| 2012 | Ga0105243_10095464 | |||
| 2013 | Ga0105243_10096414 | |||
| 2014 | Ga0105241_10043770 | |||
| 2015 | Ga0105241_10097509 | |||
| 2016 | Ga0105242_10028818 | |||
| 2017 | Ga0105242_10047973 | |||
| 2018 | Ga0105242_10087236 | |||
| 2019 | Ga0105242_10108327 | |||
| 2020 | Ga0105248_10000014 | |||
| 2021 | Ga0105248_10020029 | |||
| 2022 | Ga0105248_10028137 | |||
| 2023 | Ga0105248_10034717 | |||
| 2024 | Ga0105248_10085006 | |||
| 2025 | Ga0105248_10445446 | |||
| 2026 | Ga0105237_10000681 | |||
| 2027 | Ga0105237_10015085 | |||
| 2028 | Ga0105237_10017247 | |||
| 2029 | Ga0105237_10046841 | |||
| 2030 | Ga0105237_10050938 | |||
| 2031 | Ga0105237_10063603 | |||
| 2032 | Ga0105237_10077247 | |||
| 2033 | Ga0105238_10068561 | |||
| 2034 | Ga0105249_10000048 | |||
| 2035 | Ga0105249_10000305 | |||
| 2036 | Ga0105249_10001408 | |||
| 2037 | Ga0105249_10017159 | |||
| 2038 | Ga0105249_10070021 | |||
| 2039 | Ga0105249_10119965 | |||
| 2040 | Ga0105249_10134540 | |||
| 2041 | Ga0105239_10003066 | |||
| 2042 | Ga0105239_10066734 | |||
| 2043 | Ga0105239_10078462 | |||
| 2044 | Ga0105239_10174362 | |||
| 2045 | Ga0105239_10263549 | |||
| 2046 | Ga0105239_10338014 | |||
| 2047 | Ga0105246_10001817 | |||
| 2048 | Ga0105246_10009585 | |||
| 2049 | Ga0105246_10037415 | |||
| 2050 | Ga0105246_10117137 | |||
| 2051 | Ga0157373_10043419 | |||
| 2052 | Ga0157373_10057099 | |||
| 2053 | Ga0157371_10032330 | |||
| 2054 | Ga0157371_10033162 | |||
| 2055 | Ga0157371_10068432 | |||
| 2056 | Ga0157371_10107024 | |||
| 2057 | Ga0157371_10115375 | |||
| 2058 | Ga0157370_10048914 | |||
| 2059 | Ga0157370_10124500 | |||
| 2060 | Ga0157370_10157510 | |||
| 2061 | Ga0157369_10028383 | |||
| 2062 | Ga0157369_10053243 | |||
| 2063 | Ga0157369_10080438 | |||
| 2064 | Ga0157369_10110381 | |||
| 2065 | Ga0171462_1002 | |||
| 2066 | Ga0157374_10029225 | |||
| 2067 | Ga0157378_10041354 | |||
| 2068 | Ga0163162_10024165 | |||
| 2069 | Ga0163162_10056847 | |||
| 2070 | Ga0163162_10224878 | |||
| 2071 | Ga0163162_10477674 | |||
| 2072 | Ga0157375_10010788 | |||
| 2073 | Ga0157375_10048566 | |||
| 2074 | Ga0157375_10091051 | |||
| 2075 | Ga0157375_10489359 | |||
| 2076 | Ga0163163_10179161 | |||
| 2077 | Ga0163163_10325178 | |||
| 2078 | Ga0157380_10007550 | |||
| 2079 | Ga0157380_10173779 | |||
| 2080 | Ga0157380_10310741 | |||
| 2081 | Ga0182008_10002889 | |||
| 2082 | Ga0157377_10131214 | |||
| 2083 | Ga0157379_10015692 | |||
| 2084 | Ga0157379_10017157 | |||
| 2085 | Ga0157379_10244541 | |||
| 2086 | Ga0157376_10031970 | |||
| 2087 | Ga0182006_1000214 | |||
| 2088 | Ga0163161_10012381 | |||
| 2089 | Ga0163161_10042245 | |||
| 2090 | Ga0163161_10044709 | |||
| 2091 | Ga0163161_10159331 | |||
| 2092 | Ga0197907_11483172 | |||
| 2093 | Ga0206356_11001745 | |||
| 2094 | Ga0206356_11711657 | |||
| 2095 | Ga0206351_10051467 | |||
| 2096 | Ga0206354_10117409 | |||
| 2097 | Ga0206354_10807169 | |||
| 2098 | Ga0206354_11645157 | |||
| 2099 | Ga0206353_11721640 | |||
| 2100 | Ga0213873_10000130 | |||
| 2101 | Ga0213876_10000004 | |||
| 2102 | Ga0213876_10001915 | |||
| 2103 | Ga0213876_10046411 | |||
| 2104 | Ga0213875_10000174 | |||
| 2105 | Ga0213875_10001334 | |||
| 2106 | Ga0213875_10004336 | |||
| 2107 | Ga0213875_10029575 | |||
| 2108 | Ga0213875_10051292 | |||
| 2109 | Ga0224712_10011188 | |||
| 2110 | Ga0209784_100105 | |||
| 2111 | Ga0209566_100178 | |||
| 2112 | Ga0209147_100160 | |||
| 2113 | Ga0209676_1000833 | |||
| 2114 | Ga0209676_1001081 | |||
| 2115 | Ga0209025_1000107 | |||
| 2116 | Ga0209025_1000945 | |||
| 2117 | Ga0209025_1001134 | |||
| 2118 | Ga0209025_1001208 | |||
| 2119 | Ga0209025_1001403 | |||
| 2120 | Ga0209025_1001415 | |||
| 2121 | Ga0209025_1007148 | |||
| 2122 | Ga0209025_1016229 | |||
| 2123 | Ga0207696_1001447 | |||
| 2124 | Ga0207696_1002892 | |||
| 2125 | Ga0207696_1004519 | |||
| 2126 | Ga0207655_1000612 | |||
| 2127 | Ga0207655_1000947 | |||
| 2128 | Ga0207655_1001468 | |||
| 2129 | Ga0207655_1001487 | |||
| 2130 | Ga0207655_1004432 | |||
| 2131 | Ga0207655_1004629 | |||
| 2132 | Ga0207655_1025039 | |||
| 2133 | Ga0207713_1001490 | |||
| 2134 | Ga0207713_1002830 | |||
| 2135 | Ga0207713_1003575 | |||
| 2136 | Ga0207713_1003827 | |||
| 2137 | Ga0207692_10000421 | |||
| 2138 | Ga0207692_10001282 | |||
| 2139 | Ga0207692_10003061 | |||
| 2140 | Ga0207692_10005915 | |||
| 2141 | Ga0207692_10006481 | |||
| 2142 | Ga0207692_10006566 | |||
| 2143 | Ga0207692_10019402 | |||
| 2144 | Ga0207692_10062047 | |||
| 2145 | Ga0207692_10078831 | |||
| 2146 | Ga0207692_10082230 | |||
| 2147 | Ga0207642_10054531 | |||
| 2148 | Ga0207710_10000005 | |||
| 2149 | Ga0207710_10000009 | |||
| 2150 | Ga0207710_10027386 | |||
| 2151 | Ga0207688_10000991 | |||
| 2152 | Ga0207688_10006904 | |||
| 2153 | Ga0207688_10009574 | |||
| 2154 | Ga0207647_10022112 | |||
| 2155 | Ga0207647_10038435 | |||
| 2156 | Ga0207685_10004419 | |||
| 2157 | Ga0207685_10030921 | |||
| 2158 | Ga0207685_10041816 | |||
| 2159 | Ga0207685_10048846 | |||
| 2160 | Ga0207699_10000093 | |||
| 2161 | Ga0207699_10000284 | |||
| 2162 | Ga0207699_10000662 | |||
| 2163 | Ga0207699_10001582 | |||
| 2164 | Ga0207699_10005863 | |||
| 2165 | Ga0207699_10017060 | |||
| 2166 | Ga0207699_10020355 | |||
| 2167 | Ga0207699_10091957 | |||
| 2168 | Ga0207699_10094877 | |||
| 2169 | Ga0207645_10009910 | |||
| 2170 | Ga0207643_10008182 | |||
| 2171 | Ga0207643_10012512 | |||
| 2172 | Ga0207705_10146877 | |||
| 2173 | Ga0207684_10001772 | |||
| 2174 | Ga0207684_10004720 | |||
| 2175 | Ga0207684_10008252 | |||
| 2176 | Ga0207684_10009745 | |||
| 2177 | Ga0207684_10014241 | |||
| 2178 | Ga0207654_10222854 | |||
| 2179 | Ga0207707_10000103 | |||
| 2180 | Ga0207707_10091743 | |||
| 2181 | Ga0207707_10210546 | |||
| 2182 | Ga0207695_10120527 | |||
| 2183 | Ga0207695_10145102 | |||
| 2184 | Ga0207695_10296735 | |||
| 2185 | Ga0207671_10006846 | |||
| 2186 | Ga0207671_10015047 | |||
| 2187 | Ga0207671_10038462 | |||
| 2188 | Ga0207671_10052534 | |||
| 2189 | Ga0207671_10158968 | |||
| 2190 | Ga0207693_10000132 | |||
| 2191 | Ga0207693_10001324 | |||
| 2192 | Ga0207693_10003617 | |||
| 2193 | Ga0207693_10020370 | |||
| 2194 | Ga0207693_10029138 | |||
| 2195 | Ga0207693_10082483 | |||
| 2196 | Ga0207693_10191902 | |||
| 2197 | Ga0207663_10000336 | |||
| 2198 | Ga0207663_10002893 | |||
| 2199 | Ga0207663_10003266 | |||
| 2200 | Ga0207663_10007631 | |||
| 2201 | Ga0207663_10020136 | |||
| 2202 | Ga0207663_10025482 | |||
| 2203 | Ga0207663_10081312 | |||
| 2204 | Ga0207660_10000257 | |||
| 2205 | Ga0207662_10002153 | |||
| 2206 | Ga0207662_10002244 | |||
| 2207 | Ga0207662_10008170 | |||
| 2208 | Ga0207657_10006511 | |||
| 2209 | Ga0207657_10014772 | |||
| 2210 | Ga0207657_10022199 | |||
| 2211 | Ga0207657_10184560 | |||
| 2212 | Ga0207649_10080394 | |||
| 2213 | Ga0207652_10000256 | |||
| 2214 | Ga0207652_10031578 | |||
| 2215 | Ga0207652_10072673 | |||
| 2216 | Ga0207646_10000075 | |||
| 2217 | Ga0207646_10015421 | |||
| 2218 | Ga0207646_10017449 | |||
| 2219 | Ga0207646_10057499 | |||
| 2220 | Ga0207646_10080270 | |||
| 2221 | Ga0207646_10182212 | |||
| 2222 | Ga0207681_10021318 | |||
| 2223 | Ga0207650_10000116 | |||
| 2224 | Ga0207650_10052964 | |||
| 2225 | Ga0207659_10098405 | |||
| 2226 | Ga0207659_10106030 | |||
| 2227 | Ga0207687_10005129 | |||
| 2228 | Ga0207700_10000103 | |||
| 2229 | Ga0207700_10002220 | |||
| 2230 | Ga0207700_10034685 | |||
| 2231 | Ga0207700_10049537 | |||
| 2232 | Ga0207700_10060223 | |||
| 2233 | Ga0207700_10073786 | |||
| 2234 | Ga0207700_10096707 | |||
| 2235 | Ga0207700_10122798 | |||
| 2236 | Ga0207700_10154778 | |||
| 2237 | Ga0207700_10189588 | |||
| 2238 | Ga0207700_10291627 | |||
| 2239 | Ga0207664_10000533 | |||
| 2240 | Ga0207664_10000556 | |||
| 2241 | Ga0207664_10003071 | |||
| 2242 | Ga0207664_10004341 | |||
| 2243 | Ga0207664_10019976 | |||
| 2244 | Ga0207664_10028924 | |||
| 2245 | Ga0207664_10030465 | |||
| 2246 | Ga0207664_10051508 | |||
| 2247 | Ga0207664_10062833 | |||
| 2248 | Ga0207664_10177398 | |||
| 2249 | Ga0207644_10005148 | |||
| 2250 | Ga0207644_10007134 | |||
| 2251 | Ga0207644_10093215 | |||
| 2252 | Ga0207690_10040941 | |||
| 2253 | Ga0207706_10000852 | |||
| 2254 | Ga0207706_10013671 | |||
| 2255 | Ga0207706_10057206 | |||
| 2256 | Ga0207706_10074067 | |||
| 2257 | Ga0207686_10103163 | |||
| 2258 | Ga0207686_10137525 | |||
| 2259 | Ga0207709_10000001 | |||
| 2260 | Ga0207709_10105690 | |||
| 2261 | Ga0207709_10131806 | |||
| 2262 | Ga0207665_10000110 | |||
| 2263 | Ga0207665_10000836 | |||
| 2264 | Ga0207665_10003439 | |||
| 2265 | Ga0207665_10006149 | |||
| 2266 | Ga0207665_10048553 | |||
| 2267 | Ga0207665_10049003 | |||
| 2268 | Ga0207665_10113935 | |||
| 2269 | Ga0207665_10210750 | |||
| 2270 | Ga0207691_10009921 | |||
| 2271 | Ga0207691_10023464 | |||
| 2272 | Ga0207691_10025511 | |||
| 2273 | Ga0207691_10090507 | |||
| 2274 | Ga0207711_10000021 | |||
| 2275 | Ga0207711_10008827 | |||
| 2276 | Ga0207711_10018068 | |||
| 2277 | Ga0207711_10104916 | |||
| 2278 | Ga0207689_10001908 | |||
| 2279 | Ga0207689_10009281 | |||
| 2280 | Ga0207689_10015339 | |||
| 2281 | Ga0207689_10032937 | |||
| 2282 | Ga0207661_10183331 | |||
| 2283 | Ga0207679_10040889 | |||
| 2284 | Ga0207679_10190171 | |||
| 2285 | Ga0207679_10194987 | |||
| 2286 | Ga0207667_10007694 | |||
| 2287 | Ga0207667_10029360 | |||
| 2288 | Ga0207667_10050910 | |||
| 2289 | Ga0207667_10154310 | |||
| 2290 | Ga0207667_10267137 | |||
| 2291 | Ga0207712_10000148 | |||
| 2292 | Ga0207712_10001509 | |||
| 2293 | Ga0207712_10018892 | |||
| 2294 | Ga0207668_10004092 | |||
| 2295 | Ga0207668_10157608 | |||
| 2296 | Ga0207640_10002707 | |||
| 2297 | Ga0207658_10000555 | |||
| 2298 | Ga0207658_10015000 | |||
| 2299 | Ga0207658_10130302 | |||
| 2300 | Ga0207677_10013523 | |||
| 2301 | Ga0207677_10138169 | |||
| 2302 | Ga0207703_10000149 | |||
| 2303 | Ga0207703_10012392 | |||
| 2304 | Ga0207703_10183402 | |||
| 2305 | Ga0207639_10023938 | |||
| 2306 | Ga0207639_10196246 | |||
| 2307 | Ga0207678_10002509 | |||
| 2308 | Ga0207678_10008904 | |||
| 2309 | Ga0207678_10034232 | |||
| 2310 | Ga0207678_10042538 | |||
| 2311 | Ga0207678_10067322 | |||
| 2312 | Ga0207678_10319843 | |||
| 2313 | Ga0207708_10006195 | |||
| 2314 | Ga0207708_10036612 | |||
| 2315 | Ga0207708_10108336 | |||
| 2316 | Ga0207702_10024238 | |||
| 2317 | Ga0207702_10031911 | |||
| 2318 | Ga0207702_10056729 | |||
| 2319 | Ga0207641_10000005 | |||
| 2320 | Ga0207641_10000008 | |||
| 2321 | Ga0207648_10130635 | |||
| 2322 | Ga0207676_10000019 | |||
| 2323 | Ga0207676_10000049 | |||
| 2324 | Ga0207674_10003114 | |||
| 2325 | Ga0207674_10024371 | |||
| 2326 | Ga0207674_10033349 | |||
| 2327 | Ga0207674_10083656 | |||
| 2328 | Ga0207674_10092626 | |||
| 2329 | Ga0207674_10266163 | |||
| 2330 | Ga0207675_100003405 | |||
| 2331 | Ga0207675_100013383 | |||
| 2332 | Ga0207675_100114121 | |||
| 2333 | Ga0207675_100571901 | |||
| 2334 | Ga0207683_10001681 | |||
| 2335 | Ga0207683_10001732 | |||
| 2336 | Ga0207683_10093430 | |||
| 2337 | Ga0207698_10016317 | |||
| 2338 | Ga0207698_10019935 | |||
| 2339 | Ga0207698_10038915 | |||
| 2340 | Ga0209371_1000006 | |||
| 2341 | Ga0209371_1000008 | |||
| 2342 | Ga0207428_10089450 | |||
| 2343 | Ga0207428_10177711 | |||
| 2344 | Ga0207428_10260813 | |||
| 2345 | Ga0268266_10038719 | |||
| 2346 | Ga0268266_10060121 | |||
| 2347 | Ga0268265_10000165 | |||
| 2348 | Ga0268265_10112618 | |||
| 2349 | Ga0268265_10152037 | |||
| 2350 | Ga0268264_10059779 | |||
| 2351 | Ga0268264_10158808 | |||
| 2352 | Ga0268264_10230455 | |||
| 2353 | Ga0268264_10340054 | |||
| 2354 | Ga0268264_10390934 | |||
| 2355 | Ga0265319_1004182 | |||
| 2356 | Ga0265334_10057558 | |||
| 2357 | Ga0265318_10002515 | |||
| 2358 | Ga0265336_10000005 | |||
| 2359 | Ga0265336_10008838 | |||
| 2360 | Ga0265338_10000001 | |||
| 2361 | Ga0265338_10010903 | |||
| 2362 | Ga0268256_1000007 | |||
| 2363 | Ga0268256_1000009 | |||
| 2364 | Ga0265762_1006823 | |||
| 2365 | Ga0265760_10036986 | |||
| 2366 | Ga0265340_10000001 | |||
| 2367 | Ga0265339_10037585 | |||
| 2368 | Ga0265327_10048452 | |||
| 2369 | Ga0265327_10061873 | |||
| 2370 | Ga0265327_10090003 | |||
| 2371 | Ga0265316_10236769 | |||
| 2372 | Ga0307513_10007758 | |||
| 2373 | Ga0307513_10105448 | |||
| 2374 | Ga0307509_10000004 | |||
| 2375 | Ga0307408_100000387 | |||
| 2376 | Ga0307408_100271656 | |||
| 2377 | Ga0316575_10016255 | |||
| 2378 | Ga0316579_10119735 | |||
| 2379 | Ga0316576_10002159 | |||
| 2380 | Ga0316576_10004942 | |||
| 2381 | Ga0316576_10014931 | |||
| 2382 | Ga0316576_10023559 | |||
| 2383 | Ga0316576_10058201 | |||
| 2384 | Ga0316576_10220302 | |||
| 2385 | Ga0316578_10008294 | |||
| 2386 | Ga0316578_10011678 | |||
| 2387 | Ga0316578_10027510 | |||
| 2388 | Ga0316577_10005905 | |||
| 2389 | Ga0307413_10092852 | |||
| 2390 | Ga0307409_100049254 | |||
| 2391 | Ga0307409_100106607 | |||
| 2392 | Ga0307416_100237259 | |||
| 2393 | Ga0373930_0002746 | |||
| 2394 | Ga0373959_0006108 | |||
| 2395 | Ga0373959_0009144 | |||
| 2396 | Ga0373926_0009320 | |||
| 2397 | Ga0373928_0000501 | |||
| 2398 | Ga0373929_0008922 | |||
| 2399 | Ga0373934_0000074 | |||
| 2400 | Ga0373934_0004420 | |||
| 2401 | Ga0373934_0011417 | |||
| 2402 | Ga0373934_0013932 | |||
| 2403 | Ga0373934_0025762 | |||
| 2404 | Ga0373944_0002708 | |||
| 2405 | Ga0373944_0012433 | |||
| 2406 | Ga0373949_0022946 | |||
| 2407 | Ga0373951_0007038 | |||
| 2408 | Ga0373951_0031416 | |||
| 2409 | Ga0373952_0008979 | |||
| 2410 | Ga0373923_0003312 | |||
| 2411 | Ga0373923_0007133 | |||
| 2412 | Ga0373923_0067947 | |||
| 2413 | Ga0373923_0070525 | |||
| 2414 | Ga0373923_0107184 | |||
| 2415 | Ga0373932_0000217 | |||
| 2416 | Ga0373932_0003244 | |||
| 2417 | Ga0373932_0011995 | |||
| 2418 | Ga0373936_0000119 | |||
| 2419 | Ga0373936_0001254 | |||
| 2420 | Ga0373936_0003910 | |||
| 2421 | Ga0373936_0088890 | |||
| 2422 | Ga0373939_0005890 | |||
| 2423 | Ga0373941_0031976 | |||
| 2424 | Ga0373945_0000755 | |||
| 2425 | Ga0373953_0001822 | |||
| 2426 | Ga0373953_0008422 | |||
| 2427 | Ga0373953_0015121 | |||
| 2428 | Ga0373953_0056397 | |||
| 2429 | Ga0373954_0008571 | |||
| 2430 | Ga0373954_0009201 | |||
| 2431 | Ga0373954_0034572 | |||
| 2432 | Ga0373954_0054112 | |||
| 2433 | Ga0373956_0001407 | |||
| 2434 | Ga0373956_0020403 | |||
| 2435 | Ga0373957_0000056 | |||
| 2436 | Ga0373957_0002119 | |||
| 2437 | Ga0373957_0040416 | |||
| 2438 | Ga0373957_0087385 | |||
| 2439 | Ga0373960_0010364 | |||
| 2440 | Ga0373943_0008618 | |||
| 2441 | Ga0373943_0030676 | |||
| 2442 | Ga0373943_0044748 | |||
| 2443 | Ga0373943_0076988 | |||
| 2444 | Ga0373943_0098645 | |||
| 2445 | Ga0373943_0100093 | |||
| 2446 | Ga0373946_0001411 | |||
| 2447 | Ga0373955_0004271 | |||
| 2448 | Ga0373955_0013253 | |||
| 2449 | Ga0373955_0096568 | |||
| 2450 | Ga0373955_0140777 | |||
| 2451 | Ga0373942_0002905 | |||
| 2452 | Ga0373962_0025291 | |||
| 2453 | Ga0316574_0006801 | |||
| 2454 | Ga0316574_0011379 | |||
| 2455 | Ga0316574_0011947 | |||
| 2456 | Ga0316574_0035842 | |||
| 2457 | Ga0316574_0126126 | |||
| 2458 | Ga0373924_0000088 | |||
| 2459 | Ga0373924_0002191 | |||
| 2460 | Ga0373924_0003031 | |||
| 2461 | Ga0373924_0003240 | |||
| 2462 | Ga0373931_0000005 | |||
| 2463 | Ga0373931_0000027 | |||
| 2464 | Ga0373931_0002914 | |||
| 2465 | Ga0373931_0149047 | |||
| 2466 | Ga0373931_0154931 | |||
| 2467 | Ga0373935_0004208 | |||
| 2468 | Ga0373935_0009981 | |||
| 2469 | Ga0373935_0011653 | |||
| 2470 | Ga0373935_0080562 | |||
| 2471 | Ga0373927_0022062 | |||
| 2472 | Ga0373927_0248107 | |||
| 2473 | Ga0373933_0000005 | |||
| 2474 | Ga0373933_0033741 | |||
| 2475 | Ga0373933_0071890 | |||
| 2476 | Ga0373947_0000220 | |||
| 2477 | Ga0373947_0090298 | |||
| 2478 | Ga0373937_0000278 | |||
| 2479 | Ga0373937_0054255 | |||
| 2480 | Ga0373937_0079557 | |||
| 2481 | Ga0373937_0189654 | |||
| 2482 | Ga0372808_000663 | |||
| 2483 | Ga0372808_001740 | |||
| 2484 | Ga0316582_0010895 | |||
| 2485 | Ga0316582_0095040 | |||
| 2486 | Ga0316584_0003409 | |||
| 2487 | Ga0316584_0004433 | |||
| 2488 | Ga0316584_0008628 | |||
| 2489 | Ga0316584_0050522 | |||
| 2490 | Ga0316584_0102651 | |||
| 2491 | Ga0373925_0041858 | |||
| 2492 | Ga0373925_0055558 | |||
| 2493 | Ga0436364_0033704 | |||
| 2494 | Ga0436364_0509088 | |||
| 2495 | Ga0436364_0604875 | |||
| 2496 | Ga0436364_0676163 | |||
| 2497 | Ga0436364_0757834 | |||
| 2498 | Ga0436364_0786042 | |||
| 2499 | Ga0436364_0802940 | |||
| 2500 | Ga0436364_1227141 | |||
| 2501 | Ga0436364_1456387 | |||
| 2502 | Ga0436364_1464045 | |||
| 2503 | Ga0395901_0060605 | |||
| 2504 | Ga0400485_02355 | |||
| 2505 | Ga0400483_058289 | |||
| 2506 | Ga0400483_215395 | |||
| 2507 | Ga0400483_232124 | |||
| 2508 | Ga0400483_245537 | |||
| 2509 | Ga0237816_01881 | |||
| 2510 | Ga0436365_0012902 | |||
| 2511 | Ga0436365_0075484 | |||
| 2512 | Ga0436365_0758715 | |||
| 2513 | Ga0436365_1202098 | |||
| 2514 | Ga0436361_0374946 | |||
| 2515 | Ga0436361_1186958 | |||
| 2516 | Ga0436362_0035386 | |||
| 2517 | Ga0436362_0131109 | |||
| 2518 | Ga0439447_043708 | |||
| 2519 | Ga0439466_0021474 | |||
| 2520 | Ga0439465_0053120 | |||
| 2521 | Ga0451791_1300260 | |||
| 2522 | Ga0451843_0067489 | |||
| 2523 | Ga0451843_1574986 | |||
| 2524 | Ga0439445_0031973 | |||
| 2525 | Ga0439432_032374 | |||
| 2526 | Ga0439449_0001300 | |||
| 2527 | Ga0439450_014046 | |||
| 2528 | Ga0439452_019347 | |||
| 2529 | Ga0439457_022828 | |||
| 2530 | Ga0439440_0002061 | |||
| 2531 | Ga0466969_0002027 | |||
| 2532 | Ga0466969_0016901 | |||
| 2533 | Ga0466972_0002652 | |||
| 2534 | Ga0466965_0000829 | |||
| 2535 | Ga0466965_0003566 | |||
| 2536 | Ga0466966_0011220 | |||
| 2537 | Ga0466966_0023668 | |||
| 2538 | Ga0466966_0068845 | |||
| 2539 | Ga0466961_0018481 | |||
| 2540 | Ga0466963_0005494 | |||
| 2541 | Ga0466963_0015101 | |||
| 2542 | Ga0466963_0027405 | |||
| 2543 | Ga0466963_0039987 | |||
| 2544 | Ga0466963_0052033 | |||
| 2545 | Ga0466963_0105466 | |||
| 2546 | Ga0466963_0134633 | |||
| 2547 | Ga0466964_0029818 | |||
| 2548 | Ga0466971_0092278 | |||
| 2549 | Ga0466968_0002914 | |||
| 2550 | Ga0466968_0035557 | |||
| 2551 | Ga0466970_0054126 | |||
| 2552 | Ga0466957_0007518 | |||
| 2553 | Ga0466957_0157063 | |||
| 2554 | Ga0466959_0017904 | |||
| 2555 | Ga0466959_0124003 | |||
| 2556 | Ga0466958_0185212 | |||
| 2557 | Ga0466967_0012564 | |||
| 2558 | Ga0466967_0019489 | |||
| 2559 | Ga0466967_0024982 | |||
| 2560 | Ga0466967_0089070 | |||
| 2561 | Ga0466967_0089880 | |||
| 2562 | Ga0466967_0111096 | |||
| 2563 | Ga0466967_0621354 | |||
| 2564 | Ga0495627_000110 | |||
| 2565 | Ga0495592_0000010 | |||
| 2566 | Ga0495592_0006585 | |||
| 2567 | Ga0495592_0012104 | |||
| 2568 | Ga0495592_0027319 | |||
| 2569 | Ga0495592_0043975 | |||
| 2570 | Ga0495592_0052562 | |||
| 2571 | Ga0495592_0137810 | |||
| 2572 | Ga0495603_0003396 | |||
| 2573 | Ga0495603_0018742 | |||
| 2574 | Ga0495629_0003600 | |||
| 2575 | Ga0495629_0004898 | |||
| 2576 | Ga0495629_0012270 | |||
| 2577 | Ga0495641_0004957 | |||
| 2578 | Ga0495641_0008522 | |||
| 2579 | Ga0495641_0013408 | |||
| 2580 | Ga0495641_0040339 | |||
| 2581 | Ga0495641_0064342 | |||
| 2582 | Ga0495651_0000006 | |||
| 2583 | Ga0495651_0006392 | |||
| 2584 | Ga0495651_0016070 | |||
| 2585 | Ga0495651_0017225 | |||
| 2586 | Ga0495651_0031182 | |||
| 2587 | Ga0495651_0035502 | |||
| 2588 | Ga0495651_0053979 | |||
| 2589 | Ga0495651_0106132 | |||
| 2590 | Ga0495653_0016641 | |||
| 2591 | Ga0495653_0028100 | |||
| 2592 | Ga0495653_0041667 | |||
| 2593 | Ga0495653_0059979 | |||
| 2594 | Ga0495653_0062265 | |||
| 2595 | Ga0495653_0064751 | |||
| 2596 | Ga0495653_0076719 | |||
| 2597 | Ga0495653_0088750 | |||
| 2598 | Ga0495653_0108270 | |||
| 2599 | Ga0495653_0121353 | |||
| 2600 | Ga0495580_0011635 | |||
| 2601 | Ga0495580_0081125 | |||
| 2602 | Ga0495580_0101173 | |||
| 2603 | Ga0495580_0101941 | |||
| 2604 | Ga0495582_0002548 | |||
| 2605 | Ga0495582_0003759 | |||
| 2606 | Ga0495582_0143380 | |||
| 2607 | Ga0495639_0016401 | |||
| 2608 | Ga0495662_0000649 | |||
| 2609 | Ga0495662_0001170 | |||
| 2610 | Ga0495662_0003177 | |||
| 2611 | Ga0495662_0009850 | |||
| 2612 | Ga0495662_0015376 | |||
| 2613 | Ga0495664_0044348 | |||
| 2614 | Ga0495664_0069108 | |||
| 2615 | Ga0495594_0013981 | |||
| 2616 | Ga0495607_0086639 | |||
| 2617 | Ga0495607_0103113 | |||
| 2618 | Ga0495608_0000243 | |||
| 2619 | Ga0495608_0000955 | |||
| 2620 | Ga0495608_0012153 | |||
| 2621 | Ga0495608_0013781 | |||
| 2622 | Ga0495608_0047023 | |||
| 2623 | Ga0495608_0062595 | |||
| 2624 | Ga0495608_0071773 | |||
| 2625 | Ga0495608_0109376 | |||
| 2626 | Ga0495608_0132923 | |||
| 2627 | Ga0495610_0000013 | |||
| 2628 | Ga0495616_0000032 | |||
| 2629 | Ga0495618_0001036 | |||
| 2630 | Ga0495618_0040927 | |||
| 2631 | Ga0495618_0065699 | |||
| 2632 | Ga0495620_0006077 | |||
| 2633 | Ga0495628_0000566 | |||
| 2634 | Ga0495628_0009608 | |||
| 2635 | Ga0495628_0010807 | |||
| 2636 | Ga0495628_0162672 | |||
| 2637 | Ga0495628_0176461 | |||
| 2638 | Ga0495630_0006721 | |||
| 2639 | Ga0495630_0034365 | |||
| 2640 | Ga0495630_0047622 | |||
| 2641 | Ga0495630_0048699 | |||
| 2642 | Ga0495630_0078485 | |||
| 2643 | Ga0495630_0183914 | |||
| 2644 | Ga0495630_0202682 | |||
| 2645 | Ga0495643_0094826 | |||
| 2646 | Ga0495663_0000041 | |||
| 2647 | Ga0495663_0012611 | |||
| 2648 | Ga0495666_0015344 | |||
| 2649 | Ga0495666_0051407 | |||
| 2650 | Ga0495666_0079308 | |||
| 2651 | Ga0495652_0000415 | |||
| 2652 | Ga0495652_0003238 | |||
| 2653 | Ga0495652_0014498 | |||
| 2654 | Ga0495652_0017823 | |||
| 2655 | Ga0495652_0032816 | |||
| 2656 | Ga0495652_0131791 | |||
| 2657 | Ga0495665_0003630 | |||
| 2658 | Ga0495665_0032011 | |||
| 2659 | Ga0495640_0014491 | |||
| 2660 | Ga0495640_0021723 | |||
| 2661 | Ga0495640_0027072 | |||
| 2662 | Ga0495640_0050138 | |||
| 2663 | Ga0495640_0098754 | |||
| 2664 | Ga0495586_0001504 | |||
| 2665 | Ga0495586_0009784 | |||
| 2666 | Ga0495586_0053888 | |||
| 2667 | Ga0495587_0000049 | |||
| 2668 | Ga0495587_0011091 | |||
| 2669 | Ga0495587_0059565 | |||
| 2670 | Ga0495587_0072640 | |||
| 2671 | Ga0495645_0007547 | |||
| 2672 | Ga0495645_0026918 | |||
| 2673 | Ga0495645_0048487 | |||
| 2674 | Ga0495645_0057004 | |||
| 2675 | Ga0495645_0079474 | |||
| 2676 | Ga0495645_0098882 | |||
| 2677 | Ga0495667_0000041 | |||
| 2678 | Ga0495667_0001387 | |||
| 2679 | Ga0495667_0005665 | |||
| 2680 | Ga0495667_0006595 | |||
| 2681 | Ga0495667_0020456 | |||
| 2682 | Ga0495667_0095863 | |||
| 2683 | Ga0495667_0102530 | |||
| 2684 | Ga0495668_0007996 | |||
| 2685 | Ga0495634_0003643 | |||
| 2686 | Ga0495634_0018131 | |||
| 2687 | Ga0495634_0077598 | |||
| 2688 | Ga0495634_0202145 | |||
| 2689 | Ga0495625_0000911 | |||
| 2690 | Ga0495625_0076269 | |||
| 2691 | Ga0495635_0006189 | |||
| 2692 | Ga0495635_0008669 | |||
| 2693 | Ga0495635_0012396 | |||
| 2694 | Ga0495635_0057977 | |||
| 2695 | Ga0495635_0059571 | |||
| 2696 | Ga0495661_0149716 | |||
| 2697 | Ga0495657_0000126 | |||
| 2698 | Ga0495657_0001156 | |||
| 2699 | Ga0495657_0001976 | |||
| 2700 | Ga0495657_0008646 | |||
| 2701 | Ga0495657_0026456 | |||
| 2702 | Ga0495657_0042552 | |||
| 2703 | Ga0495657_0051433 | |||
| 2704 | Ga0495657_0078154 | |||
| 2705 | Ga0495657_0096449 | |||
| 2706 | Ga0495599_0000208 | |||
| 2707 | Ga0495599_0001775 | |||
| 2708 | Ga0495599_0018711 | |||
| 2709 | Ga0495599_0018766 | |||
| 2710 | Ga0495599_0038666 | |||
| 2711 | Ga0495599_0049461 | |||
| 2712 | Ga0495599_0108324 | |||
| 2713 | Ga0495599_0148868 | |||
| 2714 | Ga0495623_0000080 | |||
| 2715 | Ga0495623_0031511 | |||
| 2716 | Ga0495623_0067957 | |||
| 2717 | Ga0495623_0070471 | |||
| 2718 | Ga0495623_0076412 | |||
| 2719 | Ga0495646_0010008 | |||
| 2720 | Ga0495646_0065778 | |||
| 2721 | Ga0495646_0093322 | |||
| 2722 | Ga0495647_0001573 | |||
| 2723 | Ga0495647_0015118 | |||
| 2724 | Ga0495647_0032207 | |||
| 2725 | Ga0495658_0005908 | |||
| 2726 | Ga0495658_0015267 | |||
| 2727 | Ga0495658_0211687 | |||
| 2728 | Ga0495669_0005687 | |||
| 2729 | Ga0495613_0000845 | |||
| 2730 | Ga0495613_0004976 | |||
| 2731 | Ga0495613_0107782 | |||
| 2732 | Ga0495613_0125773 | |||
| 2733 | Ga0495624_0021883 | |||
| 2734 | Ga0495624_0056784 | |||
| 2735 | Ga0495624_0090776 | |||
| 2736 | Ga0495671_0000862 | |||
| 2737 | Ga0495589_0010318 | |||
| 2738 | Ga0495589_0018316 | |||
| 2739 | Ga0495600_0002375 | |||
| 2740 | Ga0495600_0007334 | |||
| 2741 | Ga0495600_0007516 | |||
| 2742 | Ga0495600_0037708 | |||
| 2743 | Ga0495600_0064147 | |||
| 2744 | Ga0495600_0106200 | |||
| 2745 | Ga0495600_0184292 | |||
| 2746 | Ga0495581_0000351 | |||
| 2747 | Ga0495581_0000521 | |||
| 2748 | Ga0495581_0005105 | |||
| 2749 | Ga0495581_0036056 | |||
| 2750 | Ga0495604_0000110 | |||
| 2751 | Ga0495604_0011376 | |||
| 2752 | Ga0495604_0016743 | |||
| 2753 | Ga0495604_0017187 | |||
| 2754 | Ga0495604_0023947 | |||
| 2755 | Ga0495604_0116430 | |||
| 2756 | Ga0495674_0018851 | |||
| 2757 | Ga0495674_0034272 | |||
| 2758 | Ga0495674_0113178 | |||
| 2759 | Ga0495674_0218663 | |||
| 2760 | Ga0495672_0000459 | |||
| 2761 | Ga0495676_0023169 | |||
| 2762 | Ga0495676_0026844 | |||
| 2763 | Ga0495676_0039795 | |||
| 2764 | Ga0495676_0133979 | |||
| 2765 | Ga0495680_0000470 | |||
| 2766 | Ga0495680_0016062 | |||
| 2767 | Ga0495680_0018088 | |||
| 2768 | Ga0495680_0054190 | |||
| 2769 | Ga0495680_0054251 | |||
| 2770 | Ga0495680_0132445 | |||
| 2771 | Ga0495680_0140073 | |||
| 2772 | Ga0495680_0154501 | |||
| 2773 | Ga0495680_0172957 | |||
| 2774 | Ga0495675_0001308 | |||
| 2775 | Ga0495675_0012268 | |||
| 2776 | Ga0495675_0012301 | |||
| 2777 | Ga0495675_0045652 | |||
| 2778 | Ga0495685_009173 | |||
| 2779 | Ga0495685_018896 | |||
| 2780 | Ga0495684_0007979 | |||
| 2781 | Ga0495684_0015817 | |||
| 2782 | Ga0495684_0016585 | |||
| 2783 | Ga0495684_0044762 | |||
| 2784 | Ga0495684_0081883 | |||
| 2785 | Ga0495684_0116175 | |||
| 2786 | Ga0495684_0176765 | |||
| 2787 | Ga0495593_0002534 | |||
| 2788 | Ga0495593_0008687 | |||
| 2789 | Ga0495593_0012098 | |||
| 2790 | Ga0495602_0000345 | |||
| 2791 | Ga0495602_0017183 | |||
| 2792 | Ga0495602_0049716 | |||
| 2793 | Ga0495602_0116355 | |||
| 2794 | Ga0495602_0286427 | |||
| 2795 | Ga0496100_0011379 | |||
| 2796 | Ga0496100_0034446 | |||
| 2797 | Ga0496100_0044118 | |||
| 2798 | Ga0496101_0011569 | |||
| 2799 | Ga0496101_0029917 | |||
| 2800 | Ga0496101_0061222 | |||
| 2801 | Ga0496101_0072304 | |||
| 2802 | Ga0496102_0000121 | |||
| 2803 | Ga0496102_0017751 | |||
| 2804 | Ga0496102_0018389 | |||
| 2805 | Ga0496102_0032155 | |||
| 2806 | Ga0496102_0107091 | |||
| 2807 | Ga0496102_0191357 | |||
| 2808 | Ga0496103_0000224 | |||
| 2809 | Ga0496103_0005303 | |||
| 2810 | Ga0496103_0025461 | |||
| 2811 | Ga0496103_0039407 | |||
| 2812 | Ga0496103_0133196 | |||
| 2813 | Ga0496103_0145545 | |||
| 2814 | Ga0496104_0004532 | |||
| 2815 | Ga0496104_0006922 | |||
| 2816 | Ga0496104_0007859 | |||
| 2817 | Ga0496104_0011347 | |||
| 2818 | Ga0496104_0016014 | |||
| 2819 | Ga0496104_0033156 | |||
| 2820 | Ga0496104_0077574 | |||
| 2821 | Ga0496105_0007753 | |||
| 2822 | Ga0496105_0025217 | |||
| 2823 | Ga0496105_0031764 | |||
| 2824 | Ga0496105_0044914 | |||
| 2825 | Ga0496105_0055772 | |||
| 2826 | Ga0496105_0091186 | |||
| 2827 | Ga0496105_0177619 | |||
| 2828 | Ga0496106_0051571 | |||
| 2829 | Ga0496106_0080505 | |||
| 2830 | Ga0496106_0106791 | |||
| 2831 | Ga0496106_0171546 | |||
| 2832 | Ga0496107_0012475 | |||
| 2833 | Ga0496107_0023821 | |||
| 2834 | Ga0496107_0039362 | |||
| 2835 | Ga0496108_0013234 | |||
| 2836 | Ga0496108_0015337 | |||
| 2837 | Ga0496108_0023390 | |||
| 2838 | Ga0496108_0239178 | |||
| 2839 | Ga0496109_0010382 | |||
| 2840 | Ga0496109_0017894 | |||
| 2841 | Ga0496109_0031113 | |||
| 2842 | Ga0496109_0048341 | |||
| 2843 | Ga0496109_0107561 | |||
| 2844 | Ga0496110_0000640 | |||
| 2845 | Ga0496110_0003291 | |||
| 2846 | Ga0496110_0010185 | |||
| 2847 | Ga0496110_0011073 | |||
| 2848 | Ga0496110_0014565 | |||
| 2849 | Ga0496110_0061335 | |||
| 2850 | Ga0496110_0077614 | |||
| 2851 | Ga0496110_0284975 | |||
| 2852 | Ga0496110_0325162 | |||
| 2853 | Ga0496110_0352531 | |||
| 2854 | Ga0496111_0010632 | |||
| 2855 | Ga0496111_0033772 | |||
| 2856 | Ga0496111_0050523 | |||
| 2857 | Ga0496111_0073792 | |||
| 2858 | Ga0496111_0114534 | |||
| 2859 | Ga0496111_0115037 | |||
| 2860 | Ga0496112_0002361 | |||
| 2861 | Ga0496112_0027178 | |||
| 2862 | Ga0496112_0068395 | |||
| 2863 | Ga0496112_0143814 | |||
| 2864 | Ga0496112_0170150 | |||
| 2865 | Ga0496113_0026225 | |||
| 2866 | Ga0496113_0115992 | |||
| 2867 | Ga0496113_0184209 | |||
| 2868 | Ga0496114_0000840 | |||
| 2869 | Ga0496114_0001257 | |||
| 2870 | Ga0496114_0002103 | |||
| 2871 | Ga0496114_0009000 | |||
| 2872 | Ga0496114_0019711 | |||
| 2873 | Ga0496114_0062677 | |||
| 2874 | Ga0496114_0093864 | |||
| 2875 | Ga0496114_0129640 | |||
| 2876 | Ga0496114_0148994 | |||
| 2877 | Ga0496114_0239133 | |||
| 2878 | Ga0496114_0245293 | |||
| 2879 | Ga0496114_0334493 | |||
| 2880 | Ga0496115_0016938 | |||
| 2881 | Ga0496115_0024948 | |||
| 2882 | Ga0496115_0034855 | |||
| 2883 | Ga0496115_0049785 | |||
| 2884 | Ga0496115_0051318 | |||
| 2885 | Ga0496115_0087035 | |||
| 2886 | Ga0496115_0088232 | |||
| 2887 | Ga0496115_0125518 | |||
| 2888 | Ga0496115_0169186 | |||
| 2889 | Ga0496116_0001687 | |||
| 2890 | Ga0496116_0002425 | |||
| 2891 | Ga0496117_0022116 | |||
| 2892 | Ga0496117_0045443 | |||
| 2893 | Ga0496118_0000322 | |||
| 2894 | Ga0496118_0000462 | |||
| 2895 | Ga0496118_0031380 | |||
| 2896 | Ga0496118_0044709 | |||
| 2897 | Ga0496118_0172570 | |||
| 2898 | Ga0496119_0000104 | |||
| 2899 | Ga0496120_0002351 | |||
| 2900 | Ga0496121_0006448 | |||
| 2901 | Ga0496121_0009278 | |||
| 2902 | Ga0496121_0028527 | |||
| 2903 | Ga0496121_0111659 | |||
| 2904 | Ga0496121_0134614 | |||
| 2905 | Ga0496121_0297850 | |||
| 2906 | Ga0496123_0002402 | |||
| 2907 | Ga0496124_0000459 | |||
| 2908 | Ga0496125_0030253 | |||
| 2909 | Ga0496125_0053137 | |||
| 2910 | Ga0496126_0000037 | |||
| 2911 | Ga0496126_0000999 | |||
| 2912 | Ga0496126_0004694 | |||
| 2913 | Ga0496126_0005936 | |||
| 2914 | Ga0496126_0075454 | |||
| 2915 | Ga0496126_0231817 | |||
| 2916 | Ga0501294_005152 | |||
| 2917 | Ga0501031_0000485 | |||
| 2918 | Ga0501031_0022708 | |||
| 2919 | Ga0501031_0163834 | |||
| 2920 | Ga0501032_0000424 | |||
| 2921 | Ga0501032_0008084 | |||
| 2922 | Ga0501033_0016983 | |||
| 2923 | Ga0501033_0061288 | |||
| 2924 | Ga0501033_0066414 | |||
| 2925 | Ga0501033_0170713 | |||
| 2926 | Ga0501034_0000339 | |||
| 2927 | Ga0501034_0011396 | |||
| 2928 | Ga0501034_0026673 | |||
| 2929 | Ga0501034_0027747 | |||
| 2930 | Ga0501034_0029476 | |||
| 2931 | Ga0501034_0116918 | |||
| 2932 | Ga0501034_0120428 | |||
| 2933 | Ga0501034_0168887 | |||
| 2934 | Ga0501034_0198045 | |||
| 2935 | Ga0501036_0005274 | |||
| 2936 | Ga0501036_0026339 | |||
| 2937 | Ga0501036_0108991 | |||
| 2938 | Ga0501036_0124055 | |||
| 2939 | Ga0501037_0003342 | |||
| 2940 | Ga0501037_0043187 | |||
| 2941 | Ga0501037_0049439 | |||
| 2942 | Ga0501037_0050557 | |||
| 2943 | Ga0501038_0007562 | |||
| 2944 | Ga0501038_0021944 | |||
| 2945 | Ga0501038_0028260 | |||
| 2946 | Ga0501038_0035688 | |||
| 2947 | Ga0501038_0104806 | |||
| 2948 | Ga0501038_0127699 | |||
| 2949 | Ga0501038_0161269 | |||
| 2950 | Ga0501038_0253855 | |||
| 2951 | Ga0501039_0000966 | |||
| 2952 | Ga0501039_0001751 | |||
| 2953 | Ga0501039_0016350 | |||
| 2954 | Ga0501039_0025475 | |||
| 2955 | Ga0501039_0028102 | |||
| 2956 | Ga0501039_0096987 | |||
| 2957 | Ga0501039_0318269 | |||
| 2958 | Ga0501040_0000581 | |||
| 2959 | Ga0501040_0002936 | |||
| 2960 | Ga0501040_0003290 | |||
| 2961 | Ga0501040_0010682 | |||
| 2962 | Ga0501040_0017049 | |||
| 2963 | Ga0501040_0029162 | |||
| 2964 | Ga0501041_0009664 | |||
| 2965 | Ga0501041_0012306 | |||
| 2966 | Ga0501041_0039741 | |||
| 2967 | Ga0501041_0052236 | |||
| 2968 | Ga0501041_0132853 | |||
| 2969 | Ga0501041_0164675 | |||
| 2970 | Ga0501042_0001049 | |||
| 2971 | Ga0501042_0004432 | |||
| 2972 | Ga0501042_0005589 | |||
| 2973 | Ga0501042_0006659 | |||
| 2974 | Ga0501042_0010012 | |||
| 2975 | Ga0501042_0019346 | |||
| 2976 | Ga0501042_0028106 | |||
| 2977 | Ga0501042_0053785 | |||
| 2978 | Ga0501042_0101067 | |||
| 2979 | Ga0501042_0154025 | |||
| 2980 | Ga0501043_0012258 | |||
| 2981 | Ga0501043_0019067 | |||
| 2982 | Ga0501046_0005483 | |||
| 2983 | Ga0501046_0008010 | |||
| 2984 | Ga0501046_0017525 | |||
| 2985 | Ga0501046_0028814 | |||
| 2986 | Ga0501046_0031002 | |||
| 2987 | Ga0501046_0078648 | |||
| 2988 | Ga0501047_0000601 | |||
| 2989 | Ga0501047_0001963 | |||
| 2990 | Ga0501047_0003093 | |||
| 2991 | Ga0501047_0037282 | |||
| 2992 | Ga0501047_0096977 | |||
| 2993 | Ga0501047_0133398 | |||
| 2994 | Ga0501047_0217953 | |||
| 2995 | Ga0501048_0001137 | |||
| 2996 | Ga0501048_0016878 | |||
| 2997 | Ga0501048_0023764 | |||
| 2998 | Ga0501048_0029364 | |||
| 2999 | Ga0501048_0037709 | |||
| 3000 | Ga0501048_0074323 | |||
| 3001 | Ga0501048_0075556 | |||
| 3002 | Ga0501048_0082044 | |||
| 3003 | Ga0501067_0029205 | |||
| 3004 | Ga0501068_0025615 | |||
| 3005 | Ga0501068_0050086 | |||
| 3006 | Ga0501068_0054389 | |||
| 3007 | Ga0501068_0167417 | |||
| 3008 | Ga0501069_0000089 | |||
| 3009 | Ga0501069_0005202 | |||
| 3010 | Ga0501069_0008959 | |||
| 3011 | Ga0501069_0116590 | |||
| 3012 | Ga0501070_0000008 | |||
| 3013 | Ga0501070_0001203 | |||
| 3014 | Ga0501070_0017196 | |||
| 3015 | Ga0501070_0054912 | |||
| 3016 | Ga0501070_0065034 | |||
| 3017 | Ga0501070_0189953 | |||
| 3018 | Ga0501071_0001866 | |||
| 3019 | Ga0501071_0003038 | |||
| 3020 | Ga0501071_0003173 | |||
| 3021 | Ga0501071_0007247 | |||
| 3022 | Ga0501071_0020290 | |||
| 3023 | Ga0501071_0065614 | |||
| 3024 | Ga0501072_0001968 | |||
| 3025 | Ga0501072_0002597 | |||
| 3026 | Ga0501072_0007326 | |||
| 3027 | Ga0501072_0009139 | |||
| 3028 | Ga0501072_0018044 | |||
| 3029 | Ga0501072_0022975 | |||
| 3030 | Ga0501072_0025611 | |||
| 3031 | Ga0501072_0056152 | |||
| 3032 | Ga0501072_0096587 | |||
| 3033 | Ga0501072_0125836 | |||
| 3034 | Ga0501072_0161244 | |||
| 3035 | Ga0501074_0022034 | |||
| 3036 | Ga0501074_0038358 | |||
| 3037 | Ga0501074_0102731 | |||
| 3038 | Ga0501075_0000895 | |||
| 3039 | Ga0501075_0002183 | |||
| 3040 | Ga0501075_0006676 | |||
| 3041 | Ga0501075_0013675 | |||
| 3042 | Ga0501075_0022349 | |||
| 3043 | Ga0501075_0148205 | |||
| 3044 | Ga0501075_0174122 | |||
| 3045 | Ga0501076_0001798 | |||
| 3046 | Ga0501076_0002273 | |||
| 3047 | Ga0501076_0002738 | |||
| 3048 | Ga0501076_0004824 | |||
| 3049 | Ga0501076_0045646 | |||
| 3050 | Ga0501076_0076524 | |||
| 3051 | Ga0501076_0078451 | |||
| 3052 | Ga0501076_0104808 | |||
| 3053 | Ga0501076_0120304 | |||
| 3054 | Ga0501076_0202792 | |||
| 3055 | Ga0501077_0003196 | |||
| 3056 | Ga0501077_0005440 | |||
| 3057 | Ga0501077_0025113 | |||
| 3058 | Ga0501077_0033857 | |||
| 3059 | Ga0501077_0205902 | |||
| 3060 | Ga0501198_004370 | |||
| 3061 | Ga0501217_005828 | |||
| 3062 | Ga0501235_023528 | |||
| 3063 | Ga0501249_000117 | |||
| 3064 | Ga0501079_0004718 | |||
| 3065 | Ga0501079_0008561 | |||
| 3066 | Ga0501079_0009798 | |||
| 3067 | Ga0501079_0106805 | |||
| 3068 | Ga0501079_0129740 | |||
| 3069 | Ga0501079_0189018 | |||
| 3070 | Ga0501080_0012185 | |||
| 3071 | Ga0501080_0018696 | |||
| 3072 | Ga0501080_0074250 | |||
| 3073 | Ga0501080_0092571 | |||
| 3074 | Ga0501080_0107899 | |||
| 3075 | Ga0501080_0146369 | |||
| 3076 | Ga0501080_0347985 | |||
| 3077 | Ga0501081_0005016 | |||
| 3078 | Ga0501081_0008789 | |||
| 3079 | Ga0501081_0027685 | |||
| 3080 | Ga0501081_0027709 | |||
| 3081 | Ga0501081_0030670 | |||
| 3082 | Ga0501081_0234164 | |||
| 3083 | Ga0501081_0251147 | |||
| 3084 | Ga0501083_0000408 | |||
| 3085 | Ga0501083_0009305 | |||
| 3086 | Ga0501083_0019807 | |||
| 3087 | Ga0501281_00002 | |||
| 3088 | Ga0501035_0004302 | |||
| 3089 | Ga0501035_0010123 | |||
| 3090 | Ga0501035_0018495 | |||
| 3091 | Ga0501035_0026910 | |||
| 3092 | Ga0501035_0060451 | |||
| 3093 | Ga0501035_0069525 | |||
| 3094 | Ga0501035_0078324 | |||
| 3095 | Ga0501035_0130017 | |||
| 3096 | Ga0501035_0155576 | |||
| 3097 | Ga0501044_0001813 | |||
| 3098 | Ga0501044_0008299 | |||
| 3099 | Ga0501044_0010153 | |||
| 3100 | Ga0501044_0012648 | |||
| 3101 | Ga0501044_0016106 | |||
| 3102 | Ga0501044_0378393 | |||
| 3103 | Ga0501045_0000725 | |||
| 3104 | Ga0501045_0003204 | |||
| 3105 | Ga0501045_0003364 | |||
| 3106 | Ga0501045_0013023 | |||
| 3107 | Ga0501045_0025509 | |||
| 3108 | Ga0501045_0066501 | |||
| 3109 | Ga0501045_0078470 | |||
| 3110 | Ga0501045_0171973 | |||
| 3111 | Ga0501204_000446 | |||
| 3112 | nmdc:mga03n38_97111_c1 | |||
| 3113 | nmdc:mga0yw44_117309_c1 | |||
| 3114 | nmdc:mga0yw44_1691_c1 | |||
| 3115 | nmdc:mga0yw44_2005_c1 | |||
| 3116 | nmdc:mga0yw44_2625_c1 | |||
| 3117 | nmdc:mga0yw44_33385_c1 | |||
| 3118 | nmdc:mga0yw44_48520_c1 | |||
| 3119 | nmdc:mga07m45_6297_c1 | |||
| 3120 | nmdc:mga05p37_213038_c1 | |||
| 3121 | nmdc:mga05p37_2208_c1 | |||
| 3122 | nmdc:mga05p37_30113_c1 | |||
| 3123 | nmdc:mga05p37_47073_c1 | |||
| 3124 | nmdc:mga09592_135167_c1 | |||
| 3125 | nmdc:mga09592_33032_c1 | |||
| 3126 | nmdc:mga0qj67_181720_c1 | |||
| 3127 | nmdc:mga0qj67_20395_c1 | |||
| 3128 | nmdc:mga0qj67_66004_c1 | |||
| 3129 | nmdc:mga0qj67_8448_c1 | |||
| 3130 | nmdc:mga06r32_107748_c1 | |||
| 3131 | nmdc:mga06r32_12374_c1 | |||
| 3132 | nmdc:mga06r32_158411_c1 | |||
| 3133 | nmdc:mga06r32_30013_c1 | |||
| 3134 | nmdc:mga08y16_155061_c1 | |||
| 3135 | nmdc:mga08y16_169045_c1 | |||
| 3136 | nmdc:mga08y16_451430_c1 | |||
| 3137 | nmdc:mga08y16_49670_c1 | |||
| 3138 | nmdc:mga08y16_72585_c1 | |||
| 3139 | nmdc:mga0n895_15173_c1 | |||
| 3140 | nmdc:mga0n895_196045_c1 | |||
| 3141 | nmdc:mga0n895_235323_c1 | |||
| 3142 | nmdc:mga0n895_3276_c1 | |||
| 3143 | nmdc:mga0rr50_125550_c1 | |||
| 3144 | nmdc:mga0rr50_23084_c1 | |||
| 3145 | nmdc:mga0rr50_335318_c1 | |||
| 3146 | nmdc:mga0rr50_62699_c1 | |||
| 3147 | nmdc:mga0rr50_92352_c1 | |||
| 3148 | nmdc:mga08x19_223708_c1 | |||
| 3149 | nmdc:mga08x19_264524_c1 | |||
| 3150 | nmdc:mga08x19_4090_c1 | |||
| 3151 | nmdc:mga08x19_4_c1 | |||
| 3152 | nmdc:mga0a205_116864_c1 | |||
| 3153 | nmdc:mga0a205_258698_c1 | |||
| 3154 | Ga0495601_0004240 | |||
| 3155 | Ga0495601_0020581 | |||
| 3156 | Ga0495601_0026317 | |||
| 3157 | Ga0495601_0043337 | |||
| 3158 | Ga0495601_0104454 | |||
| 3159 | Ga0495612_0003194 | |||
| 3160 | Ga0495612_0017040 | |||
| 3161 | Ga0495612_0052197 | |||
| 3162 | Ga0500610_0000152 | |||
| 3163 | Ga0495595_0000800 | |||
| 3164 | Ga0495595_0018875 | |||
| 3165 | Ga0495595_0024185 | |||
| 3166 | Ga0495595_0062865 | |||
| 3167 | Ga0495595_0096053 | |||
| 3168 | Ga0495619_0005129 | |||
| 3169 | Ga0495619_0008855 | |||
| 3170 | Ga0495619_0016896 | |||
| 3171 | Ga0495619_0158383 | |||
| 3172 | Ga0500643_000188 | |||
| 3173 | Ga0500641_0065901 | |||
| 3174 | Ga0500650_0000017 | |||
| 3175 | Ga0500593_000100 | |||
| 3176 | Ga0500593_014489 | |||
| 3177 | Ga0500658_0000047 | |||
| 3178 | Ga0500568_0000011 | |||
| 3179 | Ga0500604_0008326 | |||
| 3180 | Ga0500604_0009663 | |||
| 3181 | Ga0500616_0000905 | |||
| 3182 | Ga0500616_0001088 | |||
| 3183 | Ga0500622_0001774 | |||
| 3184 | Ga0500622_0011034 | |||
| 3185 | Ga0500627_0007069 | |||
| 3186 | Ga0500627_0046820 | |||
| 3187 | Ga0500596_002176 | |||
| 3188 | Ga0501084_0000086 | |||
| 3189 | Ga0501084_0002919 | |||
| 3190 | Ga0501084_0007402 | |||
| 3191 | Ga0501084_0024187 | |||
| 3192 | Ga0501084_0033145 | |||
| 3193 | Ga0501084_0049068 | |||
| 3194 | Ga0501084_0068412 | |||
| 3195 | Ga0501084_0076326 | |||
| 3196 | Ga0501082_0010656 | |||
| 3197 | Ga0501082_0012946 | |||
| 3198 | Ga0501082_0017891 | |||
| 3199 | Ga0501082_0020755 | |||
| 3200 | Ga0501082_0033862 | |||
| 3201 | Ga0501082_0039827 | |||
| 3202 | Ga0501082_0130332 | |||
| 3203 | Ga0466962_0015510 | |||
| 3204 | Ga0466962_0017966 | |||
| 3205 | Ga0530510_0001548 | |||
| 3206 | Ga0530510_0001995 | |||
| 3207 | Ga0530510_0003428 | |||
| 3208 | Ga0530510_0006008 | |||
| 3209 | Ga0530510_0012291 | |||
| 3210 | Ga0530510_0013569 | |||
| 3211 | Ga0530510_0136535 | |||
| 3212 | 2501940916 | |||
| 3213 | 2506867910 | |||
| 3214 | 2508678411 | |||
| 3215 | 2523384783 | |||
| 3216 | 2548692936 | |||
| 3217 | 2552746647 | |||
| 3218 | 2552748084 | |||
| 3219 | 2595088439 | |||
| 3220 | 2626636376 | |||
| 3221 | 2640733522 | |||
| 3222 | 2640734984 | |||
| 3223 | 2644361825 | |||
| 3224 | 2671838875 | |||
| 3225 | 2672334260 | |||
| 3226 | 2676201324 | |||
| 3227 | 2678230558 | |||
| 3228 | 2678231882 | |||
| 3229 | 2689995690 | |||
| 3230 | 2738709073 | |||
| 3231 | 2738837937 | |||
| 3232 | 2738847498 | |||
| 3233 | 2738863227 | |||
| 3234 | 2739231013 | |||
| 3235 | 2739268153 | |||
| 3236 | 2739295745 | |||
| 3237 | 2739357423 | |||
| 3238 | 2745160634 | |||
| 3239 | 2757565484 | |||
| 3240 | 2774388911 | |||
| 3241 | 2774389592 | |||
| 3242 | 2774436704 | |||
| 3243 | 2774439797 | |||
| 3244 | 2774845900 | |||
| 3245 | 2774857031 | |||
| 3246 | 2774904332 | |||
| 3247 | 2774905752 | |||
| 3248 | 2774905893 | |||
| 3249 | 2777762820 | |||
| 3250 | 2777763903 | |||
| 3251 | 2777837009 | |||
| 3252 | 2791211710 | |||
| 3253 | 2816865838 | |||
| 3254 | 2819628639 | |||
| 3255 | 2842685863 | |||
| 3256 | 2849142075 | |||
| 3257 | 2852674059 | |||
| 3258 | 2856861817 | |||
| 3259 | 2857581761 | |||
| 3260 | 2857585902 | |||
| 3261 | 2857588220 | |||
| 3262 | 2857592049 | |||
| 3263 | 2862292997 | |||
| 3264 | 2862575416 | |||
| 3265 | 2867508492 | |||
| 3266 | 2894776755 | |||
| 3267 | 2898907217 | |||
| 3268 | 2904609068 | |||
| 3269 | 2912727207 | |||
| 3270 | 2915359925 | |||
| 3271 | 2916699715 | |||
| 3272 | 2919183069 | |||
| 3273 | 2919183459 | |||
| 3274 | 2919506965 | |||
| 3275 | 2919508598 | |||
| 3276 | 2919717854 | |||
| 3277 | 2928102157 | |||
| 3278 | 2928510666 | |||
| 3279 | 2928517940 | |||
| 3280 | 2928962401 | |||
| 3281 | 2929186610 | |||
| 3282 | 2929201291 | |||
| 3283 | 2929212719 | |||
| 3284 | 2936342873 | |||
| 3285 | 2936364301 | |||
| 3286 | 2939597928 | |||
| 3287 | 2954692323 | |||
| 3288 | 2954707389 | |||
| 3289 | 2977259176 | |||
| 3290 | 2984569529 | |||
| 3291 | 2990280205 | |||
| 3292 | 2995464186 | |||
| 3293 | 3001893021 | |||
| 3294 | 3001895645 | |||
| 3295 | 3003006308 | |||
| 3296 | 3006829265 | |||
| 3297 | 3006978211 | |||
| 3298 | 649812415 | |||
| 3299 | 8002779564 | |||
| 3300 | 8022793391 | |||
| 3301 | 8033233388 | |||
| 3302 | 8033233553 | |||
| 3303 | 8046355932 | |||
| 3304 | 8047713229 | |||
| 3305 | 8055532291 | |||
| 3306 | 8055910058 | |||
| 3307 | 8057587118 | |||
| 3308 | 8057634880 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pg0-assembly1.cif.gz_A | crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus | 0.9846 | 2 | 378 |
| 2jif-assembly1.cif.gz_D | structure of human short-branched chain acyl-coa dehydrogenase (acadsb) | 0.9627 | 1 | 379 |
| 1ivh-assembly1.cif.gz_B | structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity | 0.9621 | 6 | 379 |
| 4kto-assembly1.cif.gz_D | crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 | 0.9618 | 2 | 380 |
| 4kto-assembly1.cif.gz_C | crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 | 0.9604 | 2 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P28330_285_428_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 1.001 | 237 | 380 | 1.20.140.10 |
| af_O33229_243_386_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9959 | 237 | 380 | 1.20.140.10 |
| 2pg0B03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9944 | 233 | 378 | 1.20.140.10 |
| af_P28330_285_428_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9939 | 237 | 380 | 1.20.140.10 |
| af_O33229_243_386_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.989 | 237 | 380 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7SUN5-F1-model_v4 | deleted | 0.998 | 140 | 377 |
|
| AF-V7MQB5-F1-model_v4 | deleted | 0.9948 | 1 | 323 |
|
| AF-A0A848DKD1-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9918 | 214 | 380 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A3Q2P568-F1-model_v4 | Long-chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.8) | 0.9913 | 2 | 379 |
GO:0004466
GO:0005759 GO:0016401 GO:0019254 GO:0033539 GO:0042758 GO:0050660 |
| AF-A0A3S3V250-F1-model_v4 | Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N) | 0.9908 | 1 | 378 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |