metagRoot

F495228

General Info

Members	Datasets	Scaffolds	Average Seq Length
1655	555	3308	381

Family's Representative Sequence

Representative Sequence	3300048905\|Ga0496102_0165760\|Ga0496102_0165760_274_1602
Length	442
Sequence	VDVDEAGLGCVVGHLGSLGPGGPWSSSHGSSRTSGFAAQGTAALADPDGPTPDVPTQLNLMTMRALFEDEHEQFRETVRRFIEKEMAPNFDRWEAAGVADREMYRKAGEIGLLGMAVPEQYGGGGVDDFRYNLVILEEVQRAGMGGAGLGITLHNDIVLPYFLTYCDDAQRDRWLPGIVSGDLITAIAMTEPGIGSDLASMSTSAIRDGDDYVVNGAKTFITNGINSDLVVTAVKTDPSERHRGISLLVLERGMEGFERGRNLAKVGMHSQDTAELFFTDVRVPVANRLGLEGDGFRYLVSNLPQERLSIAASGVAAARAALDWTLEYTKERRAFGQPINSFQHSRFVLAEMATEVEIGQTFVDACVLELNAGTLTAEKAAMAKWWCTELQKRAVDHGVQLHGGYGYMTEYPIARAYTDARVTTIYGGTTEIMKEIIGRSLA

Samples

	Sample ID	Description	Type	Environment
1	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
2	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
3	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
4	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
5	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
6	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
7	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
8	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
9	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
10	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
11	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
12	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
14	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
15	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
16	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
17	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
18	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
19	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
20	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
21	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
22	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
23	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
24	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
25	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
26	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
27	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
28	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
29	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
30	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
31	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
32	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
33	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
34	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
37	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
41	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
42	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
43	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
44	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
45	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
46	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
47	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
48	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
49	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
50	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
51	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
52	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
53	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
54	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
55	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
56	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
57	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
58	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
59	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
60	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
61	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
62	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
63	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
64	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
65	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
66	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
67	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
68	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
69	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
70	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
71	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
72	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
73	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
74	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
75	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
76	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
77	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
78	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
79	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
80	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
81	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
82	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
83	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
84	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
85	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
86	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
87	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
88	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
89	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
90	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
91	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
92	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
93	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
94	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
95	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
96	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
98	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
99	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
100	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
101	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
102	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
103	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
104	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
105	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
106	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
107	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
108	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
109	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
110	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
111	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
112	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
114	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
115	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
116	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
117	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
118	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
119	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
120	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
121	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
122	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
123	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
124	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
125	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
126	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
127	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
128	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
129	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
130	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
131	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
132	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
133	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
134	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
135	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
136	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
137	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
138	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
139	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
140	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
141	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
142	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
143	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
144	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
145	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
146	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
147	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
148	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
149	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
150	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
151	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
152	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
219	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
223	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
224	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
225	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
226	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
227	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
228	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
229	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
230	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
231	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
232	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
233	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
234	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
235	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
236	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
237	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
238	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
239	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
240	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
241	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
242	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
243	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
244	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
245	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
246	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
247	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
248	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
249	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
250	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
251	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
252	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
253	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
254	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
255	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
256	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
257	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
258	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
259	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
260	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
261	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
262	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
263	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
264	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
265	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
266	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
267	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
268	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
269	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
270	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
271	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
272	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
273	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
274	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
275	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
276	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
277	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
278	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
279	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
280	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
281	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
282	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
283	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
284	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
285	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
286	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
287	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
288	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
289	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
290	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
291	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
292	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
293	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
294	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
295	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
296	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
297	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
298	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
299	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
300	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
301	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
302	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
303	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
304	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
305	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
306	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
307	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
308	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
309	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
310	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
311	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
312	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
313	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
314	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
315	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
316	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
317	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
318	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
319	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
320	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
321	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
322	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
323	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
324	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
325	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
326	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
327	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
328	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
329	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
330	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
331	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
332	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
333	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
334	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
335	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
336	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
337	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
338	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
339	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
340	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
341	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
342	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
343	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
344	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
345	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
346	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
347	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
348	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
349	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
350	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
351	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
352	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
353	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
354	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
355	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
356	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
357	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
358	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
359	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
360	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
361	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
362	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
363	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
364	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
365	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
366	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
367	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
368	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
369	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
370	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
371	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
372	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
373	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
374	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
375	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
376	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
377	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
378	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
379	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
380	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
381	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
382	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
383	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
384	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
385	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
386	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
387	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
388	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
389	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
390	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
391	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
392	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
393	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
394	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
395	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
396	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
397	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
398	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
399	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
400	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
401	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
402	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
403	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
404	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
405	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
406	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
407	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
408	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
409	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
410	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
411	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
412	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
413	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
414	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
415	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
416	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
417	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
418	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
419	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
420	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
421	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
422	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
423	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
424	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
425	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
426	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
427	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
428	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
429	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
430	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
431	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
432	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
433	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
434	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
435	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
436	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
437	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
438	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
439	3300049850	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control	Metagenome	Rhizosphere
440	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
441	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
442	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
443	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
444	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
445	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
446	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
447	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
448	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
449	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
450	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
451	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
452	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
453	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
454	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
455	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
456	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
457	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
458	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
459	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
460	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
461	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
462	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
463	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
464	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
465	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
466	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
467	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
468	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
469	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
470	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
471	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
472	2501939600	Micromonospora sp. L5	Isolate	Unclassified
473	2506783011	Frankia datiscae Dg1	Isolate	Nodule
474	2508501039	Frankia saprophytica CN3	Isolate	Nodule
475	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
476	2547132424	Nocardia nova SH22a	Isolate	Unclassified
477	2551306352	Acinetobacter sp. GG2	Isolate	Rhizosphere
478	2593339131	Bacillus sp. UNCCL81	Isolate	Unclassified
479	2626541554	Frankia sp. AvcI.1	Isolate	Nodule
480	2639762793	Acinetobacter calcoaceticus GK1	Isolate	Rhizosphere
481	2643221665	Acinetobacter sp. Root1280	Isolate	Unclassified
482	2671180195	Frankia sp. CcI49	Isolate	Nodule
483	2671180330	Peribacillus simplex SH-B26	Isolate	Unclassified
484	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
485	2675903507	Acinetobacter calcoaceticus GK2	Isolate	Unclassified
486	2687453743	Frankia colletiae Cc1.17	Isolate	Nodule
487	2738541275	Novosphingobium sp. GV027	Isolate	Unclassified
488	2738541299	Paenisporosarcina sp. OV554	Isolate	Unclassified
489	2738541301	Novosphingobium sp. GV079	Isolate	Unclassified
490	2738541304	Novosphingobium sp. GV061	Isolate	Unclassified
491	2738543010	Bacillus sp. YR335	Isolate	Unclassified
492	2738543017	Bacillus sp. OV186	Isolate	Unclassified
493	2738543022	Novosphingobium sp. GV055	Isolate	Unclassified
494	2738543033	Novosphingobium sp. GV064	Isolate	Unclassified
495	2744054655	Acinetobacter sp. BMW17	Isolate	Unclassified
496	2757320391	Bacillus sp. NFR08	Isolate	Rhizoplane
497	2773857761	Acinetobacter sp. 3664	Isolate	Unclassified
498	2773857770	Acinetobacter sp. 3636	Isolate	Unclassified
499	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
500	2773857922	Frankia sp. CcI49	Isolate	Nodule
501	2773857933	Frankia sp. BMG5.30	Isolate	Nodule
502	2775507177	Bacillus sp. AFS055030	Isolate	Unclassified
503	2775507192	Bacillus sp. AFS041924	Isolate	Unclassified
504	2788500588	Lysinibacillus sp. YS11	Isolate	Unclassified
505	2816332186	Peribacillus frigoritolerans 3612	Isolate	Unclassified
506	2818991451	Lysinibacillus fusiformis 3193	Isolate	Unclassified
507	2842682962	Bacillus sp. R-72492	Isolate	Unclassified
508	2849139964	Bacillus sp. R-71875	Isolate	Unclassified
509	2852673933	Sporosarcina sp. JAI121	Isolate	Rhizosphere
510	2856858025	Micromonospora aurantiaca 110B(2018)	Isolate	Unclassified
511	2857581216	Bacillus sp. R-71922	Isolate	Unclassified
512	2857586860	Bacillus sp. R-71935	Isolate	Unclassified
513	2857591370	Brevibacillus sp. R-71934	Isolate	Unclassified
514	2862290372	Streptomyces triticagri NEAU-YY421	Isolate	Rhizosphere
515	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
516	2867507094	Micromonospora zingiberis PLAI 1-1	Isolate	Unclassified
517	2894772417	Roseomonas oryzicola KCTC 22478	Isolate	Rhizosphere
518	2898907183	Brevibacillus sp. SYP-B805	Isolate	Rhizosphere
519	2904606771	Lysinibacillus macroides 1284	Isolate	Rhizosphere
520	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
521	2915358134	Pseudonocardia pini CAP47R	Isolate	Unclassified
522	2916699645	Acinetobacter ursingii M3	Isolate	Unclassified
523	2919182534	Acinetobacter calcoaceticus 2589	Isolate	Rhizosphere
524	2919506607	Acinetobacter sp. 3657	Isolate	Unclassified
525	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
526	2928100450	Novosphingobium sp. 1529	Isolate	Rhizosphere
527	2928510474	Sporosarcina psychrophila 1288	Isolate	Rhizosphere
528	2928515477	Acinetobacter bereziniae 1375	Isolate	Rhizosphere
529	2928959182	Novosphingobium capsulatum 1057	Isolate	Unclassified
530	2929183550	Brevibacillus sp. R-71971 Hybrid assembly	Isolate	Unclassified
531	2929199973	Roseomonas sp. R-73070 Hybrid assembly	Isolate	Unclassified
532	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
533	2936340661	Gottfriedia acidiceleris 1-17	Isolate	Rhizosphere
534	2936361878	Neobacillus endophyticus BRMEA1	Isolate	Unclassified
535	2939593269	Lysinibacillus parviboronicapiens 736	Isolate	Rhizosphere
536	2954691527	Streptomyces sp. SAI-127	Isolate	Rhizosphere
537	2954701450	Streptomyces sp. SAI-144	Isolate	Rhizosphere
538	2977254563	Bacillus sp. SORGH_AS 510	Isolate	Unclassified
539	2984568884	Acinetobacter baylyi SORGH_AS893	Isolate	Aerial Root
540	2990275345	Bacillus sp. SLBN-46	Isolate	Unclassified
541	2995463766	Streptacidiphilus fuscans NEAU-YB345	Isolate	Unclassified
542	3001892409	Neobacillus rhizophilus FJAT-49825	Isolate	Rhizosphere
543	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
544	3006826541	Bacillus haikouensis CrR16	Isolate	Unclassified
545	3006973921	Bacillus sp. FJAT-49736	Isolate	Rhizosphere
546	649633069	Micromonospora sp. L5	Isolate	Unclassified
547	8002775197	Frankia nepalensis CN7	Isolate	Nodule
548	8022792930	Bacillus sp. Xin	Isolate	Rhizosphere
549	8033232454	Acinetobacter radioresistens SA188	Isolate	Unclassified
550	8046352972	Agromyces mangrovi NBRC 112812	Isolate	Rhizosphere
551	8047710418	Umezawaea endophytica DSM 103496	Isolate	Unclassified
552	8055531788	Lysinibacillus pakistanensis LY1	Isolate	Rhizosphere
553	8055909800	Plastoroseomonas hellenica LMG 31523	Isolate	Unclassified
554	8057582654	Bacillus arachidis YX15	Isolate	Rhizosphere
555	8057632132	Cytobacillus kochii RZ2	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	93.23
Metatranscriptomes	0.91
Isolates	5.86

Biome Distribution

Category	Percentage (%)
Aerial Root	0.06
Bulb	0
Endosphere	3.32
Nodule	0.79
Rhizoplane	5.86
Rhizosphere	82.84
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0496102_0165760	3300048905	Bacteria	2079
2	LJQas_1005422	3300000549	Bacteria	1620
3	JGI24752J21851_1000031	3300001976	Bacteria	16764
4	JGI25151J46595_10001297	3300003187	Bacteria	17528
5	JGI25151J46595_10001914	3300003187	Bacteria	13217
6	JGI25151J46595_10002376	3300003187	Bacteria	11424
7	JGI25151J46595_10003056	3300003187	Bacteria	9468
8	JGI25151J46595_10003287	3300003187	Bacteria	8984
9	JGI25151J46595_10018537	3300003187	Bacteria	2984
10	JGI25406J46586_10000099	3300003203	Bacteria	38165
11	JGI25406J46586_10001854	3300003203	Bacteria	9929
12	rootH1_10192437	3300003316	Bacteria	1430
13	Ga0006562J51391_1016962	3300003578	Bacteria	1857
14	Ga0006562J51391_1041968	3300003578	Bacteria	1291
15	Ga0055538_1000283	3300003751	Bacteria	25962
16	Ga0055532_1000229	3300003758	Bacteria	42014
17	Ga0055536_1022910	3300003781	Bacteria	1849
18	Ga0058692_1000001	3300003856	Bacteria	834230
19	Ga0058692_1000063	3300003856	Bacteria	93069
20	Ga0065714_10080014	3300005288	Bacteria	2471
21	Ga0065704_10003837	3300005289	Bacteria	4474
22	Ga0065704_10010176	3300005289	Bacteria	2830
23	Ga0065704_10077027	3300005289	Bacteria	4883
24	Ga0065707_10084189	3300005295	Bacteria	7555
25	Ga0065707_10118720	3300005295	Bacteria	2178
26	Ga0070658_10026316	3300005327	Bacteria	4666
27	Ga0070676_10041771	3300005328	Bacteria	2660
28	Ga0070676_10099977	3300005328	Bacteria	1790
29	Ga0070683_100007853	3300005329	Bacteria	9036
30	Ga0070683_100024318	3300005329	Bacteria	5425
31	Ga0070683_100254800	3300005329	Bacteria	1669
32	Ga0070690_100027158	3300005330	Bacteria	3537
33	Ga0070690_100171394	3300005330	Bacteria	1494
34	Ga0070670_100000072	3300005331	Bacteria	102029
35	Ga0070670_100119174	3300005331	Bacteria	2276
36	Ga0070670_100144088	3300005331	Bacteria	2061
37	Ga0070677_10023288	3300005333	Bacteria	2292
38	Ga0068869_100028234	3300005334	Bacteria	3920
39	Ga0068869_100081247	3300005334	Bacteria	2420
40	Ga0070666_10050020	3300005335	Bacteria	2811
41	Ga0070666_10129546	3300005335	Bacteria	1752
42	Ga0070680_100000261	3300005336	Bacteria	34740
43	Ga0070680_100017787	3300005336	Bacteria	5607
44	Ga0070680_100069143	3300005336	Bacteria	2899
45	Ga0070680_100107679	3300005336	Bacteria	2318
46	Ga0070680_100240839	3300005336	Bacteria	1529
47	Ga0068868_100002141	3300005338	Bacteria	13628
48	Ga0068868_100019874	3300005338	Bacteria	5038
49	Ga0070660_100012370	3300005339	Bacteria	6092
50	Ga0070660_100026559	3300005339	Bacteria	4312
51	Ga0070660_100224956	3300005339	Bacteria	1526
52	Ga0070689_100036774	3300005340	Bacteria	3743
53	Ga0070691_10011061	3300005341	Bacteria	4122
54	Ga0070691_10033980	3300005341	Bacteria	2399
55	Ga0070687_100018616	3300005343	Bacteria	3216
56	Ga0070687_100055083	3300005343	Bacteria	2075
57	Ga0070687_100058624	3300005343	Bacteria	2023
58	Ga0070661_100068424	3300005344	Bacteria	2609
59	Ga0070661_100097130	3300005344	Bacteria	2187
60	Ga0070692_10071974	3300005345	Bacteria	1843
61	Ga0070668_100001049	3300005347	Bacteria	19395
62	Ga0070668_100005680	3300005347	Bacteria	9248
63	Ga0070668_100057236	3300005347	Bacteria	3012
64	Ga0070668_100087008	3300005347	Bacteria	2458
65	Ga0070669_100005928	3300005353	Bacteria	8817
66	Ga0070669_100016997	3300005353	Bacteria	5194
67	Ga0070669_100050975	3300005353	Bacteria	3024
68	Ga0070669_100113457	3300005353	Bacteria	2059
69	Ga0070675_100000935	3300005354	Bacteria	20796
70	Ga0070675_100028702	3300005354	Bacteria	4479
71	Ga0070671_100000969	3300005355	Bacteria	21018
72	Ga0070671_100015123	3300005355	Bacteria	6233
73	Ga0070671_100019608	3300005355	Bacteria	5506
74	Ga0070671_100027586	3300005355	Bacteria	4675
75	Ga0070671_100118565	3300005355	Bacteria	2226
76	Ga0070674_100027421	3300005356	Bacteria	3732
77	Ga0070673_100031261	3300005364	Bacteria	3993
78	Ga0070673_100051522	3300005364	Bacteria	3225
79	Ga0070688_100048884	3300005365	Bacteria	2630
80	Ga0070659_100003482	3300005366	Bacteria	11205
81	Ga0070659_100073290	3300005366	Bacteria	2725
82	Ga0070659_100140338	3300005366	Bacteria	1967
83	Ga0070667_100000746	3300005367	Bacteria	31099
84	Ga0070667_100012821	3300005367	Bacteria	6927
85	Ga0070667_100021378	3300005367	Bacteria	5373
86	Ga0070703_10013487	3300005406	Bacteria	2322
87	Ga0070709_10000727	3300005434	Bacteria	18619
88	Ga0070709_10001186	3300005434	Bacteria	14341
89	Ga0070709_10001840	3300005434	Bacteria	11510
90	Ga0070709_10014473	3300005434	Bacteria	4463
91	Ga0070709_10052770	3300005434	Bacteria	2557
92	Ga0070709_10063900	3300005434	Bacteria	2352
93	Ga0070709_10168283	3300005434	Bacteria	1529
94	Ga0070714_100000601	3300005435	Bacteria	25736
95	Ga0070714_100007663	3300005435	Bacteria	8407
96	Ga0070714_100034070	3300005435	Bacteria	4263
97	Ga0070714_100057419	3300005435	Bacteria	3332
98	Ga0070713_100008515	3300005436	Bacteria	7279
99	Ga0070713_100020320	3300005436	Bacteria	5089
100	Ga0070713_100053270	3300005436	Bacteria	3352
101	Ga0070713_100061729	3300005436	Bacteria	3136
102	Ga0070713_100075790	3300005436	Bacteria	2854
103	Ga0070713_100099046	3300005436	Bacteria	2521
104	Ga0070713_100141823	3300005436	Bacteria	2129
105	Ga0070710_10000225	3300005437	Bacteria	26402
106	Ga0070710_10000234	3300005437	Bacteria	25949
107	Ga0070710_10000408	3300005437	Bacteria	20191
108	Ga0070710_10004952	3300005437	Bacteria	6303
109	Ga0070710_10024459	3300005437	Bacteria	3186
110	Ga0070710_10039025	3300005437	Bacteria	2611
111	Ga0070710_10040416	3300005437	Bacteria	2571
112	Ga0070711_100000428	3300005439	Bacteria	21935
113	Ga0070711_100000526	3300005439	Bacteria	19854
114	Ga0070711_100001089	3300005439	Bacteria	14524
115	Ga0070711_100001574	3300005439	Bacteria	12551
116	Ga0070711_100032364	3300005439	Bacteria	3476
117	Ga0070705_100012199	3300005440	Bacteria	4362
118	Ga0070705_100043448	3300005440	Bacteria	2575
119	Ga0070705_100052962	3300005440	Bacteria	2373
120	Ga0070700_100002856	3300005441	Bacteria	8860
121	Ga0070694_100029011	3300005444	Bacteria	3607
122	Ga0070694_100065923	3300005444	Bacteria	2483
123	Ga0070708_100004853	3300005445	Bacteria	10615
124	Ga0070663_100001262	3300005455	Bacteria	13900
125	Ga0070663_100002450	3300005455	Bacteria	10453
126	Ga0070678_100068784	3300005456	Bacteria	2641
127	Ga0070662_100037024	3300005457	Bacteria	3456
128	Ga0070662_100123912	3300005457	Bacteria	1984
129	Ga0070681_10000079	3300005458	Bacteria	71936
130	Ga0070681_10057401	3300005458	Bacteria	3873
131	Ga0070681_10077913	3300005458	Bacteria	3271
132	Ga0070681_10186803	3300005458	Bacteria	1993
133	Ga0070681_10240551	3300005458	Bacteria	1724
134	Ga0070685_10203052	3300005466	Bacteria	1289
135	Ga0070706_100001191	3300005467	Bacteria	27870
136	Ga0070706_100012100	3300005467	Bacteria	8008
137	Ga0070706_100023248	3300005467	Bacteria	5710
138	Ga0070706_100023878	3300005467	Bacteria	5630
139	Ga0070706_100117704	3300005467	Bacteria	2475
140	Ga0070707_100000563	3300005468	Bacteria	37248
141	Ga0070707_100001915	3300005468	Bacteria	19953
142	Ga0070707_100009169	3300005468	Bacteria	9180
143	Ga0070707_100015399	3300005468	Bacteria	7175
144	Ga0070707_100024691	3300005468	Bacteria	5695
145	Ga0070707_100042973	3300005468	Bacteria	4327
146	Ga0070707_100109691	3300005468	Bacteria	2676
147	Ga0070707_100133074	3300005468	Bacteria	2419
148	Ga0070707_100169209	3300005468	Bacteria	2130
149	Ga0070698_100000280	3300005471	Bacteria	51955
150	Ga0070698_100000592	3300005471	Bacteria	38966
151	Ga0070698_100000647	3300005471	Bacteria	37248
152	Ga0070698_100006462	3300005471	Bacteria	12717
153	Ga0070698_100008349	3300005471	Bacteria	11193
154	Ga0070698_100013896	3300005471	Bacteria	8516
155	Ga0070698_100017952	3300005471	Bacteria	7451
156	Ga0070698_100083485	3300005471	Bacteria	3183
157	Ga0070698_100093440	3300005471	Bacteria	2987
158	Ga0070699_100000149	3300005518	Bacteria	66121
159	Ga0070699_100268449	3300005518	Bacteria	1527
160	Ga0070679_100000056	3300005530	Bacteria	83790
161	Ga0070679_100019580	3300005530	Bacteria	6585
162	Ga0070684_100004005	3300005535	Bacteria	11150
163	Ga0070684_100071856	3300005535	Bacteria	3045
164	Ga0070684_100086865	3300005535	Bacteria	2776
165	Ga0070684_100134362	3300005535	Bacteria	2233
166	Ga0070684_100154934	3300005535	Bacteria	2077
167	Ga0070684_100183608	3300005535	Bacteria	1902
168	Ga0070697_100000222	3300005536	Bacteria	46798
169	Ga0070697_100119837	3300005536	Bacteria	2200
170	Ga0070697_100250938	3300005536	Bacteria	1513
171	Ga0068853_100042114	3300005539	Bacteria	3903
172	Ga0068853_100234628	3300005539	Bacteria	1679
173	Ga0068853_100298155	3300005539	Bacteria	1489
174	Ga0070672_100010102	3300005543	Bacteria	6536
175	Ga0070686_100024100	3300005544	Bacteria	3645
176	Ga0070695_100004596	3300005545	Bacteria	8100
177	Ga0070695_100032163	3300005545	Bacteria	3279
178	Ga0070695_100081324	3300005545	Bacteria	2143
179	Ga0070695_100193948	3300005545	Bacteria	1447
180	Ga0070696_100010621	3300005546	Bacteria	6167
181	Ga0070696_100045553	3300005546	Bacteria	3039
182	Ga0070696_100052323	3300005546	Bacteria	2841
183	Ga0070693_100009751	3300005547	Bacteria	4785
184	Ga0070693_100011397	3300005547	Bacteria	4478
185	Ga0070693_100040158	3300005547	Bacteria	2625
186	Ga0070665_100055258	3300005548	Bacteria	3982
187	Ga0070665_100318480	3300005548	Bacteria	1559
188	Ga0070665_100425573	3300005548	Bacteria	1336
189	Ga0070704_100035963	3300005549	Bacteria	3370
190	Ga0070704_100051187	3300005549	Bacteria	2907
191	Ga0070704_100056813	3300005549	Bacteria	2780
192	Ga0070704_100074806	3300005549	Bacteria	2472
193	Ga0070704_100077506	3300005549	Bacteria	2435
194	Ga0068855_100007525	3300005563	Bacteria	13183
195	Ga0070664_100000402	3300005564	Bacteria	32165
196	Ga0070664_100014689	3300005564	Bacteria	6394
197	Ga0070664_100215100	3300005564	Bacteria	1718
198	Ga0068857_100010684	3300005577	Bacteria	7986
199	Ga0068857_100028644	3300005577	Bacteria	4914
200	Ga0068857_100077797	3300005577	Bacteria	2960
201	Ga0068857_100095592	3300005577	Bacteria	2662
202	Ga0068857_100125796	3300005577	Bacteria	2309
203	Ga0068854_100002153	3300005578	Bacteria	12088
204	Ga0068854_100009528	3300005578	Bacteria	6269
205	Ga0068856_100018569	3300005614	Bacteria	6738
206	Ga0068856_100029701	3300005614	Bacteria	5340
207	Ga0068856_100096372	3300005614	Bacteria	2947
208	Ga0070702_100031728	3300005615	Bacteria	2893
209	Ga0070702_100104153	3300005615	Bacteria	1746
210	Ga0070702_100150879	3300005615	Bacteria	1492
211	Ga0068852_100021347	3300005616	Bacteria	5169
212	Ga0068852_100036367	3300005616	Bacteria	4119
213	Ga0068852_100081232	3300005616	Bacteria	2877
214	Ga0068852_100220995	3300005616	Bacteria	1801
215	Ga0068859_100013427	3300005617	Bacteria	8212
216	Ga0068859_100095026	3300005617	Bacteria	3033
217	Ga0068859_100104974	3300005617	Bacteria	2885
218	Ga0068859_100116526	3300005617	Bacteria	2736
219	Ga0068859_100143667	3300005617	Bacteria	2460
220	Ga0068864_100000019	3300005618	Bacteria	271650
221	Ga0068864_100000038	3300005618	Bacteria	181005
222	Ga0068864_100022161	3300005618	Bacteria	5326
223	Ga0068864_100055644	3300005618	Bacteria	3416
224	Ga0068864_100095729	3300005618	Bacteria	2626
225	Ga0068866_10023473	3300005718	Bacteria	2871
226	Ga0068866_10030458	3300005718	Bacteria	2590
227	Ga0068861_100005613	3300005719	Bacteria	8504
228	Ga0068861_100036062	3300005719	Bacteria	3667
229	Ga0068861_100224450	3300005719	Bacteria	1590
230	Ga0068870_10044825	3300005840	Bacteria	2312
231	Ga0068870_10160202	3300005840	Bacteria	1334
232	Ga0068863_100000026	3300005841	Bacteria	185590
233	Ga0068863_100000104	3300005841	Bacteria	90766
234	Ga0068863_100023034	3300005841	Bacteria	5952
235	Ga0068863_100026479	3300005841	Bacteria	5532
236	Ga0068863_100038287	3300005841	Bacteria	4562
237	Ga0068863_100055667	3300005841	Bacteria	3745
238	Ga0068863_100078450	3300005841	Bacteria	3127
239	Ga0068858_100000061	3300005842	Bacteria	113998
240	Ga0068858_100009842	3300005842	Bacteria	9090
241	Ga0068858_100018641	3300005842	Bacteria	6497
242	Ga0068858_100293361	3300005842	Bacteria	1550
243	Ga0068860_100025917	3300005843	Bacteria	5657
244	Ga0068860_100144017	3300005843	Bacteria	2292
245	Ga0068860_100156066	3300005843	Bacteria	2199
246	Ga0068862_100000279	3300005844	Bacteria	56941
247	Ga0068862_100005914	3300005844	Bacteria	10187
248	Ga0068862_100018828	3300005844	Bacteria	5754
249	Ga0081455_10006019	3300005937	Bacteria	13143
250	Ga0081455_10010606	3300005937	Bacteria	9323
251	Ga0081455_10012222	3300005937	Bacteria	8573
252	Ga0081455_10040682	3300005937	Bacteria	4097
253	Ga0081455_10100803	3300005937	Bacteria	2319
254	Ga0081455_10205544	3300005937	Bacteria	1471
255	Ga0081538_10001179	3300005981	Bacteria	27583
256	Ga0081540_1001050	3300005983	Bacteria	24617
257	Ga0081540_1001110	3300005983	Bacteria	23850
258	Ga0081540_1002720	3300005983	Bacteria	14387
259	Ga0081539_10000183	3300005985	Bacteria	148051
260	Ga0081539_10003736	3300005985	Bacteria	18107
261	Ga0081539_10013047	3300005985	Bacteria	6302
262	Ga0081539_10155366	3300005985	Bacteria	1096
263	Ga0070717_10001939	3300006028	Bacteria	14431
264	Ga0070717_10020874	3300006028	Bacteria	5157
265	Ga0070717_10051249	3300006028	Bacteria	3396
266	Ga0070717_10058473	3300006028	Bacteria	3188
267	Ga0070717_10065448	3300006028	Bacteria	3022
268	Ga0070717_10090203	3300006028	Bacteria	2586
269	Ga0070717_10127910	3300006028	Bacteria	2182
270	Ga0070717_10145010	3300006028	Bacteria	2050
271	Ga0075365_10021633	3300006038	Bacteria	4015
272	Ga0075365_10034701	3300006038	Bacteria	3259
273	Ga0075365_10042756	3300006038	Bacteria	2964
274	Ga0075365_10047169	3300006038	Bacteria	2831
275	Ga0075365_10145120	3300006038	Bacteria	1649
276	Ga0075364_10054781	3300006051	Bacteria	2608
277	Ga0070715_10008016	3300006163	Bacteria	3663
278	Ga0070715_10022431	3300006163	Bacteria	2462
279	Ga0070716_100001419	3300006173	Bacteria	10643
280	Ga0070716_100009855	3300006173	Bacteria	4775
281	Ga0070716_100041749	3300006173	Bacteria	2557
282	Ga0070716_100134387	3300006173	Bacteria	1568
283	Ga0070716_100152432	3300006173	Bacteria	1488
284	Ga0070712_100000151	3300006175	Bacteria	37005
285	Ga0070712_100018301	3300006175	Bacteria	4548
286	Ga0070712_100077823	3300006175	Bacteria	2392
287	Ga0070712_100078117	3300006175	Bacteria	2388
288	Ga0070712_100118895	3300006175	Bacteria	1985
289	Ga0070712_100136035	3300006175	Bacteria	1868
290	Ga0097621_100056583	3300006237	Bacteria	3204
291	Ga0075370_10004043	3300006353	Bacteria	7051
292	Ga0075370_10100818	3300006353	Bacteria	1671
293	Ga0068871_100039518	3300006358	Bacteria	3776
294	Ga0068871_100092724	3300006358	Bacteria	2519
295	Ga0075428_100171501	3300006844	Bacteria	2351
296	Ga0075428_100464928	3300006844	Bacteria	1354
297	Ga0075428_100483770	3300006844	Bacteria	1325
298	Ga0075430_100045529	3300006846	Bacteria	3706
299	Ga0075431_100000341	3300006847	Bacteria	36704
300	Ga0075431_100000800	3300006847	Bacteria	27517
301	Ga0075431_100010582	3300006847	Bacteria	9276
302	Ga0075431_100207211	3300006847	Bacteria	2004
303	Ga0075431_100283634	3300006847	Bacteria	1677
304	Ga0075433_10068651	3300006852	Bacteria	3112
305	Ga0075434_100026312	3300006871	Bacteria	5698
306	Ga0075434_100050538	3300006871	Bacteria	4130
307	Ga0075434_100204005	3300006871	Bacteria	1997
308	Ga0075429_100023407	3300006880	Bacteria	5360
309	Ga0075436_100017334	3300006914	Bacteria	4930
310	Ga0075436_100043069	3300006914	Bacteria	3112
311	Ga0075436_100126404	3300006914	Bacteria	1791
312	Ga0097620_100013427	3300006931	Bacteria	8212
313	Ga0097620_100095023	3300006931	Bacteria	3033
314	Ga0097620_100104974	3300006931	Bacteria	2885
315	Ga0097620_100116513	3300006931	Bacteria	2736
316	Ga0097620_100143669	3300006931	Bacteria	2460
317	Ga0075435_100006251	3300007076	Bacteria	8409
318	Ga0075435_100016534	3300007076	Bacteria	5563
319	Ga0075435_100026937	3300007076	Bacteria	4491
320	Ga0105251_10000905	3300009011	Bacteria	26609
321	Ga0105251_10007705	3300009011	Bacteria	6578
322	Ga0105251_10019101	3300009011	Bacteria	3628
323	Ga0105251_10029432	3300009011	Bacteria	2766
324	Ga0105251_10039953	3300009011	Bacteria	2289
325	Ga0105244_10001754	3300009036	Bacteria	17039
326	Ga0105244_10005044	3300009036	Bacteria	8882
327	Ga0105244_10005353	3300009036	Bacteria	8543
328	Ga0105250_10000642	3300009092	Bacteria	22235
329	Ga0105250_10001851	3300009092	Bacteria	11018
330	Ga0105250_10016467	3300009092	Bacteria	3011
331	Ga0105250_10053938	3300009092	Bacteria	1612
332	Ga0105240_10093238	3300009093	Bacteria	3676
333	Ga0105240_10185438	3300009093	Bacteria	2451
334	Ga0105240_10203795	3300009093	Bacteria	2317
335	Ga0111539_10000944	3300009094	Bacteria	38074
336	Ga0111539_10017082	3300009094	Bacteria	8981
337	Ga0111539_10054923	3300009094	Bacteria	4736
338	Ga0111539_10086300	3300009094	Bacteria	3688
339	Ga0111539_10113334	3300009094	Bacteria	3181
340	Ga0111539_10113709	3300009094	Bacteria	3175
341	Ga0105245_10011337	3300009098	Bacteria	7762
342	Ga0105245_10036871	3300009098	Bacteria	4345
343	Ga0105245_10090808	3300009098	Bacteria	2810
344	Ga0105247_10000251	3300009101	Bacteria	49900
345	Ga0105247_10008026	3300009101	Bacteria	6450
346	Ga0105247_10019843	3300009101	Bacteria	4037
347	Ga0105247_10056251	3300009101	Bacteria	2429
348	Ga0114129_10006787	3300009147	Bacteria	16254
349	Ga0114129_10008886	3300009147	Bacteria	14325
350	Ga0114129_10018930	3300009147	Bacteria	9810
351	Ga0114129_10030723	3300009147	Bacteria	7597
352	Ga0114129_10655607	3300009147	Bacteria	1354
353	Ga0114129_10664763	3300009147	Bacteria	1343
354	Ga0105243_10000010	3300009148	Bacteria	316672
355	Ga0105243_10000155	3300009148	Bacteria	78612
356	Ga0105243_10009892	3300009148	Bacteria	7251
357	Ga0105243_10080826	3300009148	Bacteria	2652
358	Ga0105243_10095464	3300009148	Bacteria	2457
359	Ga0105243_10096414	3300009148	Bacteria	2447
360	Ga0105241_10043770	3300009174	Bacteria	3391
361	Ga0105241_10097509	3300009174	Bacteria	2331
362	Ga0105242_10028818	3300009176	Bacteria	4422
363	Ga0105242_10047973	3300009176	Bacteria	3469
364	Ga0105242_10087236	3300009176	Bacteria	2620
365	Ga0105242_10108327	3300009176	Bacteria	2364
366	Ga0105248_10000014	3300009177	Bacteria	324729
367	Ga0105248_10020029	3300009177	Bacteria	7407
368	Ga0105248_10028137	3300009177	Bacteria	6260
369	Ga0105248_10034717	3300009177	Bacteria	5642
370	Ga0105248_10085006	3300009177	Bacteria	3560
371	Ga0105248_10445446	3300009177	Bacteria	1459
372	Ga0105237_10000681	3300009545	Bacteria	47030
373	Ga0105237_10015085	3300009545	Bacteria	8051
374	Ga0105237_10017247	3300009545	Bacteria	7488
375	Ga0105237_10046841	3300009545	Bacteria	4348
376	Ga0105237_10050938	3300009545	Bacteria	4160
377	Ga0105237_10063603	3300009545	Bacteria	3687
378	Ga0105237_10077247	3300009545	Bacteria	3320
379	Ga0105238_10068561	3300009551	Bacteria	3548
380	Ga0105249_10000048	3300009553	Bacteria	172137
381	Ga0105249_10000305	3300009553	Bacteria	49977
382	Ga0105249_10001408	3300009553	Bacteria	21068
383	Ga0105249_10017159	3300009553	Bacteria	6426
384	Ga0105249_10070021	3300009553	Bacteria	3238
385	Ga0105249_10119965	3300009553	Bacteria	2498
386	Ga0105249_10134540	3300009553	Bacteria	2364
387	Ga0105239_10003066	3300010375	Bacteria	20762
388	Ga0105239_10066734	3300010375	Bacteria	3952
389	Ga0105239_10078462	3300010375	Bacteria	3634
390	Ga0105239_10174362	3300010375	Bacteria	2405
391	Ga0105239_10263549	3300010375	Bacteria	1937
392	Ga0105239_10338014	3300010375	Bacteria	1699
393	Ga0105246_10001817	3300011119	Bacteria	12785
394	Ga0105246_10009585	3300011119	Bacteria	5968
395	Ga0105246_10037415	3300011119	Bacteria	3257
396	Ga0105246_10117137	3300011119	Bacteria	1968
397	Ga0157373_10043419	3300013100	Bacteria	3211
398	Ga0157373_10057099	3300013100	Bacteria	2769
399	Ga0157371_10032330	3300013102	Bacteria	3766
400	Ga0157371_10033162	3300013102	Bacteria	3712
401	Ga0157371_10068432	3300013102	Bacteria	2513
402	Ga0157371_10107024	3300013102	Bacteria	1984
403	Ga0157371_10115375	3300013102	Bacteria	1907
404	Ga0157370_10048914	3300013104	Bacteria	4050
405	Ga0157370_10124500	3300013104	Bacteria	2407
406	Ga0157370_10157510	3300013104	Bacteria	2113
407	Ga0157369_10028383	3300013105	Bacteria	6193
408	Ga0157369_10053243	3300013105	Bacteria	4375
409	Ga0157369_10080438	3300013105	Bacteria	3489
410	Ga0157369_10110381	3300013105	Bacteria	2924
411	Ga0171462_1002	3300013250	Bacteria	1052134
412	Ga0157374_10029225	3300013296	Bacteria	4988
413	Ga0157378_10041354	3300013297	Bacteria	4088
414	Ga0163162_10024165	3300013306	Bacteria	5997
415	Ga0163162_10056847	3300013306	Bacteria	3940
416	Ga0163162_10224878	3300013306	Bacteria	2006
417	Ga0163162_10477674	3300013306	Bacteria	1378
418	Ga0157375_10010788	3300013308	Bacteria	8049
419	Ga0157375_10048566	3300013308	Bacteria	4152
420	Ga0157375_10091051	3300013308	Bacteria	3110
421	Ga0157375_10489359	3300013308	Bacteria	1395
422	Ga0163163_10179161	3300014325	Bacteria	2166
423	Ga0163163_10325178	3300014325	Bacteria	1592
424	Ga0157380_10007550	3300014326	Bacteria	7725
425	Ga0157380_10173779	3300014326	Bacteria	1885
426	Ga0157380_10310741	3300014326	Bacteria	1457
427	Ga0182008_10002889	3300014497	Bacteria	10629
428	Ga0157377_10131214	3300014745	Bacteria	1530
429	Ga0157379_10015692	3300014968	Bacteria	6656
430	Ga0157379_10017157	3300014968	Bacteria	6376
431	Ga0157379_10244541	3300014968	Bacteria	1628
432	Ga0157376_10031970	3300014969	Bacteria	4221
433	Ga0182006_1000214	3300015261	Bacteria	56285
434	Ga0163161_10012381	3300017792	Bacteria	5922
435	Ga0163161_10042245	3300017792	Bacteria	3278
436	Ga0163161_10044709	3300017792	Bacteria	3191
437	Ga0163161_10159331	3300017792	Bacteria	1720
438	Ga0197907_11483172	3300020069	Bacteria	1572
439	Ga0206356_11001745	3300020070	Bacteria	1575
440	Ga0206356_11711657	3300020070	Bacteria	3391
441	Ga0206351_10051467	3300020077	Bacteria	1568
442	Ga0206354_10117409	3300020081	Bacteria	1440
443	Ga0206354_10807169	3300020081	Bacteria	2016
444	Ga0206354_11645157	3300020081	Bacteria	2199
445	Ga0206353_11721640	3300020082	Bacteria	3142
446	Ga0213873_10000130	3300021358	Bacteria	14226
447	Ga0213876_10000004	3300021384	Bacteria	943822
448	Ga0213876_10001915	3300021384	Bacteria	12500
449	Ga0213876_10046411	3300021384	Bacteria	2297
450	Ga0213875_10000174	3300021388	Bacteria	67979
451	Ga0213875_10001334	3300021388	Bacteria	16255
452	Ga0213875_10004336	3300021388	Bacteria	7814
453	Ga0213875_10029575	3300021388	Bacteria	2598
454	Ga0213875_10051292	3300021388	Bacteria	1933
455	Ga0224712_10011188	3300022467	Bacteria	2774
456	Ga0209784_100105	3300025224	Bacteria	98262
457	Ga0209566_100178	3300025225	Bacteria	69170
458	Ga0209147_100160	3300025229	Bacteria	90883
459	Ga0209676_1000833	3300025292	Bacteria	39972
460	Ga0209676_1001081	3300025292	Bacteria	30764
461	Ga0209025_1000107	3300025294	Bacteria	222387
462	Ga0209025_1000945	3300025294	Bacteria	44061
463	Ga0209025_1001134	3300025294	Bacteria	38133
464	Ga0209025_1001208	3300025294	Bacteria	36263
465	Ga0209025_1001403	3300025294	Bacteria	31984
466	Ga0209025_1001415	3300025294	Bacteria	31780
467	Ga0209025_1007148	3300025294	Bacteria	8433
468	Ga0209025_1016229	3300025294	Bacteria	4418
469	Ga0207696_1001447	3300025711	Bacteria	12882
470	Ga0207696_1002892	3300025711	Bacteria	8083
471	Ga0207696_1004519	3300025711	Bacteria	5976
472	Ga0207655_1000612	3300025728	Bacteria	43148
473	Ga0207655_1000947	3300025728	Bacteria	30071
474	Ga0207655_1001468	3300025728	Bacteria	21769
475	Ga0207655_1001487	3300025728	Bacteria	21477
476	Ga0207655_1004432	3300025728	Bacteria	9957
477	Ga0207655_1004629	3300025728	Bacteria	9661
478	Ga0207655_1025039	3300025728	Bacteria	2907
479	Ga0207713_1001490	3300025735	Bacteria	18513
480	Ga0207713_1002830	3300025735	Bacteria	12207
481	Ga0207713_1003575	3300025735	Bacteria	10501
482	Ga0207713_1003827	3300025735	Bacteria	10070
483	Ga0207692_10000421	3300025898	Bacteria	14851
484	Ga0207692_10001282	3300025898	Bacteria	9329
485	Ga0207692_10003061	3300025898	Bacteria	6492
486	Ga0207692_10005915	3300025898	Bacteria	4935
487	Ga0207692_10006481	3300025898	Bacteria	4746
488	Ga0207692_10006566	3300025898	Bacteria	4723
489	Ga0207692_10019402	3300025898	Bacteria	3072
490	Ga0207692_10062047	3300025898	Bacteria	1939
491	Ga0207692_10078831	3300025898	Bacteria	1756
492	Ga0207692_10082230	3300025898	Bacteria	1725
493	Ga0207642_10054531	3300025899	Bacteria	1824
494	Ga0207710_10000005	3300025900	Bacteria	607066
495	Ga0207710_10000009	3300025900	Bacteria	485205
496	Ga0207710_10027386	3300025900	Bacteria	2467
497	Ga0207688_10000991	3300025901	Bacteria	14486
498	Ga0207688_10006904	3300025901	Bacteria	6179
499	Ga0207688_10009574	3300025901	Bacteria	5275
500	Ga0207647_10022112	3300025904	Bacteria	4230
501	Ga0207647_10038435	3300025904	Bacteria	3026
502	Ga0207685_10004419	3300025905	Bacteria	3571
503	Ga0207685_10030921	3300025905	Bacteria	1912
504	Ga0207685_10041816	3300025905	Bacteria	1717
505	Ga0207685_10048846	3300025905	Bacteria	1623
506	Ga0207699_10000093	3300025906	Bacteria	65868
507	Ga0207699_10000284	3300025906	Bacteria	27725
508	Ga0207699_10000662	3300025906	Bacteria	16542
509	Ga0207699_10001582	3300025906	Bacteria	10795
510	Ga0207699_10005863	3300025906	Bacteria	5910
511	Ga0207699_10017060	3300025906	Bacteria	3812
512	Ga0207699_10020355	3300025906	Bacteria	3554
513	Ga0207699_10091957	3300025906	Bacteria	1906
514	Ga0207699_10094877	3300025906	Bacteria	1880
515	Ga0207645_10009910	3300025907	Bacteria	6564
516	Ga0207643_10008182	3300025908	Bacteria	5613
517	Ga0207643_10012512	3300025908	Bacteria	4585
518	Ga0207705_10146877	3300025909	Bacteria	1765
519	Ga0207684_10001772	3300025910	Bacteria	22781
520	Ga0207684_10004720	3300025910	Bacteria	12781
521	Ga0207684_10008252	3300025910	Bacteria	9272
522	Ga0207684_10009745	3300025910	Bacteria	8472
523	Ga0207684_10014241	3300025910	Bacteria	6862
524	Ga0207654_10222854	3300025911	Bacteria	1252
525	Ga0207707_10000103	3300025912	Bacteria	83766
526	Ga0207707_10091743	3300025912	Bacteria	2655
527	Ga0207707_10210546	3300025912	Bacteria	1693
528	Ga0207695_10120527	3300025913	Bacteria	2592
529	Ga0207695_10145102	3300025913	Bacteria	2318
530	Ga0207695_10296735	3300025913	Bacteria	1508
531	Ga0207671_10006846	3300025914	Bacteria	10060
532	Ga0207671_10015047	3300025914	Bacteria	6081
533	Ga0207671_10038462	3300025914	Bacteria	3546
534	Ga0207671_10052534	3300025914	Bacteria	3020
535	Ga0207671_10158968	3300025914	Bacteria	1749
536	Ga0207693_10000132	3300025915	Bacteria	67726
537	Ga0207693_10001324	3300025915	Bacteria	21935
538	Ga0207693_10003617	3300025915	Bacteria	13200
539	Ga0207693_10020370	3300025915	Bacteria	5276
540	Ga0207693_10029138	3300025915	Bacteria	4363
541	Ga0207693_10082483	3300025915	Bacteria	2518
542	Ga0207693_10191902	3300025915	Bacteria	1607
543	Ga0207663_10000336	3300025916	Bacteria	20570
544	Ga0207663_10002893	3300025916	Bacteria	8294
545	Ga0207663_10003266	3300025916	Bacteria	7910
546	Ga0207663_10007631	3300025916	Bacteria	5622
547	Ga0207663_10020136	3300025916	Bacteria	3774
548	Ga0207663_10025482	3300025916	Bacteria	3420
549	Ga0207663_10081312	3300025916	Bacteria	2121
550	Ga0207660_10000257	3300025917	Bacteria	34559
551	Ga0207662_10002153	3300025918	Bacteria	9810
552	Ga0207662_10002244	3300025918	Bacteria	9651
553	Ga0207662_10008170	3300025918	Bacteria	5722
554	Ga0207657_10006511	3300025919	Bacteria	12098
555	Ga0207657_10014772	3300025919	Bacteria	7603
556	Ga0207657_10022199	3300025919	Bacteria	5951
557	Ga0207657_10184560	3300025919	Bacteria	1685
558	Ga0207649_10080394	3300025920	Bacteria	2108
559	Ga0207652_10000256	3300025921	Bacteria	55346
560	Ga0207652_10031578	3300025921	Bacteria	4449
561	Ga0207652_10072673	3300025921	Bacteria	2991
562	Ga0207646_10000075	3300025922	Bacteria	136316
563	Ga0207646_10015421	3300025922	Bacteria	7218
564	Ga0207646_10017449	3300025922	Bacteria	6716
565	Ga0207646_10057499	3300025922	Bacteria	3475
566	Ga0207646_10080270	3300025922	Bacteria	2917
567	Ga0207646_10182212	3300025922	Bacteria	1897
568	Ga0207681_10021318	3300025923	Bacteria	4117
569	Ga0207650_10000116	3300025925	Bacteria	104652
570	Ga0207650_10052964	3300025925	Bacteria	3007
571	Ga0207659_10098405	3300025926	Bacteria	2200
572	Ga0207659_10106030	3300025926	Bacteria	2127
573	Ga0207687_10005129	3300025927	Bacteria	8686
574	Ga0207700_10000103	3300025928	Bacteria	51803
575	Ga0207700_10002220	3300025928	Bacteria	11146
576	Ga0207700_10034685	3300025928	Bacteria	3625
577	Ga0207700_10049537	3300025928	Bacteria	3125
578	Ga0207700_10060223	3300025928	Bacteria	2874
579	Ga0207700_10073786	3300025928	Bacteria	2636
580	Ga0207700_10096707	3300025928	Bacteria	2345
581	Ga0207700_10122798	3300025928	Bacteria	2108
582	Ga0207700_10154778	3300025928	Bacteria	1898
583	Ga0207700_10189588	3300025928	Bacteria	1727
584	Ga0207700_10291627	3300025928	Bacteria	1406
585	Ga0207664_10000533	3300025929	Bacteria	27072
586	Ga0207664_10000556	3300025929	Bacteria	26167
587	Ga0207664_10003071	3300025929	Bacteria	11091
588	Ga0207664_10004341	3300025929	Bacteria	9604
589	Ga0207664_10019976	3300025929	Bacteria	4959
590	Ga0207664_10028924	3300025929	Bacteria	4217
591	Ga0207664_10030465	3300025929	Bacteria	4119
592	Ga0207664_10051508	3300025929	Bacteria	3251
593	Ga0207664_10062833	3300025929	Bacteria	2966
594	Ga0207664_10177398	3300025929	Bacteria	1827
595	Ga0207644_10005148	3300025931	Bacteria	8544
596	Ga0207644_10007134	3300025931	Bacteria	7281
597	Ga0207644_10093215	3300025931	Bacteria	2248
598	Ga0207690_10040941	3300025932	Bacteria	3033
599	Ga0207706_10000852	3300025933	Bacteria	31410
600	Ga0207706_10013671	3300025933	Bacteria	7368
601	Ga0207706_10057206	3300025933	Bacteria	3436
602	Ga0207706_10074067	3300025933	Bacteria	2994
603	Ga0207686_10103163	3300025934	Bacteria	1908
604	Ga0207686_10137525	3300025934	Bacteria	1684
605	Ga0207709_10000001	3300025935	Bacteria	2228154
606	Ga0207709_10105690	3300025935	Bacteria	1871
607	Ga0207709_10131806	3300025935	Bacteria	1705
608	Ga0207665_10000110	3300025939	Bacteria	53827
609	Ga0207665_10000836	3300025939	Bacteria	20786
610	Ga0207665_10003439	3300025939	Bacteria	10589
611	Ga0207665_10006149	3300025939	Bacteria	7973
612	Ga0207665_10048553	3300025939	Bacteria	2850
613	Ga0207665_10049003	3300025939	Bacteria	2838
614	Ga0207665_10113935	3300025939	Bacteria	1903
615	Ga0207665_10210750	3300025939	Bacteria	1419
616	Ga0207691_10009921	3300025940	Bacteria	9142
617	Ga0207691_10023464	3300025940	Bacteria	5808
618	Ga0207691_10025511	3300025940	Bacteria	5548
619	Ga0207691_10090507	3300025940	Bacteria	2742
620	Ga0207711_10000021	3300025941	Bacteria	355952
621	Ga0207711_10008827	3300025941	Bacteria	8428
622	Ga0207711_10018068	3300025941	Bacteria	5863
623	Ga0207711_10104916	3300025941	Bacteria	2505
624	Ga0207689_10001908	3300025942	Bacteria	19711
625	Ga0207689_10009281	3300025942	Bacteria	8504
626	Ga0207689_10015339	3300025942	Bacteria	6486
627	Ga0207689_10032937	3300025942	Bacteria	4307
628	Ga0207661_10183331	3300025944	Bacteria	1830
629	Ga0207679_10040889	3300025945	Bacteria	3321
630	Ga0207679_10190171	3300025945	Bacteria	1706
631	Ga0207679_10194987	3300025945	Bacteria	1687
632	Ga0207667_10007694	3300025949	Bacteria	12896
633	Ga0207667_10029360	3300025949	Bacteria	5964
634	Ga0207667_10050910	3300025949	Bacteria	4368
635	Ga0207667_10154310	3300025949	Bacteria	2363
636	Ga0207667_10267137	3300025949	Bacteria	1749
637	Ga0207712_10000148	3300025961	Bacteria	72568
638	Ga0207712_10001509	3300025961	Bacteria	15781
639	Ga0207712_10018892	3300025961	Bacteria	4496
640	Ga0207668_10004092	3300025972	Bacteria	8569
641	Ga0207668_10157608	3300025972	Bacteria	1765
642	Ga0207640_10002707	3300025981	Bacteria	9484
643	Ga0207658_10000555	3300025986	Bacteria	33908
644	Ga0207658_10015000	3300025986	Bacteria	5313
645	Ga0207658_10130302	3300025986	Bacteria	2020
646	Ga0207677_10013523	3300026023	Bacteria	4733
647	Ga0207677_10138169	3300026023	Bacteria	1861
648	Ga0207703_10000149	3300026035	Bacteria	80168
649	Ga0207703_10012392	3300026035	Bacteria	6645
650	Ga0207703_10183402	3300026035	Bacteria	1848
651	Ga0207639_10023938	3300026041	Bacteria	4413
652	Ga0207639_10196246	3300026041	Bacteria	1728
653	Ga0207678_10002509	3300026067	Bacteria	16704
654	Ga0207678_10008904	3300026067	Bacteria	8835
655	Ga0207678_10034232	3300026067	Bacteria	4425
656	Ga0207678_10042538	3300026067	Bacteria	3934
657	Ga0207678_10067322	3300026067	Bacteria	3074
658	Ga0207678_10319843	3300026067	Bacteria	1335
659	Ga0207708_10006195	3300026075	Bacteria	8866
660	Ga0207708_10036612	3300026075	Bacteria	3737
661	Ga0207708_10108336	3300026075	Bacteria	2155
662	Ga0207702_10024238	3300026078	Bacteria	5034
663	Ga0207702_10031911	3300026078	Bacteria	4394
664	Ga0207702_10056729	3300026078	Bacteria	3326
665	Ga0207641_10000005	3300026088	Bacteria	470841
666	Ga0207641_10000008	3300026088	Bacteria	424415
667	Ga0207648_10130635	3300026089	Bacteria	2211
668	Ga0207676_10000019	3300026095	Bacteria	305653
669	Ga0207676_10000049	3300026095	Bacteria	133695
670	Ga0207674_10003114	3300026116	Bacteria	20468
671	Ga0207674_10024371	3300026116	Bacteria	6468
672	Ga0207674_10033349	3300026116	Bacteria	5392
673	Ga0207674_10083656	3300026116	Bacteria	3191
674	Ga0207674_10092626	3300026116	Bacteria	3011
675	Ga0207674_10266163	3300026116	Bacteria	1661
676	Ga0207675_100003405	3300026118	Bacteria	15530
677	Ga0207675_100013383	3300026118	Bacteria	7655
678	Ga0207675_100114121	3300026118	Bacteria	2551
679	Ga0207675_100571901	3300026118	Bacteria	1131
680	Ga0207683_10001681	3300026121	Bacteria	19802
681	Ga0207683_10001732	3300026121	Bacteria	19433
682	Ga0207683_10093430	3300026121	Bacteria	2680
683	Ga0207698_10016317	3300026142	Bacteria	5003
684	Ga0207698_10019935	3300026142	Bacteria	4604
685	Ga0207698_10038915	3300026142	Bacteria	3518
686	Ga0209371_1000006	3300027312	Bacteria	1055642
687	Ga0209371_1000008	3300027312	Bacteria	1024606
688	Ga0207428_10089450	3300027907	Bacteria	2393
689	Ga0207428_10177711	3300027907	Bacteria	1609
690	Ga0207428_10260813	3300027907	Bacteria	1291
691	Ga0268266_10038719	3300028379	Bacteria	4059
692	Ga0268266_10060121	3300028379	Bacteria	3275
693	Ga0268265_10000165	3300028380	Bacteria	80699
694	Ga0268265_10112618	3300028380	Bacteria	2225
695	Ga0268265_10152037	3300028380	Bacteria	1953
696	Ga0268264_10059779	3300028381	Bacteria	3194
697	Ga0268264_10158808	3300028381	Bacteria	2034
698	Ga0268264_10230455	3300028381	Bacteria	1710
699	Ga0268264_10340054	3300028381	Bacteria	1425
700	Ga0268264_10390934	3300028381	Bacteria	1334
701	Ga0265319_1004182	3300028563	Bacteria	7227
702	Ga0265334_10057558	3300028573	Bacteria	1473
703	Ga0265318_10002515	3300028577	Bacteria	9735
704	Ga0265336_10000005	3300028666	Bacteria	399349
705	Ga0265336_10008838	3300028666	Bacteria	3512
706	Ga0265338_10000001	3300028800	Bacteria	1177449
707	Ga0265338_10010903	3300028800	Bacteria	10576
708	Ga0268256_1000007	3300030500	Bacteria	1055326
709	Ga0268256_1000009	3300030500	Bacteria	1022625
710	Ga0265762_1006823	3300030760	Bacteria	2040
711	Ga0265760_10036986	3300031090	Bacteria	1449
712	Ga0265340_10000001	3300031247	Bacteria	1647668
713	Ga0265339_10037585	3300031249	Bacteria	2705
714	Ga0265327_10048452	3300031251	Bacteria	2235
715	Ga0265327_10061873	3300031251	Bacteria	1907
716	Ga0265327_10090003	3300031251	Bacteria	1498
717	Ga0265316_10236769	3300031344	Bacteria	1343
718	Ga0307513_10007758	3300031456	Bacteria	13855
719	Ga0307513_10105448	3300031456	Bacteria	2828
720	Ga0307509_10000004	3300031507	Bacteria	535507
721	Ga0307408_100000387	3300031548	Bacteria	40174
722	Ga0307408_100271656	3300031548	Bacteria	1408
723	Ga0316575_10016255	3300031665	Bacteria	2814
724	Ga0316579_10119735	3300031691	Bacteria	1265
725	Ga0316576_10002159	3300031727	Bacteria	11090
726	Ga0316576_10004942	3300031727	Bacteria	8070
727	Ga0316576_10014931	3300031727	Bacteria	5197
728	Ga0316576_10023559	3300031727	Bacteria	4290
729	Ga0316576_10058201	3300031727	Bacteria	2827
730	Ga0316576_10220302	3300031727	Bacteria	1427
731	Ga0316578_10008294	3300031728	Bacteria	5278
732	Ga0316578_10011678	3300031728	Bacteria	4607
733	Ga0316578_10027510	3300031728	Bacteria	3214
734	Ga0316577_10005905	3300031733	Bacteria	6445
735	Ga0307413_10092852	3300031824	Bacteria	1971
736	Ga0307409_100049254	3300031995	Bacteria	3211
737	Ga0307409_100106607	3300031995	Bacteria	2339
738	Ga0307416_100237259	3300032002	Bacteria	1764
739	Ga0373930_0002746	3300034816	Bacteria	2745
740	Ga0373959_0006108	3300034820	Bacteria	1991
741	Ga0373959_0009144	3300034820	Bacteria	1702
742	Ga0373926_0009320	3300035083	Bacteria	3278
743	Ga0373928_0000501	3300035084	Bacteria	7713
744	Ga0373929_0008922	3300035085	Bacteria	1853
745	Ga0373934_0000074	3300035086	Bacteria	34573
746	Ga0373934_0004420	3300035086	Bacteria	5192
747	Ga0373934_0011417	3300035086	Bacteria	3341
748	Ga0373934_0013932	3300035086	Bacteria	3042
749	Ga0373934_0025762	3300035086	Bacteria	2279
750	Ga0373944_0002708	3300035089	Bacteria	4521
751	Ga0373944_0012433	3300035089	Bacteria	2346
752	Ga0373949_0022946	3300035090	Bacteria	1442
753	Ga0373951_0007038	3300035091	Bacteria	2563
754	Ga0373951_0031416	3300035091	Bacteria	1252
755	Ga0373952_0008979	3300035092	Bacteria	1906
756	Ga0373923_0003312	3300035111	Bacteria	5143
757	Ga0373923_0007133	3300035111	Bacteria	3913
758	Ga0373923_0067947	3300035111	Bacteria	1525
759	Ga0373923_0070525	3300035111	Bacteria	1500
760	Ga0373923_0107184	3300035111	Bacteria	1237
761	Ga0373932_0000217	3300035112	Bacteria	17000
762	Ga0373932_0003244	3300035112	Bacteria	3937
763	Ga0373932_0011995	3300035112	Bacteria	2128
764	Ga0373936_0000119	3300035113	Bacteria	27899
765	Ga0373936_0001254	3300035113	Bacteria	9160
766	Ga0373936_0003910	3300035113	Bacteria	5612
767	Ga0373936_0088890	3300035113	Bacteria	1293
768	Ga0373939_0005890	3300035114	Bacteria	2933
769	Ga0373941_0031976	3300035115	Bacteria	1572
770	Ga0373945_0000755	3300035116	Bacteria	9443
771	Ga0373953_0001822	3300035117	Bacteria	6292
772	Ga0373953_0008422	3300035117	Bacteria	3502
773	Ga0373953_0015121	3300035117	Bacteria	2789
774	Ga0373953_0056397	3300035117	Bacteria	1597
775	Ga0373954_0008571	3300035118	Bacteria	4495
776	Ga0373954_0009201	3300035118	Bacteria	4346
777	Ga0373954_0034572	3300035118	Bacteria	2341
778	Ga0373954_0054112	3300035118	Bacteria	1887
779	Ga0373956_0001407	3300035119	Bacteria	9949
780	Ga0373956_0020403	3300035119	Bacteria	2819
781	Ga0373957_0000056	3300035120	Bacteria	28254
782	Ga0373957_0002119	3300035120	Bacteria	5579
783	Ga0373957_0040416	3300035120	Bacteria	1753
784	Ga0373957_0087385	3300035120	Bacteria	1235
785	Ga0373960_0010364	3300035121	Bacteria	2275
786	Ga0373943_0008618	3300035170	Bacteria	4572
787	Ga0373943_0030676	3300035170	Bacteria	2546
788	Ga0373943_0044748	3300035170	Bacteria	2155
789	Ga0373943_0076988	3300035170	Bacteria	1702
790	Ga0373943_0098645	3300035170	Bacteria	1524
791	Ga0373943_0100093	3300035170	Bacteria	1515
792	Ga0373946_0001411	3300035171	Bacteria	8333
793	Ga0373955_0004271	3300035172	Bacteria	6312
794	Ga0373955_0013253	3300035172	Bacteria	3981
795	Ga0373955_0096568	3300035172	Bacteria	1691
796	Ga0373955_0140777	3300035172	Bacteria	1414
797	Ga0373942_0002905	3300035207	Bacteria	4064
798	Ga0373962_0025291	3300035242	Bacteria	1594
799	Ga0316574_0006801	3300035398	Bacteria	6215
800	Ga0316574_0011379	3300035398	Bacteria	5056
801	Ga0316574_0011947	3300035398	Bacteria	4952
802	Ga0316574_0035842	3300035398	Bacteria	3034
803	Ga0316574_0126126	3300035398	Bacteria	1646
804	Ga0373924_0000088	3300035410	Bacteria	25289
805	Ga0373924_0002191	3300035410	Bacteria	6543
806	Ga0373924_0003031	3300035410	Bacteria	5726
807	Ga0373924_0003240	3300035410	Bacteria	5570
808	Ga0373931_0000005	3300035691	Bacteria	480485
809	Ga0373931_0000027	3300035691	Bacteria	123672
810	Ga0373931_0002914	3300035691	Bacteria	7634
811	Ga0373931_0149047	3300035691	Bacteria	1362
812	Ga0373931_0154931	3300035691	Bacteria	1338
813	Ga0373935_0004208	3300035692	Bacteria	8433
814	Ga0373935_0009981	3300035692	Bacteria	5687
815	Ga0373935_0011653	3300035692	Bacteria	5280
816	Ga0373935_0080562	3300035692	Bacteria	2115
817	Ga0373927_0022062	3300035695	Bacteria	4172
818	Ga0373927_0248107	3300035695	Bacteria	1170
819	Ga0373933_0000005	3300035724	Bacteria	128820
820	Ga0373933_0033741	3300035724	Bacteria	2979
821	Ga0373933_0071890	3300035724	Bacteria	2106
822	Ga0373947_0000220	3300035725	Bacteria	32120
823	Ga0373947_0090298	3300035725	Bacteria	1909
824	Ga0373937_0000278	3300036401	Bacteria	48828
825	Ga0373937_0054255	3300036401	Bacteria	3677
826	Ga0373937_0079557	3300036401	Bacteria	3029
827	Ga0373937_0189654	3300036401	Bacteria	1931
828	Ga0372808_000663	3300036459	Bacteria	2966
829	Ga0372808_001740	3300036459	Bacteria	2350
830	Ga0316582_0010895	3300036647	Bacteria	5004
831	Ga0316582_0095040	3300036647	Bacteria	1967
832	Ga0316584_0003409	3300036712	Bacteria	10313
833	Ga0316584_0004433	3300036712	Bacteria	9296
834	Ga0316584_0008628	3300036712	Bacteria	7028
835	Ga0316584_0050522	3300036712	Bacteria	3109
836	Ga0316584_0102651	3300036712	Bacteria	2141
837	Ga0373925_0041858	3300037068	Bacteria	3397
838	Ga0373925_0055558	3300037068	Bacteria	2964
839	Ga0436364_0033704	3300037853	Bacteria	1710
840	Ga0436364_0509088	3300037853	Bacteria	1565
841	Ga0436364_0604875	3300037853	Bacteria	15615
842	Ga0436364_0676163	3300037853	Bacteria	64006
843	Ga0436364_0757834	3300037853	Bacteria	1263
844	Ga0436364_0786042	3300037853	Bacteria	20160
845	Ga0436364_0802940	3300037853	Bacteria	6735
846	Ga0436364_1227141	3300037853	Bacteria	4136
847	Ga0436364_1456387	3300037853	Bacteria	1888
848	Ga0436364_1464045	3300037853	Bacteria	3338
849	Ga0395901_0060605	3300038443	Bacteria	3938
850	Ga0400485_02355	3300038735	Bacteria	4319
851	Ga0400483_058289	3300039062	Bacteria	9230
852	Ga0400483_215395	3300039062	Bacteria	9338
853	Ga0400483_232124	3300039062	Bacteria	10279
854	Ga0400483_245537	3300039062	Bacteria	4243
855	Ga0237816_01881	3300039145	Bacteria	1672
856	Ga0436365_0012902	3300039437	Bacteria	1185
857	Ga0436365_0075484	3300039437	Bacteria	13035
858	Ga0436365_0758715	3300039437	Bacteria	2292
859	Ga0436365_1202098	3300039437	Bacteria	19080
860	Ga0436361_0374946	3300039447	Bacteria	3283
861	Ga0436361_1186958	3300039447	Bacteria	1328
862	Ga0436362_0035386	3300039453	Bacteria	9973
863	Ga0436362_0131109	3300039453	Bacteria	1777
864	Ga0439447_043708	3300041407	Bacteria	1085
865	Ga0439466_0021474	3300041411	Bacteria	2287
866	Ga0439465_0053120	3300041413	Bacteria	1331
867	Ga0451791_1300260	3300041451	Bacteria	2966
868	Ga0451843_0067489	3300041509	Bacteria	1551
869	Ga0451843_1574986	3300041509	Bacteria	1340
870	Ga0439445_0031973	3300042004	Bacteria	1370
871	Ga0439432_032374	3300042006	Bacteria	1686
872	Ga0439449_0001300	3300042007	Bacteria	9777
873	Ga0439450_014046	3300042008	Bacteria	1618
874	Ga0439452_019347	3300042010	Bacteria	1802
875	Ga0439457_022828	3300042014	Bacteria	1385
876	Ga0439440_0002061	3300042993	Bacteria	3749
877	Ga0466969_0002027	3300044656	Bacteria	10820
878	Ga0466969_0016901	3300044656	Bacteria	3815
879	Ga0466972_0002652	3300044658	Bacteria	8856
880	Ga0466965_0000829	3300044683	Bacteria	11695
881	Ga0466965_0003566	3300044683	Bacteria	6843
882	Ga0466966_0011220	3300044684	Bacteria	5945
883	Ga0466966_0023668	3300044684	Bacteria	4020
884	Ga0466966_0068845	3300044684	Bacteria	2221
885	Ga0466961_0018481	3300044693	Bacteria	4484
886	Ga0466963_0005494	3300044694	Bacteria	7421
887	Ga0466963_0015101	3300044694	Bacteria	4775
888	Ga0466963_0027405	3300044694	Bacteria	3648
889	Ga0466963_0039987	3300044694	Bacteria	3073
890	Ga0466963_0052033	3300044694	Bacteria	2716
891	Ga0466963_0105466	3300044694	Bacteria	1932
892	Ga0466963_0134633	3300044694	Bacteria	1709
893	Ga0466964_0029818	3300044706	Bacteria	2156
894	Ga0466971_0092278	3300044719	Bacteria	1387
895	Ga0466968_0002914	3300044735	Bacteria	6321
896	Ga0466968_0035557	3300044735	Bacteria	2085
897	Ga0466970_0054126	3300044765	Bacteria	2143
898	Ga0466957_0007518	3300044842	Bacteria	6156
899	Ga0466957_0157063	3300044842	Bacteria	1475
900	Ga0466959_0017904	3300045049	Bacteria	5197
901	Ga0466959_0124003	3300045049	Bacteria	1834
902	Ga0466958_0185212	3300045836	Bacteria	1322
903	Ga0466967_0012564	3300045976	Bacteria	6486
904	Ga0466967_0019489	3300045976	Bacteria	5455
905	Ga0466967_0024982	3300045976	Bacteria	4919
906	Ga0466967_0089070	3300045976	Bacteria	2802
907	Ga0466967_0089880	3300045976	Bacteria	2789
908	Ga0466967_0111096	3300045976	Bacteria	2518
909	Ga0466967_0621354	3300045976	Bacteria	1067
910	Ga0495627_000110	3300046453	Bacteria	101742
911	Ga0495592_0000010	3300046454	Bacteria	157001
912	Ga0495592_0006585	3300046454	Bacteria	8655
913	Ga0495592_0012104	3300046454	Bacteria	6544
914	Ga0495592_0027319	3300046454	Bacteria	4327
915	Ga0495592_0043975	3300046454	Bacteria	3339
916	Ga0495592_0052562	3300046454	Bacteria	3024
917	Ga0495592_0137810	3300046454	Bacteria	1700
918	Ga0495603_0003396	3300046455	Bacteria	9478
919	Ga0495603_0018742	3300046455	Bacteria	4188
920	Ga0495629_0003600	3300046459	Bacteria	11706
921	Ga0495629_0004898	3300046459	Bacteria	10049
922	Ga0495629_0012270	3300046459	Bacteria	6206
923	Ga0495641_0004957	3300046461	Bacteria	9200
924	Ga0495641_0008522	3300046461	Bacteria	6236
925	Ga0495641_0013408	3300046461	Bacteria	4506
926	Ga0495641_0040339	3300046461	Bacteria	2171
927	Ga0495641_0064342	3300046461	Bacteria	1652
928	Ga0495651_0000006	3300046462	Bacteria	171575
929	Ga0495651_0006392	3300046462	Bacteria	9017
930	Ga0495651_0016070	3300046462	Bacteria	5796
931	Ga0495651_0017225	3300046462	Bacteria	5599
932	Ga0495651_0031182	3300046462	Bacteria	4158
933	Ga0495651_0035502	3300046462	Bacteria	3880
934	Ga0495651_0053979	3300046462	Bacteria	3092
935	Ga0495651_0106132	3300046462	Bacteria	2082
936	Ga0495653_0016641	3300046463	Bacteria	5985
937	Ga0495653_0028100	3300046463	Bacteria	4501
938	Ga0495653_0041667	3300046463	Bacteria	3582
939	Ga0495653_0059979	3300046463	Bacteria	2884
940	Ga0495653_0062265	3300046463	Bacteria	2819
941	Ga0495653_0064751	3300046463	Bacteria	2753
942	Ga0495653_0076719	3300046463	Bacteria	2483
943	Ga0495653_0088750	3300046463	Bacteria	2267
944	Ga0495653_0108270	3300046463	Bacteria	2001
945	Ga0495653_0121353	3300046463	Bacteria	1862
946	Ga0495580_0011635	3300046472	Bacteria	6805
947	Ga0495580_0081125	3300046472	Bacteria	2261
948	Ga0495580_0101173	3300046472	Bacteria	2004
949	Ga0495580_0101941	3300046472	Bacteria	1996
950	Ga0495582_0002548	3300046473	Bacteria	10144
951	Ga0495582_0003759	3300046473	Bacteria	8558
952	Ga0495582_0143380	3300046473	Bacteria	1354
953	Ga0495639_0016401	3300046475	Bacteria	3216
954	Ga0495662_0000649	3300046476	Bacteria	16301
955	Ga0495662_0001170	3300046476	Bacteria	12942
956	Ga0495662_0003177	3300046476	Bacteria	8297
957	Ga0495662_0009850	3300046476	Bacteria	4694
958	Ga0495662_0015376	3300046476	Bacteria	3717
959	Ga0495664_0044348	3300046477	Bacteria	2635
960	Ga0495664_0069108	3300046477	Bacteria	2108
961	Ga0495594_0013981	3300046499	Bacteria	4202
962	Ga0495607_0086639	3300046501	Bacteria	1707
963	Ga0495607_0103113	3300046501	Bacteria	1524
964	Ga0495608_0000243	3300046511	Bacteria	39556
965	Ga0495608_0000955	3300046511	Bacteria	20371
966	Ga0495608_0012153	3300046511	Bacteria	5983
967	Ga0495608_0013781	3300046511	Bacteria	5609
968	Ga0495608_0047023	3300046511	Bacteria	2870
969	Ga0495608_0062595	3300046511	Bacteria	2444
970	Ga0495608_0071773	3300046511	Bacteria	2259
971	Ga0495608_0109376	3300046511	Bacteria	1777
972	Ga0495608_0132923	3300046511	Bacteria	1591
973	Ga0495610_0000013	3300046512	Bacteria	465872
974	Ga0495616_0000032	3300046513	Bacteria	130692
975	Ga0495618_0001036	3300046514	Bacteria	19045
976	Ga0495618_0040927	3300046514	Bacteria	2917
977	Ga0495618_0065699	3300046514	Bacteria	2305
978	Ga0495620_0006077	3300046515	Bacteria	6677
979	Ga0495628_0000566	3300046516	Bacteria	33950
980	Ga0495628_0009608	3300046516	Bacteria	8252
981	Ga0495628_0010807	3300046516	Bacteria	7732
982	Ga0495628_0162672	3300046516	Bacteria	1695
983	Ga0495628_0176461	3300046516	Bacteria	1618
984	Ga0495630_0006721	3300046517	Bacteria	8194
985	Ga0495630_0034365	3300046517	Bacteria	3786
986	Ga0495630_0047622	3300046517	Bacteria	3207
987	Ga0495630_0048699	3300046517	Bacteria	3171
988	Ga0495630_0078485	3300046517	Bacteria	2489
989	Ga0495630_0183914	3300046517	Bacteria	1594
990	Ga0495630_0202682	3300046517	Bacteria	1514
991	Ga0495643_0094826	3300046522	Bacteria	1535
992	Ga0495663_0000041	3300046525	Bacteria	63505
993	Ga0495663_0012611	3300046525	Bacteria	2356
994	Ga0495666_0015344	3300046526	Bacteria	3814
995	Ga0495666_0051407	3300046526	Bacteria	1980
996	Ga0495666_0079308	3300046526	Bacteria	1554
997	Ga0495652_0000415	3300046529	Bacteria	49757
998	Ga0495652_0003238	3300046529	Bacteria	16225
999	Ga0495652_0014498	3300046529	Bacteria	7074
1000	Ga0495652_0017823	3300046529	Bacteria	6337
1001	Ga0495652_0032816	3300046529	Bacteria	4537
1002	Ga0495652_0131791	3300046529	Bacteria	1978
1003	Ga0495665_0003630	3300046531	Bacteria	8374
1004	Ga0495665_0032011	3300046531	Bacteria	2813
1005	Ga0495640_0014491	3300046533	Bacteria	5961
1006	Ga0495640_0021723	3300046533	Bacteria	4703
1007	Ga0495640_0027072	3300046533	Bacteria	4138
1008	Ga0495640_0050138	3300046533	Bacteria	2877
1009	Ga0495640_0098754	3300046533	Bacteria	1919
1010	Ga0495586_0001504	3300046535	Bacteria	12869
1011	Ga0495586_0009784	3300046535	Bacteria	5104
1012	Ga0495586_0053888	3300046535	Bacteria	2179
1013	Ga0495587_0000049	3300046536	Bacteria	104756
1014	Ga0495587_0011091	3300046536	Bacteria	5716
1015	Ga0495587_0059565	3300046536	Bacteria	2240
1016	Ga0495587_0072640	3300046536	Bacteria	1999
1017	Ga0495645_0007547	3300046543	Bacteria	7565
1018	Ga0495645_0026918	3300046543	Bacteria	4176
1019	Ga0495645_0048487	3300046543	Bacteria	3093
1020	Ga0495645_0057004	3300046543	Bacteria	2837
1021	Ga0495645_0079474	3300046543	Bacteria	2355
1022	Ga0495645_0098882	3300046543	Bacteria	2076
1023	Ga0495667_0000041	3300046559	Bacteria	124884
1024	Ga0495667_0001387	3300046559	Bacteria	15949
1025	Ga0495667_0005665	3300046559	Bacteria	8451
1026	Ga0495667_0006595	3300046559	Bacteria	7880
1027	Ga0495667_0020456	3300046559	Bacteria	4464
1028	Ga0495667_0095863	3300046559	Bacteria	1920
1029	Ga0495667_0102530	3300046559	Bacteria	1850
1030	Ga0495668_0007996	3300046616	Bacteria	6665
1031	Ga0495634_0003643	3300046642	Bacteria	12289
1032	Ga0495634_0018131	3300046642	Bacteria	5014
1033	Ga0495634_0077598	3300046642	Bacteria	2178
1034	Ga0495634_0202145	3300046642	Bacteria	1234
1035	Ga0495625_0000911	3300046660	Bacteria	39772
1036	Ga0495625_0076269	3300046660	Bacteria	2344
1037	Ga0495635_0006189	3300046663	Bacteria	8338
1038	Ga0495635_0008669	3300046663	Bacteria	7101
1039	Ga0495635_0012396	3300046663	Bacteria	5974
1040	Ga0495635_0057977	3300046663	Bacteria	2664
1041	Ga0495635_0059571	3300046663	Bacteria	2625
1042	Ga0495661_0149716	3300046665	Bacteria	1262
1043	Ga0495657_0000126	3300046675	Bacteria	68659
1044	Ga0495657_0001156	3300046675	Bacteria	23145
1045	Ga0495657_0001976	3300046675	Bacteria	17474
1046	Ga0495657_0008646	3300046675	Bacteria	7769
1047	Ga0495657_0026456	3300046675	Bacteria	4107
1048	Ga0495657_0042552	3300046675	Bacteria	3100
1049	Ga0495657_0051433	3300046675	Bacteria	2766
1050	Ga0495657_0078154	3300046675	Bacteria	2145
1051	Ga0495657_0096449	3300046675	Bacteria	1890
1052	Ga0495599_0000208	3300046678	Bacteria	38561
1053	Ga0495599_0001775	3300046678	Bacteria	12511
1054	Ga0495599_0018711	3300046678	Bacteria	4316
1055	Ga0495599_0018766	3300046678	Bacteria	4310
1056	Ga0495599_0038666	3300046678	Bacteria	2998
1057	Ga0495599_0049461	3300046678	Bacteria	2635
1058	Ga0495599_0108324	3300046678	Bacteria	1731
1059	Ga0495599_0148868	3300046678	Bacteria	1451
1060	Ga0495623_0000080	3300046679	Bacteria	57432
1061	Ga0495623_0031511	3300046679	Bacteria	3408
1062	Ga0495623_0067957	3300046679	Bacteria	2223
1063	Ga0495623_0070471	3300046679	Bacteria	2178
1064	Ga0495623_0076412	3300046679	Bacteria	2078
1065	Ga0495646_0010008	3300046680	Bacteria	6029
1066	Ga0495646_0065778	3300046680	Bacteria	2145
1067	Ga0495646_0093322	3300046680	Bacteria	1734
1068	Ga0495647_0001573	3300046681	Bacteria	7044
1069	Ga0495647_0015118	3300046681	Bacteria	2699
1070	Ga0495647_0032207	3300046681	Bacteria	1953
1071	Ga0495658_0005908	3300046683	Bacteria	6008
1072	Ga0495658_0015267	3300046683	Bacteria	3938
1073	Ga0495658_0211687	3300046683	Bacteria	1211
1074	Ga0495669_0005687	3300046684	Bacteria	5200
1075	Ga0495613_0000845	3300046689	Bacteria	23540
1076	Ga0495613_0004976	3300046689	Bacteria	9981
1077	Ga0495613_0107782	3300046689	Bacteria	2009
1078	Ga0495613_0125773	3300046689	Bacteria	1839
1079	Ga0495624_0021883	3300046690	Bacteria	4235
1080	Ga0495624_0056784	3300046690	Bacteria	2462
1081	Ga0495624_0090776	3300046690	Bacteria	1885
1082	Ga0495671_0000862	3300046692	Bacteria	21694
1083	Ga0495589_0010318	3300046794	Bacteria	4852
1084	Ga0495589_0018316	3300046794	Bacteria	3591
1085	Ga0495600_0002375	3300046809	Bacteria	10763
1086	Ga0495600_0007334	3300046809	Bacteria	6738
1087	Ga0495600_0007516	3300046809	Bacteria	6670
1088	Ga0495600_0037708	3300046809	Bacteria	3143
1089	Ga0495600_0064147	3300046809	Bacteria	2401
1090	Ga0495600_0106200	3300046809	Bacteria	1829
1091	Ga0495600_0184292	3300046809	Bacteria	1345
1092	Ga0495581_0000351	3300047315	Bacteria	22939
1093	Ga0495581_0000521	3300047315	Bacteria	19689
1094	Ga0495581_0005105	3300047315	Bacteria	7602
1095	Ga0495581_0036056	3300047315	Bacteria	2861
1096	Ga0495604_0000110	3300047317	Bacteria	68659
1097	Ga0495604_0011376	3300047317	Bacteria	7062
1098	Ga0495604_0016743	3300047317	Bacteria	5864
1099	Ga0495604_0017187	3300047317	Bacteria	5787
1100	Ga0495604_0023947	3300047317	Bacteria	4873
1101	Ga0495604_0116430	3300047317	Bacteria	1940
1102	Ga0495674_0018851	3300047319	Bacteria	6417
1103	Ga0495674_0034272	3300047319	Bacteria	4592
1104	Ga0495674_0113178	3300047319	Bacteria	2298
1105	Ga0495674_0218663	3300047319	Bacteria	1575
1106	Ga0495672_0000459	3300047320	Bacteria	48101
1107	Ga0495676_0023169	3300047321	Bacteria	5392
1108	Ga0495676_0026844	3300047321	Bacteria	4948
1109	Ga0495676_0039795	3300047321	Bacteria	3889
1110	Ga0495676_0133979	3300047321	Bacteria	1784
1111	Ga0495680_0000470	3300047322	Bacteria	45402
1112	Ga0495680_0016062	3300047322	Bacteria	6437
1113	Ga0495680_0018088	3300047322	Bacteria	5996
1114	Ga0495680_0054190	3300047322	Bacteria	3115
1115	Ga0495680_0054251	3300047322	Bacteria	3113
1116	Ga0495680_0132445	3300047322	Bacteria	1831
1117	Ga0495680_0140073	3300047322	Bacteria	1770
1118	Ga0495680_0154501	3300047322	Bacteria	1670
1119	Ga0495680_0172957	3300047322	Bacteria	1563
1120	Ga0495675_0001308	3300047444	Bacteria	15081
1121	Ga0495675_0012268	3300047444	Bacteria	5394
1122	Ga0495675_0012301	3300047444	Bacteria	5387
1123	Ga0495675_0045652	3300047444	Bacteria	2790
1124	Ga0495685_009173	3300047447	Bacteria	3299
1125	Ga0495685_018896	3300047447	Bacteria	2366
1126	Ga0495684_0007979	3300047471	Bacteria	8181
1127	Ga0495684_0015817	3300047471	Bacteria	5807
1128	Ga0495684_0016585	3300047471	Bacteria	5674
1129	Ga0495684_0044762	3300047471	Bacteria	3387
1130	Ga0495684_0081883	3300047471	Bacteria	2449
1131	Ga0495684_0116175	3300047471	Bacteria	2017
1132	Ga0495684_0176765	3300047471	Bacteria	1584
1133	Ga0495593_0002534	3300047673	Bacteria	10972
1134	Ga0495593_0008687	3300047673	Bacteria	5903
1135	Ga0495593_0012098	3300047673	Bacteria	4940
1136	Ga0495602_0000345	3300048088	Bacteria	42944
1137	Ga0495602_0017183	3300048088	Bacteria	7254
1138	Ga0495602_0049716	3300048088	Bacteria	3753
1139	Ga0495602_0116355	3300048088	Bacteria	2160
1140	Ga0495602_0286427	3300048088	Bacteria	1211
1141	Ga0496100_0011379	3300048903	Bacteria	5064
1142	Ga0496100_0034446	3300048903	Bacteria	3178
1143	Ga0496100_0044118	3300048903	Bacteria	2854
1144	Ga0496101_0011569	3300048904	Bacteria	5859
1145	Ga0496101_0029917	3300048904	Bacteria	3812
1146	Ga0496101_0061222	3300048904	Bacteria	2733
1147	Ga0496101_0072304	3300048904	Bacteria	2531
1148	Ga0496102_0000121	3300048905	Bacteria	112133
1149	Ga0496102_0017751	3300048905	Bacteria	6237
1150	Ga0496102_0018389	3300048905	Bacteria	6141
1151	Ga0496102_0032155	3300048905	Bacteria	4713
1152	Ga0496102_0107091	3300048905	Bacteria	2602
1153	Ga0496102_0191357	3300048905	Bacteria	1928
1154	Ga0496103_0000224	3300048906	Bacteria	55730
1155	Ga0496103_0005303	3300048906	Bacteria	7733
1156	Ga0496103_0025461	3300048906	Bacteria	3576
1157	Ga0496103_0039407	3300048906	Bacteria	2903
1158	Ga0496103_0133196	3300048906	Bacteria	1588
1159	Ga0496103_0145545	3300048906	Bacteria	1517
1160	Ga0496104_0004532	3300048907	Bacteria	12107
1161	Ga0496104_0006922	3300048907	Bacteria	10002
1162	Ga0496104_0007859	3300048907	Bacteria	9455
1163	Ga0496104_0011347	3300048907	Bacteria	7974
1164	Ga0496104_0016014	3300048907	Bacteria	6807
1165	Ga0496104_0033156	3300048907	Bacteria	4808
1166	Ga0496104_0077574	3300048907	Bacteria	3165
1167	Ga0496105_0007753	3300048908	Bacteria	8329
1168	Ga0496105_0025217	3300048908	Bacteria	4837
1169	Ga0496105_0031764	3300048908	Bacteria	4330
1170	Ga0496105_0044914	3300048908	Bacteria	3645
1171	Ga0496105_0055772	3300048908	Bacteria	3262
1172	Ga0496105_0091186	3300048908	Bacteria	2517
1173	Ga0496105_0177619	3300048908	Bacteria	1744
1174	Ga0496106_0051571	3300048909	Bacteria	3102
1175	Ga0496106_0080505	3300048909	Bacteria	2501
1176	Ga0496106_0106791	3300048909	Bacteria	2176
1177	Ga0496106_0171546	3300048909	Bacteria	1719
1178	Ga0496107_0012475	3300048910	Bacteria	5931
1179	Ga0496107_0023821	3300048910	Bacteria	4327
1180	Ga0496107_0039362	3300048910	Bacteria	3391
1181	Ga0496108_0013234	3300048911	Bacteria	6724
1182	Ga0496108_0015337	3300048911	Bacteria	6251
1183	Ga0496108_0023390	3300048911	Bacteria	5084
1184	Ga0496108_0239178	3300048911	Bacteria	1579
1185	Ga0496109_0010382	3300048912	Bacteria	7953
1186	Ga0496109_0017894	3300048912	Bacteria	6219
1187	Ga0496109_0031113	3300048912	Bacteria	4787
1188	Ga0496109_0048341	3300048912	Bacteria	3871
1189	Ga0496109_0107561	3300048912	Bacteria	2591
1190	Ga0496110_0000640	3300048913	Bacteria	23997
1191	Ga0496110_0003291	3300048913	Bacteria	12331
1192	Ga0496110_0010185	3300048913	Bacteria	7639
1193	Ga0496110_0011073	3300048913	Bacteria	7364
1194	Ga0496110_0014565	3300048913	Bacteria	6534
1195	Ga0496110_0061335	3300048913	Bacteria	3318
1196	Ga0496110_0077614	3300048913	Bacteria	2955
1197	Ga0496110_0284975	3300048913	Bacteria	1504
1198	Ga0496110_0325162	3300048913	Bacteria	1401
1199	Ga0496110_0352531	3300048913	Bacteria	1340
1200	Ga0496111_0010632	3300048914	Bacteria	6185
1201	Ga0496111_0033772	3300048914	Bacteria	3650
1202	Ga0496111_0050523	3300048914	Bacteria	3000
1203	Ga0496111_0073792	3300048914	Bacteria	2484
1204	Ga0496111_0114534	3300048914	Bacteria	1988
1205	Ga0496111_0115037	3300048914	Bacteria	1983
1206	Ga0496112_0002361	3300048915	Bacteria	15165
1207	Ga0496112_0027178	3300048915	Bacteria	5517
1208	Ga0496112_0068395	3300048915	Bacteria	3507
1209	Ga0496112_0143814	3300048915	Bacteria	2354
1210	Ga0496112_0170150	3300048915	Bacteria	2144
1211	Ga0496113_0026225	3300048916	Bacteria	4164
1212	Ga0496113_0115992	3300048916	Bacteria	2089
1213	Ga0496113_0184209	3300048916	Bacteria	1655
1214	Ga0496114_0000840	3300048917	Bacteria	23001
1215	Ga0496114_0001257	3300048917	Bacteria	19194
1216	Ga0496114_0002103	3300048917	Bacteria	15142
1217	Ga0496114_0009000	3300048917	Bacteria	7915
1218	Ga0496114_0019711	3300048917	Bacteria	5467
1219	Ga0496114_0062677	3300048917	Bacteria	3112
1220	Ga0496114_0093864	3300048917	Bacteria	2552
1221	Ga0496114_0129640	3300048917	Bacteria	2177
1222	Ga0496114_0148994	3300048917	Bacteria	2029
1223	Ga0496114_0239133	3300048917	Bacteria	1596
1224	Ga0496114_0245293	3300048917	Bacteria	1576
1225	Ga0496114_0334493	3300048917	Bacteria	1339
1226	Ga0496115_0016938	3300048918	Bacteria	5559
1227	Ga0496115_0024948	3300048918	Bacteria	4651
1228	Ga0496115_0034855	3300048918	Bacteria	3978
1229	Ga0496115_0049785	3300048918	Bacteria	3355
1230	Ga0496115_0051318	3300048918	Bacteria	3307
1231	Ga0496115_0087035	3300048918	Bacteria	2549
1232	Ga0496115_0088232	3300048918	Bacteria	2532
1233	Ga0496115_0125518	3300048918	Bacteria	2114
1234	Ga0496115_0169186	3300048918	Bacteria	1807
1235	Ga0496116_0001687	3300048919	Bacteria	24198
1236	Ga0496116_0002425	3300048919	Bacteria	19649
1237	Ga0496117_0022116	3300048920	Bacteria	5109
1238	Ga0496117_0045443	3300048920	Bacteria	3171
1239	Ga0496118_0000322	3300048921	Bacteria	82886
1240	Ga0496118_0000462	3300048921	Bacteria	67416
1241	Ga0496118_0031380	3300048921	Bacteria	4406
1242	Ga0496118_0044709	3300048921	Bacteria	3465
1243	Ga0496118_0172570	3300048921	Bacteria	1319
1244	Ga0496119_0000104	3300048922	Bacteria	121325
1245	Ga0496120_0002351	3300048923	Bacteria	19430
1246	Ga0496121_0006448	3300048924	Bacteria	14558
1247	Ga0496121_0009278	3300048924	Bacteria	11348
1248	Ga0496121_0028527	3300048924	Bacteria	5192
1249	Ga0496121_0111659	3300048924	Bacteria	2084
1250	Ga0496121_0134614	3300048924	Bacteria	1843
1251	Ga0496121_0297850	3300048924	Bacteria	1096
1252	Ga0496123_0002402	3300048926	Bacteria	23389
1253	Ga0496124_0000459	3300048927	Bacteria	70625
1254	Ga0496125_0030253	3300048928	Bacteria	4847
1255	Ga0496125_0053137	3300048928	Bacteria	3325
1256	Ga0496126_0000037	3300048929	Bacteria	353425
1257	Ga0496126_0000999	3300048929	Bacteria	48191
1258	Ga0496126_0004694	3300048929	Bacteria	16143
1259	Ga0496126_0005936	3300048929	Bacteria	13766
1260	Ga0496126_0075454	3300048929	Bacteria	2992
1261	Ga0496126_0231817	3300048929	Bacteria	1547
1262	Ga0501294_005152	3300049517	Bacteria	1235
1263	Ga0501031_0000485	3300049568	Bacteria	23163
1264	Ga0501031_0022708	3300049568	Bacteria	4090
1265	Ga0501031_0163834	3300049568	Bacteria	1453
1266	Ga0501032_0000424	3300049569	Bacteria	35024
1267	Ga0501032_0008084	3300049569	Bacteria	7668
1268	Ga0501033_0016983	3300049570	Bacteria	5502
1269	Ga0501033_0061288	3300049570	Bacteria	2773
1270	Ga0501033_0066414	3300049570	Bacteria	2652
1271	Ga0501033_0170713	3300049570	Bacteria	1562
1272	Ga0501034_0000339	3300049571	Bacteria	81769
1273	Ga0501034_0011396	3300049571	Bacteria	9220
1274	Ga0501034_0026673	3300049571	Bacteria	5879
1275	Ga0501034_0027747	3300049571	Bacteria	5757
1276	Ga0501034_0029476	3300049571	Bacteria	5578
1277	Ga0501034_0116918	3300049571	Bacteria	2654
1278	Ga0501034_0120428	3300049571	Bacteria	2611
1279	Ga0501034_0168887	3300049571	Bacteria	2155
1280	Ga0501034_0198045	3300049571	Bacteria	1968
1281	Ga0501036_0005274	3300049572	Bacteria	10456
1282	Ga0501036_0026339	3300049572	Bacteria	4907
1283	Ga0501036_0108991	3300049572	Bacteria	2340
1284	Ga0501036_0124055	3300049572	Bacteria	2181
1285	Ga0501037_0003342	3300049573	Bacteria	11657
1286	Ga0501037_0043187	3300049573	Bacteria	3313
1287	Ga0501037_0049439	3300049573	Bacteria	3079
1288	Ga0501037_0050557	3300049573	Bacteria	3042
1289	Ga0501038_0007562	3300049574	Bacteria	10018
1290	Ga0501038_0021944	3300049574	Bacteria	5726
1291	Ga0501038_0028260	3300049574	Bacteria	4983
1292	Ga0501038_0035688	3300049574	Bacteria	4365
1293	Ga0501038_0104806	3300049574	Bacteria	2350
1294	Ga0501038_0127699	3300049574	Bacteria	2091
1295	Ga0501038_0161269	3300049574	Bacteria	1822
1296	Ga0501038_0253855	3300049574	Bacteria	1392
1297	Ga0501039_0000966	3300049575	Bacteria	20946
1298	Ga0501039_0001751	3300049575	Bacteria	16011
1299	Ga0501039_0016350	3300049575	Bacteria	5686
1300	Ga0501039_0025475	3300049575	Bacteria	4545
1301	Ga0501039_0028102	3300049575	Bacteria	4327
1302	Ga0501039_0096987	3300049575	Bacteria	2299
1303	Ga0501039_0318269	3300049575	Bacteria	1223
1304	Ga0501040_0000581	3300049576	Bacteria	22265
1305	Ga0501040_0002936	3300049576	Bacteria	11026
1306	Ga0501040_0003290	3300049576	Bacteria	10442
1307	Ga0501040_0010682	3300049576	Bacteria	6005
1308	Ga0501040_0017049	3300049576	Bacteria	4817
1309	Ga0501040_0029162	3300049576	Bacteria	3724
1310	Ga0501041_0009664	3300049577	Bacteria	5685
1311	Ga0501041_0012306	3300049577	Bacteria	5068
1312	Ga0501041_0039741	3300049577	Bacteria	2855
1313	Ga0501041_0052236	3300049577	Bacteria	2491
1314	Ga0501041_0132853	3300049577	Bacteria	1550
1315	Ga0501041_0164675	3300049577	Bacteria	1387
1316	Ga0501042_0001049	3300049578	Bacteria	15762
1317	Ga0501042_0004432	3300049578	Bacteria	8956
1318	Ga0501042_0005589	3300049578	Bacteria	8103
1319	Ga0501042_0006659	3300049578	Bacteria	7528
1320	Ga0501042_0010012	3300049578	Bacteria	6340
1321	Ga0501042_0019346	3300049578	Bacteria	4726
1322	Ga0501042_0028106	3300049578	Bacteria	3958
1323	Ga0501042_0053785	3300049578	Bacteria	2872
1324	Ga0501042_0101067	3300049578	Bacteria	2074
1325	Ga0501042_0154025	3300049578	Bacteria	1658
1326	Ga0501043_0012258	3300049579	Bacteria	6702
1327	Ga0501043_0019067	3300049579	Bacteria	5386
1328	Ga0501046_0005483	3300049580	Bacteria	11339
1329	Ga0501046_0008010	3300049580	Bacteria	9235
1330	Ga0501046_0017525	3300049580	Bacteria	5973
1331	Ga0501046_0028814	3300049580	Bacteria	4518
1332	Ga0501046_0031002	3300049580	Bacteria	4338
1333	Ga0501046_0078648	3300049580	Bacteria	2551
1334	Ga0501047_0000601	3300049581	Bacteria	38282
1335	Ga0501047_0001963	3300049581	Bacteria	19747
1336	Ga0501047_0003093	3300049581	Bacteria	15792
1337	Ga0501047_0037282	3300049581	Bacteria	4701
1338	Ga0501047_0096977	3300049581	Bacteria	2827
1339	Ga0501047_0133398	3300049581	Bacteria	2363
1340	Ga0501047_0217953	3300049581	Bacteria	1765
1341	Ga0501048_0001137	3300049582	Bacteria	19970
1342	Ga0501048_0016878	3300049582	Bacteria	5383
1343	Ga0501048_0023764	3300049582	Bacteria	4476
1344	Ga0501048_0029364	3300049582	Bacteria	3988
1345	Ga0501048_0037709	3300049582	Bacteria	3471
1346	Ga0501048_0074323	3300049582	Bacteria	2398
1347	Ga0501048_0075556	3300049582	Bacteria	2377
1348	Ga0501048_0082044	3300049582	Bacteria	2274
1349	Ga0501067_0029205	3300049583	Bacteria	3056
1350	Ga0501068_0025615	3300049584	Bacteria	3470
1351	Ga0501068_0050086	3300049584	Bacteria	2524
1352	Ga0501068_0054389	3300049584	Bacteria	2425
1353	Ga0501068_0167417	3300049584	Bacteria	1386
1354	Ga0501069_0000089	3300049585	Bacteria	43912
1355	Ga0501069_0005202	3300049585	Bacteria	6763
1356	Ga0501069_0008959	3300049585	Bacteria	5279
1357	Ga0501069_0116590	3300049585	Bacteria	1523
1358	Ga0501070_0000008	3300049586	Bacteria	199963
1359	Ga0501070_0001203	3300049586	Bacteria	23173
1360	Ga0501070_0017196	3300049586	Bacteria	6070
1361	Ga0501070_0054912	3300049586	Bacteria	3302
1362	Ga0501070_0065034	3300049586	Bacteria	3020
1363	Ga0501070_0189953	3300049586	Bacteria	1689
1364	Ga0501071_0001866	3300049587	Bacteria	12495
1365	Ga0501071_0003038	3300049587	Bacteria	10392
1366	Ga0501071_0003173	3300049587	Bacteria	10224
1367	Ga0501071_0007247	3300049587	Bacteria	7261
1368	Ga0501071_0020290	3300049587	Bacteria	4617
1369	Ga0501071_0065614	3300049587	Bacteria	2636
1370	Ga0501072_0001968	3300049588	Bacteria	15315
1371	Ga0501072_0002597	3300049588	Bacteria	13541
1372	Ga0501072_0007326	3300049588	Bacteria	8369
1373	Ga0501072_0009139	3300049588	Bacteria	7525
1374	Ga0501072_0018044	3300049588	Bacteria	5426
1375	Ga0501072_0022975	3300049588	Bacteria	4841
1376	Ga0501072_0025611	3300049588	Bacteria	4595
1377	Ga0501072_0056152	3300049588	Bacteria	3103
1378	Ga0501072_0096587	3300049588	Bacteria	2348
1379	Ga0501072_0125836	3300049588	Bacteria	2042
1380	Ga0501072_0161244	3300049588	Bacteria	1789
1381	Ga0501074_0022034	3300049590	Bacteria	4628
1382	Ga0501074_0038358	3300049590	Bacteria	3473
1383	Ga0501074_0102731	3300049590	Bacteria	2046
1384	Ga0501075_0000895	3300049591	Bacteria	18813
1385	Ga0501075_0002183	3300049591	Bacteria	12942
1386	Ga0501075_0006676	3300049591	Bacteria	7958
1387	Ga0501075_0013675	3300049591	Bacteria	5797
1388	Ga0501075_0022349	3300049591	Bacteria	4619
1389	Ga0501075_0148205	3300049591	Bacteria	1789
1390	Ga0501075_0174122	3300049591	Bacteria	1642
1391	Ga0501076_0001798	3300049592	Bacteria	14548
1392	Ga0501076_0002273	3300049592	Bacteria	13140
1393	Ga0501076_0002738	3300049592	Bacteria	12202
1394	Ga0501076_0004824	3300049592	Bacteria	9624
1395	Ga0501076_0045646	3300049592	Bacteria	3460
1396	Ga0501076_0076524	3300049592	Bacteria	2684
1397	Ga0501076_0078451	3300049592	Bacteria	2650
1398	Ga0501076_0104808	3300049592	Bacteria	2282
1399	Ga0501076_0120304	3300049592	Bacteria	2126
1400	Ga0501076_0202792	3300049592	Bacteria	1620
1401	Ga0501077_0003196	3300049593	Bacteria	9872
1402	Ga0501077_0005440	3300049593	Bacteria	7750
1403	Ga0501077_0025113	3300049593	Bacteria	3784
1404	Ga0501077_0033857	3300049593	Bacteria	3252
1405	Ga0501077_0205902	3300049593	Bacteria	1250
1406	Ga0501198_004370	3300049649	Bacteria	1962
1407	Ga0501217_005828	3300049661	Bacteria	2591
1408	Ga0501235_023528	3300049669	Bacteria	1374
1409	Ga0501249_000117	3300049679	Bacteria	24631
1410	Ga0501079_0004718	3300049741	Bacteria	10089
1411	Ga0501079_0008561	3300049741	Bacteria	7762
1412	Ga0501079_0009798	3300049741	Bacteria	7266
1413	Ga0501079_0106805	3300049741	Bacteria	2172
1414	Ga0501079_0129740	3300049741	Bacteria	1961
1415	Ga0501079_0189018	3300049741	Bacteria	1607
1416	Ga0501080_0012185	3300049742	Bacteria	7878
1417	Ga0501080_0018696	3300049742	Bacteria	6413
1418	Ga0501080_0074250	3300049742	Bacteria	3163
1419	Ga0501080_0092571	3300049742	Bacteria	2808
1420	Ga0501080_0107899	3300049742	Bacteria	2580
1421	Ga0501080_0146369	3300049742	Bacteria	2184
1422	Ga0501080_0347985	3300049742	Bacteria	1339
1423	Ga0501081_0005016	3300049743	Bacteria	8522
1424	Ga0501081_0008789	3300049743	Bacteria	6565
1425	Ga0501081_0027685	3300049743	Bacteria	3822
1426	Ga0501081_0027709	3300049743	Bacteria	3820
1427	Ga0501081_0030670	3300049743	Bacteria	3641
1428	Ga0501081_0234164	3300049743	Bacteria	1338
1429	Ga0501081_0251147	3300049743	Bacteria	1291
1430	Ga0501083_0000408	3300049744	Bacteria	27403
1431	Ga0501083_0009305	3300049744	Bacteria	6935
1432	Ga0501083_0019807	3300049744	Bacteria	4683
1433	Ga0501281_00002	3300049777	Bacteria	40846
1434	Ga0501035_0004302	3300049822	Bacteria	13526
1435	Ga0501035_0010123	3300049822	Bacteria	8752
1436	Ga0501035_0018495	3300049822	Bacteria	6420
1437	Ga0501035_0026910	3300049822	Bacteria	5258
1438	Ga0501035_0060451	3300049822	Bacteria	3373
1439	Ga0501035_0069525	3300049822	Bacteria	3121
1440	Ga0501035_0078324	3300049822	Bacteria	2920
1441	Ga0501035_0130017	3300049822	Bacteria	2196
1442	Ga0501035_0155576	3300049822	Bacteria	1982
1443	Ga0501044_0001813	3300049823	Bacteria	24900
1444	Ga0501044_0008299	3300049823	Bacteria	11385
1445	Ga0501044_0010153	3300049823	Bacteria	10234
1446	Ga0501044_0012648	3300049823	Bacteria	9138
1447	Ga0501044_0016106	3300049823	Bacteria	8036
1448	Ga0501044_0378393	3300049823	Bacteria	1331
1449	Ga0501045_0000725	3300049824	Bacteria	20990
1450	Ga0501045_0003204	3300049824	Bacteria	11188
1451	Ga0501045_0003364	3300049824	Bacteria	10954
1452	Ga0501045_0013023	3300049824	Bacteria	5863
1453	Ga0501045_0025509	3300049824	Bacteria	4250
1454	Ga0501045_0066501	3300049824	Bacteria	2646
1455	Ga0501045_0078470	3300049824	Bacteria	2434
1456	Ga0501045_0171973	3300049824	Bacteria	1613
1457	Ga0501204_000446	3300049850	Bacteria	3579
1458	nmdc:mga03n38_97111_c1	3300050490	Bacteria	1414
1459	nmdc:mga0yw44_117309_c1	3300050492	Bacteria	1711
1460	nmdc:mga0yw44_1691_c1	3300050492	Bacteria	8928
1461	nmdc:mga0yw44_2005_c1	3300050492	Bacteria	6190
1462	nmdc:mga0yw44_2625_c1	3300050492	Bacteria	7734
1463	nmdc:mga0yw44_33385_c1	3300050492	Bacteria	3006
1464	nmdc:mga0yw44_48520_c1	3300050492	Bacteria	2560
1465	nmdc:mga07m45_6297_c1	3300050496	Bacteria	5994
1466	nmdc:mga05p37_213038_c1	3300050507	Bacteria	2334
1467	nmdc:mga05p37_2208_c1	3300050507	Bacteria	22673
1468	nmdc:mga05p37_30113_c1	3300050507	Bacteria	6623
1469	nmdc:mga05p37_47073_c1	3300050507	Bacteria	5304
1470	nmdc:mga09592_135167_c1	3300050508	Bacteria	2124
1471	nmdc:mga09592_33032_c1	3300050508	Bacteria	4317
1472	nmdc:mga0qj67_181720_c1	3300050509	Bacteria	1708
1473	nmdc:mga0qj67_20395_c1	3300050509	Bacteria	5074
1474	nmdc:mga0qj67_66004_c1	3300050509	Bacteria	2882
1475	nmdc:mga0qj67_8448_c1	3300050509	Bacteria	7641
1476	nmdc:mga06r32_107748_c1	3300050510	Bacteria	2739
1477	nmdc:mga06r32_12374_c1	3300050510	Bacteria	7697
1478	nmdc:mga06r32_158411_c1	3300050510	Bacteria	2246
1479	nmdc:mga06r32_30013_c1	3300050510	Bacteria	5100
1480	nmdc:mga08y16_155061_c1	3300050511	Bacteria	2380
1481	nmdc:mga08y16_169045_c1	3300050511	Bacteria	2271
1482	nmdc:mga08y16_451430_c1	3300050511	Bacteria	1311
1483	nmdc:mga08y16_49670_c1	3300050511	Bacteria	4390
1484	nmdc:mga08y16_72585_c1	3300050511	Bacteria	3586
1485	nmdc:mga0n895_15173_c1	3300050512	Bacteria	7021
1486	nmdc:mga0n895_196045_c1	3300050512	Bacteria	2051
1487	nmdc:mga0n895_235323_c1	3300050512	Bacteria	1859
1488	nmdc:mga0n895_3276_c1	3300050512	Bacteria	12993
1489	nmdc:mga0rr50_125550_c1	3300050513	Bacteria	2049
1490	nmdc:mga0rr50_23084_c1	3300050513	Bacteria	4283
1491	nmdc:mga0rr50_335318_c1	3300050513	Bacteria	1270
1492	nmdc:mga0rr50_62699_c1	3300050513	Bacteria	2806
1493	nmdc:mga0rr50_92352_c1	3300050513	Bacteria	2360
1494	nmdc:mga08x19_223708_c1	3300050514	Bacteria	1294
1495	nmdc:mga08x19_264524_c1	3300050514	Bacteria	1189
1496	nmdc:mga08x19_4090_c1	3300050514	Bacteria	8656
1497	nmdc:mga08x19_4_c1	3300050514	Bacteria	335979
1498	nmdc:mga0a205_116864_c1	3300050515	Bacteria	2566
1499	nmdc:mga0a205_258698_c1	3300050515	Bacteria	1619
1500	Ga0495601_0004240	3300053077	Bacteria	8277
1501	Ga0495601_0020581	3300053077	Bacteria	4031
1502	Ga0495601_0026317	3300053077	Bacteria	3591
1503	Ga0495601_0043337	3300053077	Bacteria	2826
1504	Ga0495601_0104454	3300053077	Bacteria	1831
1505	Ga0495612_0003194	3300053078	Bacteria	6789
1506	Ga0495612_0017040	3300053078	Bacteria	2910
1507	Ga0495612_0052197	3300053078	Bacteria	1682
1508	Ga0500610_0000152	3300053079	Bacteria	20704
1509	Ga0495595_0000800	3300053084	Bacteria	11997
1510	Ga0495595_0018875	3300053084	Bacteria	2985
1511	Ga0495595_0024185	3300053084	Bacteria	2681
1512	Ga0495595_0062865	3300053084	Bacteria	1742
1513	Ga0495595_0096053	3300053084	Bacteria	1426
1514	Ga0495619_0005129	3300053085	Bacteria	8315
1515	Ga0495619_0008855	3300053085	Bacteria	6362
1516	Ga0495619_0016896	3300053085	Bacteria	4622
1517	Ga0495619_0158383	3300053085	Bacteria	1563
1518	Ga0500643_000188	3300053087	Bacteria	59049
1519	Ga0500641_0065901	3300053096	Bacteria	1516
1520	Ga0500650_0000017	3300053098	Bacteria	70720
1521	Ga0500593_000100	3300053117	Bacteria	32734
1522	Ga0500593_014489	3300053117	Bacteria	3384
1523	Ga0500658_0000047	3300053134	Bacteria	66543
1524	Ga0500568_0000011	3300053139	Bacteria	248947
1525	Ga0500604_0008326	3300053151	Bacteria	2751
1526	Ga0500604_0009663	3300053151	Bacteria	2571
1527	Ga0500616_0000905	3300053153	Bacteria	32539
1528	Ga0500616_0001088	3300053153	Bacteria	28313
1529	Ga0500622_0001774	3300053156	Bacteria	16503
1530	Ga0500622_0011034	3300053156	Bacteria	4931
1531	Ga0500627_0007069	3300053158	Bacteria	3877
1532	Ga0500627_0046820	3300053158	Bacteria	1875
1533	Ga0500596_002176	3300053735	Bacteria	3883
1534	Ga0501084_0000086	3300054114	Bacteria	66940
1535	Ga0501084_0002919	3300054114	Bacteria	13834
1536	Ga0501084_0007402	3300054114	Bacteria	9050
1537	Ga0501084_0024187	3300054114	Bacteria	5067
1538	Ga0501084_0033145	3300054114	Bacteria	4320
1539	Ga0501084_0049068	3300054114	Bacteria	3533
1540	Ga0501084_0068412	3300054114	Bacteria	2973
1541	Ga0501084_0076326	3300054114	Bacteria	2809
1542	Ga0501082_0010656	3300060353	Bacteria	7914
1543	Ga0501082_0012946	3300060353	Bacteria	7171
1544	Ga0501082_0017891	3300060353	Bacteria	6105
1545	Ga0501082_0020755	3300060353	Bacteria	5664
1546	Ga0501082_0033862	3300060353	Bacteria	4406
1547	Ga0501082_0039827	3300060353	Bacteria	4054
1548	Ga0501082_0130332	3300060353	Bacteria	2182
1549	Ga0466962_0015510	3300061719	Bacteria	3675
1550	Ga0466962_0017966	3300061719	Bacteria	3403
1551	Ga0530510_0001548	3300061734	Bacteria	15504
1552	Ga0530510_0001995	3300061734	Bacteria	13994
1553	Ga0530510_0003428	3300061734	Bacteria	10903
1554	Ga0530510_0006008	3300061734	Bacteria	8424
1555	Ga0530510_0012291	3300061734	Bacteria	6011
1556	Ga0530510_0013569	3300061734	Bacteria	5730
1557	Ga0530510_0136535	3300061734	Bacteria	1806
1558	2501940916	2501939600	Bacteria	6907073
1559	2506867910	2506783011	Bacteria	5323186
1560	2508678411	2508501039	Bacteria	9978592
1561	2523384783	2523231044	Bacteria	6434991
1562	2548692936	2547132424	Bacteria	8348532
1563	2552746647	2551306352	Bacteria	3873115
1564	2552748084	2551306352	Bacteria	3873115
1565	2595088439	2593339131	Bacteria	5116855
1566	2626636376	2626541554	Bacteria	7741902
1567	2640733522	2639762793	Bacteria	3943681
1568	2640734984	2639762793	Bacteria	3943681
1569	2644361825	2643221665	Bacteria	4699229
1570	2671838875	2671180195	Bacteria	9757215
1571	2672334260	2671180330	Bacteria	5521719
1572	2676201324	2675902999	Bacteria	9438463
1573	2678230558	2675903507	Bacteria	3737791
1574	2678231882	2675903507	Bacteria	3737791
1575	2689995690	2687453743	Bacteria	8361025
1576	2738709073	2738541275	Bacteria	4830863
1577	2738837937	2738541299	Bacteria	4020721
1578	2738847498	2738541301	Bacteria	4834102
1579	2738863227	2738541304	Bacteria	4833665
1580	2739231013	2738543010	Bacteria	5583595
1581	2739268153	2738543017	Bacteria	4271950
1582	2739295745	2738543022	Bacteria	4835059
1583	2739357423	2738543033	Bacteria	4833336
1584	2745160634	2744054655	Bacteria	3552603
1585	2757565484	2757320391	Bacteria	4746095
1586	2774388911	2773857761	Bacteria	3837365
1587	2774389592	2773857761	Bacteria	3837365
1588	2774436704	2773857770	Bacteria	3911866
1589	2774439797	2773857770	Bacteria	3911866
1590	2774845900	2773857921	Bacteria	9435764
1591	2774857031	2773857922	Bacteria	9757215
1592	2774904332	2773857933	Bacteria	5818019
1593	2774905752	2773857933	Bacteria	5818019
1594	2774905893	2773857933	Bacteria	5818019
1595	2777762820	2775507177	Bacteria	4384303
1596	2777763903	2775507177	Bacteria	4384303
1597	2777837009	2775507192	Bacteria	4622234
1598	2791211710	2788500588	Bacteria	4584915
1599	2816865838	2816332186	Bacteria	5331395
1600	2819628639	2818991451	Bacteria	4697364
1601	2842685863	2842682962	Bacteria	5589973
1602	2849142075	2849139964	Bacteria	5613304
1603	2852674059	2852673933	Bacteria	3347676
1604	2856861817	2856858025	Bacteria	7255264
1605	2857581761	2857581216	Bacteria	5522813
1606	2857585902	2857581216	Bacteria	5522813
1607	2857588220	2857586860	Bacteria	4354574
1608	2857592049	2857591370	Bacteria	6569758
1609	2862292997	2862290372	Bacteria	7471434
1610	2862575416	2862574272	Bacteria	10567477
1611	2867508492	2867507094	Bacteria	6506033
1612	2894776755	2894772417	Bacteria	5305674
1613	2898907217	2898907183	Bacteria	4067722
1614	2904609068	2904606771	Bacteria	4684500
1615	2912727207	2912723979	Bacteria	8557534
1616	2915359925	2915358134	Bacteria	6050864
1617	2916699715	2916699645	Bacteria	3568996
1618	2919183069	2919182534	Bacteria	3907101
1619	2919183459	2919182534	Bacteria	3907101
1620	2919506965	2919506607	Bacteria	3392955
1621	2919508598	2919506607	Bacteria	3392955
1622	2919717854	2919713450	Bacteria	7431245
1623	2928102157	2928100450	Bacteria	4837635
1624	2928510666	2928510474	Bacteria	4815308
1625	2928517940	2928515477	Bacteria	4448421
1626	2928962401	2928959182	Bacteria	4725774
1627	2929186610	2929183550	Bacteria	6377511
1628	2929201291	2929199973	Bacteria	7260745
1629	2929212719	2929212328	Bacteria	7708288
1630	2936342873	2936340661	Bacteria	5139038
1631	2936364301	2936361878	Bacteria	5632809
1632	2939597928	2939593269	Bacteria	4798695
1633	2954692323	2954691527	Bacteria	10720516
1634	2954707389	2954701450	Bacteria	10834262
1635	2977259176	2977254563	Bacteria	4828420
1636	2984569529	2984568884	Bacteria	3884413
1637	2990280205	2990275345	Bacteria	4887158
1638	2995464186	2995463766	Bacteria	8577691
1639	3001893021	3001892409	Bacteria	6328293
1640	3001895645	3001892409	Bacteria	6328293
1641	3003006308	3002998708	Bacteria	11715108
1642	3006829265	3006826541	Bacteria	4678913
1643	3006978211	3006973921	Bacteria	4423788
1644	649812415	649633069	Bacteria	6962533
1645	8002779564	8002775197	Bacteria	10728764
1646	8022793391	8022792930	Bacteria	5693794
1647	8033233388	8033232454	Bacteria	3202805
1648	8033233553	8033232454	Bacteria	3202805
1649	8046355932	8046352972	Bacteria	3613806
1650	8047713229	8047710418	Bacteria	11023148
1651	8055532291	8055531788	Bacteria	5249694
1652	8055910058	8055909800	Bacteria	7278581
1653	8057587118	8057582654	Bacteria	5218944
1654	8057634880	8057632132	Bacteria	4726859
1655	Ga0496102_0165760
1656	LJQas_1005422
1657	JGI24752J21851_1000031
1658	JGI25151J46595_10001297
1659	JGI25151J46595_10001914
1660	JGI25151J46595_10002376
1661	JGI25151J46595_10003056
1662	JGI25151J46595_10003287
1663	JGI25151J46595_10018537
1664	JGI25406J46586_10000099
1665	JGI25406J46586_10001854
1666	rootH1_10192437
1667	Ga0006562J51391_1016962
1668	Ga0006562J51391_1041968
1669	Ga0055538_1000283
1670	Ga0055532_1000229
1671	Ga0055536_1022910
1672	Ga0058692_1000001
1673	Ga0058692_1000063
1674	Ga0065714_10080014
1675	Ga0065704_10003837
1676	Ga0065704_10010176
1677	Ga0065704_10077027
1678	Ga0065707_10084189
1679	Ga0065707_10118720
1680	Ga0070658_10026316
1681	Ga0070676_10041771
1682	Ga0070676_10099977
1683	Ga0070683_100007853
1684	Ga0070683_100024318
1685	Ga0070683_100254800
1686	Ga0070690_100027158
1687	Ga0070690_100171394
1688	Ga0070670_100000072
1689	Ga0070670_100119174
1690	Ga0070670_100144088
1691	Ga0070677_10023288
1692	Ga0068869_100028234
1693	Ga0068869_100081247
1694	Ga0070666_10050020
1695	Ga0070666_10129546
1696	Ga0070680_100000261
1697	Ga0070680_100017787
1698	Ga0070680_100069143
1699	Ga0070680_100107679
1700	Ga0070680_100240839
1701	Ga0068868_100002141
1702	Ga0068868_100019874
1703	Ga0070660_100012370
1704	Ga0070660_100026559
1705	Ga0070660_100224956
1706	Ga0070689_100036774
1707	Ga0070691_10011061
1708	Ga0070691_10033980
1709	Ga0070687_100018616
1710	Ga0070687_100055083
1711	Ga0070687_100058624
1712	Ga0070661_100068424
1713	Ga0070661_100097130
1714	Ga0070692_10071974
1715	Ga0070668_100001049
1716	Ga0070668_100005680
1717	Ga0070668_100057236
1718	Ga0070668_100087008
1719	Ga0070669_100005928
1720	Ga0070669_100016997
1721	Ga0070669_100050975
1722	Ga0070669_100113457
1723	Ga0070675_100000935
1724	Ga0070675_100028702
1725	Ga0070671_100000969
1726	Ga0070671_100015123
1727	Ga0070671_100019608
1728	Ga0070671_100027586
1729	Ga0070671_100118565
1730	Ga0070674_100027421
1731	Ga0070673_100031261
1732	Ga0070673_100051522
1733	Ga0070688_100048884
1734	Ga0070659_100003482
1735	Ga0070659_100073290
1736	Ga0070659_100140338
1737	Ga0070667_100000746
1738	Ga0070667_100012821
1739	Ga0070667_100021378
1740	Ga0070703_10013487
1741	Ga0070709_10000727
1742	Ga0070709_10001186
1743	Ga0070709_10001840
1744	Ga0070709_10014473
1745	Ga0070709_10052770
1746	Ga0070709_10063900
1747	Ga0070709_10168283
1748	Ga0070714_100000601
1749	Ga0070714_100007663
1750	Ga0070714_100034070
1751	Ga0070714_100057419
1752	Ga0070713_100008515
1753	Ga0070713_100020320
1754	Ga0070713_100053270
1755	Ga0070713_100061729
1756	Ga0070713_100075790
1757	Ga0070713_100099046
1758	Ga0070713_100141823
1759	Ga0070710_10000225
1760	Ga0070710_10000234
1761	Ga0070710_10000408
1762	Ga0070710_10004952
1763	Ga0070710_10024459
1764	Ga0070710_10039025
1765	Ga0070710_10040416
1766	Ga0070711_100000428
1767	Ga0070711_100000526
1768	Ga0070711_100001089
1769	Ga0070711_100001574
1770	Ga0070711_100032364
1771	Ga0070705_100012199
1772	Ga0070705_100043448
1773	Ga0070705_100052962
1774	Ga0070700_100002856
1775	Ga0070694_100029011
1776	Ga0070694_100065923
1777	Ga0070708_100004853
1778	Ga0070663_100001262
1779	Ga0070663_100002450
1780	Ga0070678_100068784
1781	Ga0070662_100037024
1782	Ga0070662_100123912
1783	Ga0070681_10000079
1784	Ga0070681_10057401
1785	Ga0070681_10077913
1786	Ga0070681_10186803
1787	Ga0070681_10240551
1788	Ga0070685_10203052
1789	Ga0070706_100001191
1790	Ga0070706_100012100
1791	Ga0070706_100023248
1792	Ga0070706_100023878
1793	Ga0070706_100117704
1794	Ga0070707_100000563
1795	Ga0070707_100001915
1796	Ga0070707_100009169
1797	Ga0070707_100015399
1798	Ga0070707_100024691
1799	Ga0070707_100042973
1800	Ga0070707_100109691
1801	Ga0070707_100133074
1802	Ga0070707_100169209
1803	Ga0070698_100000280
1804	Ga0070698_100000592
1805	Ga0070698_100000647
1806	Ga0070698_100006462
1807	Ga0070698_100008349
1808	Ga0070698_100013896
1809	Ga0070698_100017952
1810	Ga0070698_100083485
1811	Ga0070698_100093440
1812	Ga0070699_100000149
1813	Ga0070699_100268449
1814	Ga0070679_100000056
1815	Ga0070679_100019580
1816	Ga0070684_100004005
1817	Ga0070684_100071856
1818	Ga0070684_100086865
1819	Ga0070684_100134362
1820	Ga0070684_100154934
1821	Ga0070684_100183608
1822	Ga0070697_100000222
1823	Ga0070697_100119837
1824	Ga0070697_100250938
1825	Ga0068853_100042114
1826	Ga0068853_100234628
1827	Ga0068853_100298155
1828	Ga0070672_100010102
1829	Ga0070686_100024100
1830	Ga0070695_100004596
1831	Ga0070695_100032163
1832	Ga0070695_100081324
1833	Ga0070695_100193948
1834	Ga0070696_100010621
1835	Ga0070696_100045553
1836	Ga0070696_100052323
1837	Ga0070693_100009751
1838	Ga0070693_100011397
1839	Ga0070693_100040158
1840	Ga0070665_100055258
1841	Ga0070665_100318480
1842	Ga0070665_100425573
1843	Ga0070704_100035963
1844	Ga0070704_100051187
1845	Ga0070704_100056813
1846	Ga0070704_100074806
1847	Ga0070704_100077506
1848	Ga0068855_100007525
1849	Ga0070664_100000402
1850	Ga0070664_100014689
1851	Ga0070664_100215100
1852	Ga0068857_100010684
1853	Ga0068857_100028644
1854	Ga0068857_100077797
1855	Ga0068857_100095592
1856	Ga0068857_100125796
1857	Ga0068854_100002153
1858	Ga0068854_100009528
1859	Ga0068856_100018569
1860	Ga0068856_100029701
1861	Ga0068856_100096372
1862	Ga0070702_100031728
1863	Ga0070702_100104153
1864	Ga0070702_100150879
1865	Ga0068852_100021347
1866	Ga0068852_100036367
1867	Ga0068852_100081232
1868	Ga0068852_100220995
1869	Ga0068859_100013427
1870	Ga0068859_100095026
1871	Ga0068859_100104974
1872	Ga0068859_100116526
1873	Ga0068859_100143667
1874	Ga0068864_100000019
1875	Ga0068864_100000038
1876	Ga0068864_100022161
1877	Ga0068864_100055644
1878	Ga0068864_100095729
1879	Ga0068866_10023473
1880	Ga0068866_10030458
1881	Ga0068861_100005613
1882	Ga0068861_100036062
1883	Ga0068861_100224450
1884	Ga0068870_10044825
1885	Ga0068870_10160202
1886	Ga0068863_100000026
1887	Ga0068863_100000104
1888	Ga0068863_100023034
1889	Ga0068863_100026479
1890	Ga0068863_100038287
1891	Ga0068863_100055667
1892	Ga0068863_100078450
1893	Ga0068858_100000061
1894	Ga0068858_100009842
1895	Ga0068858_100018641
1896	Ga0068858_100293361
1897	Ga0068860_100025917
1898	Ga0068860_100144017
1899	Ga0068860_100156066
1900	Ga0068862_100000279
1901	Ga0068862_100005914
1902	Ga0068862_100018828
1903	Ga0081455_10006019
1904	Ga0081455_10010606
1905	Ga0081455_10012222
1906	Ga0081455_10040682
1907	Ga0081455_10100803
1908	Ga0081455_10205544
1909	Ga0081538_10001179
1910	Ga0081540_1001050
1911	Ga0081540_1001110
1912	Ga0081540_1002720
1913	Ga0081539_10000183
1914	Ga0081539_10003736
1915	Ga0081539_10013047
1916	Ga0081539_10155366
1917	Ga0070717_10001939
1918	Ga0070717_10020874
1919	Ga0070717_10051249
1920	Ga0070717_10058473
1921	Ga0070717_10065448
1922	Ga0070717_10090203
1923	Ga0070717_10127910
1924	Ga0070717_10145010
1925	Ga0075365_10021633
1926	Ga0075365_10034701
1927	Ga0075365_10042756
1928	Ga0075365_10047169
1929	Ga0075365_10145120
1930	Ga0075364_10054781
1931	Ga0070715_10008016
1932	Ga0070715_10022431
1933	Ga0070716_100001419
1934	Ga0070716_100009855
1935	Ga0070716_100041749
1936	Ga0070716_100134387
1937	Ga0070716_100152432
1938	Ga0070712_100000151
1939	Ga0070712_100018301
1940	Ga0070712_100077823
1941	Ga0070712_100078117
1942	Ga0070712_100118895
1943	Ga0070712_100136035
1944	Ga0097621_100056583
1945	Ga0075370_10004043
1946	Ga0075370_10100818
1947	Ga0068871_100039518
1948	Ga0068871_100092724
1949	Ga0075428_100171501
1950	Ga0075428_100464928
1951	Ga0075428_100483770
1952	Ga0075430_100045529
1953	Ga0075431_100000341
1954	Ga0075431_100000800
1955	Ga0075431_100010582
1956	Ga0075431_100207211
1957	Ga0075431_100283634
1958	Ga0075433_10068651
1959	Ga0075434_100026312
1960	Ga0075434_100050538
1961	Ga0075434_100204005
1962	Ga0075429_100023407
1963	Ga0075436_100017334
1964	Ga0075436_100043069
1965	Ga0075436_100126404
1966	Ga0097620_100013427
1967	Ga0097620_100095023
1968	Ga0097620_100104974
1969	Ga0097620_100116513
1970	Ga0097620_100143669
1971	Ga0075435_100006251
1972	Ga0075435_100016534
1973	Ga0075435_100026937
1974	Ga0105251_10000905
1975	Ga0105251_10007705
1976	Ga0105251_10019101
1977	Ga0105251_10029432
1978	Ga0105251_10039953
1979	Ga0105244_10001754
1980	Ga0105244_10005044
1981	Ga0105244_10005353
1982	Ga0105250_10000642
1983	Ga0105250_10001851
1984	Ga0105250_10016467
1985	Ga0105250_10053938
1986	Ga0105240_10093238
1987	Ga0105240_10185438
1988	Ga0105240_10203795
1989	Ga0111539_10000944
1990	Ga0111539_10017082
1991	Ga0111539_10054923
1992	Ga0111539_10086300
1993	Ga0111539_10113334
1994	Ga0111539_10113709
1995	Ga0105245_10011337
1996	Ga0105245_10036871
1997	Ga0105245_10090808
1998	Ga0105247_10000251
1999	Ga0105247_10008026
2000	Ga0105247_10019843
2001	Ga0105247_10056251
2002	Ga0114129_10006787
2003	Ga0114129_10008886
2004	Ga0114129_10018930
2005	Ga0114129_10030723
2006	Ga0114129_10655607
2007	Ga0114129_10664763
2008	Ga0105243_10000010
2009	Ga0105243_10000155
2010	Ga0105243_10009892
2011	Ga0105243_10080826
2012	Ga0105243_10095464
2013	Ga0105243_10096414
2014	Ga0105241_10043770
2015	Ga0105241_10097509
2016	Ga0105242_10028818
2017	Ga0105242_10047973
2018	Ga0105242_10087236
2019	Ga0105242_10108327
2020	Ga0105248_10000014
2021	Ga0105248_10020029
2022	Ga0105248_10028137
2023	Ga0105248_10034717
2024	Ga0105248_10085006
2025	Ga0105248_10445446
2026	Ga0105237_10000681
2027	Ga0105237_10015085
2028	Ga0105237_10017247
2029	Ga0105237_10046841
2030	Ga0105237_10050938
2031	Ga0105237_10063603
2032	Ga0105237_10077247
2033	Ga0105238_10068561
2034	Ga0105249_10000048
2035	Ga0105249_10000305
2036	Ga0105249_10001408
2037	Ga0105249_10017159
2038	Ga0105249_10070021
2039	Ga0105249_10119965
2040	Ga0105249_10134540
2041	Ga0105239_10003066
2042	Ga0105239_10066734
2043	Ga0105239_10078462
2044	Ga0105239_10174362
2045	Ga0105239_10263549
2046	Ga0105239_10338014
2047	Ga0105246_10001817
2048	Ga0105246_10009585
2049	Ga0105246_10037415
2050	Ga0105246_10117137
2051	Ga0157373_10043419
2052	Ga0157373_10057099
2053	Ga0157371_10032330
2054	Ga0157371_10033162
2055	Ga0157371_10068432
2056	Ga0157371_10107024
2057	Ga0157371_10115375
2058	Ga0157370_10048914
2059	Ga0157370_10124500
2060	Ga0157370_10157510
2061	Ga0157369_10028383
2062	Ga0157369_10053243
2063	Ga0157369_10080438
2064	Ga0157369_10110381
2065	Ga0171462_1002
2066	Ga0157374_10029225
2067	Ga0157378_10041354
2068	Ga0163162_10024165
2069	Ga0163162_10056847
2070	Ga0163162_10224878
2071	Ga0163162_10477674
2072	Ga0157375_10010788
2073	Ga0157375_10048566
2074	Ga0157375_10091051
2075	Ga0157375_10489359
2076	Ga0163163_10179161
2077	Ga0163163_10325178
2078	Ga0157380_10007550
2079	Ga0157380_10173779
2080	Ga0157380_10310741
2081	Ga0182008_10002889
2082	Ga0157377_10131214
2083	Ga0157379_10015692
2084	Ga0157379_10017157
2085	Ga0157379_10244541
2086	Ga0157376_10031970
2087	Ga0182006_1000214
2088	Ga0163161_10012381
2089	Ga0163161_10042245
2090	Ga0163161_10044709
2091	Ga0163161_10159331
2092	Ga0197907_11483172
2093	Ga0206356_11001745
2094	Ga0206356_11711657
2095	Ga0206351_10051467
2096	Ga0206354_10117409
2097	Ga0206354_10807169
2098	Ga0206354_11645157
2099	Ga0206353_11721640
2100	Ga0213873_10000130
2101	Ga0213876_10000004
2102	Ga0213876_10001915
2103	Ga0213876_10046411
2104	Ga0213875_10000174
2105	Ga0213875_10001334
2106	Ga0213875_10004336
2107	Ga0213875_10029575
2108	Ga0213875_10051292
2109	Ga0224712_10011188
2110	Ga0209784_100105
2111	Ga0209566_100178
2112	Ga0209147_100160
2113	Ga0209676_1000833
2114	Ga0209676_1001081
2115	Ga0209025_1000107
2116	Ga0209025_1000945
2117	Ga0209025_1001134
2118	Ga0209025_1001208
2119	Ga0209025_1001403
2120	Ga0209025_1001415
2121	Ga0209025_1007148
2122	Ga0209025_1016229
2123	Ga0207696_1001447
2124	Ga0207696_1002892
2125	Ga0207696_1004519
2126	Ga0207655_1000612
2127	Ga0207655_1000947
2128	Ga0207655_1001468
2129	Ga0207655_1001487
2130	Ga0207655_1004432
2131	Ga0207655_1004629
2132	Ga0207655_1025039
2133	Ga0207713_1001490
2134	Ga0207713_1002830
2135	Ga0207713_1003575
2136	Ga0207713_1003827
2137	Ga0207692_10000421
2138	Ga0207692_10001282
2139	Ga0207692_10003061
2140	Ga0207692_10005915
2141	Ga0207692_10006481
2142	Ga0207692_10006566
2143	Ga0207692_10019402
2144	Ga0207692_10062047
2145	Ga0207692_10078831
2146	Ga0207692_10082230
2147	Ga0207642_10054531
2148	Ga0207710_10000005
2149	Ga0207710_10000009
2150	Ga0207710_10027386
2151	Ga0207688_10000991
2152	Ga0207688_10006904
2153	Ga0207688_10009574
2154	Ga0207647_10022112
2155	Ga0207647_10038435
2156	Ga0207685_10004419
2157	Ga0207685_10030921
2158	Ga0207685_10041816
2159	Ga0207685_10048846
2160	Ga0207699_10000093
2161	Ga0207699_10000284
2162	Ga0207699_10000662
2163	Ga0207699_10001582
2164	Ga0207699_10005863
2165	Ga0207699_10017060
2166	Ga0207699_10020355
2167	Ga0207699_10091957
2168	Ga0207699_10094877
2169	Ga0207645_10009910
2170	Ga0207643_10008182
2171	Ga0207643_10012512
2172	Ga0207705_10146877
2173	Ga0207684_10001772
2174	Ga0207684_10004720
2175	Ga0207684_10008252
2176	Ga0207684_10009745
2177	Ga0207684_10014241
2178	Ga0207654_10222854
2179	Ga0207707_10000103
2180	Ga0207707_10091743
2181	Ga0207707_10210546
2182	Ga0207695_10120527
2183	Ga0207695_10145102
2184	Ga0207695_10296735
2185	Ga0207671_10006846
2186	Ga0207671_10015047
2187	Ga0207671_10038462
2188	Ga0207671_10052534
2189	Ga0207671_10158968
2190	Ga0207693_10000132
2191	Ga0207693_10001324
2192	Ga0207693_10003617
2193	Ga0207693_10020370
2194	Ga0207693_10029138
2195	Ga0207693_10082483
2196	Ga0207693_10191902
2197	Ga0207663_10000336
2198	Ga0207663_10002893
2199	Ga0207663_10003266
2200	Ga0207663_10007631
2201	Ga0207663_10020136
2202	Ga0207663_10025482
2203	Ga0207663_10081312
2204	Ga0207660_10000257
2205	Ga0207662_10002153
2206	Ga0207662_10002244
2207	Ga0207662_10008170
2208	Ga0207657_10006511
2209	Ga0207657_10014772
2210	Ga0207657_10022199
2211	Ga0207657_10184560
2212	Ga0207649_10080394
2213	Ga0207652_10000256
2214	Ga0207652_10031578
2215	Ga0207652_10072673
2216	Ga0207646_10000075
2217	Ga0207646_10015421
2218	Ga0207646_10017449
2219	Ga0207646_10057499
2220	Ga0207646_10080270
2221	Ga0207646_10182212
2222	Ga0207681_10021318
2223	Ga0207650_10000116
2224	Ga0207650_10052964
2225	Ga0207659_10098405
2226	Ga0207659_10106030
2227	Ga0207687_10005129
2228	Ga0207700_10000103
2229	Ga0207700_10002220
2230	Ga0207700_10034685
2231	Ga0207700_10049537
2232	Ga0207700_10060223
2233	Ga0207700_10073786
2234	Ga0207700_10096707
2235	Ga0207700_10122798
2236	Ga0207700_10154778
2237	Ga0207700_10189588
2238	Ga0207700_10291627
2239	Ga0207664_10000533
2240	Ga0207664_10000556
2241	Ga0207664_10003071
2242	Ga0207664_10004341
2243	Ga0207664_10019976
2244	Ga0207664_10028924
2245	Ga0207664_10030465
2246	Ga0207664_10051508
2247	Ga0207664_10062833
2248	Ga0207664_10177398
2249	Ga0207644_10005148
2250	Ga0207644_10007134
2251	Ga0207644_10093215
2252	Ga0207690_10040941
2253	Ga0207706_10000852
2254	Ga0207706_10013671
2255	Ga0207706_10057206
2256	Ga0207706_10074067
2257	Ga0207686_10103163
2258	Ga0207686_10137525
2259	Ga0207709_10000001
2260	Ga0207709_10105690
2261	Ga0207709_10131806
2262	Ga0207665_10000110
2263	Ga0207665_10000836
2264	Ga0207665_10003439
2265	Ga0207665_10006149
2266	Ga0207665_10048553
2267	Ga0207665_10049003
2268	Ga0207665_10113935
2269	Ga0207665_10210750
2270	Ga0207691_10009921
2271	Ga0207691_10023464
2272	Ga0207691_10025511
2273	Ga0207691_10090507
2274	Ga0207711_10000021
2275	Ga0207711_10008827
2276	Ga0207711_10018068
2277	Ga0207711_10104916
2278	Ga0207689_10001908
2279	Ga0207689_10009281
2280	Ga0207689_10015339
2281	Ga0207689_10032937
2282	Ga0207661_10183331
2283	Ga0207679_10040889
2284	Ga0207679_10190171
2285	Ga0207679_10194987
2286	Ga0207667_10007694
2287	Ga0207667_10029360
2288	Ga0207667_10050910
2289	Ga0207667_10154310
2290	Ga0207667_10267137
2291	Ga0207712_10000148
2292	Ga0207712_10001509
2293	Ga0207712_10018892
2294	Ga0207668_10004092
2295	Ga0207668_10157608
2296	Ga0207640_10002707
2297	Ga0207658_10000555
2298	Ga0207658_10015000
2299	Ga0207658_10130302
2300	Ga0207677_10013523
2301	Ga0207677_10138169
2302	Ga0207703_10000149
2303	Ga0207703_10012392
2304	Ga0207703_10183402
2305	Ga0207639_10023938
2306	Ga0207639_10196246
2307	Ga0207678_10002509
2308	Ga0207678_10008904
2309	Ga0207678_10034232
2310	Ga0207678_10042538
2311	Ga0207678_10067322
2312	Ga0207678_10319843
2313	Ga0207708_10006195
2314	Ga0207708_10036612
2315	Ga0207708_10108336
2316	Ga0207702_10024238
2317	Ga0207702_10031911
2318	Ga0207702_10056729
2319	Ga0207641_10000005
2320	Ga0207641_10000008
2321	Ga0207648_10130635
2322	Ga0207676_10000019
2323	Ga0207676_10000049
2324	Ga0207674_10003114
2325	Ga0207674_10024371
2326	Ga0207674_10033349
2327	Ga0207674_10083656
2328	Ga0207674_10092626
2329	Ga0207674_10266163
2330	Ga0207675_100003405
2331	Ga0207675_100013383
2332	Ga0207675_100114121
2333	Ga0207675_100571901
2334	Ga0207683_10001681
2335	Ga0207683_10001732
2336	Ga0207683_10093430
2337	Ga0207698_10016317
2338	Ga0207698_10019935
2339	Ga0207698_10038915
2340	Ga0209371_1000006
2341	Ga0209371_1000008
2342	Ga0207428_10089450
2343	Ga0207428_10177711
2344	Ga0207428_10260813
2345	Ga0268266_10038719
2346	Ga0268266_10060121
2347	Ga0268265_10000165
2348	Ga0268265_10112618
2349	Ga0268265_10152037
2350	Ga0268264_10059779
2351	Ga0268264_10158808
2352	Ga0268264_10230455
2353	Ga0268264_10340054
2354	Ga0268264_10390934
2355	Ga0265319_1004182
2356	Ga0265334_10057558
2357	Ga0265318_10002515
2358	Ga0265336_10000005
2359	Ga0265336_10008838
2360	Ga0265338_10000001
2361	Ga0265338_10010903
2362	Ga0268256_1000007
2363	Ga0268256_1000009
2364	Ga0265762_1006823
2365	Ga0265760_10036986
2366	Ga0265340_10000001
2367	Ga0265339_10037585
2368	Ga0265327_10048452
2369	Ga0265327_10061873
2370	Ga0265327_10090003
2371	Ga0265316_10236769
2372	Ga0307513_10007758
2373	Ga0307513_10105448
2374	Ga0307509_10000004
2375	Ga0307408_100000387
2376	Ga0307408_100271656
2377	Ga0316575_10016255
2378	Ga0316579_10119735
2379	Ga0316576_10002159
2380	Ga0316576_10004942
2381	Ga0316576_10014931
2382	Ga0316576_10023559
2383	Ga0316576_10058201
2384	Ga0316576_10220302
2385	Ga0316578_10008294
2386	Ga0316578_10011678
2387	Ga0316578_10027510
2388	Ga0316577_10005905
2389	Ga0307413_10092852
2390	Ga0307409_100049254
2391	Ga0307409_100106607
2392	Ga0307416_100237259
2393	Ga0373930_0002746
2394	Ga0373959_0006108
2395	Ga0373959_0009144
2396	Ga0373926_0009320
2397	Ga0373928_0000501
2398	Ga0373929_0008922
2399	Ga0373934_0000074
2400	Ga0373934_0004420
2401	Ga0373934_0011417
2402	Ga0373934_0013932
2403	Ga0373934_0025762
2404	Ga0373944_0002708
2405	Ga0373944_0012433
2406	Ga0373949_0022946
2407	Ga0373951_0007038
2408	Ga0373951_0031416
2409	Ga0373952_0008979
2410	Ga0373923_0003312
2411	Ga0373923_0007133
2412	Ga0373923_0067947
2413	Ga0373923_0070525
2414	Ga0373923_0107184
2415	Ga0373932_0000217
2416	Ga0373932_0003244
2417	Ga0373932_0011995
2418	Ga0373936_0000119
2419	Ga0373936_0001254
2420	Ga0373936_0003910
2421	Ga0373936_0088890
2422	Ga0373939_0005890
2423	Ga0373941_0031976
2424	Ga0373945_0000755
2425	Ga0373953_0001822
2426	Ga0373953_0008422
2427	Ga0373953_0015121
2428	Ga0373953_0056397
2429	Ga0373954_0008571
2430	Ga0373954_0009201
2431	Ga0373954_0034572
2432	Ga0373954_0054112
2433	Ga0373956_0001407
2434	Ga0373956_0020403
2435	Ga0373957_0000056
2436	Ga0373957_0002119
2437	Ga0373957_0040416
2438	Ga0373957_0087385
2439	Ga0373960_0010364
2440	Ga0373943_0008618
2441	Ga0373943_0030676
2442	Ga0373943_0044748
2443	Ga0373943_0076988
2444	Ga0373943_0098645
2445	Ga0373943_0100093
2446	Ga0373946_0001411
2447	Ga0373955_0004271
2448	Ga0373955_0013253
2449	Ga0373955_0096568
2450	Ga0373955_0140777
2451	Ga0373942_0002905
2452	Ga0373962_0025291
2453	Ga0316574_0006801
2454	Ga0316574_0011379
2455	Ga0316574_0011947
2456	Ga0316574_0035842
2457	Ga0316574_0126126
2458	Ga0373924_0000088
2459	Ga0373924_0002191
2460	Ga0373924_0003031
2461	Ga0373924_0003240
2462	Ga0373931_0000005
2463	Ga0373931_0000027
2464	Ga0373931_0002914
2465	Ga0373931_0149047
2466	Ga0373931_0154931
2467	Ga0373935_0004208
2468	Ga0373935_0009981
2469	Ga0373935_0011653
2470	Ga0373935_0080562
2471	Ga0373927_0022062
2472	Ga0373927_0248107
2473	Ga0373933_0000005
2474	Ga0373933_0033741
2475	Ga0373933_0071890
2476	Ga0373947_0000220
2477	Ga0373947_0090298
2478	Ga0373937_0000278
2479	Ga0373937_0054255
2480	Ga0373937_0079557
2481	Ga0373937_0189654
2482	Ga0372808_000663
2483	Ga0372808_001740
2484	Ga0316582_0010895
2485	Ga0316582_0095040
2486	Ga0316584_0003409
2487	Ga0316584_0004433
2488	Ga0316584_0008628
2489	Ga0316584_0050522
2490	Ga0316584_0102651
2491	Ga0373925_0041858
2492	Ga0373925_0055558
2493	Ga0436364_0033704
2494	Ga0436364_0509088
2495	Ga0436364_0604875
2496	Ga0436364_0676163
2497	Ga0436364_0757834
2498	Ga0436364_0786042
2499	Ga0436364_0802940
2500	Ga0436364_1227141
2501	Ga0436364_1456387
2502	Ga0436364_1464045
2503	Ga0395901_0060605
2504	Ga0400485_02355
2505	Ga0400483_058289
2506	Ga0400483_215395
2507	Ga0400483_232124
2508	Ga0400483_245537
2509	Ga0237816_01881
2510	Ga0436365_0012902
2511	Ga0436365_0075484
2512	Ga0436365_0758715
2513	Ga0436365_1202098
2514	Ga0436361_0374946
2515	Ga0436361_1186958
2516	Ga0436362_0035386
2517	Ga0436362_0131109
2518	Ga0439447_043708
2519	Ga0439466_0021474
2520	Ga0439465_0053120
2521	Ga0451791_1300260
2522	Ga0451843_0067489
2523	Ga0451843_1574986
2524	Ga0439445_0031973
2525	Ga0439432_032374
2526	Ga0439449_0001300
2527	Ga0439450_014046
2528	Ga0439452_019347
2529	Ga0439457_022828
2530	Ga0439440_0002061
2531	Ga0466969_0002027
2532	Ga0466969_0016901
2533	Ga0466972_0002652
2534	Ga0466965_0000829
2535	Ga0466965_0003566
2536	Ga0466966_0011220
2537	Ga0466966_0023668
2538	Ga0466966_0068845
2539	Ga0466961_0018481
2540	Ga0466963_0005494
2541	Ga0466963_0015101
2542	Ga0466963_0027405
2543	Ga0466963_0039987
2544	Ga0466963_0052033
2545	Ga0466963_0105466
2546	Ga0466963_0134633
2547	Ga0466964_0029818
2548	Ga0466971_0092278
2549	Ga0466968_0002914
2550	Ga0466968_0035557
2551	Ga0466970_0054126
2552	Ga0466957_0007518
2553	Ga0466957_0157063
2554	Ga0466959_0017904
2555	Ga0466959_0124003
2556	Ga0466958_0185212
2557	Ga0466967_0012564
2558	Ga0466967_0019489
2559	Ga0466967_0024982
2560	Ga0466967_0089070
2561	Ga0466967_0089880
2562	Ga0466967_0111096
2563	Ga0466967_0621354
2564	Ga0495627_000110
2565	Ga0495592_0000010
2566	Ga0495592_0006585
2567	Ga0495592_0012104
2568	Ga0495592_0027319
2569	Ga0495592_0043975
2570	Ga0495592_0052562
2571	Ga0495592_0137810
2572	Ga0495603_0003396
2573	Ga0495603_0018742
2574	Ga0495629_0003600
2575	Ga0495629_0004898
2576	Ga0495629_0012270
2577	Ga0495641_0004957
2578	Ga0495641_0008522
2579	Ga0495641_0013408
2580	Ga0495641_0040339
2581	Ga0495641_0064342
2582	Ga0495651_0000006
2583	Ga0495651_0006392
2584	Ga0495651_0016070
2585	Ga0495651_0017225
2586	Ga0495651_0031182
2587	Ga0495651_0035502
2588	Ga0495651_0053979
2589	Ga0495651_0106132
2590	Ga0495653_0016641
2591	Ga0495653_0028100
2592	Ga0495653_0041667
2593	Ga0495653_0059979
2594	Ga0495653_0062265
2595	Ga0495653_0064751
2596	Ga0495653_0076719
2597	Ga0495653_0088750
2598	Ga0495653_0108270
2599	Ga0495653_0121353
2600	Ga0495580_0011635
2601	Ga0495580_0081125
2602	Ga0495580_0101173
2603	Ga0495580_0101941
2604	Ga0495582_0002548
2605	Ga0495582_0003759
2606	Ga0495582_0143380
2607	Ga0495639_0016401
2608	Ga0495662_0000649
2609	Ga0495662_0001170
2610	Ga0495662_0003177
2611	Ga0495662_0009850
2612	Ga0495662_0015376
2613	Ga0495664_0044348
2614	Ga0495664_0069108
2615	Ga0495594_0013981
2616	Ga0495607_0086639
2617	Ga0495607_0103113
2618	Ga0495608_0000243
2619	Ga0495608_0000955
2620	Ga0495608_0012153
2621	Ga0495608_0013781
2622	Ga0495608_0047023
2623	Ga0495608_0062595
2624	Ga0495608_0071773
2625	Ga0495608_0109376
2626	Ga0495608_0132923
2627	Ga0495610_0000013
2628	Ga0495616_0000032
2629	Ga0495618_0001036
2630	Ga0495618_0040927
2631	Ga0495618_0065699
2632	Ga0495620_0006077
2633	Ga0495628_0000566
2634	Ga0495628_0009608
2635	Ga0495628_0010807
2636	Ga0495628_0162672
2637	Ga0495628_0176461
2638	Ga0495630_0006721
2639	Ga0495630_0034365
2640	Ga0495630_0047622
2641	Ga0495630_0048699
2642	Ga0495630_0078485
2643	Ga0495630_0183914
2644	Ga0495630_0202682
2645	Ga0495643_0094826
2646	Ga0495663_0000041
2647	Ga0495663_0012611
2648	Ga0495666_0015344
2649	Ga0495666_0051407
2650	Ga0495666_0079308
2651	Ga0495652_0000415
2652	Ga0495652_0003238
2653	Ga0495652_0014498
2654	Ga0495652_0017823
2655	Ga0495652_0032816
2656	Ga0495652_0131791
2657	Ga0495665_0003630
2658	Ga0495665_0032011
2659	Ga0495640_0014491
2660	Ga0495640_0021723
2661	Ga0495640_0027072
2662	Ga0495640_0050138
2663	Ga0495640_0098754
2664	Ga0495586_0001504
2665	Ga0495586_0009784
2666	Ga0495586_0053888
2667	Ga0495587_0000049
2668	Ga0495587_0011091
2669	Ga0495587_0059565
2670	Ga0495587_0072640
2671	Ga0495645_0007547
2672	Ga0495645_0026918
2673	Ga0495645_0048487
2674	Ga0495645_0057004
2675	Ga0495645_0079474
2676	Ga0495645_0098882
2677	Ga0495667_0000041
2678	Ga0495667_0001387
2679	Ga0495667_0005665
2680	Ga0495667_0006595
2681	Ga0495667_0020456
2682	Ga0495667_0095863
2683	Ga0495667_0102530
2684	Ga0495668_0007996
2685	Ga0495634_0003643
2686	Ga0495634_0018131
2687	Ga0495634_0077598
2688	Ga0495634_0202145
2689	Ga0495625_0000911
2690	Ga0495625_0076269
2691	Ga0495635_0006189
2692	Ga0495635_0008669
2693	Ga0495635_0012396
2694	Ga0495635_0057977
2695	Ga0495635_0059571
2696	Ga0495661_0149716
2697	Ga0495657_0000126
2698	Ga0495657_0001156
2699	Ga0495657_0001976
2700	Ga0495657_0008646
2701	Ga0495657_0026456
2702	Ga0495657_0042552
2703	Ga0495657_0051433
2704	Ga0495657_0078154
2705	Ga0495657_0096449
2706	Ga0495599_0000208
2707	Ga0495599_0001775
2708	Ga0495599_0018711
2709	Ga0495599_0018766
2710	Ga0495599_0038666
2711	Ga0495599_0049461
2712	Ga0495599_0108324
2713	Ga0495599_0148868
2714	Ga0495623_0000080
2715	Ga0495623_0031511
2716	Ga0495623_0067957
2717	Ga0495623_0070471
2718	Ga0495623_0076412
2719	Ga0495646_0010008
2720	Ga0495646_0065778
2721	Ga0495646_0093322
2722	Ga0495647_0001573
2723	Ga0495647_0015118
2724	Ga0495647_0032207
2725	Ga0495658_0005908
2726	Ga0495658_0015267
2727	Ga0495658_0211687
2728	Ga0495669_0005687
2729	Ga0495613_0000845
2730	Ga0495613_0004976
2731	Ga0495613_0107782
2732	Ga0495613_0125773
2733	Ga0495624_0021883
2734	Ga0495624_0056784
2735	Ga0495624_0090776
2736	Ga0495671_0000862
2737	Ga0495589_0010318
2738	Ga0495589_0018316
2739	Ga0495600_0002375
2740	Ga0495600_0007334
2741	Ga0495600_0007516
2742	Ga0495600_0037708
2743	Ga0495600_0064147
2744	Ga0495600_0106200
2745	Ga0495600_0184292
2746	Ga0495581_0000351
2747	Ga0495581_0000521
2748	Ga0495581_0005105
2749	Ga0495581_0036056
2750	Ga0495604_0000110
2751	Ga0495604_0011376
2752	Ga0495604_0016743
2753	Ga0495604_0017187
2754	Ga0495604_0023947
2755	Ga0495604_0116430
2756	Ga0495674_0018851
2757	Ga0495674_0034272
2758	Ga0495674_0113178
2759	Ga0495674_0218663
2760	Ga0495672_0000459
2761	Ga0495676_0023169
2762	Ga0495676_0026844
2763	Ga0495676_0039795
2764	Ga0495676_0133979
2765	Ga0495680_0000470
2766	Ga0495680_0016062
2767	Ga0495680_0018088
2768	Ga0495680_0054190
2769	Ga0495680_0054251
2770	Ga0495680_0132445
2771	Ga0495680_0140073
2772	Ga0495680_0154501
2773	Ga0495680_0172957
2774	Ga0495675_0001308
2775	Ga0495675_0012268
2776	Ga0495675_0012301
2777	Ga0495675_0045652
2778	Ga0495685_009173
2779	Ga0495685_018896
2780	Ga0495684_0007979
2781	Ga0495684_0015817
2782	Ga0495684_0016585
2783	Ga0495684_0044762
2784	Ga0495684_0081883
2785	Ga0495684_0116175
2786	Ga0495684_0176765
2787	Ga0495593_0002534
2788	Ga0495593_0008687
2789	Ga0495593_0012098
2790	Ga0495602_0000345
2791	Ga0495602_0017183
2792	Ga0495602_0049716
2793	Ga0495602_0116355
2794	Ga0495602_0286427
2795	Ga0496100_0011379
2796	Ga0496100_0034446
2797	Ga0496100_0044118
2798	Ga0496101_0011569
2799	Ga0496101_0029917
2800	Ga0496101_0061222
2801	Ga0496101_0072304
2802	Ga0496102_0000121
2803	Ga0496102_0017751
2804	Ga0496102_0018389
2805	Ga0496102_0032155
2806	Ga0496102_0107091
2807	Ga0496102_0191357
2808	Ga0496103_0000224
2809	Ga0496103_0005303
2810	Ga0496103_0025461
2811	Ga0496103_0039407
2812	Ga0496103_0133196
2813	Ga0496103_0145545
2814	Ga0496104_0004532
2815	Ga0496104_0006922
2816	Ga0496104_0007859
2817	Ga0496104_0011347
2818	Ga0496104_0016014
2819	Ga0496104_0033156
2820	Ga0496104_0077574
2821	Ga0496105_0007753
2822	Ga0496105_0025217
2823	Ga0496105_0031764
2824	Ga0496105_0044914
2825	Ga0496105_0055772
2826	Ga0496105_0091186
2827	Ga0496105_0177619
2828	Ga0496106_0051571
2829	Ga0496106_0080505
2830	Ga0496106_0106791
2831	Ga0496106_0171546
2832	Ga0496107_0012475
2833	Ga0496107_0023821
2834	Ga0496107_0039362
2835	Ga0496108_0013234
2836	Ga0496108_0015337
2837	Ga0496108_0023390
2838	Ga0496108_0239178
2839	Ga0496109_0010382
2840	Ga0496109_0017894
2841	Ga0496109_0031113
2842	Ga0496109_0048341
2843	Ga0496109_0107561
2844	Ga0496110_0000640
2845	Ga0496110_0003291
2846	Ga0496110_0010185
2847	Ga0496110_0011073
2848	Ga0496110_0014565
2849	Ga0496110_0061335
2850	Ga0496110_0077614
2851	Ga0496110_0284975
2852	Ga0496110_0325162
2853	Ga0496110_0352531
2854	Ga0496111_0010632
2855	Ga0496111_0033772
2856	Ga0496111_0050523
2857	Ga0496111_0073792
2858	Ga0496111_0114534
2859	Ga0496111_0115037
2860	Ga0496112_0002361
2861	Ga0496112_0027178
2862	Ga0496112_0068395
2863	Ga0496112_0143814
2864	Ga0496112_0170150
2865	Ga0496113_0026225
2866	Ga0496113_0115992
2867	Ga0496113_0184209
2868	Ga0496114_0000840
2869	Ga0496114_0001257
2870	Ga0496114_0002103
2871	Ga0496114_0009000
2872	Ga0496114_0019711
2873	Ga0496114_0062677
2874	Ga0496114_0093864
2875	Ga0496114_0129640
2876	Ga0496114_0148994
2877	Ga0496114_0239133
2878	Ga0496114_0245293
2879	Ga0496114_0334493
2880	Ga0496115_0016938
2881	Ga0496115_0024948
2882	Ga0496115_0034855
2883	Ga0496115_0049785
2884	Ga0496115_0051318
2885	Ga0496115_0087035
2886	Ga0496115_0088232
2887	Ga0496115_0125518
2888	Ga0496115_0169186
2889	Ga0496116_0001687
2890	Ga0496116_0002425
2891	Ga0496117_0022116
2892	Ga0496117_0045443
2893	Ga0496118_0000322
2894	Ga0496118_0000462
2895	Ga0496118_0031380
2896	Ga0496118_0044709
2897	Ga0496118_0172570
2898	Ga0496119_0000104
2899	Ga0496120_0002351
2900	Ga0496121_0006448
2901	Ga0496121_0009278
2902	Ga0496121_0028527
2903	Ga0496121_0111659
2904	Ga0496121_0134614
2905	Ga0496121_0297850
2906	Ga0496123_0002402
2907	Ga0496124_0000459
2908	Ga0496125_0030253
2909	Ga0496125_0053137
2910	Ga0496126_0000037
2911	Ga0496126_0000999
2912	Ga0496126_0004694
2913	Ga0496126_0005936
2914	Ga0496126_0075454
2915	Ga0496126_0231817
2916	Ga0501294_005152
2917	Ga0501031_0000485
2918	Ga0501031_0022708
2919	Ga0501031_0163834
2920	Ga0501032_0000424
2921	Ga0501032_0008084
2922	Ga0501033_0016983
2923	Ga0501033_0061288
2924	Ga0501033_0066414
2925	Ga0501033_0170713
2926	Ga0501034_0000339
2927	Ga0501034_0011396
2928	Ga0501034_0026673
2929	Ga0501034_0027747
2930	Ga0501034_0029476
2931	Ga0501034_0116918
2932	Ga0501034_0120428
2933	Ga0501034_0168887
2934	Ga0501034_0198045
2935	Ga0501036_0005274
2936	Ga0501036_0026339
2937	Ga0501036_0108991
2938	Ga0501036_0124055
2939	Ga0501037_0003342
2940	Ga0501037_0043187
2941	Ga0501037_0049439
2942	Ga0501037_0050557
2943	Ga0501038_0007562
2944	Ga0501038_0021944
2945	Ga0501038_0028260
2946	Ga0501038_0035688
2947	Ga0501038_0104806
2948	Ga0501038_0127699
2949	Ga0501038_0161269
2950	Ga0501038_0253855
2951	Ga0501039_0000966
2952	Ga0501039_0001751
2953	Ga0501039_0016350
2954	Ga0501039_0025475
2955	Ga0501039_0028102
2956	Ga0501039_0096987
2957	Ga0501039_0318269
2958	Ga0501040_0000581
2959	Ga0501040_0002936
2960	Ga0501040_0003290
2961	Ga0501040_0010682
2962	Ga0501040_0017049
2963	Ga0501040_0029162
2964	Ga0501041_0009664
2965	Ga0501041_0012306
2966	Ga0501041_0039741
2967	Ga0501041_0052236
2968	Ga0501041_0132853
2969	Ga0501041_0164675
2970	Ga0501042_0001049
2971	Ga0501042_0004432
2972	Ga0501042_0005589
2973	Ga0501042_0006659
2974	Ga0501042_0010012
2975	Ga0501042_0019346
2976	Ga0501042_0028106
2977	Ga0501042_0053785
2978	Ga0501042_0101067
2979	Ga0501042_0154025
2980	Ga0501043_0012258
2981	Ga0501043_0019067
2982	Ga0501046_0005483
2983	Ga0501046_0008010
2984	Ga0501046_0017525
2985	Ga0501046_0028814
2986	Ga0501046_0031002
2987	Ga0501046_0078648
2988	Ga0501047_0000601
2989	Ga0501047_0001963
2990	Ga0501047_0003093
2991	Ga0501047_0037282
2992	Ga0501047_0096977
2993	Ga0501047_0133398
2994	Ga0501047_0217953
2995	Ga0501048_0001137
2996	Ga0501048_0016878
2997	Ga0501048_0023764
2998	Ga0501048_0029364
2999	Ga0501048_0037709
3000	Ga0501048_0074323
3001	Ga0501048_0075556
3002	Ga0501048_0082044
3003	Ga0501067_0029205
3004	Ga0501068_0025615
3005	Ga0501068_0050086
3006	Ga0501068_0054389
3007	Ga0501068_0167417
3008	Ga0501069_0000089
3009	Ga0501069_0005202
3010	Ga0501069_0008959
3011	Ga0501069_0116590
3012	Ga0501070_0000008
3013	Ga0501070_0001203
3014	Ga0501070_0017196
3015	Ga0501070_0054912
3016	Ga0501070_0065034
3017	Ga0501070_0189953
3018	Ga0501071_0001866
3019	Ga0501071_0003038
3020	Ga0501071_0003173
3021	Ga0501071_0007247
3022	Ga0501071_0020290
3023	Ga0501071_0065614
3024	Ga0501072_0001968
3025	Ga0501072_0002597
3026	Ga0501072_0007326
3027	Ga0501072_0009139
3028	Ga0501072_0018044
3029	Ga0501072_0022975
3030	Ga0501072_0025611
3031	Ga0501072_0056152
3032	Ga0501072_0096587
3033	Ga0501072_0125836
3034	Ga0501072_0161244
3035	Ga0501074_0022034
3036	Ga0501074_0038358
3037	Ga0501074_0102731
3038	Ga0501075_0000895
3039	Ga0501075_0002183
3040	Ga0501075_0006676
3041	Ga0501075_0013675
3042	Ga0501075_0022349
3043	Ga0501075_0148205
3044	Ga0501075_0174122
3045	Ga0501076_0001798
3046	Ga0501076_0002273
3047	Ga0501076_0002738
3048	Ga0501076_0004824
3049	Ga0501076_0045646
3050	Ga0501076_0076524
3051	Ga0501076_0078451
3052	Ga0501076_0104808
3053	Ga0501076_0120304
3054	Ga0501076_0202792
3055	Ga0501077_0003196
3056	Ga0501077_0005440
3057	Ga0501077_0025113
3058	Ga0501077_0033857
3059	Ga0501077_0205902
3060	Ga0501198_004370
3061	Ga0501217_005828
3062	Ga0501235_023528
3063	Ga0501249_000117
3064	Ga0501079_0004718
3065	Ga0501079_0008561
3066	Ga0501079_0009798
3067	Ga0501079_0106805
3068	Ga0501079_0129740
3069	Ga0501079_0189018
3070	Ga0501080_0012185
3071	Ga0501080_0018696
3072	Ga0501080_0074250
3073	Ga0501080_0092571
3074	Ga0501080_0107899
3075	Ga0501080_0146369
3076	Ga0501080_0347985
3077	Ga0501081_0005016
3078	Ga0501081_0008789
3079	Ga0501081_0027685
3080	Ga0501081_0027709
3081	Ga0501081_0030670
3082	Ga0501081_0234164
3083	Ga0501081_0251147
3084	Ga0501083_0000408
3085	Ga0501083_0009305
3086	Ga0501083_0019807
3087	Ga0501281_00002
3088	Ga0501035_0004302
3089	Ga0501035_0010123
3090	Ga0501035_0018495
3091	Ga0501035_0026910
3092	Ga0501035_0060451
3093	Ga0501035_0069525
3094	Ga0501035_0078324
3095	Ga0501035_0130017
3096	Ga0501035_0155576
3097	Ga0501044_0001813
3098	Ga0501044_0008299
3099	Ga0501044_0010153
3100	Ga0501044_0012648
3101	Ga0501044_0016106
3102	Ga0501044_0378393
3103	Ga0501045_0000725
3104	Ga0501045_0003204
3105	Ga0501045_0003364
3106	Ga0501045_0013023
3107	Ga0501045_0025509
3108	Ga0501045_0066501
3109	Ga0501045_0078470
3110	Ga0501045_0171973
3111	Ga0501204_000446
3112	nmdc:mga03n38_97111_c1
3113	nmdc:mga0yw44_117309_c1
3114	nmdc:mga0yw44_1691_c1
3115	nmdc:mga0yw44_2005_c1
3116	nmdc:mga0yw44_2625_c1
3117	nmdc:mga0yw44_33385_c1
3118	nmdc:mga0yw44_48520_c1
3119	nmdc:mga07m45_6297_c1
3120	nmdc:mga05p37_213038_c1
3121	nmdc:mga05p37_2208_c1
3122	nmdc:mga05p37_30113_c1
3123	nmdc:mga05p37_47073_c1
3124	nmdc:mga09592_135167_c1
3125	nmdc:mga09592_33032_c1
3126	nmdc:mga0qj67_181720_c1
3127	nmdc:mga0qj67_20395_c1
3128	nmdc:mga0qj67_66004_c1
3129	nmdc:mga0qj67_8448_c1
3130	nmdc:mga06r32_107748_c1
3131	nmdc:mga06r32_12374_c1
3132	nmdc:mga06r32_158411_c1
3133	nmdc:mga06r32_30013_c1
3134	nmdc:mga08y16_155061_c1
3135	nmdc:mga08y16_169045_c1
3136	nmdc:mga08y16_451430_c1
3137	nmdc:mga08y16_49670_c1
3138	nmdc:mga08y16_72585_c1
3139	nmdc:mga0n895_15173_c1
3140	nmdc:mga0n895_196045_c1
3141	nmdc:mga0n895_235323_c1
3142	nmdc:mga0n895_3276_c1
3143	nmdc:mga0rr50_125550_c1
3144	nmdc:mga0rr50_23084_c1
3145	nmdc:mga0rr50_335318_c1
3146	nmdc:mga0rr50_62699_c1
3147	nmdc:mga0rr50_92352_c1
3148	nmdc:mga08x19_223708_c1
3149	nmdc:mga08x19_264524_c1
3150	nmdc:mga08x19_4090_c1
3151	nmdc:mga08x19_4_c1
3152	nmdc:mga0a205_116864_c1
3153	nmdc:mga0a205_258698_c1
3154	Ga0495601_0004240
3155	Ga0495601_0020581
3156	Ga0495601_0026317
3157	Ga0495601_0043337
3158	Ga0495601_0104454
3159	Ga0495612_0003194
3160	Ga0495612_0017040
3161	Ga0495612_0052197
3162	Ga0500610_0000152
3163	Ga0495595_0000800
3164	Ga0495595_0018875
3165	Ga0495595_0024185
3166	Ga0495595_0062865
3167	Ga0495595_0096053
3168	Ga0495619_0005129
3169	Ga0495619_0008855
3170	Ga0495619_0016896
3171	Ga0495619_0158383
3172	Ga0500643_000188
3173	Ga0500641_0065901
3174	Ga0500650_0000017
3175	Ga0500593_000100
3176	Ga0500593_014489
3177	Ga0500658_0000047
3178	Ga0500568_0000011
3179	Ga0500604_0008326
3180	Ga0500604_0009663
3181	Ga0500616_0000905
3182	Ga0500616_0001088
3183	Ga0500622_0001774
3184	Ga0500622_0011034
3185	Ga0500627_0007069
3186	Ga0500627_0046820
3187	Ga0500596_002176
3188	Ga0501084_0000086
3189	Ga0501084_0002919
3190	Ga0501084_0007402
3191	Ga0501084_0024187
3192	Ga0501084_0033145
3193	Ga0501084_0049068
3194	Ga0501084_0068412
3195	Ga0501084_0076326
3196	Ga0501082_0010656
3197	Ga0501082_0012946
3198	Ga0501082_0017891
3199	Ga0501082_0020755
3200	Ga0501082_0033862
3201	Ga0501082_0039827
3202	Ga0501082_0130332
3203	Ga0466962_0015510
3204	Ga0466962_0017966
3205	Ga0530510_0001548
3206	Ga0530510_0001995
3207	Ga0530510_0003428
3208	Ga0530510_0006008
3209	Ga0530510_0012291
3210	Ga0530510_0013569
3211	Ga0530510_0136535
3212	2501940916
3213	2506867910
3214	2508678411
3215	2523384783
3216	2548692936
3217	2552746647
3218	2552748084
3219	2595088439
3220	2626636376
3221	2640733522
3222	2640734984
3223	2644361825
3224	2671838875
3225	2672334260
3226	2676201324
3227	2678230558
3228	2678231882
3229	2689995690
3230	2738709073
3231	2738837937
3232	2738847498
3233	2738863227
3234	2739231013
3235	2739268153
3236	2739295745
3237	2739357423
3238	2745160634
3239	2757565484
3240	2774388911
3241	2774389592
3242	2774436704
3243	2774439797
3244	2774845900
3245	2774857031
3246	2774904332
3247	2774905752
3248	2774905893
3249	2777762820
3250	2777763903
3251	2777837009
3252	2791211710
3253	2816865838
3254	2819628639
3255	2842685863
3256	2849142075
3257	2852674059
3258	2856861817
3259	2857581761
3260	2857585902
3261	2857588220
3262	2857592049
3263	2862292997
3264	2862575416
3265	2867508492
3266	2894776755
3267	2898907217
3268	2904609068
3269	2912727207
3270	2915359925
3271	2916699715
3272	2919183069
3273	2919183459
3274	2919506965
3275	2919508598
3276	2919717854
3277	2928102157
3278	2928510666
3279	2928517940
3280	2928962401
3281	2929186610
3282	2929201291
3283	2929212719
3284	2936342873
3285	2936364301
3286	2939597928
3287	2954692323
3288	2954707389
3289	2977259176
3290	2984569529
3291	2990280205
3292	2995464186
3293	3001893021
3294	3001895645
3295	3003006308
3296	3006829265
3297	3006978211
3298	649812415
3299	8002779564
3300	8022793391
3301	8033233388
3302	8033233553
3303	8046355932
3304	8047713229
3305	8055532291
3306	8055910058
3307	8057587118
3308	8057634880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

293

442

0.99 PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

68

182

0.95 PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

308

431

0.94 PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

186

281

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2pg0-assembly1.cif.gz_A	crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus	0.9846	2	378
2jif-assembly1.cif.gz_D	structure of human short-branched chain acyl-coa dehydrogenase (acadsb)	0.9627	1	379
1ivh-assembly1.cif.gz_B	structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity	0.9621	6	379
4kto-assembly1.cif.gz_D	crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021	0.9618	2	380
4kto-assembly1.cif.gz_C	crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021	0.9604	2	379

ID	Description	Score	Start	End	Superfamily
af_P28330_285_428_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	1.001	237	380	1.20.140.10
af_O33229_243_386_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9959	237	380	1.20.140.10
2pg0B03	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9944	233	378	1.20.140.10
af_P28330_285_428_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9939	237	380	1.20.140.10
af_O33229_243_386_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.989	237	380	1.20.140.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2R7SUN5-F1-model_v4	deleted	0.998	140	377
AF-V7MQB5-F1-model_v4	deleted	0.9948	1	323
AF-A0A848DKD1-F1-model_v4	Acyl-CoA dehydrogenase	0.9918	214	380	GO:0003995 GO:0005737 GO:0033539 GO:0050660
AF-A0A3Q2P568-F1-model_v4	Long-chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.8)	0.9913	2	379	GO:0004466 GO:0005759 GO:0016401 GO:0019254 GO:0033539 GO:0042758 GO:0050660
AF-A0A3S3V250-F1-model_v4	Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N)	0.9908	1	378	GO:0003995 GO:0005737 GO:0033539 GO:0050660

F495228

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

293

442

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

68

182

0.95

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

308

431

0.94

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

186

281

0.93

Structural Annotation

Top 5 Hits

Map