F495247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1660 | 645 | 3320 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0012405|Ga0495625_0012405_2188_3693 |
| Length | 501 |
| Sequence | LEANGNAAPLRDARERAYGWVGGLSPLLPTLIRDINARVTNLPQTGGLVKSQSANPLTEQFMKIKLAAFAPGLLALALASPAHAQVEVQWWHSMTGGLNEWVNDLAKQFNESQKDYKIVPTFKGNYDESMTAAVAAFRAGNAPHILQVFEVGTATMMSAKGAIKPVGEVMKQSGVSFDPKAYVPAVSGYYTAPNGEMLSFPFNSSTTIFYYNKDAFKAAGLDPNKAPTTWPEVVAAAAKLKASGSKCPYTTSWMSWVHLESFSTWHNTLFATQNNGFGGPSARLAFNSPLHLRHFDNLANMSKQGLFVYKGRASVAVPSFVSGECAMLTGSSGSYADVSKGAKFAYGLAALPYYPDVPGAPQNTAIGGASLWVMSGKKPAEYKGVAEFFKFLSSPDVQSASHKRTGYLPITTAAYQLTEKSGFYTEKPGTDVAVTQMIRKTTDKSRGIRLGNFVQIRTIIDEETEQIWAGKKDAKTALNDAVKRGNEQLERFEKQNKAPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 128 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 129 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 130 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 149 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 170 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 269 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 274 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 278 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 279 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 281 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 282 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 283 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 286 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 287 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 288 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 289 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 290 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 291 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 292 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 293 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 294 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 295 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 296 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 297 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 298 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 299 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 300 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 302 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 303 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 304 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 305 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 306 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 307 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 308 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 309 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 310 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 311 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 313 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 314 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 317 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 319 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 320 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 327 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 328 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 329 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 330 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 331 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 332 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 333 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 334 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 335 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 336 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 337 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 338 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 339 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 340 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 341 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 342 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 343 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 344 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 345 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 346 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 347 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 348 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 349 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 350 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 351 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 352 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 353 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 354 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 355 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 356 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 357 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 358 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 359 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 360 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 361 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 362 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 363 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 364 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 365 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 366 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 367 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 368 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 369 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 370 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 371 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 372 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 373 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 374 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 375 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 376 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 377 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 378 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 379 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 438 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 439 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 440 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 441 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 442 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 445 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 446 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 447 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 448 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 449 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 450 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 451 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 452 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 453 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 454 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 455 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 456 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 457 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 458 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 459 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 462 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 463 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 464 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 483 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 484 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 485 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 486 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 487 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 488 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 489 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 490 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 495 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 496 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 501 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 502 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 503 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 504 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 505 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 506 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 519 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 520 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 521 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 522 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 523 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 524 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 525 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 526 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 528 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 529 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 530 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 531 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 532 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 533 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 534 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 535 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 536 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 537 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 538 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 539 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 540 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 541 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 542 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 543 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 544 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 545 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 546 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 547 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 548 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 549 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 550 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 551 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 552 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 553 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 554 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 555 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 556 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 557 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 558 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 559 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 560 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 561 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 562 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 563 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 564 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 565 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 566 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 567 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 568 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 569 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 570 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 571 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 572 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 573 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 574 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 575 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 576 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 577 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 578 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 579 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 580 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 581 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 582 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 583 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 584 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 585 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 586 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 587 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 588 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 589 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 590 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 591 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 592 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 593 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 594 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 595 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 596 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 597 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 598 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 599 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 600 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 601 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 602 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 603 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 604 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 605 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 606 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 607 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 608 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 609 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 610 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 611 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 612 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 613 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 614 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 615 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 616 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 617 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 618 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 619 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 620 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 621 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 622 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 623 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 624 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 625 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 626 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 627 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 628 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 629 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 630 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 631 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 632 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 633 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 634 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 635 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 636 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 637 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 638 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 639 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 640 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 641 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 642 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 643 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 644 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 645 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.25 |
| Metatranscriptomes | 0.18 |
| Isolates | 6.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.77 |
| Nodule | 1.14 |
| Rhizoplane | 1.87 |
| Rhizosphere | 69.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495625_0012405 | 3300046660 | Bacteria | 6906 |
| 2 | JGI24739J22299_10000107 | 3300001989 | Bacteria | 25402 |
| 3 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 4 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 5 | JGI25162J39368_1002554 | 3300002737 | Bacteria | 6924 |
| 6 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 7 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 8 | JGI25157J39369_1000747 | 3300002741 | Bacteria | 17104 |
| 9 | JGI25152J39213_1001428 | 3300002773 | Bacteria | 10325 |
| 10 | JGI25150J39212_1001994 | 3300002774 | Bacteria | 5335 |
| 11 | JGI25159J45721_1001646 | 3300002987 | Bacteria | 9081 |
| 12 | JGI25159J45721_1001983 | 3300002987 | Bacteria | 8149 |
| 13 | JGI25151J46595_10002783 | 3300003187 | Bacteria | 10136 |
| 14 | JGI25151J46595_10003777 | 3300003187 | Bacteria | 8216 |
| 15 | JGI25151J46595_10007702 | 3300003187 | Bacteria | 5245 |
| 16 | JGI25151J46595_10009716 | 3300003187 | Bacteria | 4532 |
| 17 | JGI25406J46586_10000977 | 3300003203 | Bacteria | 13433 |
| 18 | JGI25153J46596_10005438 | 3300003215 | Bacteria | 6684 |
| 19 | rootL2_10004438 | 3300003322 | Bacteria | 5836 |
| 20 | rootL2_10021412 | 3300003322 | Bacteria | 3310 |
| 21 | JGI25160J50197_1000273 | 3300003354 | Bacteria | 38119 |
| 22 | JGI25161J50226_1000095 | 3300003374 | Bacteria | 72343 |
| 23 | Ga0055532_1000271 | 3300003758 | Bacteria | 33888 |
| 24 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 25 | Ga0055527_1001088 | 3300003760 | Bacteria | 6375 |
| 26 | Ga0055535_1000380 | 3300003761 | Bacteria | 42008 |
| 27 | Ga0055542_1000062 | 3300003762 | Bacteria | 161494 |
| 28 | Ga0055526_1000968 | 3300003771 | Bacteria | 21218 |
| 29 | Ga0055526_1006110 | 3300003771 | Bacteria | 6642 |
| 30 | Ga0055526_1006746 | 3300003771 | Bacteria | 6148 |
| 31 | Ga0055526_1014527 | 3300003771 | Bacteria | 3231 |
| 32 | Ga0055537_1000483 | 3300003773 | Bacteria | 24708 |
| 33 | Ga0055537_1000717 | 3300003773 | Bacteria | 17146 |
| 34 | Ga0055537_1002502 | 3300003773 | Bacteria | 6113 |
| 35 | Ga0055524_1000073 | 3300003775 | Bacteria | 123033 |
| 36 | Ga0055524_1000658 | 3300003775 | Bacteria | 24412 |
| 37 | Ga0055524_1001688 | 3300003775 | Bacteria | 12293 |
| 38 | Ga0055524_1022732 | 3300003775 | Bacteria | 2039 |
| 39 | Ga0055536_1000060 | 3300003781 | Bacteria | 102699 |
| 40 | Ga0055536_1004647 | 3300003781 | Bacteria | 6945 |
| 41 | Ga0055536_1006788 | 3300003781 | Bacteria | 5240 |
| 42 | Ga0055536_1022945 | 3300003781 | Bacteria | 1847 |
| 43 | Ga0055534_1000337 | 3300003784 | Bacteria | 30592 |
| 44 | Ga0055534_1000467 | 3300003784 | Bacteria | 22933 |
| 45 | Ga0055534_1000548 | 3300003784 | Bacteria | 20007 |
| 46 | Ga0055534_1000929 | 3300003784 | Bacteria | 13182 |
| 47 | Ga0055534_1001861 | 3300003784 | Bacteria | 7873 |
| 48 | Ga0055528_1007433 | 3300003790 | Bacteria | 4844 |
| 49 | Ga0055530_10001136 | 3300003791 | Bacteria | 20712 |
| 50 | Ga0055530_10004473 | 3300003791 | Bacteria | 7172 |
| 51 | Ga0055530_10011023 | 3300003791 | Bacteria | 3281 |
| 52 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 53 | Ga0055540_1000202 | 3300003792 | Bacteria | 57757 |
| 54 | Ga0055540_1001461 | 3300003792 | Bacteria | 14088 |
| 55 | Ga0055540_1007521 | 3300003792 | Bacteria | 4090 |
| 56 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 57 | Ga0055531_10000112 | 3300003794 | Bacteria | 89016 |
| 58 | Ga0055531_10001286 | 3300003794 | Bacteria | 18915 |
| 59 | Ga0055531_10001923 | 3300003794 | Bacteria | 14525 |
| 60 | Ga0055531_10011360 | 3300003794 | Bacteria | 4307 |
| 61 | Ga0058692_1000039 | 3300003856 | Bacteria | 133315 |
| 62 | Ga0058692_1000291 | 3300003856 | Bacteria | 25903 |
| 63 | Ga0058692_1000442 | 3300003856 | Bacteria | 18875 |
| 64 | Ga0058692_1000709 | 3300003856 | Bacteria | 13656 |
| 65 | Ga0058692_1002728 | 3300003856 | Bacteria | 5808 |
| 66 | Ga0058692_1003453 | 3300003856 | Bacteria | 4872 |
| 67 | Ga0055543_1000218 | 3300004625 | Bacteria | 46120 |
| 68 | Ga0055543_1002869 | 3300004625 | Bacteria | 5424 |
| 69 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 70 | Ga0065165_1000942 | 3300005262 | Bacteria | 37104 |
| 71 | Ga0065165_1003934 | 3300005262 | Bacteria | 9777 |
| 72 | Ga0065165_1013762 | 3300005262 | Bacteria | 3188 |
| 73 | Ga0065165_1014362 | 3300005262 | Bacteria | 3080 |
| 74 | Ga0065704_10072179 | 3300005289 | Bacteria | 9000 |
| 75 | Ga0065704_10079023 | 3300005289 | Bacteria | 4279 |
| 76 | Ga0065715_10179597 | 3300005293 | Bacteria | 1486 |
| 77 | Ga0065707_10083647 | 3300005295 | Bacteria | 8552 |
| 78 | Ga0065707_10143859 | 3300005295 | Bacteria | 1738 |
| 79 | Ga0070658_10003011 | 3300005327 | Bacteria | 13938 |
| 80 | Ga0070658_10037598 | 3300005327 | Bacteria | 3903 |
| 81 | Ga0070658_10102728 | 3300005327 | Bacteria | 2364 |
| 82 | Ga0070658_10154433 | 3300005327 | Bacteria | 1923 |
| 83 | Ga0070676_10002537 | 3300005328 | Bacteria | 9382 |
| 84 | Ga0070676_10044429 | 3300005328 | Bacteria | 2585 |
| 85 | Ga0070683_100022694 | 3300005329 | Bacteria | 5612 |
| 86 | Ga0070683_100057870 | 3300005329 | Bacteria | 3601 |
| 87 | Ga0070690_100011726 | 3300005330 | Bacteria | 5136 |
| 88 | Ga0070670_100000655 | 3300005331 | Bacteria | 26906 |
| 89 | Ga0070670_100018023 | 3300005331 | Bacteria | 6059 |
| 90 | Ga0070670_100018207 | 3300005331 | Bacteria | 6027 |
| 91 | Ga0070670_100048709 | 3300005331 | Bacteria | 3646 |
| 92 | Ga0070670_100056163 | 3300005331 | Bacteria | 3379 |
| 93 | Ga0070670_100119152 | 3300005331 | Bacteria | 2276 |
| 94 | Ga0070670_100140245 | 3300005331 | Bacteria | 2090 |
| 95 | Ga0070670_100149189 | 3300005331 | Bacteria | 2023 |
| 96 | Ga0070677_10026317 | 3300005333 | Bacteria | 2180 |
| 97 | Ga0068869_100002039 | 3300005334 | Bacteria | 12140 |
| 98 | Ga0068869_100041135 | 3300005334 | Bacteria | 3308 |
| 99 | Ga0068869_100061697 | 3300005334 | Bacteria | 2750 |
| 100 | Ga0070666_10027838 | 3300005335 | Bacteria | 3705 |
| 101 | Ga0070680_100043209 | 3300005336 | Bacteria | 3661 |
| 102 | Ga0070680_100074544 | 3300005336 | Bacteria | 2792 |
| 103 | Ga0070680_100216976 | 3300005336 | Bacteria | 1614 |
| 104 | Ga0070682_100045907 | 3300005337 | Bacteria | 2710 |
| 105 | Ga0070682_100081811 | 3300005337 | Bacteria | 2092 |
| 106 | Ga0068868_100001312 | 3300005338 | Bacteria | 17144 |
| 107 | Ga0068868_100034469 | 3300005338 | Bacteria | 3908 |
| 108 | Ga0068868_100059565 | 3300005338 | Bacteria | 3021 |
| 109 | Ga0070660_100030267 | 3300005339 | Bacteria | 4061 |
| 110 | Ga0070660_100058604 | 3300005339 | Bacteria | 2985 |
| 111 | Ga0070660_100061785 | 3300005339 | Bacteria | 2909 |
| 112 | Ga0070689_100035794 | 3300005340 | Bacteria | 3794 |
| 113 | Ga0070661_100005150 | 3300005344 | Bacteria | 9002 |
| 114 | Ga0070661_100014669 | 3300005344 | Bacteria | 5525 |
| 115 | Ga0070661_100054923 | 3300005344 | Bacteria | 2917 |
| 116 | Ga0070661_100106474 | 3300005344 | Bacteria | 2091 |
| 117 | Ga0070661_100172581 | 3300005344 | Bacteria | 1642 |
| 118 | Ga0070661_100234732 | 3300005344 | Bacteria | 1410 |
| 119 | Ga0070692_10046303 | 3300005345 | Bacteria | 2247 |
| 120 | Ga0070668_100010679 | 3300005347 | Bacteria | 6828 |
| 121 | Ga0070668_100052341 | 3300005347 | Bacteria | 3147 |
| 122 | Ga0070668_100058264 | 3300005347 | Bacteria | 2988 |
| 123 | Ga0070668_100062460 | 3300005347 | Bacteria | 2886 |
| 124 | Ga0070669_100005401 | 3300005353 | Bacteria | 9218 |
| 125 | Ga0070669_100021493 | 3300005353 | Bacteria | 4611 |
| 126 | Ga0070669_100074591 | 3300005353 | Bacteria | 2515 |
| 127 | Ga0070669_100080628 | 3300005353 | Bacteria | 2423 |
| 128 | Ga0070675_100002072 | 3300005354 | Bacteria | 14858 |
| 129 | Ga0070675_100002276 | 3300005354 | Bacteria | 14252 |
| 130 | Ga0070675_100058320 | 3300005354 | Bacteria | 3184 |
| 131 | Ga0070675_100078798 | 3300005354 | Bacteria | 2744 |
| 132 | Ga0070675_100208047 | 3300005354 | Bacteria | 1700 |
| 133 | Ga0070671_100011136 | 3300005355 | Bacteria | 7224 |
| 134 | Ga0070671_100014642 | 3300005355 | Bacteria | 6341 |
| 135 | Ga0070671_100016334 | 3300005355 | Bacteria | 6002 |
| 136 | Ga0070671_100039869 | 3300005355 | Bacteria | 3899 |
| 137 | Ga0070671_100060152 | 3300005355 | Bacteria | 3163 |
| 138 | Ga0070671_100062719 | 3300005355 | Bacteria | 3094 |
| 139 | Ga0070671_100096888 | 3300005355 | Bacteria | 2474 |
| 140 | Ga0070671_100280307 | 3300005355 | Bacteria | 1418 |
| 141 | Ga0070674_100027721 | 3300005356 | Bacteria | 3714 |
| 142 | Ga0070674_100035402 | 3300005356 | Bacteria | 3343 |
| 143 | Ga0070674_100075881 | 3300005356 | Bacteria | 2389 |
| 144 | Ga0070674_100116276 | 3300005356 | Bacteria | 1973 |
| 145 | Ga0070673_100010612 | 3300005364 | Bacteria | 6243 |
| 146 | Ga0070673_100013521 | 3300005364 | Bacteria | 5651 |
| 147 | Ga0070673_100231207 | 3300005364 | Bacteria | 1604 |
| 148 | Ga0070659_100000722 | 3300005366 | Bacteria | 23972 |
| 149 | Ga0070659_100025249 | 3300005366 | Bacteria | 4561 |
| 150 | Ga0070659_100028792 | 3300005366 | Bacteria | 4291 |
| 151 | Ga0070659_100039166 | 3300005366 | Bacteria | 3699 |
| 152 | Ga0070659_100163697 | 3300005366 | Bacteria | 1820 |
| 153 | Ga0070667_100027408 | 3300005367 | Bacteria | 4739 |
| 154 | Ga0070667_100063891 | 3300005367 | Bacteria | 3122 |
| 155 | Ga0070667_100085520 | 3300005367 | Bacteria | 2705 |
| 156 | Ga0070667_100152503 | 3300005367 | Bacteria | 2030 |
| 157 | Ga0070709_10012257 | 3300005434 | Bacteria | 4795 |
| 158 | Ga0070709_10012358 | 3300005434 | Bacteria | 4777 |
| 159 | Ga0070709_10074315 | 3300005434 | Bacteria | 2202 |
| 160 | Ga0070709_10116577 | 3300005434 | Bacteria | 1803 |
| 161 | Ga0070714_100116842 | 3300005435 | Bacteria | 2368 |
| 162 | Ga0070713_100012928 | 3300005436 | Bacteria | 6144 |
| 163 | Ga0070713_100034409 | 3300005436 | Bacteria | 4070 |
| 164 | Ga0070713_100128246 | 3300005436 | Bacteria | 2234 |
| 165 | Ga0070710_10047349 | 3300005437 | Bacteria | 2398 |
| 166 | Ga0070701_10053676 | 3300005438 | Bacteria | 2099 |
| 167 | Ga0070701_10106001 | 3300005438 | Bacteria | 1564 |
| 168 | Ga0070711_100004600 | 3300005439 | Bacteria | 8166 |
| 169 | Ga0070711_100061747 | 3300005439 | Bacteria | 2609 |
| 170 | Ga0070705_100136038 | 3300005440 | Bacteria | 1610 |
| 171 | Ga0070700_100000839 | 3300005441 | Bacteria | 15145 |
| 172 | Ga0070700_100077353 | 3300005441 | Bacteria | 2139 |
| 173 | Ga0070700_100131794 | 3300005441 | Bacteria | 1688 |
| 174 | Ga0070694_100017278 | 3300005444 | Bacteria | 4556 |
| 175 | Ga0070694_100019073 | 3300005444 | Bacteria | 4359 |
| 176 | Ga0070694_100065476 | 3300005444 | Bacteria | 2490 |
| 177 | Ga0070694_100076118 | 3300005444 | Bacteria | 2323 |
| 178 | Ga0070663_100012806 | 3300005455 | Bacteria | 5320 |
| 179 | Ga0070663_100032290 | 3300005455 | Bacteria | 3607 |
| 180 | Ga0070663_100088288 | 3300005455 | Bacteria | 2292 |
| 181 | Ga0070678_100022651 | 3300005456 | Bacteria | 4168 |
| 182 | Ga0070678_100023376 | 3300005456 | Bacteria | 4118 |
| 183 | Ga0070678_100036246 | 3300005456 | Bacteria | 3451 |
| 184 | Ga0070662_100001216 | 3300005457 | Bacteria | 15804 |
| 185 | Ga0070662_100020556 | 3300005457 | Bacteria | 4497 |
| 186 | Ga0070662_100020619 | 3300005457 | Bacteria | 4493 |
| 187 | Ga0070662_100111838 | 3300005457 | Bacteria | 2081 |
| 188 | Ga0070662_100141538 | 3300005457 | Bacteria | 1865 |
| 189 | Ga0070681_10015201 | 3300005458 | Bacteria | 7656 |
| 190 | Ga0070681_10017457 | 3300005458 | Bacteria | 7173 |
| 191 | Ga0070681_10047156 | 3300005458 | Bacteria | 4307 |
| 192 | Ga0070681_10098398 | 3300005458 | Bacteria | 2871 |
| 193 | Ga0068867_100000081 | 3300005459 | Bacteria | 59361 |
| 194 | Ga0068867_100001697 | 3300005459 | Bacteria | 15357 |
| 195 | Ga0068867_100002106 | 3300005459 | Bacteria | 13948 |
| 196 | Ga0068867_100024737 | 3300005459 | Bacteria | 4303 |
| 197 | Ga0068867_100042493 | 3300005459 | Bacteria | 3326 |
| 198 | Ga0068867_100042821 | 3300005459 | Bacteria | 3314 |
| 199 | Ga0068867_100220926 | 3300005459 | Bacteria | 1527 |
| 200 | Ga0070685_10084032 | 3300005466 | Bacteria | 1914 |
| 201 | Ga0070706_100000463 | 3300005467 | Bacteria | 48079 |
| 202 | Ga0070706_100067449 | 3300005467 | Bacteria | 3309 |
| 203 | Ga0070706_100076557 | 3300005467 | Bacteria | 3096 |
| 204 | Ga0070706_100215096 | 3300005467 | Bacteria | 1794 |
| 205 | Ga0070707_100011237 | 3300005468 | Bacteria | 8345 |
| 206 | Ga0070707_100075144 | 3300005468 | Bacteria | 3259 |
| 207 | Ga0070707_100186478 | 3300005468 | Bacteria | 2023 |
| 208 | Ga0070698_100038594 | 3300005471 | Bacteria | 4920 |
| 209 | Ga0070698_100171427 | 3300005471 | Bacteria | 2111 |
| 210 | Ga0070699_100012659 | 3300005518 | Bacteria | 7276 |
| 211 | Ga0070699_100019325 | 3300005518 | Bacteria | 5865 |
| 212 | Ga0070699_100027789 | 3300005518 | Bacteria | 4878 |
| 213 | Ga0070699_100028721 | 3300005518 | Bacteria | 4796 |
| 214 | Ga0070699_100043010 | 3300005518 | Bacteria | 3910 |
| 215 | Ga0070679_100042804 | 3300005530 | Bacteria | 4510 |
| 216 | Ga0070679_100043504 | 3300005530 | Bacteria | 4473 |
| 217 | Ga0070679_100148911 | 3300005530 | Bacteria | 2318 |
| 218 | Ga0070684_100019385 | 3300005535 | Bacteria | 5626 |
| 219 | Ga0070684_100020668 | 3300005535 | Bacteria | 5460 |
| 220 | Ga0070697_100033017 | 3300005536 | Bacteria | 4167 |
| 221 | Ga0068853_100001296 | 3300005539 | Bacteria | 17963 |
| 222 | Ga0068853_100020194 | 3300005539 | Bacteria | 5538 |
| 223 | Ga0068853_100094553 | 3300005539 | Bacteria | 2633 |
| 224 | Ga0070672_100002859 | 3300005543 | Bacteria | 11085 |
| 225 | Ga0070672_100013320 | 3300005543 | Bacteria | 5805 |
| 226 | Ga0070672_100018087 | 3300005543 | Bacteria | 5088 |
| 227 | Ga0070672_100035554 | 3300005543 | Bacteria | 3787 |
| 228 | Ga0070672_100041756 | 3300005543 | Bacteria | 3528 |
| 229 | Ga0070672_100042391 | 3300005543 | Bacteria | 3504 |
| 230 | Ga0070672_100272863 | 3300005543 | Bacteria | 1428 |
| 231 | Ga0070695_100055428 | 3300005545 | Bacteria | 2555 |
| 232 | Ga0070695_100114020 | 3300005545 | Bacteria | 1839 |
| 233 | Ga0070696_100003263 | 3300005546 | Bacteria | 10818 |
| 234 | Ga0070696_100035707 | 3300005546 | Bacteria | 3424 |
| 235 | Ga0070696_100051492 | 3300005546 | Bacteria | 2864 |
| 236 | Ga0070693_100007795 | 3300005547 | Bacteria | 5251 |
| 237 | Ga0070693_100021450 | 3300005547 | Bacteria | 3422 |
| 238 | Ga0070665_100013839 | 3300005548 | Bacteria | 8114 |
| 239 | Ga0070665_100019707 | 3300005548 | Bacteria | 6772 |
| 240 | Ga0070665_100022394 | 3300005548 | Bacteria | 6358 |
| 241 | Ga0070665_100225384 | 3300005548 | Bacteria | 1875 |
| 242 | Ga0070704_100004279 | 3300005549 | Bacteria | 8250 |
| 243 | Ga0070704_100023273 | 3300005549 | Bacteria | 4042 |
| 244 | Ga0070704_100237986 | 3300005549 | Bacteria | 1489 |
| 245 | Ga0068855_100016883 | 3300005563 | Bacteria | 8778 |
| 246 | Ga0068855_100019918 | 3300005563 | Bacteria | 8057 |
| 247 | Ga0068855_100020624 | 3300005563 | Bacteria | 7902 |
| 248 | Ga0068855_100033144 | 3300005563 | Bacteria | 6167 |
| 249 | Ga0068855_100036519 | 3300005563 | Bacteria | 5848 |
| 250 | Ga0068855_100043350 | 3300005563 | Bacteria | 5330 |
| 251 | Ga0070664_100015251 | 3300005564 | Bacteria | 6281 |
| 252 | Ga0070664_100023069 | 3300005564 | Bacteria | 5136 |
| 253 | Ga0070664_100026646 | 3300005564 | Bacteria | 4797 |
| 254 | Ga0070664_100052551 | 3300005564 | Bacteria | 3452 |
| 255 | Ga0070664_100115380 | 3300005564 | Bacteria | 2347 |
| 256 | Ga0068857_100094504 | 3300005577 | Bacteria | 2677 |
| 257 | Ga0068857_100108286 | 3300005577 | Bacteria | 2497 |
| 258 | Ga0068857_100199948 | 3300005577 | Bacteria | 1822 |
| 259 | Ga0068854_100008019 | 3300005578 | Bacteria | 6766 |
| 260 | Ga0068854_100016437 | 3300005578 | Bacteria | 4933 |
| 261 | Ga0068854_100017824 | 3300005578 | Bacteria | 4759 |
| 262 | Ga0068854_100027690 | 3300005578 | Bacteria | 3909 |
| 263 | Ga0068854_100063337 | 3300005578 | Bacteria | 2684 |
| 264 | Ga0068854_100113326 | 3300005578 | Bacteria | 2048 |
| 265 | Ga0068856_100003497 | 3300005614 | Bacteria | 15861 |
| 266 | Ga0068856_100052020 | 3300005614 | Bacteria | 4038 |
| 267 | Ga0068856_100059045 | 3300005614 | Bacteria | 3788 |
| 268 | Ga0068856_100079103 | 3300005614 | Bacteria | 3260 |
| 269 | Ga0068852_100005381 | 3300005616 | Bacteria | 9152 |
| 270 | Ga0068852_100011356 | 3300005616 | Bacteria | 6701 |
| 271 | Ga0068852_100062192 | 3300005616 | Bacteria | 3247 |
| 272 | Ga0068852_100071351 | 3300005616 | Bacteria | 3049 |
| 273 | Ga0068852_100130031 | 3300005616 | Bacteria | 2318 |
| 274 | Ga0068852_100224054 | 3300005616 | Bacteria | 1789 |
| 275 | Ga0068859_100006667 | 3300005617 | Bacteria | 11721 |
| 276 | Ga0068859_100066678 | 3300005617 | Bacteria | 3634 |
| 277 | Ga0068859_100100311 | 3300005617 | Bacteria | 2951 |
| 278 | Ga0068859_100101706 | 3300005617 | Bacteria | 2931 |
| 279 | Ga0068864_100001804 | 3300005618 | Bacteria | 17566 |
| 280 | Ga0068864_100006924 | 3300005618 | Bacteria | 9300 |
| 281 | Ga0068864_100016465 | 3300005618 | Bacteria | 6153 |
| 282 | Ga0068864_100023957 | 3300005618 | Bacteria | 5130 |
| 283 | Ga0068864_100049117 | 3300005618 | Bacteria | 3629 |
| 284 | Ga0068866_10006603 | 3300005718 | Bacteria | 4838 |
| 285 | Ga0068866_10024029 | 3300005718 | Bacteria | 2842 |
| 286 | Ga0068861_100001859 | 3300005719 | Bacteria | 13589 |
| 287 | Ga0068861_100020979 | 3300005719 | Bacteria | 4689 |
| 288 | Ga0068861_100024799 | 3300005719 | Bacteria | 4341 |
| 289 | Ga0068861_100040101 | 3300005719 | Bacteria | 3499 |
| 290 | Ga0068861_100204498 | 3300005719 | Bacteria | 1659 |
| 291 | Ga0068851_10001662 | 3300005834 | Bacteria | 9748 |
| 292 | Ga0068851_10027158 | 3300005834 | Bacteria | 2819 |
| 293 | Ga0068863_100011245 | 3300005841 | Bacteria | 8671 |
| 294 | Ga0068863_100025859 | 3300005841 | Bacteria | 5600 |
| 295 | Ga0068858_100005397 | 3300005842 | Bacteria | 12526 |
| 296 | Ga0068858_100015128 | 3300005842 | Bacteria | 7256 |
| 297 | Ga0068858_100015409 | 3300005842 | Bacteria | 7190 |
| 298 | Ga0068858_100071444 | 3300005842 | Bacteria | 3219 |
| 299 | Ga0068860_100004248 | 3300005843 | Bacteria | 14675 |
| 300 | Ga0068860_100004659 | 3300005843 | Bacteria | 14002 |
| 301 | Ga0068860_100005775 | 3300005843 | Bacteria | 12470 |
| 302 | Ga0068860_100043724 | 3300005843 | Bacteria | 4271 |
| 303 | Ga0068860_100326033 | 3300005843 | Bacteria | 1508 |
| 304 | Ga0068862_100004558 | 3300005844 | Bacteria | 11686 |
| 305 | Ga0068862_100018849 | 3300005844 | Bacteria | 5751 |
| 306 | Ga0068862_100088092 | 3300005844 | Bacteria | 2700 |
| 307 | Ga0081455_10075970 | 3300005937 | Bacteria | 2770 |
| 308 | Ga0081539_10000917 | 3300005985 | Bacteria | 55614 |
| 309 | Ga0081539_10001716 | 3300005985 | Bacteria | 35112 |
| 310 | Ga0070717_10205910 | 3300006028 | Bacteria | 1725 |
| 311 | Ga0075365_10006309 | 3300006038 | Bacteria | 6511 |
| 312 | Ga0075365_10010415 | 3300006038 | Bacteria | 5415 |
| 313 | Ga0075365_10029292 | 3300006038 | Bacteria | 3518 |
| 314 | Ga0075365_10048041 | 3300006038 | Bacteria | 2808 |
| 315 | Ga0075365_10108442 | 3300006038 | Bacteria | 1907 |
| 316 | Ga0075368_10044752 | 3300006042 | Bacteria | 1747 |
| 317 | Ga0075363_100009368 | 3300006048 | Bacteria | 4602 |
| 318 | Ga0075363_100014193 | 3300006048 | Bacteria | 3885 |
| 319 | Ga0075363_100015200 | 3300006048 | Bacteria | 3778 |
| 320 | Ga0075364_10065161 | 3300006051 | Bacteria | 2391 |
| 321 | Ga0075364_10081682 | 3300006051 | Bacteria | 2137 |
| 322 | Ga0075362_10005983 | 3300006177 | Bacteria | 4499 |
| 323 | Ga0075362_10039533 | 3300006177 | Bacteria | 2074 |
| 324 | Ga0075367_10013296 | 3300006178 | Bacteria | 4420 |
| 325 | Ga0075367_10089875 | 3300006178 | Bacteria | 1867 |
| 326 | Ga0075367_10104720 | 3300006178 | Bacteria | 1732 |
| 327 | Ga0075369_10010911 | 3300006186 | Bacteria | 3560 |
| 328 | Ga0075369_10013394 | 3300006186 | Bacteria | 3255 |
| 329 | Ga0075366_10000565 | 3300006195 | Bacteria | 17352 |
| 330 | Ga0075366_10003522 | 3300006195 | Bacteria | 8269 |
| 331 | Ga0075366_10004894 | 3300006195 | Bacteria | 7225 |
| 332 | Ga0075366_10007992 | 3300006195 | Bacteria | 5859 |
| 333 | Ga0075366_10010633 | 3300006195 | Bacteria | 5169 |
| 334 | Ga0075366_10023928 | 3300006195 | Bacteria | 3559 |
| 335 | Ga0075366_10026377 | 3300006195 | Bacteria | 3403 |
| 336 | Ga0075366_10028720 | 3300006195 | Bacteria | 3265 |
| 337 | Ga0075366_10034048 | 3300006195 | Bacteria | 3001 |
| 338 | Ga0075366_10040231 | 3300006195 | Bacteria | 2765 |
| 339 | Ga0075366_10054534 | 3300006195 | Bacteria | 2374 |
| 340 | Ga0075366_10074127 | 3300006195 | Bacteria | 2029 |
| 341 | Ga0075366_10096754 | 3300006195 | Bacteria | 1770 |
| 342 | Ga0075366_10119325 | 3300006195 | Bacteria | 1589 |
| 343 | Ga0075366_10151653 | 3300006195 | Bacteria | 1403 |
| 344 | Ga0097621_100009452 | 3300006237 | Bacteria | 7077 |
| 345 | Ga0097621_100013544 | 3300006237 | Bacteria | 6080 |
| 346 | Ga0097621_100018736 | 3300006237 | Bacteria | 5295 |
| 347 | Ga0097621_100025502 | 3300006237 | Bacteria | 4626 |
| 348 | Ga0097621_100026295 | 3300006237 | Bacteria | 4563 |
| 349 | Ga0097621_100053592 | 3300006237 | Bacteria | 3288 |
| 350 | Ga0097621_100130284 | 3300006237 | Bacteria | 2141 |
| 351 | Ga0097621_100161786 | 3300006237 | Bacteria | 1925 |
| 352 | Ga0097621_100255942 | 3300006237 | Bacteria | 1535 |
| 353 | Ga0075370_10000350 | 3300006353 | Bacteria | 16757 |
| 354 | Ga0075370_10001008 | 3300006353 | Bacteria | 11658 |
| 355 | Ga0075370_10001666 | 3300006353 | Bacteria | 9827 |
| 356 | Ga0075370_10004844 | 3300006353 | Bacteria | 6598 |
| 357 | Ga0075370_10012071 | 3300006353 | Bacteria | 4556 |
| 358 | Ga0075370_10012595 | 3300006353 | Bacteria | 4475 |
| 359 | Ga0075370_10037247 | 3300006353 | Bacteria | 2734 |
| 360 | Ga0075370_10068955 | 3300006353 | Bacteria | 2020 |
| 361 | Ga0075370_10077352 | 3300006353 | Bacteria | 1909 |
| 362 | Ga0068871_100006413 | 3300006358 | Bacteria | 8323 |
| 363 | Ga0068871_100017680 | 3300006358 | Bacteria | 5401 |
| 364 | Ga0068871_100017837 | 3300006358 | Bacteria | 5381 |
| 365 | Ga0068871_100020611 | 3300006358 | Bacteria | 5054 |
| 366 | Ga0068871_100026397 | 3300006358 | Bacteria | 4532 |
| 367 | Ga0075428_100006866 | 3300006844 | Bacteria | 12647 |
| 368 | Ga0075428_100059027 | 3300006844 | Bacteria | 4201 |
| 369 | Ga0075428_100116127 | 3300006844 | Bacteria | 2915 |
| 370 | Ga0075428_100185526 | 3300006844 | Bacteria | 2251 |
| 371 | Ga0075430_100037043 | 3300006846 | Bacteria | 4134 |
| 372 | Ga0075431_100009882 | 3300006847 | Bacteria | 9579 |
| 373 | Ga0075431_100045869 | 3300006847 | Bacteria | 4505 |
| 374 | Ga0075433_10270596 | 3300006852 | Bacteria | 1505 |
| 375 | Ga0075434_100000247 | 3300006871 | Bacteria | 37944 |
| 376 | Ga0075434_100016216 | 3300006871 | Bacteria | 7162 |
| 377 | Ga0075429_100000463 | 3300006880 | Bacteria | 30330 |
| 378 | Ga0075429_100012319 | 3300006880 | Bacteria | 7418 |
| 379 | Ga0075429_100086523 | 3300006880 | Bacteria | 2732 |
| 380 | Ga0068865_100041887 | 3300006881 | Bacteria | 3119 |
| 381 | Ga0068865_100056658 | 3300006881 | Bacteria | 2731 |
| 382 | Ga0068865_100061617 | 3300006881 | Bacteria | 2630 |
| 383 | Ga0068865_100072442 | 3300006881 | Bacteria | 2447 |
| 384 | Ga0068865_100169693 | 3300006881 | Bacteria | 1671 |
| 385 | Ga0075436_100000153 | 3300006914 | Bacteria | 42824 |
| 386 | Ga0075436_100002208 | 3300006914 | Bacteria | 13443 |
| 387 | Ga0075436_100021164 | 3300006914 | Bacteria | 4463 |
| 388 | Ga0075436_100031066 | 3300006914 | Bacteria | 3676 |
| 389 | Ga0075436_100055576 | 3300006914 | Bacteria | 2734 |
| 390 | Ga0097620_100006667 | 3300006931 | Bacteria | 11721 |
| 391 | Ga0097620_100066676 | 3300006931 | Bacteria | 3634 |
| 392 | Ga0097620_100100310 | 3300006931 | Bacteria | 2951 |
| 393 | Ga0097620_100101706 | 3300006931 | Bacteria | 2931 |
| 394 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 395 | Ga0079104_1014636 | 3300006946 | Bacteria | 2358 |
| 396 | Ga0099826_10000020 | 3300006948 | Bacteria | 183920 |
| 397 | Ga0099826_10043559 | 3300006948 | Bacteria | 3088 |
| 398 | Ga0099794_10021968 | 3300007265 | Bacteria | 2904 |
| 399 | Ga0099795_10004825 | 3300007788 | Bacteria | 3520 |
| 400 | Ga0099795_10021877 | 3300007788 | Bacteria | 2104 |
| 401 | Ga0105251_10001513 | 3300009011 | Bacteria | 19971 |
| 402 | Ga0105251_10011195 | 3300009011 | Bacteria | 5137 |
| 403 | Ga0105244_10010701 | 3300009036 | Bacteria | 5546 |
| 404 | Ga0105250_10003376 | 3300009092 | Bacteria | 7576 |
| 405 | Ga0105240_10003800 | 3300009093 | Bacteria | 23327 |
| 406 | Ga0105240_10018026 | 3300009093 | Bacteria | 9496 |
| 407 | Ga0105240_10115080 | 3300009093 | Bacteria | 3248 |
| 408 | Ga0105240_10149092 | 3300009093 | Bacteria | 2788 |
| 409 | Ga0111539_10007501 | 3300009094 | Bacteria | 13961 |
| 410 | Ga0111539_10046081 | 3300009094 | Bacteria | 5218 |
| 411 | Ga0105245_10007918 | 3300009098 | Bacteria | 9292 |
| 412 | Ga0105245_10088093 | 3300009098 | Bacteria | 2850 |
| 413 | Ga0114129_10005167 | 3300009147 | Bacteria | 18369 |
| 414 | Ga0114129_10018075 | 3300009147 | Bacteria | 10043 |
| 415 | Ga0114129_10213674 | 3300009147 | Bacteria | 2606 |
| 416 | Ga0105243_10004191 | 3300009148 | Bacteria | 11432 |
| 417 | Ga0105243_10010403 | 3300009148 | Bacteria | 7065 |
| 418 | Ga0105243_10043569 | 3300009148 | Bacteria | 3517 |
| 419 | Ga0105243_10043909 | 3300009148 | Bacteria | 3505 |
| 420 | Ga0105243_10071599 | 3300009148 | Bacteria | 2804 |
| 421 | Ga0105243_10077762 | 3300009148 | Bacteria | 2699 |
| 422 | Ga0105243_10093592 | 3300009148 | Bacteria | 2480 |
| 423 | Ga0105241_10065167 | 3300009174 | Bacteria | 2815 |
| 424 | Ga0105241_10089016 | 3300009174 | Bacteria | 2432 |
| 425 | Ga0105241_10171876 | 3300009174 | Bacteria | 1790 |
| 426 | Ga0105242_10001697 | 3300009176 | Bacteria | 17431 |
| 427 | Ga0105242_10002028 | 3300009176 | Bacteria | 15933 |
| 428 | Ga0105242_10040904 | 3300009176 | Bacteria | 3736 |
| 429 | Ga0105242_10041709 | 3300009176 | Bacteria | 3703 |
| 430 | Ga0105242_10075746 | 3300009176 | Bacteria | 2802 |
| 431 | Ga0105242_10202976 | 3300009176 | Bacteria | 1762 |
| 432 | Ga0105248_10002030 | 3300009177 | Bacteria | 22461 |
| 433 | Ga0105248_10015980 | 3300009177 | Bacteria | 8263 |
| 434 | Ga0105248_10024858 | 3300009177 | Bacteria | 6658 |
| 435 | Ga0105248_10059994 | 3300009177 | Bacteria | 4272 |
| 436 | Ga0105248_10066533 | 3300009177 | Bacteria | 4046 |
| 437 | Ga0105248_10097012 | 3300009177 | Bacteria | 3321 |
| 438 | Ga0105248_10127574 | 3300009177 | Bacteria | 2870 |
| 439 | Ga0105248_10221961 | 3300009177 | Bacteria | 2128 |
| 440 | Ga0105248_10333486 | 3300009177 | Bacteria | 1708 |
| 441 | Ga0105237_10012592 | 3300009545 | Bacteria | 8908 |
| 442 | Ga0105238_10006104 | 3300009551 | Bacteria | 11950 |
| 443 | Ga0105238_10020927 | 3300009551 | Bacteria | 6664 |
| 444 | Ga0105238_10096631 | 3300009551 | Bacteria | 2940 |
| 445 | Ga0105238_10099453 | 3300009551 | Bacteria | 2892 |
| 446 | Ga0105238_10109604 | 3300009551 | Bacteria | 2742 |
| 447 | Ga0105238_10133369 | 3300009551 | Bacteria | 2462 |
| 448 | Ga0105249_10001475 | 3300009553 | Bacteria | 20614 |
| 449 | Ga0105249_10054022 | 3300009553 | Bacteria | 3672 |
| 450 | Ga0105249_10153732 | 3300009553 | Bacteria | 2217 |
| 451 | Ga0105249_10192154 | 3300009553 | Bacteria | 1993 |
| 452 | Ga0105249_10237119 | 3300009553 | Bacteria | 1802 |
| 453 | Ga0099796_10007483 | 3300010159 | Bacteria | 2857 |
| 454 | Ga0105239_10046513 | 3300010375 | Bacteria | 4755 |
| 455 | Ga0105239_10179760 | 3300010375 | Bacteria | 2367 |
| 456 | Ga0105246_10002163 | 3300011119 | Bacteria | 11864 |
| 457 | Ga0105246_10032227 | 3300011119 | Bacteria | 3475 |
| 458 | Ga0105246_10141477 | 3300011119 | Bacteria | 1810 |
| 459 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 460 | Ga0157347_1000789 | 3300012502 | Bacteria | 2232 |
| 461 | Ga0157373_10000081 | 3300013100 | Bacteria | 82343 |
| 462 | Ga0157373_10008814 | 3300013100 | Bacteria | 7474 |
| 463 | Ga0157373_10016114 | 3300013100 | Bacteria | 5455 |
| 464 | Ga0157373_10018126 | 3300013100 | Bacteria | 5126 |
| 465 | Ga0157373_10026235 | 3300013100 | Bacteria | 4210 |
| 466 | Ga0157371_10001827 | 3300013102 | Bacteria | 21447 |
| 467 | Ga0157371_10020896 | 3300013102 | Bacteria | 4814 |
| 468 | Ga0157371_10065579 | 3300013102 | Bacteria | 2572 |
| 469 | Ga0157371_10165541 | 3300013102 | Bacteria | 1579 |
| 470 | Ga0157370_10027854 | 3300013104 | Bacteria | 5568 |
| 471 | Ga0157370_10091315 | 3300013104 | Bacteria | 2859 |
| 472 | Ga0157370_10227594 | 3300013104 | Bacteria | 1726 |
| 473 | Ga0157369_10001065 | 3300013105 | Bacteria | 34435 |
| 474 | Ga0157369_10002069 | 3300013105 | Bacteria | 24238 |
| 475 | Ga0157369_10007564 | 3300013105 | Bacteria | 12501 |
| 476 | Ga0157369_10083686 | 3300013105 | Bacteria | 3412 |
| 477 | Ga0157369_10179640 | 3300013105 | Bacteria | 2227 |
| 478 | Ga0157374_10042081 | 3300013296 | Bacteria | 4213 |
| 479 | Ga0157374_10075672 | 3300013296 | Bacteria | 3181 |
| 480 | Ga0157378_10001998 | 3300013297 | Bacteria | 18236 |
| 481 | Ga0163162_10000314 | 3300013306 | Bacteria | 44769 |
| 482 | Ga0163162_10016393 | 3300013306 | Bacteria | 7242 |
| 483 | Ga0163162_10021214 | 3300013306 | Bacteria | 6392 |
| 484 | Ga0163162_10030137 | 3300013306 | Bacteria | 5375 |
| 485 | Ga0163162_10085712 | 3300013306 | Bacteria | 3227 |
| 486 | Ga0163162_10119864 | 3300013306 | Bacteria | 2734 |
| 487 | Ga0163162_10154753 | 3300013306 | Bacteria | 2412 |
| 488 | Ga0163162_10168017 | 3300013306 | Bacteria | 2318 |
| 489 | Ga0163162_10206137 | 3300013306 | Bacteria | 2095 |
| 490 | Ga0157372_10001667 | 3300013307 | Bacteria | 24062 |
| 491 | Ga0157372_10014005 | 3300013307 | Bacteria | 8567 |
| 492 | Ga0157372_10133919 | 3300013307 | Bacteria | 2853 |
| 493 | Ga0157372_10145265 | 3300013307 | Bacteria | 2735 |
| 494 | Ga0157372_10152193 | 3300013307 | Bacteria | 2671 |
| 495 | Ga0157372_10181148 | 3300013307 | Bacteria | 2439 |
| 496 | Ga0157372_10246392 | 3300013307 | Bacteria | 2074 |
| 497 | Ga0157372_10296465 | 3300013307 | Bacteria | 1881 |
| 498 | Ga0157375_10010300 | 3300013308 | Bacteria | 8228 |
| 499 | Ga0157375_10031315 | 3300013308 | Bacteria | 5026 |
| 500 | Ga0157375_10061416 | 3300013308 | Bacteria | 3731 |
| 501 | Ga0157375_10078372 | 3300013308 | Bacteria | 3337 |
| 502 | Ga0157375_10154851 | 3300013308 | Bacteria | 2430 |
| 503 | Ga0157375_10171662 | 3300013308 | Bacteria | 2316 |
| 504 | Ga0157375_10296407 | 3300013308 | Bacteria | 1780 |
| 505 | Ga0163163_10001639 | 3300014325 | Bacteria | 18841 |
| 506 | Ga0163163_10063892 | 3300014325 | Bacteria | 3652 |
| 507 | Ga0163163_10257800 | 3300014325 | Bacteria | 1795 |
| 508 | Ga0163163_10382441 | 3300014325 | Bacteria | 1465 |
| 509 | Ga0157380_10008262 | 3300014326 | Bacteria | 7416 |
| 510 | Ga0157380_10022246 | 3300014326 | Bacteria | 4768 |
| 511 | Ga0157380_10056722 | 3300014326 | Bacteria | 3117 |
| 512 | Ga0182008_10004122 | 3300014497 | Bacteria | 8561 |
| 513 | Ga0182008_10007102 | 3300014497 | Bacteria | 6202 |
| 514 | Ga0182008_10009794 | 3300014497 | Bacteria | 5157 |
| 515 | Ga0182008_10084240 | 3300014497 | Bacteria | 1566 |
| 516 | Ga0157377_10000048 | 3300014745 | Bacteria | 94061 |
| 517 | Ga0157379_10010467 | 3300014968 | Bacteria | 8085 |
| 518 | Ga0157379_10030571 | 3300014968 | Bacteria | 4795 |
| 519 | Ga0157379_10037678 | 3300014968 | Bacteria | 4313 |
| 520 | Ga0157379_10050970 | 3300014968 | Bacteria | 3696 |
| 521 | Ga0157379_10062117 | 3300014968 | Bacteria | 3341 |
| 522 | Ga0157379_10104187 | 3300014968 | Bacteria | 2546 |
| 523 | Ga0157379_10201015 | 3300014968 | Bacteria | 1802 |
| 524 | Ga0157376_10001621 | 3300014969 | Bacteria | 14892 |
| 525 | Ga0157376_10016439 | 3300014969 | Bacteria | 5618 |
| 526 | Ga0157376_10036986 | 3300014969 | Bacteria | 3958 |
| 527 | Ga0157376_10061988 | 3300014969 | Bacteria | 3145 |
| 528 | Ga0157376_10063786 | 3300014969 | Bacteria | 3105 |
| 529 | Ga0182006_1008526 | 3300015261 | Bacteria | 4645 |
| 530 | Ga0182006_1014990 | 3300015261 | Bacteria | 3330 |
| 531 | Ga0182006_1019059 | 3300015261 | Bacteria | 2893 |
| 532 | Ga0182006_1046030 | 3300015261 | Bacteria | 1696 |
| 533 | Ga0182007_10000642 | 3300015262 | Bacteria | 20182 |
| 534 | Ga0182007_10003593 | 3300015262 | Bacteria | 7284 |
| 535 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 536 | Ga0163161_10009943 | 3300017792 | Bacteria | 6589 |
| 537 | Ga0163161_10033261 | 3300017792 | Bacteria | 3684 |
| 538 | Ga0163161_10041651 | 3300017792 | Bacteria | 3300 |
| 539 | Ga0163161_10063022 | 3300017792 | Bacteria | 2702 |
| 540 | Ga0163161_10064942 | 3300017792 | Bacteria | 2663 |
| 541 | Ga0163161_10094517 | 3300017792 | Bacteria | 2216 |
| 542 | Ga0213872_10000093 | 3300021361 | Bacteria | 83513 |
| 543 | Ga0213872_10000490 | 3300021361 | Bacteria | 31612 |
| 544 | Ga0213872_10003115 | 3300021361 | Bacteria | 9320 |
| 545 | Ga0213872_10005470 | 3300021361 | Bacteria | 6529 |
| 546 | Ga0213872_10021144 | 3300021361 | Bacteria | 2996 |
| 547 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 548 | Ga0209435_100018 | 3300025206 | Bacteria | 274625 |
| 549 | Ga0209436_105519 | 3300025208 | Bacteria | 2899 |
| 550 | Ga0209672_101322 | 3300025228 | Bacteria | 9450 |
| 551 | Ga0209147_100051 | 3300025229 | Bacteria | 274605 |
| 552 | Ga0209147_101675 | 3300025229 | Bacteria | 7275 |
| 553 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 554 | Ga0209437_100136 | 3300025233 | Bacteria | 176190 |
| 555 | Ga0209437_100145 | 3300025233 | Bacteria | 163138 |
| 556 | Ga0209258_100154 | 3300025242 | Bacteria | 158235 |
| 557 | Ga0209258_100760 | 3300025242 | Bacteria | 20234 |
| 558 | Ga0207425_1000540 | 3300025245 | Bacteria | 22766 |
| 559 | Ga0207425_1001617 | 3300025245 | Bacteria | 9090 |
| 560 | Ga0207425_1002353 | 3300025245 | Bacteria | 6746 |
| 561 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 562 | Ga0209646_1000090 | 3300025246 | Bacteria | 189912 |
| 563 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 564 | Ga0209026_1000042 | 3300025250 | Bacteria | 273111 |
| 565 | Ga0209148_1000145 | 3300025254 | Bacteria | 161352 |
| 566 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 567 | Ga0209759_1000933 | 3300025256 | Bacteria | 21089 |
| 568 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 569 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 570 | Ga0209129_1002683 | 3300025258 | Bacteria | 8383 |
| 571 | Ga0209129_1005664 | 3300025258 | Bacteria | 4321 |
| 572 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 573 | Ga0209565_1000092 | 3300025263 | Bacteria | 141563 |
| 574 | Ga0209565_1000128 | 3300025263 | Bacteria | 108959 |
| 575 | Ga0209565_1000648 | 3300025263 | Bacteria | 22443 |
| 576 | Ga0209565_1000708 | 3300025263 | Bacteria | 20409 |
| 577 | Ga0209565_1001327 | 3300025263 | Bacteria | 11327 |
| 578 | Ga0209565_1002114 | 3300025263 | Bacteria | 7566 |
| 579 | Ga0209455_1001361 | 3300025272 | Bacteria | 11209 |
| 580 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 581 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 582 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 583 | Ga0209673_1001430 | 3300025273 | Bacteria | 22800 |
| 584 | Ga0209673_1006310 | 3300025273 | Bacteria | 5756 |
| 585 | Ga0209673_1011746 | 3300025273 | Bacteria | 3587 |
| 586 | Ga0209673_1017095 | 3300025273 | Bacteria | 2684 |
| 587 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 588 | Ga0209130_1000315 | 3300025284 | Bacteria | 56958 |
| 589 | Ga0209130_1000954 | 3300025284 | Bacteria | 22871 |
| 590 | Ga0209130_1001108 | 3300025284 | Bacteria | 19845 |
| 591 | Ga0209130_1002024 | 3300025284 | Bacteria | 11039 |
| 592 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 593 | Ga0209675_1000221 | 3300025291 | Bacteria | 59141 |
| 594 | Ga0209675_1000690 | 3300025291 | Bacteria | 23483 |
| 595 | Ga0209675_1001507 | 3300025291 | Bacteria | 13323 |
| 596 | Ga0209675_1003314 | 3300025291 | Bacteria | 7734 |
| 597 | Ga0209675_1003374 | 3300025291 | Bacteria | 7626 |
| 598 | Ga0209675_1004564 | 3300025291 | Bacteria | 6109 |
| 599 | Ga0209675_1004790 | 3300025291 | Bacteria | 5878 |
| 600 | Ga0209675_1006032 | 3300025291 | Bacteria | 4951 |
| 601 | Ga0209675_1013233 | 3300025291 | Bacteria | 2598 |
| 602 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 603 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 604 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 605 | Ga0209676_1001679 | 3300025292 | Bacteria | 19202 |
| 606 | Ga0209676_1007984 | 3300025292 | Bacteria | 4829 |
| 607 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 608 | Ga0209025_1000173 | 3300025294 | Bacteria | 159623 |
| 609 | Ga0209025_1000174 | 3300025294 | Bacteria | 158915 |
| 610 | Ga0209025_1001066 | 3300025294 | Bacteria | 39849 |
| 611 | Ga0209025_1001606 | 3300025294 | Bacteria | 28358 |
| 612 | Ga0209025_1001733 | 3300025294 | Bacteria | 26305 |
| 613 | Ga0209025_1001987 | 3300025294 | Bacteria | 23455 |
| 614 | Ga0209025_1002139 | 3300025294 | Bacteria | 22147 |
| 615 | Ga0209025_1004985 | 3300025294 | Bacteria | 11107 |
| 616 | Ga0209025_1005561 | 3300025294 | Bacteria | 10213 |
| 617 | Ga0209025_1010865 | 3300025294 | Bacteria | 6101 |
| 618 | Ga0209025_1020817 | 3300025294 | Bacteria | 3563 |
| 619 | Ga0209025_1027510 | 3300025294 | Bacteria | 2818 |
| 620 | Ga0209025_1030667 | 3300025294 | Bacteria | 2567 |
| 621 | Ga0209025_1039297 | 3300025294 | Bacteria | 2066 |
| 622 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 623 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 624 | Ga0209564_1000241 | 3300025295 | Bacteria | 118237 |
| 625 | Ga0209564_1000435 | 3300025295 | Bacteria | 72434 |
| 626 | Ga0209564_1000998 | 3300025295 | Bacteria | 35364 |
| 627 | Ga0209564_1001515 | 3300025295 | Bacteria | 23174 |
| 628 | Ga0209564_1002737 | 3300025295 | Bacteria | 13264 |
| 629 | Ga0209564_1002822 | 3300025295 | Bacteria | 12877 |
| 630 | Ga0209564_1003293 | 3300025295 | Bacteria | 11225 |
| 631 | Ga0209564_1004319 | 3300025295 | Bacteria | 8779 |
| 632 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 633 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 634 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 635 | Ga0209758_1002271 | 3300025297 | Bacteria | 19909 |
| 636 | Ga0209758_1004536 | 3300025297 | Bacteria | 11484 |
| 637 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 638 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 639 | Ga0209050_1000165 | 3300025298 | Bacteria | 152109 |
| 640 | Ga0209050_1000294 | 3300025298 | Bacteria | 105705 |
| 641 | Ga0209050_1001032 | 3300025298 | Bacteria | 34539 |
| 642 | Ga0209050_1002988 | 3300025298 | Bacteria | 13162 |
| 643 | Ga0209050_1004806 | 3300025298 | Bacteria | 8889 |
| 644 | Ga0209050_1008642 | 3300025298 | Bacteria | 5385 |
| 645 | Ga0209050_1012744 | 3300025298 | Bacteria | 3820 |
| 646 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 647 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 648 | Ga0209256_1000120 | 3300025299 | Bacteria | 167691 |
| 649 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 650 | Ga0209256_1000450 | 3300025299 | Bacteria | 62771 |
| 651 | Ga0209256_1000912 | 3300025299 | Bacteria | 36188 |
| 652 | Ga0209256_1001146 | 3300025299 | Bacteria | 30061 |
| 653 | Ga0209256_1001845 | 3300025299 | Bacteria | 19655 |
| 654 | Ga0209256_1023396 | 3300025299 | Bacteria | 1843 |
| 655 | Ga0209256_1025211 | 3300025299 | Bacteria | 1737 |
| 656 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 657 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 658 | Ga0207426_1000319 | 3300025302 | Bacteria | 92696 |
| 659 | Ga0207426_1002937 | 3300025302 | Bacteria | 10035 |
| 660 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 661 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 662 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 663 | Ga0209051_1000235 | 3300025303 | Bacteria | 92799 |
| 664 | Ga0209051_1000384 | 3300025303 | Bacteria | 62340 |
| 665 | Ga0209051_1001398 | 3300025303 | Bacteria | 20776 |
| 666 | Ga0209051_1002935 | 3300025303 | Bacteria | 11678 |
| 667 | Ga0209051_1005813 | 3300025303 | Bacteria | 7098 |
| 668 | Ga0209051_1007797 | 3300025303 | Bacteria | 5785 |
| 669 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 670 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 671 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 672 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 673 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 674 | Ga0209257_1000260 | 3300025304 | Bacteria | 121653 |
| 675 | Ga0209257_1001206 | 3300025304 | Bacteria | 32484 |
| 676 | Ga0209257_1010586 | 3300025304 | Bacteria | 4634 |
| 677 | Ga0209257_1010643 | 3300025304 | Bacteria | 4608 |
| 678 | Ga0207697_10016431 | 3300025315 | Bacteria | 3049 |
| 679 | Ga0207656_10003460 | 3300025321 | Bacteria | 5429 |
| 680 | Ga0207656_10006943 | 3300025321 | Bacteria | 4105 |
| 681 | Ga0207696_1000557 | 3300025711 | Bacteria | 29652 |
| 682 | Ga0207696_1003192 | 3300025711 | Bacteria | 7579 |
| 683 | Ga0207696_1003996 | 3300025711 | Bacteria | 6479 |
| 684 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 685 | Ga0207655_1000639 | 3300025728 | Bacteria | 41880 |
| 686 | Ga0207655_1000983 | 3300025728 | Bacteria | 29240 |
| 687 | Ga0207655_1003550 | 3300025728 | Bacteria | 11549 |
| 688 | Ga0207655_1030240 | 3300025728 | Bacteria | 2522 |
| 689 | Ga0207713_1000043 | 3300025735 | Bacteria | 241808 |
| 690 | Ga0207713_1008050 | 3300025735 | Bacteria | 6124 |
| 691 | Ga0207713_1027146 | 3300025735 | Bacteria | 2606 |
| 692 | Ga0207713_1042393 | 3300025735 | Bacteria | 1890 |
| 693 | Ga0207682_10011302 | 3300025893 | Bacteria | 3488 |
| 694 | Ga0207682_10015452 | 3300025893 | Bacteria | 2971 |
| 695 | Ga0207682_10030730 | 3300025893 | Bacteria | 2153 |
| 696 | Ga0207642_10052396 | 3300025899 | Bacteria | 1851 |
| 697 | Ga0207688_10015371 | 3300025901 | Bacteria | 4152 |
| 698 | Ga0207680_10001495 | 3300025903 | Bacteria | 11047 |
| 699 | Ga0207699_10026650 | 3300025906 | Bacteria | 3190 |
| 700 | Ga0207699_10067168 | 3300025906 | Bacteria | 2179 |
| 701 | Ga0207645_10007473 | 3300025907 | Bacteria | 7715 |
| 702 | Ga0207645_10052992 | 3300025907 | Bacteria | 2592 |
| 703 | Ga0207645_10056229 | 3300025907 | Bacteria | 2512 |
| 704 | Ga0207645_10129688 | 3300025907 | Bacteria | 1641 |
| 705 | Ga0207645_10148073 | 3300025907 | Bacteria | 1531 |
| 706 | Ga0207643_10027110 | 3300025908 | Bacteria | 3175 |
| 707 | Ga0207643_10076978 | 3300025908 | Bacteria | 1928 |
| 708 | Ga0207705_10008509 | 3300025909 | Bacteria | 7487 |
| 709 | Ga0207705_10032151 | 3300025909 | Bacteria | 3749 |
| 710 | Ga0207705_10060329 | 3300025909 | Bacteria | 2739 |
| 711 | Ga0207684_10002070 | 3300025910 | Bacteria | 20640 |
| 712 | Ga0207684_10031033 | 3300025910 | Bacteria | 4548 |
| 713 | Ga0207654_10028201 | 3300025911 | Bacteria | 3060 |
| 714 | Ga0207654_10036040 | 3300025911 | Bacteria | 2761 |
| 715 | Ga0207654_10051850 | 3300025911 | Bacteria | 2363 |
| 716 | Ga0207654_10141122 | 3300025911 | Bacteria | 1536 |
| 717 | Ga0207707_10010626 | 3300025912 | Bacteria | 7996 |
| 718 | Ga0207707_10016028 | 3300025912 | Bacteria | 6536 |
| 719 | Ga0207707_10026595 | 3300025912 | Bacteria | 5057 |
| 720 | Ga0207707_10040244 | 3300025912 | Bacteria | 4082 |
| 721 | Ga0207695_10005351 | 3300025913 | Bacteria | 17072 |
| 722 | Ga0207695_10023926 | 3300025913 | Bacteria | 6890 |
| 723 | Ga0207695_10109358 | 3300025913 | Bacteria | 2746 |
| 724 | Ga0207695_10261501 | 3300025913 | Bacteria | 1628 |
| 725 | Ga0207671_10017114 | 3300025914 | Bacteria | 5604 |
| 726 | Ga0207671_10032445 | 3300025914 | Bacteria | 3888 |
| 727 | Ga0207693_10004206 | 3300025915 | Bacteria | 12205 |
| 728 | Ga0207693_10024167 | 3300025915 | Bacteria | 4825 |
| 729 | Ga0207660_10023901 | 3300025917 | Bacteria | 4132 |
| 730 | Ga0207660_10061869 | 3300025917 | Bacteria | 2696 |
| 731 | Ga0207660_10083826 | 3300025917 | Bacteria | 2348 |
| 732 | Ga0207660_10123348 | 3300025917 | Bacteria | 1965 |
| 733 | Ga0207660_10215822 | 3300025917 | Bacteria | 1504 |
| 734 | Ga0207662_10061126 | 3300025918 | Bacteria | 2261 |
| 735 | Ga0207657_10000447 | 3300025919 | Bacteria | 43815 |
| 736 | Ga0207657_10003605 | 3300025919 | Bacteria | 16496 |
| 737 | Ga0207657_10004258 | 3300025919 | Bacteria | 15161 |
| 738 | Ga0207657_10027949 | 3300025919 | Bacteria | 5156 |
| 739 | Ga0207649_10029633 | 3300025920 | Bacteria | 3233 |
| 740 | Ga0207649_10051595 | 3300025920 | Bacteria | 2548 |
| 741 | Ga0207649_10091531 | 3300025920 | Bacteria | 1992 |
| 742 | Ga0207649_10111273 | 3300025920 | Bacteria | 1830 |
| 743 | Ga0207652_10012394 | 3300025921 | Bacteria | 6889 |
| 744 | Ga0207652_10015269 | 3300025921 | Bacteria | 6234 |
| 745 | Ga0207652_10212603 | 3300025921 | Bacteria | 1742 |
| 746 | Ga0207646_10002045 | 3300025922 | Bacteria | 24234 |
| 747 | Ga0207646_10030455 | 3300025922 | Bacteria | 4891 |
| 748 | Ga0207646_10083481 | 3300025922 | Bacteria | 2857 |
| 749 | Ga0207646_10090569 | 3300025922 | Bacteria | 2738 |
| 750 | Ga0207681_10043137 | 3300025923 | Bacteria | 3017 |
| 751 | Ga0207681_10058220 | 3300025923 | Bacteria | 2645 |
| 752 | Ga0207681_10063816 | 3300025923 | Bacteria | 2541 |
| 753 | Ga0207681_10075638 | 3300025923 | Bacteria | 2362 |
| 754 | Ga0207681_10081392 | 3300025923 | Bacteria | 2286 |
| 755 | Ga0207681_10118513 | 3300025923 | Bacteria | 1938 |
| 756 | Ga0207694_10017482 | 3300025924 | Bacteria | 5419 |
| 757 | Ga0207694_10056941 | 3300025924 | Bacteria | 3037 |
| 758 | Ga0207694_10079876 | 3300025924 | Bacteria | 2566 |
| 759 | Ga0207650_10003707 | 3300025925 | Bacteria | 10445 |
| 760 | Ga0207650_10014826 | 3300025925 | Bacteria | 5421 |
| 761 | Ga0207650_10056430 | 3300025925 | Bacteria | 2918 |
| 762 | Ga0207650_10096580 | 3300025925 | Bacteria | 2267 |
| 763 | Ga0207650_10138665 | 3300025925 | Bacteria | 1910 |
| 764 | Ga0207650_10225635 | 3300025925 | Bacteria | 1509 |
| 765 | Ga0207659_10002055 | 3300025926 | Bacteria | 11945 |
| 766 | Ga0207659_10002947 | 3300025926 | Bacteria | 10134 |
| 767 | Ga0207659_10003098 | 3300025926 | Bacteria | 9930 |
| 768 | Ga0207659_10058394 | 3300025926 | Bacteria | 2769 |
| 769 | Ga0207687_10209821 | 3300025927 | Bacteria | 1527 |
| 770 | Ga0207687_10213026 | 3300025927 | Bacteria | 1517 |
| 771 | Ga0207700_10022967 | 3300025928 | Bacteria | 4289 |
| 772 | Ga0207700_10032950 | 3300025928 | Bacteria | 3702 |
| 773 | Ga0207700_10040172 | 3300025928 | Bacteria | 3413 |
| 774 | Ga0207700_10139194 | 3300025928 | Bacteria | 1992 |
| 775 | Ga0207700_10195604 | 3300025928 | Bacteria | 1701 |
| 776 | Ga0207664_10050500 | 3300025929 | Bacteria | 3280 |
| 777 | Ga0207664_10081866 | 3300025929 | Bacteria | 2628 |
| 778 | Ga0207664_10090116 | 3300025929 | Bacteria | 2512 |
| 779 | Ga0207644_10000130 | 3300025931 | Bacteria | 54417 |
| 780 | Ga0207644_10002085 | 3300025931 | Bacteria | 12942 |
| 781 | Ga0207644_10022846 | 3300025931 | Bacteria | 4276 |
| 782 | Ga0207644_10067704 | 3300025931 | Bacteria | 2603 |
| 783 | Ga0207644_10165726 | 3300025931 | Bacteria | 1721 |
| 784 | Ga0207690_10003996 | 3300025932 | Bacteria | 8718 |
| 785 | Ga0207690_10013485 | 3300025932 | Bacteria | 4912 |
| 786 | Ga0207690_10037637 | 3300025932 | Bacteria | 3142 |
| 787 | Ga0207690_10064410 | 3300025932 | Bacteria | 2503 |
| 788 | Ga0207706_10000156 | 3300025933 | Bacteria | 75583 |
| 789 | Ga0207706_10016017 | 3300025933 | Bacteria | 6775 |
| 790 | Ga0207706_10025996 | 3300025933 | Bacteria | 5242 |
| 791 | Ga0207706_10036971 | 3300025933 | Bacteria | 4336 |
| 792 | Ga0207706_10054917 | 3300025933 | Bacteria | 3514 |
| 793 | Ga0207706_10070546 | 3300025933 | Bacteria | 3073 |
| 794 | Ga0207686_10011790 | 3300025934 | Bacteria | 4794 |
| 795 | Ga0207686_10128851 | 3300025934 | Bacteria | 1733 |
| 796 | Ga0207709_10000111 | 3300025935 | Bacteria | 127580 |
| 797 | Ga0207709_10044565 | 3300025935 | Bacteria | 2681 |
| 798 | Ga0207670_10004647 | 3300025936 | Bacteria | 7440 |
| 799 | Ga0207670_10167009 | 3300025936 | Bacteria | 1647 |
| 800 | Ga0207704_10010368 | 3300025938 | Bacteria | 4544 |
| 801 | Ga0207704_10034820 | 3300025938 | Bacteria | 2878 |
| 802 | Ga0207665_10002266 | 3300025939 | Bacteria | 12985 |
| 803 | Ga0207691_10003386 | 3300025940 | Bacteria | 15512 |
| 804 | Ga0207691_10010432 | 3300025940 | Bacteria | 8913 |
| 805 | Ga0207691_10011577 | 3300025940 | Bacteria | 8471 |
| 806 | Ga0207691_10019285 | 3300025940 | Bacteria | 6456 |
| 807 | Ga0207691_10022541 | 3300025940 | Bacteria | 5937 |
| 808 | Ga0207691_10032593 | 3300025940 | Bacteria | 4858 |
| 809 | Ga0207691_10053626 | 3300025940 | Bacteria | 3681 |
| 810 | Ga0207691_10057599 | 3300025940 | Bacteria | 3536 |
| 811 | Ga0207711_10020362 | 3300025941 | Bacteria | 5530 |
| 812 | Ga0207711_10021326 | 3300025941 | Bacteria | 5413 |
| 813 | Ga0207711_10035493 | 3300025941 | Bacteria | 4226 |
| 814 | Ga0207711_10053726 | 3300025941 | Bacteria | 3455 |
| 815 | Ga0207711_10165679 | 3300025941 | Bacteria | 2003 |
| 816 | Ga0207711_10174904 | 3300025941 | Bacteria | 1950 |
| 817 | Ga0207689_10001818 | 3300025942 | Bacteria | 20157 |
| 818 | Ga0207689_10015442 | 3300025942 | Bacteria | 6465 |
| 819 | Ga0207661_10086402 | 3300025944 | Bacteria | 2603 |
| 820 | Ga0207679_10007093 | 3300025945 | Bacteria | 7101 |
| 821 | Ga0207679_10012131 | 3300025945 | Bacteria | 5609 |
| 822 | Ga0207679_10033943 | 3300025945 | Bacteria | 3595 |
| 823 | Ga0207679_10037700 | 3300025945 | Bacteria | 3438 |
| 824 | Ga0207679_10147866 | 3300025945 | Bacteria | 1908 |
| 825 | Ga0207667_10006776 | 3300025949 | Bacteria | 13836 |
| 826 | Ga0207667_10010777 | 3300025949 | Bacteria | 10663 |
| 827 | Ga0207667_10016009 | 3300025949 | Bacteria | 8490 |
| 828 | Ga0207667_10019277 | 3300025949 | Bacteria | 7621 |
| 829 | Ga0207667_10024536 | 3300025949 | Bacteria | 6618 |
| 830 | Ga0207667_10110330 | 3300025949 | Bacteria | 2838 |
| 831 | Ga0207667_10203748 | 3300025949 | Bacteria | 2029 |
| 832 | Ga0207651_10001665 | 3300025960 | Bacteria | 10209 |
| 833 | Ga0207651_10003976 | 3300025960 | Bacteria | 7344 |
| 834 | Ga0207651_10005715 | 3300025960 | Bacteria | 6421 |
| 835 | Ga0207651_10005940 | 3300025960 | Bacteria | 6322 |
| 836 | Ga0207712_10008399 | 3300025961 | Bacteria | 6524 |
| 837 | Ga0207712_10070498 | 3300025961 | Bacteria | 2511 |
| 838 | Ga0207712_10206932 | 3300025961 | Bacteria | 1560 |
| 839 | Ga0207668_10015585 | 3300025972 | Bacteria | 4725 |
| 840 | Ga0207668_10084585 | 3300025972 | Bacteria | 2312 |
| 841 | Ga0207668_10107123 | 3300025972 | Bacteria | 2089 |
| 842 | Ga0207668_10134384 | 3300025972 | Bacteria | 1893 |
| 843 | Ga0207668_10240887 | 3300025972 | Bacteria | 1463 |
| 844 | Ga0207640_10037866 | 3300025981 | Bacteria | 3038 |
| 845 | Ga0207640_10075079 | 3300025981 | Bacteria | 2290 |
| 846 | Ga0207640_10101284 | 3300025981 | Bacteria | 2020 |
| 847 | Ga0207658_10004458 | 3300025986 | Bacteria | 9728 |
| 848 | Ga0207658_10004645 | 3300025986 | Bacteria | 9520 |
| 849 | Ga0207658_10050936 | 3300025986 | Bacteria | 3049 |
| 850 | Ga0207658_10083767 | 3300025986 | Bacteria | 2452 |
| 851 | Ga0207677_10007151 | 3300026023 | Bacteria | 6147 |
| 852 | Ga0207677_10018191 | 3300026023 | Bacteria | 4213 |
| 853 | Ga0207677_10033477 | 3300026023 | Bacteria | 3317 |
| 854 | Ga0207677_10040300 | 3300026023 | Bacteria | 3078 |
| 855 | Ga0207677_10173075 | 3300026023 | Bacteria | 1690 |
| 856 | Ga0207703_10002546 | 3300026035 | Bacteria | 15741 |
| 857 | Ga0207703_10009968 | 3300026035 | Bacteria | 7451 |
| 858 | Ga0207703_10012912 | 3300026035 | Bacteria | 6510 |
| 859 | Ga0207703_10016647 | 3300026035 | Bacteria | 5734 |
| 860 | Ga0207703_10042121 | 3300026035 | Bacteria | 3661 |
| 861 | Ga0207703_10092086 | 3300026035 | Bacteria | 2551 |
| 862 | Ga0207639_10013143 | 3300026041 | Bacteria | 5785 |
| 863 | Ga0207639_10013776 | 3300026041 | Bacteria | 5670 |
| 864 | Ga0207639_10059696 | 3300026041 | Bacteria | 2939 |
| 865 | Ga0207639_10076160 | 3300026041 | Bacteria | 2641 |
| 866 | Ga0207639_10126648 | 3300026041 | Bacteria | 2107 |
| 867 | Ga0207639_10131754 | 3300026041 | Bacteria | 2071 |
| 868 | Ga0207678_10030122 | 3300026067 | Bacteria | 4738 |
| 869 | Ga0207678_10043272 | 3300026067 | Bacteria | 3897 |
| 870 | Ga0207678_10050007 | 3300026067 | Bacteria | 3612 |
| 871 | Ga0207678_10083673 | 3300026067 | Bacteria | 2729 |
| 872 | Ga0207678_10149880 | 3300026067 | Bacteria | 1991 |
| 873 | Ga0207678_10157414 | 3300026067 | Bacteria | 1940 |
| 874 | Ga0207708_10001026 | 3300026075 | Bacteria | 20900 |
| 875 | Ga0207708_10021822 | 3300026075 | Bacteria | 4831 |
| 876 | Ga0207708_10092172 | 3300026075 | Bacteria | 2337 |
| 877 | Ga0207708_10153052 | 3300026075 | Bacteria | 1817 |
| 878 | Ga0207702_10002083 | 3300026078 | Bacteria | 19317 |
| 879 | Ga0207702_10075064 | 3300026078 | Bacteria | 2920 |
| 880 | Ga0207702_10133219 | 3300026078 | Bacteria | 2239 |
| 881 | Ga0207641_10016950 | 3300026088 | Bacteria | 5964 |
| 882 | Ga0207641_10032784 | 3300026088 | Bacteria | 4314 |
| 883 | Ga0207641_10037962 | 3300026088 | Bacteria | 4025 |
| 884 | Ga0207641_10091037 | 3300026088 | Bacteria | 2669 |
| 885 | Ga0207641_10235396 | 3300026088 | Bacteria | 1704 |
| 886 | Ga0207648_10000179 | 3300026089 | Bacteria | 66602 |
| 887 | Ga0207648_10001876 | 3300026089 | Bacteria | 22992 |
| 888 | Ga0207648_10002319 | 3300026089 | Bacteria | 20537 |
| 889 | Ga0207648_10006478 | 3300026089 | Bacteria | 11630 |
| 890 | Ga0207648_10006871 | 3300026089 | Bacteria | 11280 |
| 891 | Ga0207648_10015767 | 3300026089 | Bacteria | 6932 |
| 892 | Ga0207648_10021732 | 3300026089 | Bacteria | 5765 |
| 893 | Ga0207648_10025102 | 3300026089 | Bacteria | 5314 |
| 894 | Ga0207648_10047779 | 3300026089 | Bacteria | 3750 |
| 895 | Ga0207648_10050843 | 3300026089 | Bacteria | 3623 |
| 896 | Ga0207648_10057806 | 3300026089 | Bacteria | 3384 |
| 897 | Ga0207648_10082099 | 3300026089 | Bacteria | 2811 |
| 898 | Ga0207676_10001487 | 3300026095 | Bacteria | 17339 |
| 899 | Ga0207676_10008447 | 3300026095 | Bacteria | 7323 |
| 900 | Ga0207676_10009407 | 3300026095 | Bacteria | 6955 |
| 901 | Ga0207676_10014048 | 3300026095 | Bacteria | 5751 |
| 902 | Ga0207674_10004569 | 3300026116 | Bacteria | 16624 |
| 903 | Ga0207674_10013444 | 3300026116 | Bacteria | 9085 |
| 904 | Ga0207674_10041207 | 3300026116 | Bacteria | 4777 |
| 905 | Ga0207674_10137304 | 3300026116 | Bacteria | 2406 |
| 906 | Ga0207674_10188323 | 3300026116 | Bacteria | 2013 |
| 907 | Ga0207675_100000704 | 3300026118 | Bacteria | 33126 |
| 908 | Ga0207675_100001602 | 3300026118 | Bacteria | 22678 |
| 909 | Ga0207675_100021533 | 3300026118 | Bacteria | 6004 |
| 910 | Ga0207675_100022891 | 3300026118 | Bacteria | 5812 |
| 911 | Ga0207675_100044251 | 3300026118 | Bacteria | 4159 |
| 912 | Ga0207675_100046449 | 3300026118 | Bacteria | 4057 |
| 913 | Ga0207675_100110243 | 3300026118 | Bacteria | 2597 |
| 914 | Ga0207675_100129843 | 3300026118 | Bacteria | 2389 |
| 915 | Ga0207675_100222980 | 3300026118 | Bacteria | 1817 |
| 916 | Ga0207683_10013324 | 3300026121 | Bacteria | 7011 |
| 917 | Ga0207683_10024002 | 3300026121 | Bacteria | 5248 |
| 918 | Ga0207683_10026397 | 3300026121 | Bacteria | 5012 |
| 919 | Ga0207683_10060473 | 3300026121 | Bacteria | 3330 |
| 920 | Ga0207683_10079558 | 3300026121 | Bacteria | 2906 |
| 921 | Ga0207683_10096370 | 3300026121 | Bacteria | 2638 |
| 922 | Ga0207698_10001892 | 3300026142 | Bacteria | 12258 |
| 923 | Ga0207698_10004332 | 3300026142 | Bacteria | 8639 |
| 924 | Ga0207698_10020098 | 3300026142 | Bacteria | 4590 |
| 925 | Ga0207698_10064780 | 3300026142 | Bacteria | 2866 |
| 926 | Ga0207698_10065155 | 3300026142 | Bacteria | 2860 |
| 927 | Ga0207698_10151001 | 3300026142 | Bacteria | 2016 |
| 928 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 929 | Ga0209281_1000455 | 3300027111 | Bacteria | 58143 |
| 930 | Ga0209389_1000249 | 3300027296 | Bacteria | 34712 |
| 931 | Ga0209371_1000061 | 3300027312 | Bacteria | 223014 |
| 932 | Ga0209371_1000082 | 3300027312 | Bacteria | 184560 |
| 933 | Ga0209371_1000119 | 3300027312 | Bacteria | 133367 |
| 934 | Ga0209371_1000230 | 3300027312 | Bacteria | 71436 |
| 935 | Ga0209371_1001086 | 3300027312 | Bacteria | 20323 |
| 936 | Ga0209371_1001324 | 3300027312 | Bacteria | 17288 |
| 937 | Ga0209371_1002070 | 3300027312 | Bacteria | 11949 |
| 938 | Ga0210000_1002971 | 3300027462 | Bacteria | 2423 |
| 939 | Ga0209999_1000743 | 3300027543 | Bacteria | 5317 |
| 940 | Ga0209970_1000108 | 3300027614 | Bacteria | 11841 |
| 941 | Ga0209983_1009217 | 3300027665 | Bacteria | 2017 |
| 942 | Ga0209282_1000053 | 3300027666 | Bacteria | 103311 |
| 943 | Ga0209282_1000250 | 3300027666 | Bacteria | 26928 |
| 944 | Ga0209588_1004210 | 3300027671 | Bacteria | 4044 |
| 945 | Ga0209971_1001384 | 3300027682 | Bacteria | 6026 |
| 946 | Ga0209966_1006236 | 3300027695 | Bacteria | 2067 |
| 947 | Ga0209974_10006556 | 3300027876 | Bacteria | 4060 |
| 948 | Ga0209974_10006964 | 3300027876 | Bacteria | 3914 |
| 949 | Ga0209974_10029859 | 3300027876 | Bacteria | 1807 |
| 950 | Ga0207428_10003201 | 3300027907 | Bacteria | 16012 |
| 951 | Ga0268266_10059218 | 3300028379 | Bacteria | 3299 |
| 952 | Ga0268266_10095949 | 3300028379 | Bacteria | 2605 |
| 953 | Ga0268266_10304796 | 3300028379 | Bacteria | 1487 |
| 954 | Ga0268265_10004089 | 3300028380 | Bacteria | 10253 |
| 955 | Ga0268265_10013992 | 3300028380 | Bacteria | 5463 |
| 956 | Ga0268265_10076950 | 3300028380 | Bacteria | 2619 |
| 957 | Ga0268265_10246391 | 3300028380 | Bacteria | 1580 |
| 958 | Ga0268264_10000613 | 3300028381 | Bacteria | 42687 |
| 959 | Ga0268264_10037899 | 3300028381 | Bacteria | 3976 |
| 960 | Ga0268264_10073697 | 3300028381 | Bacteria | 2898 |
| 961 | Ga0268264_10248016 | 3300028381 | Bacteria | 1653 |
| 962 | Ga0268264_10271995 | 3300028381 | Bacteria | 1583 |
| 963 | Ga0307517_10001395 | 3300028786 | Bacteria | 40607 |
| 964 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 965 | Ga0307515_10000213 | 3300028794 | Bacteria | 142742 |
| 966 | Ga0307515_10000472 | 3300028794 | Bacteria | 96172 |
| 967 | Ga0307515_10000655 | 3300028794 | Bacteria | 79837 |
| 968 | Ga0307515_10003487 | 3300028794 | Bacteria | 33051 |
| 969 | Ga0307515_10009632 | 3300028794 | Bacteria | 18642 |
| 970 | Ga0307515_10048317 | 3300028794 | Bacteria | 6436 |
| 971 | Ga0307515_10069340 | 3300028794 | Bacteria | 4822 |
| 972 | Ga0307515_10201563 | 3300028794 | Bacteria | 1864 |
| 973 | Ga0268256_1000059 | 3300030500 | Bacteria | 223875 |
| 974 | Ga0268256_1000072 | 3300030500 | Bacteria | 184436 |
| 975 | Ga0268256_1000096 | 3300030500 | Bacteria | 139457 |
| 976 | Ga0268256_1001132 | 3300030500 | Bacteria | 17288 |
| 977 | Ga0268256_1004087 | 3300030500 | Bacteria | 6237 |
| 978 | Ga0268256_1009796 | 3300030500 | Bacteria | 3146 |
| 979 | Ga0307511_10000043 | 3300030521 | Bacteria | 101232 |
| 980 | Ga0316183_1035885 | 3300030742 | Bacteria | 2538 |
| 981 | Ga0316182_1411781 | 3300030745 | Bacteria | 2360 |
| 982 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 983 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 984 | Ga0265332_10000125 | 3300031238 | Bacteria | 63932 |
| 985 | Ga0265332_10000951 | 3300031238 | Bacteria | 17144 |
| 986 | Ga0265328_10003818 | 3300031239 | Bacteria | 6620 |
| 987 | Ga0265328_10022676 | 3300031239 | Bacteria | 2387 |
| 988 | Ga0265331_10001806 | 3300031250 | Bacteria | 15206 |
| 989 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 990 | Ga0265327_10001288 | 3300031251 | Bacteria | 32919 |
| 991 | Ga0265327_10010084 | 3300031251 | Bacteria | 6702 |
| 992 | Ga0265327_10011638 | 3300031251 | Bacteria | 6033 |
| 993 | Ga0265327_10022614 | 3300031251 | Bacteria | 3751 |
| 994 | Ga0265327_10034279 | 3300031251 | Bacteria | 2819 |
| 995 | Ga0265316_10053940 | 3300031344 | Bacteria | 3148 |
| 996 | Ga0265316_10224581 | 3300031344 | Bacteria | 1385 |
| 997 | Ga0307513_10000117 | 3300031456 | Bacteria | 110951 |
| 998 | Ga0307513_10002745 | 3300031456 | Bacteria | 24211 |
| 999 | Ga0307513_10003270 | 3300031456 | Bacteria | 22086 |
| 1000 | Ga0307513_10008037 | 3300031456 | Bacteria | 13552 |
| 1001 | Ga0307513_10203007 | 3300031456 | Bacteria | 1821 |
| 1002 | Ga0307509_10003946 | 3300031507 | Bacteria | 21881 |
| 1003 | Ga0307509_10005133 | 3300031507 | Bacteria | 18400 |
| 1004 | Ga0307509_10046715 | 3300031507 | Bacteria | 4660 |
| 1005 | Ga0307509_10072791 | 3300031507 | Bacteria | 3579 |
| 1006 | Ga0307509_10113339 | 3300031507 | Bacteria | 2709 |
| 1007 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 1008 | Ga0307408_100000101 | 3300031548 | Bacteria | 94089 |
| 1009 | Ga0307408_100001843 | 3300031548 | Bacteria | 15443 |
| 1010 | Ga0307408_100004804 | 3300031548 | Bacteria | 9103 |
| 1011 | Ga0307408_100006023 | 3300031548 | Bacteria | 8070 |
| 1012 | Ga0307408_100016090 | 3300031548 | Bacteria | 4987 |
| 1013 | Ga0307408_100055479 | 3300031548 | Bacteria | 2869 |
| 1014 | Ga0307408_100085525 | 3300031548 | Bacteria | 2368 |
| 1015 | Ga0307508_10000404 | 3300031616 | Bacteria | 51734 |
| 1016 | Ga0307508_10003052 | 3300031616 | Bacteria | 17219 |
| 1017 | Ga0307514_10012483 | 3300031649 | Bacteria | 7066 |
| 1018 | Ga0307514_10089293 | 3300031649 | Bacteria | 2252 |
| 1019 | Ga0316575_10006695 | 3300031665 | Bacteria | 4158 |
| 1020 | Ga0316579_10000811 | 3300031691 | Bacteria | 10796 |
| 1021 | Ga0316579_10001459 | 3300031691 | Bacteria | 8597 |
| 1022 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 1023 | Ga0265314_10001039 | 3300031711 | Bacteria | 32357 |
| 1024 | Ga0316576_10009121 | 3300031727 | Bacteria | 6388 |
| 1025 | Ga0316576_10011214 | 3300031727 | Bacteria | 5861 |
| 1026 | Ga0316578_10035796 | 3300031728 | Bacteria | 2855 |
| 1027 | Ga0307516_10001586 | 3300031730 | Bacteria | 31257 |
| 1028 | Ga0307516_10002443 | 3300031730 | Bacteria | 24860 |
| 1029 | Ga0307516_10002741 | 3300031730 | Bacteria | 23228 |
| 1030 | Ga0307516_10020817 | 3300031730 | Bacteria | 6769 |
| 1031 | Ga0307405_10012732 | 3300031731 | Bacteria | 4467 |
| 1032 | Ga0307405_10055945 | 3300031731 | Bacteria | 2471 |
| 1033 | Ga0307405_10071978 | 3300031731 | Bacteria | 2226 |
| 1034 | Ga0307413_10001940 | 3300031824 | Bacteria | 8214 |
| 1035 | Ga0307410_10002072 | 3300031852 | Bacteria | 9489 |
| 1036 | Ga0307410_10009283 | 3300031852 | Bacteria | 5510 |
| 1037 | Ga0307410_10022186 | 3300031852 | Bacteria | 3919 |
| 1038 | Ga0307406_10005067 | 3300031901 | Bacteria | 7184 |
| 1039 | Ga0307406_10006267 | 3300031901 | Bacteria | 6555 |
| 1040 | Ga0307406_10006712 | 3300031901 | Bacteria | 6364 |
| 1041 | Ga0307406_10017326 | 3300031901 | Bacteria | 4195 |
| 1042 | Ga0307406_10042617 | 3300031901 | Bacteria | 2834 |
| 1043 | Ga0307406_10087961 | 3300031901 | Bacteria | 2083 |
| 1044 | Ga0307407_10113724 | 3300031903 | Bacteria | 1704 |
| 1045 | Ga0307412_10003320 | 3300031911 | Bacteria | 8939 |
| 1046 | Ga0307409_100009728 | 3300031995 | Bacteria | 5927 |
| 1047 | Ga0307409_100042544 | 3300031995 | Bacteria | 3403 |
| 1048 | Ga0307409_100142685 | 3300031995 | Bacteria | 2066 |
| 1049 | Ga0307409_100162078 | 3300031995 | Bacteria | 1957 |
| 1050 | Ga0307409_100213215 | 3300031995 | Bacteria | 1737 |
| 1051 | Ga0307409_100263934 | 3300031995 | Bacteria | 1582 |
| 1052 | Ga0307416_100006880 | 3300032002 | Bacteria | 7160 |
| 1053 | Ga0307416_100016563 | 3300032002 | Bacteria | 5128 |
| 1054 | Ga0307416_100175287 | 3300032002 | Bacteria | 2002 |
| 1055 | Ga0307416_100196800 | 3300032002 | Bacteria | 1907 |
| 1056 | Ga0307414_10066022 | 3300032004 | Bacteria | 2584 |
| 1057 | Ga0307414_10134074 | 3300032004 | Bacteria | 1928 |
| 1058 | Ga0307414_10180484 | 3300032004 | Bacteria | 1697 |
| 1059 | Ga0307411_10002409 | 3300032005 | Bacteria | 8250 |
| 1060 | Ga0307411_10008303 | 3300032005 | Bacteria | 5367 |
| 1061 | Ga0307411_10034617 | 3300032005 | Bacteria | 3145 |
| 1062 | Ga0307415_100003806 | 3300032126 | Bacteria | 7735 |
| 1063 | Ga0316593_10023515 | 3300032168 | Bacteria | 1945 |
| 1064 | Ga0307507_10075769 | 3300033179 | Bacteria | 3006 |
| 1065 | Ga0307507_10111544 | 3300033179 | Bacteria | 2232 |
| 1066 | Ga0307510_10035314 | 3300033180 | Bacteria | 5586 |
| 1067 | Ga0307510_10045636 | 3300033180 | Bacteria | 4726 |
| 1068 | Ga0316588_1003205 | 3300033528 | Bacteria | 2954 |
| 1069 | Ga0316596_1019472 | 3300033541 | Bacteria | 1722 |
| 1070 | Ga0373926_0029136 | 3300035083 | Bacteria | 1940 |
| 1071 | Ga0373932_0011766 | 3300035112 | Bacteria | 2144 |
| 1072 | Ga0373943_0035289 | 3300035170 | Bacteria | 2389 |
| 1073 | Ga0373955_0007829 | 3300035172 | Bacteria | 4928 |
| 1074 | Ga0316574_0000070 | 3300035398 | Bacteria | 27753 |
| 1075 | Ga0316574_0004300 | 3300035398 | Bacteria | 7441 |
| 1076 | Ga0373931_0010378 | 3300035691 | Bacteria | 4476 |
| 1077 | Ga0373931_0017241 | 3300035691 | Bacteria | 3568 |
| 1078 | Ga0373935_0067325 | 3300035692 | Bacteria | 2302 |
| 1079 | Ga0373927_0001348 | 3300035695 | Bacteria | 18517 |
| 1080 | Ga0373927_0031512 | 3300035695 | Bacteria | 3455 |
| 1081 | Ga0373927_0042538 | 3300035695 | Bacteria | 2943 |
| 1082 | Ga0373947_0054512 | 3300035725 | Bacteria | 2413 |
| 1083 | Ga0373947_0085900 | 3300035725 | Bacteria | 1955 |
| 1084 | Ga0373937_0004911 | 3300036401 | Bacteria | 11367 |
| 1085 | Ga0373937_0010376 | 3300036401 | Bacteria | 8135 |
| 1086 | Ga0373937_0012886 | 3300036401 | Bacteria | 7365 |
| 1087 | Ga0373937_0093628 | 3300036401 | Bacteria | 2786 |
| 1088 | Ga0373937_0121982 | 3300036401 | Bacteria | 2429 |
| 1089 | Ga0316582_0090752 | 3300036647 | Bacteria | 2010 |
| 1090 | Ga0316584_0182065 | 3300036712 | Bacteria | 1555 |
| 1091 | Ga0373925_0081460 | 3300037068 | Bacteria | 2461 |
| 1092 | Ga0373925_0082078 | 3300037068 | Bacteria | 2452 |
| 1093 | Ga0373925_0164082 | 3300037068 | Bacteria | 1751 |
| 1094 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 1095 | Ga0395899_0001691 | 3300037312 | Bacteria | 18397 |
| 1096 | Ga0395899_0004014 | 3300037312 | Bacteria | 11598 |
| 1097 | Ga0395899_0008709 | 3300037312 | Bacteria | 7811 |
| 1098 | Ga0395899_0019141 | 3300037312 | Bacteria | 5203 |
| 1099 | Ga0395899_0024423 | 3300037312 | Bacteria | 4569 |
| 1100 | Ga0395899_0096300 | 3300037312 | Bacteria | 2140 |
| 1101 | Ga0395899_0098267 | 3300037312 | Bacteria | 2115 |
| 1102 | Ga0395899_0102772 | 3300037312 | Bacteria | 2062 |
| 1103 | Ga0395900_0008285 | 3300037418 | Bacteria | 10700 |
| 1104 | Ga0395900_0009158 | 3300037418 | Bacteria | 10143 |
| 1105 | Ga0395900_0015158 | 3300037418 | Bacteria | 7859 |
| 1106 | Ga0395900_0026870 | 3300037418 | Bacteria | 5890 |
| 1107 | Ga0395900_0074221 | 3300037418 | Bacteria | 3497 |
| 1108 | Ga0395900_0084101 | 3300037418 | Bacteria | 3269 |
| 1109 | Ga0395898_0066398 | 3300037466 | Bacteria | 3495 |
| 1110 | Ga0395898_0072998 | 3300037466 | Bacteria | 3314 |
| 1111 | Ga0395898_0133020 | 3300037466 | Bacteria | 2381 |
| 1112 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 1113 | Ga0395905_0001875 | 3300037471 | Bacteria | 24218 |
| 1114 | Ga0395905_0007970 | 3300037471 | Bacteria | 10471 |
| 1115 | Ga0395905_0010328 | 3300037471 | Bacteria | 9086 |
| 1116 | Ga0395905_0018407 | 3300037471 | Bacteria | 6629 |
| 1117 | Ga0395905_0022866 | 3300037471 | Bacteria | 5910 |
| 1118 | Ga0395905_0034452 | 3300037471 | Bacteria | 4754 |
| 1119 | Ga0395905_0038287 | 3300037471 | Bacteria | 4499 |
| 1120 | Ga0395905_0082764 | 3300037471 | Bacteria | 3007 |
| 1121 | Ga0395905_0101488 | 3300037471 | Bacteria | 2701 |
| 1122 | Ga0395905_0202737 | 3300037471 | Bacteria | 1859 |
| 1123 | Ga0395905_0249584 | 3300037471 | Bacteria | 1658 |
| 1124 | Ga0395901_0013302 | 3300038443 | Bacteria | 8358 |
| 1125 | Ga0395901_0022794 | 3300038443 | Bacteria | 6420 |
| 1126 | Ga0395901_0022795 | 3300038443 | Bacteria | 6419 |
| 1127 | Ga0395901_0036328 | 3300038443 | Bacteria | 5091 |
| 1128 | Ga0395901_0055485 | 3300038443 | Bacteria | 4120 |
| 1129 | Ga0395901_0097568 | 3300038443 | Bacteria | 3081 |
| 1130 | Ga0395901_0115496 | 3300038443 | Bacteria | 2819 |
| 1131 | Ga0395901_0121820 | 3300038443 | Bacteria | 2741 |
| 1132 | Ga0395901_0190642 | 3300038443 | Bacteria | 2150 |
| 1133 | Ga0395901_0213305 | 3300038443 | Bacteria | 2020 |
| 1134 | Ga0395901_0324211 | 3300038443 | Bacteria | 1593 |
| 1135 | Ga0436365_0450647 | 3300039437 | Bacteria | 5200 |
| 1136 | Ga0436365_1569295 | 3300039437 | Bacteria | 3751 |
| 1137 | Ga0436360_0038189 | 3300039438 | Bacteria | 2113 |
| 1138 | Ga0436361_0101461 | 3300039447 | Bacteria | 19447 |
| 1139 | Ga0436361_0289802 | 3300039447 | Bacteria | 31851 |
| 1140 | Ga0436361_0487065 | 3300039447 | Bacteria | 63556 |
| 1141 | Ga0436361_0523658 | 3300039447 | Bacteria | 15267 |
| 1142 | Ga0436362_0477984 | 3300039453 | Bacteria | 2462 |
| 1143 | Ga0439436_0004746 | 3300041404 | Bacteria | 4168 |
| 1144 | Ga0439436_0004770 | 3300041404 | Bacteria | 4159 |
| 1145 | Ga0439436_0010792 | 3300041404 | Bacteria | 2784 |
| 1146 | Ga0439447_001550 | 3300041407 | Bacteria | 8402 |
| 1147 | Ga0439466_0000011 | 3300041411 | Bacteria | 221134 |
| 1148 | Ga0439466_0020815 | 3300041411 | Bacteria | 2333 |
| 1149 | Ga0439465_0004682 | 3300041413 | Bacteria | 4413 |
| 1150 | Ga0451853_2018397 | 3300041512 | Bacteria | 2495 |
| 1151 | Ga0439431_0002356 | 3300041997 | Bacteria | 4179 |
| 1152 | Ga0439431_0021691 | 3300041997 | Bacteria | 1543 |
| 1153 | Ga0439433_0006012 | 3300041999 | Bacteria | 2609 |
| 1154 | Ga0439437_001073 | 3300042000 | Bacteria | 2862 |
| 1155 | Ga0439442_006447 | 3300042002 | Bacteria | 2356 |
| 1156 | Ga0439445_0001102 | 3300042004 | Bacteria | 5773 |
| 1157 | Ga0439432_002129 | 3300042006 | Bacteria | 7457 |
| 1158 | Ga0439449_0000187 | 3300042007 | Bacteria | 21694 |
| 1159 | Ga0439449_0000620 | 3300042007 | Bacteria | 13287 |
| 1160 | Ga0439449_0001584 | 3300042007 | Bacteria | 8924 |
| 1161 | Ga0439452_002955 | 3300042010 | Bacteria | 6052 |
| 1162 | Ga0439452_004200 | 3300042010 | Bacteria | 4880 |
| 1163 | Ga0439456_007254 | 3300042013 | Bacteria | 2272 |
| 1164 | Ga0439462_0002391 | 3300042015 | Bacteria | 4351 |
| 1165 | Ga0450911_000281 | 3300042115 | Bacteria | 18766 |
| 1166 | Ga0450890_002116 | 3300042127 | Bacteria | 2780 |
| 1167 | Ga0450889_000109 | 3300042144 | Bacteria | 8111 |
| 1168 | Ga0450906_008422 | 3300042145 | Bacteria | 1995 |
| 1169 | Ga0450907_000007 | 3300042146 | Bacteria | 111445 |
| 1170 | Ga0450910_002890 | 3300042147 | Bacteria | 2263 |
| 1171 | Ga0439446_0002089 | 3300042156 | Bacteria | 4744 |
| 1172 | Ga0439446_0002260 | 3300042156 | Bacteria | 4600 |
| 1173 | Ga0439446_0011612 | 3300042156 | Bacteria | 2394 |
| 1174 | Ga0439434_0001503 | 3300042435 | Bacteria | 6708 |
| 1175 | Ga0439434_0007932 | 3300042435 | Bacteria | 3112 |
| 1176 | Ga0439434_0010725 | 3300042435 | Bacteria | 2703 |
| 1177 | Ga0439435_0000773 | 3300042436 | Bacteria | 5374 |
| 1178 | Ga0439435_0023924 | 3300042436 | Bacteria | 1607 |
| 1179 | Ga0439464_0012317 | 3300042439 | Bacteria | 2276 |
| 1180 | Ga0450918_000158 | 3300042531 | Bacteria | 14950 |
| 1181 | Ga0450893_0001452 | 3300042532 | Bacteria | 3636 |
| 1182 | Ga0451577_0000276 | 3300042876 | Bacteria | 99531 |
| 1183 | Ga0451577_0001377 | 3300042876 | Bacteria | 32574 |
| 1184 | Ga0451577_0037888 | 3300042876 | Bacteria | 4339 |
| 1185 | Ga0451577_0065997 | 3300042876 | Bacteria | 3227 |
| 1186 | Ga0451577_0096803 | 3300042876 | Bacteria | 2635 |
| 1187 | Ga0451577_0109094 | 3300042876 | Bacteria | 2475 |
| 1188 | Ga0451577_0135954 | 3300042876 | Bacteria | 2207 |
| 1189 | Ga0466969_0004750 | 3300044656 | Bacteria | 7230 |
| 1190 | Ga0466969_0006748 | 3300044656 | Bacteria | 6104 |
| 1191 | Ga0466972_0008433 | 3300044658 | Bacteria | 5167 |
| 1192 | Ga0453683_0007502 | 3300044673 | Bacteria | 7392 |
| 1193 | Ga0453683_0018762 | 3300044673 | Bacteria | 4438 |
| 1194 | Ga0466965_0006837 | 3300044683 | Bacteria | 5210 |
| 1195 | Ga0466965_0063016 | 3300044683 | Bacteria | 1855 |
| 1196 | Ga0466966_0020148 | 3300044684 | Bacteria | 4389 |
| 1197 | Ga0466961_0014008 | 3300044693 | Bacteria | 5140 |
| 1198 | Ga0466961_0069024 | 3300044693 | Bacteria | 2244 |
| 1199 | Ga0466961_0089172 | 3300044693 | Bacteria | 1948 |
| 1200 | Ga0453684_0000891 | 3300044712 | Bacteria | 99637 |
| 1201 | Ga0453684_0001215 | 3300044712 | Bacteria | 79022 |
| 1202 | Ga0453684_0063372 | 3300044712 | Bacteria | 4729 |
| 1203 | Ga0453684_0074838 | 3300044712 | Bacteria | 4261 |
| 1204 | Ga0453684_0275004 | 3300044712 | Bacteria | 1923 |
| 1205 | Ga0453684_0279876 | 3300044712 | Bacteria | 1903 |
| 1206 | Ga0466971_0030247 | 3300044719 | Bacteria | 2423 |
| 1207 | Ga0466957_0055469 | 3300044842 | Bacteria | 2422 |
| 1208 | Ga0466959_0126070 | 3300045049 | Bacteria | 1817 |
| 1209 | Ga0451576_0000381 | 3300045051 | Bacteria | 104080 |
| 1210 | Ga0451576_0001248 | 3300045051 | Bacteria | 44697 |
| 1211 | Ga0451576_0004449 | 3300045051 | Bacteria | 18194 |
| 1212 | Ga0451576_0023570 | 3300045051 | Bacteria | 6663 |
| 1213 | Ga0451576_0025162 | 3300045051 | Bacteria | 6417 |
| 1214 | Ga0451576_0037463 | 3300045051 | Bacteria | 5137 |
| 1215 | Ga0451576_0073694 | 3300045051 | Bacteria | 3553 |
| 1216 | Ga0451576_0075018 | 3300045051 | Bacteria | 3519 |
| 1217 | Ga0451576_0095370 | 3300045051 | Bacteria | 3094 |
| 1218 | Ga0451576_0102208 | 3300045051 | Bacteria | 2981 |
| 1219 | Ga0451576_0108446 | 3300045051 | Bacteria | 2889 |
| 1220 | Ga0451576_0112207 | 3300045051 | Bacteria | 2837 |
| 1221 | Ga0451576_0137068 | 3300045051 | Bacteria | 2552 |
| 1222 | Ga0451576_0246475 | 3300045051 | Bacteria | 1867 |
| 1223 | Ga0466958_0005009 | 3300045836 | Bacteria | 7072 |
| 1224 | Ga0466967_0168927 | 3300045976 | Bacteria | 2057 |
| 1225 | Ga0466967_0184275 | 3300045976 | Bacteria | 1971 |
| 1226 | Ga0495617_006149 | 3300046452 | Bacteria | 4225 |
| 1227 | Ga0495627_006447 | 3300046453 | Bacteria | 4600 |
| 1228 | Ga0495592_0000083 | 3300046454 | Bacteria | 83092 |
| 1229 | Ga0495590_0004124 | 3300046457 | Bacteria | 5889 |
| 1230 | Ga0495591_000010 | 3300046458 | Bacteria | 327794 |
| 1231 | Ga0495591_001545 | 3300046458 | Bacteria | 14085 |
| 1232 | Ga0495591_016234 | 3300046458 | Bacteria | 2603 |
| 1233 | Ga0495653_0075170 | 3300046463 | Bacteria | 2515 |
| 1234 | Ga0495650_0000034 | 3300046471 | Bacteria | 410132 |
| 1235 | Ga0495650_0013823 | 3300046471 | Bacteria | 4243 |
| 1236 | Ga0495580_0012135 | 3300046472 | Bacteria | 6626 |
| 1237 | Ga0495605_0002892 | 3300046474 | Bacteria | 10422 |
| 1238 | Ga0495639_0010783 | 3300046475 | Bacteria | 3933 |
| 1239 | Ga0495639_0014230 | 3300046475 | Bacteria | 3443 |
| 1240 | Ga0495664_0057886 | 3300046477 | Bacteria | 2306 |
| 1241 | Ga0495596_0003191 | 3300046500 | Bacteria | 8438 |
| 1242 | Ga0495596_0003690 | 3300046500 | Bacteria | 7654 |
| 1243 | Ga0495607_0002446 | 3300046501 | Bacteria | 15121 |
| 1244 | Ga0495607_0025190 | 3300046501 | Bacteria | 3702 |
| 1245 | Ga0495606_0000511 | 3300046507 | Bacteria | 63022 |
| 1246 | Ga0495608_0015861 | 3300046511 | Bacteria | 5214 |
| 1247 | Ga0495610_0002147 | 3300046512 | Bacteria | 16766 |
| 1248 | Ga0495610_0008257 | 3300046512 | Bacteria | 6772 |
| 1249 | Ga0495616_0003177 | 3300046513 | Bacteria | 10604 |
| 1250 | Ga0495616_0003776 | 3300046513 | Bacteria | 9662 |
| 1251 | Ga0495620_0010395 | 3300046515 | Bacteria | 4912 |
| 1252 | Ga0495631_0075004 | 3300046518 | Bacteria | 1460 |
| 1253 | Ga0495632_0006527 | 3300046519 | Bacteria | 7487 |
| 1254 | Ga0495632_0034565 | 3300046519 | Bacteria | 2586 |
| 1255 | Ga0495632_0047082 | 3300046519 | Bacteria | 2140 |
| 1256 | Ga0495643_0019675 | 3300046522 | Bacteria | 3902 |
| 1257 | Ga0495643_0033289 | 3300046522 | Bacteria | 2853 |
| 1258 | Ga0495644_0054049 | 3300046523 | Bacteria | 1508 |
| 1259 | Ga0495648_0041629 | 3300046524 | Bacteria | 2899 |
| 1260 | Ga0495648_0060928 | 3300046524 | Bacteria | 2243 |
| 1261 | Ga0495642_0031685 | 3300046528 | Bacteria | 2120 |
| 1262 | Ga0495652_0048893 | 3300046529 | Bacteria | 3622 |
| 1263 | Ga0495654_0000151 | 3300046530 | Bacteria | 71530 |
| 1264 | Ga0495654_0005248 | 3300046530 | Bacteria | 7561 |
| 1265 | Ga0495654_0005475 | 3300046530 | Bacteria | 7363 |
| 1266 | Ga0495654_0045127 | 3300046530 | Bacteria | 2176 |
| 1267 | Ga0495665_0010247 | 3300046531 | Bacteria | 5072 |
| 1268 | Ga0495587_0007225 | 3300046536 | Bacteria | 7207 |
| 1269 | Ga0495598_0017969 | 3300046537 | Bacteria | 1831 |
| 1270 | Ga0495597_0001315 | 3300046542 | Bacteria | 18215 |
| 1271 | Ga0495597_0066425 | 3300046542 | Bacteria | 1563 |
| 1272 | Ga0495645_0012915 | 3300046543 | Bacteria | 5896 |
| 1273 | Ga0495645_0148003 | 3300046543 | Bacteria | 1634 |
| 1274 | Ga0495667_0005954 | 3300046559 | Bacteria | 8251 |
| 1275 | Ga0495656_0000090 | 3300046615 | Bacteria | 39387 |
| 1276 | Ga0495656_0019103 | 3300046615 | Bacteria | 2641 |
| 1277 | Ga0495625_0001055 | 3300046660 | Bacteria | 36138 |
| 1278 | Ga0495625_0025375 | 3300046660 | Bacteria | 4496 |
| 1279 | Ga0495635_0016210 | 3300046663 | Bacteria | 5201 |
| 1280 | Ga0495635_0029296 | 3300046663 | Bacteria | 3827 |
| 1281 | Ga0495599_0003944 | 3300046678 | Bacteria | 8726 |
| 1282 | Ga0495623_0002115 | 3300046679 | Bacteria | 13286 |
| 1283 | Ga0495647_0007199 | 3300046681 | Bacteria | 3720 |
| 1284 | Ga0495658_0039464 | 3300046683 | Bacteria | 2619 |
| 1285 | Ga0495669_0006300 | 3300046684 | Bacteria | 4954 |
| 1286 | Ga0495669_0060059 | 3300046684 | Bacteria | 1718 |
| 1287 | Ga0495613_0122850 | 3300046689 | Bacteria | 1863 |
| 1288 | Ga0495671_0000586 | 3300046692 | Bacteria | 26926 |
| 1289 | Ga0495649_0002049 | 3300046694 | Bacteria | 14526 |
| 1290 | Ga0495649_0030910 | 3300046694 | Bacteria | 2955 |
| 1291 | Ga0495660_0000020 | 3300046810 | Bacteria | 304768 |
| 1292 | Ga0495660_0022000 | 3300046810 | Bacteria | 3645 |
| 1293 | Ga0495660_0131274 | 3300046810 | Bacteria | 1256 |
| 1294 | Ga0495581_0046287 | 3300047315 | Bacteria | 2513 |
| 1295 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 1296 | Ga0495672_0000040 | 3300047320 | Bacteria | 268573 |
| 1297 | Ga0495676_0022957 | 3300047321 | Bacteria | 5421 |
| 1298 | Ga0495680_0119611 | 3300047322 | Bacteria | 1946 |
| 1299 | Ga0495683_0035539 | 3300047323 | Bacteria | 2532 |
| 1300 | Ga0495687_001485 | 3300047443 | Bacteria | 21418 |
| 1301 | Ga0495677_0020104 | 3300047445 | Bacteria | 2420 |
| 1302 | Ga0495679_002610 | 3300047446 | Bacteria | 9059 |
| 1303 | Ga0495685_052242 | 3300047447 | Bacteria | 1384 |
| 1304 | Ga0495673_0000020 | 3300047469 | Bacteria | 548327 |
| 1305 | Ga0495684_0138161 | 3300047471 | Bacteria | 1828 |
| 1306 | Ga0495593_0023748 | 3300047673 | Bacteria | 3404 |
| 1307 | Ga0495614_0026926 | 3300048089 | Bacteria | 2479 |
| 1308 | Ga0496100_0089285 | 3300048903 | Bacteria | 2099 |
| 1309 | Ga0496100_0115867 | 3300048903 | Bacteria | 1869 |
| 1310 | Ga0496101_0000053 | 3300048904 | Bacteria | 139859 |
| 1311 | Ga0496101_0041259 | 3300048904 | Bacteria | 3290 |
| 1312 | Ga0496102_0003600 | 3300048905 | Bacteria | 13123 |
| 1313 | Ga0496102_0060046 | 3300048905 | Bacteria | 3478 |
| 1314 | Ga0496102_0082257 | 3300048905 | Bacteria | 2969 |
| 1315 | Ga0496102_0085748 | 3300048905 | Bacteria | 2908 |
| 1316 | Ga0496104_0006891 | 3300048907 | Bacteria | 10020 |
| 1317 | Ga0496105_0003958 | 3300048908 | Bacteria | 11086 |
| 1318 | Ga0496105_0010709 | 3300048908 | Bacteria | 7216 |
| 1319 | Ga0496105_0079874 | 3300048908 | Bacteria | 2701 |
| 1320 | Ga0496106_0032806 | 3300048909 | Bacteria | 3872 |
| 1321 | Ga0496107_0037525 | 3300048910 | Bacteria | 3477 |
| 1322 | Ga0496107_0137712 | 3300048910 | Bacteria | 1804 |
| 1323 | Ga0496107_0162446 | 3300048910 | Bacteria | 1655 |
| 1324 | Ga0496108_0275988 | 3300048911 | Bacteria | 1463 |
| 1325 | Ga0496109_0118029 | 3300048912 | Bacteria | 2470 |
| 1326 | Ga0496110_0008002 | 3300048913 | Bacteria | 8472 |
| 1327 | Ga0496110_0167068 | 3300048913 | Bacteria | 1995 |
| 1328 | Ga0496110_0176348 | 3300048913 | Bacteria | 1940 |
| 1329 | Ga0496110_0219326 | 3300048913 | Bacteria | 1729 |
| 1330 | Ga0496112_0081588 | 3300048915 | Bacteria | 3198 |
| 1331 | Ga0496113_0036962 | 3300048916 | Bacteria | 3581 |
| 1332 | Ga0496114_0083481 | 3300048917 | Bacteria | 2703 |
| 1333 | Ga0496114_0084255 | 3300048917 | Bacteria | 2691 |
| 1334 | Ga0496115_0027385 | 3300048918 | Bacteria | 4457 |
| 1335 | Ga0496116_0000129 | 3300048919 | Bacteria | 158284 |
| 1336 | Ga0496116_0000734 | 3300048919 | Bacteria | 41881 |
| 1337 | Ga0496116_0006777 | 3300048919 | Bacteria | 10309 |
| 1338 | Ga0496116_0009524 | 3300048919 | Bacteria | 8271 |
| 1339 | Ga0496116_0044616 | 3300048919 | Bacteria | 3009 |
| 1340 | Ga0496116_0053637 | 3300048919 | Bacteria | 2661 |
| 1341 | Ga0496117_0000092 | 3300048920 | Bacteria | 202608 |
| 1342 | Ga0496117_0000224 | 3300048920 | Bacteria | 106727 |
| 1343 | Ga0496117_0011620 | 3300048920 | Bacteria | 7869 |
| 1344 | Ga0496117_0015917 | 3300048920 | Bacteria | 6372 |
| 1345 | Ga0496117_0074534 | 3300048920 | Bacteria | 2259 |
| 1346 | Ga0496118_0000053 | 3300048921 | Bacteria | 235810 |
| 1347 | Ga0496118_0000718 | 3300048921 | Bacteria | 53459 |
| 1348 | Ga0496118_0006660 | 3300048921 | Bacteria | 12604 |
| 1349 | Ga0496118_0041408 | 3300048921 | Bacteria | 3647 |
| 1350 | Ga0496119_0000285 | 3300048922 | Bacteria | 70929 |
| 1351 | Ga0496119_0000555 | 3300048922 | Bacteria | 50572 |
| 1352 | Ga0496119_0002224 | 3300048922 | Bacteria | 21627 |
| 1353 | Ga0496119_0005370 | 3300048922 | Bacteria | 12319 |
| 1354 | Ga0496119_0067533 | 3300048922 | Bacteria | 2108 |
| 1355 | Ga0496120_0000024 | 3300048923 | Bacteria | 236853 |
| 1356 | Ga0496120_0000178 | 3300048923 | Bacteria | 107847 |
| 1357 | Ga0496120_0000388 | 3300048923 | Bacteria | 70929 |
| 1358 | Ga0496120_0000548 | 3300048923 | Bacteria | 57387 |
| 1359 | Ga0496120_0001587 | 3300048923 | Bacteria | 26441 |
| 1360 | Ga0496121_0000304 | 3300048924 | Bacteria | 102259 |
| 1361 | Ga0496121_0005682 | 3300048924 | Bacteria | 15867 |
| 1362 | Ga0496121_0027348 | 3300048924 | Bacteria | 5338 |
| 1363 | Ga0496121_0029597 | 3300048924 | Bacteria | 5058 |
| 1364 | Ga0496122_0001889 | 3300048925 | Bacteria | 31699 |
| 1365 | Ga0496122_0009582 | 3300048925 | Bacteria | 10158 |
| 1366 | Ga0496122_0010689 | 3300048925 | Bacteria | 9423 |
| 1367 | Ga0496123_0001035 | 3300048926 | Bacteria | 42221 |
| 1368 | Ga0496123_0002189 | 3300048926 | Bacteria | 24885 |
| 1369 | Ga0496123_0003349 | 3300048926 | Bacteria | 18135 |
| 1370 | Ga0496123_0019217 | 3300048926 | Bacteria | 5391 |
| 1371 | Ga0496123_0027207 | 3300048926 | Bacteria | 4265 |
| 1372 | Ga0496124_0000251 | 3300048927 | Bacteria | 103690 |
| 1373 | Ga0496124_0001528 | 3300048927 | Bacteria | 33674 |
| 1374 | Ga0496124_0026597 | 3300048927 | Bacteria | 5214 |
| 1375 | Ga0496124_0059353 | 3300048927 | Bacteria | 3214 |
| 1376 | Ga0496124_0064591 | 3300048927 | Bacteria | 3054 |
| 1377 | Ga0496124_0081532 | 3300048927 | Bacteria | 2658 |
| 1378 | Ga0496125_0001627 | 3300048928 | Bacteria | 31652 |
| 1379 | Ga0496125_0007136 | 3300048928 | Bacteria | 11923 |
| 1380 | Ga0496125_0037381 | 3300048928 | Bacteria | 4222 |
| 1381 | Ga0496125_0041178 | 3300048928 | Bacteria | 3953 |
| 1382 | Ga0496125_0067848 | 3300048928 | Bacteria | 2808 |
| 1383 | Ga0495678_002665 | 3300049459 | Bacteria | 11815 |
| 1384 | Ga0495682_0000022 | 3300049460 | Bacteria | 183265 |
| 1385 | Ga0501291_006589 | 3300049514 | Bacteria | 1552 |
| 1386 | Ga0501298_010776 | 3300049521 | Bacteria | 1578 |
| 1387 | Ga0501298_018127 | 3300049521 | Bacteria | 1292 |
| 1388 | Ga0501303_001929 | 3300049526 | Bacteria | 1572 |
| 1389 | Ga0501034_0074934 | 3300049571 | Bacteria | 3392 |
| 1390 | Ga0501036_0024340 | 3300049572 | Bacteria | 5104 |
| 1391 | Ga0501036_0055815 | 3300049572 | Bacteria | 3347 |
| 1392 | Ga0501039_0005064 | 3300049575 | Bacteria | 9993 |
| 1393 | Ga0501039_0130938 | 3300049575 | Bacteria | 1969 |
| 1394 | Ga0501040_0018020 | 3300049576 | Bacteria | 4688 |
| 1395 | Ga0501041_0051976 | 3300049577 | Bacteria | 2498 |
| 1396 | Ga0501041_0064562 | 3300049577 | Bacteria | 2242 |
| 1397 | Ga0501042_0025236 | 3300049578 | Bacteria | 4174 |
| 1398 | Ga0501042_0101347 | 3300049578 | Bacteria | 2071 |
| 1399 | Ga0501042_0171251 | 3300049578 | Bacteria | 1566 |
| 1400 | Ga0501043_0000057 | 3300049579 | Bacteria | 103997 |
| 1401 | Ga0501046_0000075 | 3300049580 | Bacteria | 104000 |
| 1402 | Ga0501046_0011964 | 3300049580 | Bacteria | 7403 |
| 1403 | Ga0501047_0000081 | 3300049581 | Bacteria | 122697 |
| 1404 | Ga0501047_0127977 | 3300049581 | Bacteria | 2420 |
| 1405 | Ga0501048_0003517 | 3300049582 | Bacteria | 11908 |
| 1406 | Ga0501048_0034983 | 3300049582 | Bacteria | 3619 |
| 1407 | Ga0501069_0002412 | 3300049585 | Bacteria | 9502 |
| 1408 | Ga0501070_0002316 | 3300049586 | Bacteria | 16713 |
| 1409 | Ga0501070_0089982 | 3300049586 | Bacteria | 2540 |
| 1410 | Ga0501070_0099387 | 3300049586 | Bacteria | 2407 |
| 1411 | Ga0501071_0091465 | 3300049587 | Bacteria | 2235 |
| 1412 | Ga0501072_0045021 | 3300049588 | Bacteria | 3469 |
| 1413 | Ga0501072_0064683 | 3300049588 | Bacteria | 2884 |
| 1414 | Ga0501073_0015213 | 3300049589 | Bacteria | 5581 |
| 1415 | Ga0501073_0057209 | 3300049589 | Bacteria | 2727 |
| 1416 | Ga0501074_0002551 | 3300049590 | Bacteria | 12709 |
| 1417 | Ga0501075_0033424 | 3300049591 | Bacteria | 3826 |
| 1418 | Ga0501076_0028788 | 3300049592 | Bacteria | 4317 |
| 1419 | Ga0501076_0104655 | 3300049592 | Bacteria | 2284 |
| 1420 | Ga0501211_001156 | 3300049658 | Bacteria | 2801 |
| 1421 | Ga0501222_000664 | 3300049662 | Bacteria | 5028 |
| 1422 | Ga0501227_004625 | 3300049665 | Bacteria | 2955 |
| 1423 | Ga0501235_004422 | 3300049669 | Bacteria | 3035 |
| 1424 | Ga0501249_006914 | 3300049679 | Bacteria | 2338 |
| 1425 | Ga0501253_001878 | 3300049683 | Bacteria | 2254 |
| 1426 | Ga0501221_000960 | 3300049704 | Bacteria | 4720 |
| 1427 | Ga0501229_000783 | 3300049706 | Bacteria | 3588 |
| 1428 | Ga0501079_0005427 | 3300049741 | Bacteria | 9500 |
| 1429 | Ga0501079_0016872 | 3300049741 | Bacteria | 5576 |
| 1430 | Ga0501079_0065864 | 3300049741 | Bacteria | 2795 |
| 1431 | Ga0501080_0004208 | 3300049742 | Bacteria | 12772 |
| 1432 | Ga0501080_0007125 | 3300049742 | Bacteria | 10095 |
| 1433 | Ga0501080_0061602 | 3300049742 | Bacteria | 3493 |
| 1434 | Ga0501080_0133218 | 3300049742 | Bacteria | 2300 |
| 1435 | Ga0501081_0013820 | 3300049743 | Bacteria | 5313 |
| 1436 | Ga0501081_0046984 | 3300049743 | Bacteria | 2969 |
| 1437 | Ga0501083_0001718 | 3300049744 | Bacteria | 14921 |
| 1438 | Ga0501083_0028189 | 3300049744 | Bacteria | 3872 |
| 1439 | Ga0501262_000577 | 3300049759 | Bacteria | 4369 |
| 1440 | Ga0501262_003349 | 3300049759 | Bacteria | 1834 |
| 1441 | Ga0501283_001053 | 3300049779 | Bacteria | 3626 |
| 1442 | Ga0501035_0248252 | 3300049822 | Bacteria | 1512 |
| 1443 | Ga0501044_0065371 | 3300049823 | Bacteria | 3709 |
| 1444 | Ga0501045_0004966 | 3300049824 | Bacteria | 9218 |
| 1445 | Ga0501045_0010264 | 3300049824 | Bacteria | 6559 |
| 1446 | Ga0501045_0023822 | 3300049824 | Bacteria | 4393 |
| 1447 | Ga0501045_0057455 | 3300049824 | Bacteria | 2847 |
| 1448 | nmdc:mga03683_19923_c1 | 3300050489 | Bacteria | 2567 |
| 1449 | nmdc:mga03683_21456_c1 | 3300050489 | Bacteria | 2491 |
| 1450 | nmdc:mga03n38_22636_c1 | 3300050490 | Bacteria | 2546 |
| 1451 | nmdc:mga03n38_64134_c1 | 3300050490 | Bacteria | 1681 |
| 1452 | nmdc:mga03n38_7643_c1 | 3300050490 | Bacteria | 3834 |
| 1453 | nmdc:mga00v17_21665_c1 | 3300050491 | Bacteria | 3697 |
| 1454 | nmdc:mga00v17_30925_c1 | 3300050491 | Bacteria | 3153 |
| 1455 | nmdc:mga00v17_51405_c1 | 3300050491 | Bacteria | 2506 |
| 1456 | nmdc:mga0yw44_110325_c1 | 3300050492 | Bacteria | 1762 |
| 1457 | nmdc:mga0yw44_14581_c1 | 3300050492 | Bacteria | 4178 |
| 1458 | nmdc:mga0yw44_785_c1 | 3300050492 | Bacteria | 5057 |
| 1459 | nmdc:mga0yw44_90550_c1 | 3300050492 | Bacteria | 1932 |
| 1460 | nmdc:mga0k408_100765_c1 | 3300050493 | Bacteria | 1703 |
| 1461 | nmdc:mga0k408_101141_c1 | 3300050493 | Bacteria | 1699 |
| 1462 | nmdc:mga0k408_118788_c1 | 3300050493 | Bacteria | 1565 |
| 1463 | nmdc:mga0k408_13542_c1 | 3300050493 | Bacteria | 4476 |
| 1464 | nmdc:mga0k408_138_c1 | 3300050493 | Bacteria | 36717 |
| 1465 | nmdc:mga0k408_16735_c1 | 3300050493 | Bacteria | 4075 |
| 1466 | nmdc:mga0k408_19960_c1 | 3300050493 | Bacteria | 3751 |
| 1467 | nmdc:mga0k408_2064_c1 | 3300050493 | Bacteria | 10745 |
| 1468 | nmdc:mga0k408_29331_c1 | 3300050493 | Bacteria | 3131 |
| 1469 | nmdc:mga0k408_34607_c1 | 3300050493 | Bacteria | 2893 |
| 1470 | nmdc:mga0k408_40887_c1 | 3300050493 | Bacteria | 2669 |
| 1471 | nmdc:mga0k408_42033_c1 | 3300050493 | Bacteria | 2633 |
| 1472 | nmdc:mga0k408_57440_c1 | 3300050493 | Bacteria | 2259 |
| 1473 | nmdc:mga0k408_576_c1 | 3300050493 | Bacteria | 20303 |
| 1474 | nmdc:mga0k408_5849_c1 | 3300050493 | Bacteria | 6553 |
| 1475 | nmdc:mga0k408_7033_c1 | 3300050493 | Bacteria | 6006 |
| 1476 | nmdc:mga0k408_7262_c1 | 3300050493 | Bacteria | 5921 |
| 1477 | nmdc:mga0k408_7453_c1 | 3300050493 | Bacteria | 5843 |
| 1478 | nmdc:mga0k408_8618_c1 | 3300050493 | Bacteria | 5479 |
| 1479 | nmdc:mga0k408_93429_c1 | 3300050493 | Bacteria | 1769 |
| 1480 | nmdc:mga06z11_18151_c1 | 3300050494 | Bacteria | 3208 |
| 1481 | nmdc:mga07m45_11357_c1 | 3300050496 | Bacteria | 4677 |
| 1482 | nmdc:mga07m45_1226_c1 | 3300050496 | Bacteria | 11616 |
| 1483 | nmdc:mga07m45_28774_c1 | 3300050496 | Bacteria | 3068 |
| 1484 | nmdc:mga07m45_31118_c1 | 3300050496 | Bacteria | 2297 |
| 1485 | nmdc:mga07m45_32283_c1 | 3300050496 | Bacteria | 2904 |
| 1486 | nmdc:mga07m45_3534_c1 | 3300050496 | Bacteria | 7549 |
| 1487 | nmdc:mga07m45_4924_c1 | 3300050496 | Bacteria | 6581 |
| 1488 | nmdc:mga07m45_639_c1 | 3300050496 | Bacteria | 13305 |
| 1489 | nmdc:mga07m45_9657_c1 | 3300050496 | Bacteria | 5014 |
| 1490 | nmdc:mga05p37_181_c1 | 3300050507 | Bacteria | 61821 |
| 1491 | nmdc:mga05p37_21359_c1 | 3300050507 | Bacteria | 7840 |
| 1492 | nmdc:mga05p37_241233_c1 | 3300050507 | Bacteria | 2173 |
| 1493 | nmdc:mga09592_1507_c1 | 3300050508 | Bacteria | 18749 |
| 1494 | nmdc:mga09592_239456_c1 | 3300050508 | Bacteria | 1572 |
| 1495 | nmdc:mga09592_64009_c1 | 3300050508 | Bacteria | 3113 |
| 1496 | nmdc:mga09592_64418_c1 | 3300050508 | Bacteria | 3103 |
| 1497 | nmdc:mga06r32_33024_c1 | 3300050510 | Bacteria | 4873 |
| 1498 | nmdc:mga06r32_73337_c1 | 3300050510 | Bacteria | 3316 |
| 1499 | nmdc:mga08y16_14999_c1 | 3300050511 | Bacteria | 8151 |
| 1500 | nmdc:mga08y16_18394_c1 | 3300050511 | Bacteria | 7366 |
| 1501 | nmdc:mga08y16_224_c1 | 3300050511 | Bacteria | 50738 |
| 1502 | nmdc:mga08y16_315156_c1 | 3300050511 | Bacteria | 1611 |
| 1503 | nmdc:mga0n895_10661_c1 | 3300050512 | Bacteria | 8138 |
| 1504 | nmdc:mga0n895_1144_c1 | 3300050512 | Bacteria | 19418 |
| 1505 | nmdc:mga0n895_278806_c1 | 3300050512 | Bacteria | 1695 |
| 1506 | nmdc:mga0rr50_42782_c1 | 3300050513 | Bacteria | 3310 |
| 1507 | nmdc:mga0rr50_60153_c1 | 3300050513 | Bacteria | 2856 |
| 1508 | nmdc:mga0rr50_7490_c1 | 3300050513 | Bacteria | 6737 |
| 1509 | nmdc:mga08x19_175135_c1 | 3300050514 | Bacteria | 1462 |
| 1510 | nmdc:mga08x19_219_c1 | 3300050514 | Bacteria | 43753 |
| 1511 | nmdc:mga08x19_63571_c1 | 3300050514 | Bacteria | 2395 |
| 1512 | nmdc:mga08x19_8071_c1 | 3300050514 | Bacteria | 6255 |
| 1513 | nmdc:mga0a205_15430_c1 | 3300050515 | Bacteria | 7139 |
| 1514 | nmdc:mga0sz30_10668_c1 | 3300050516 | Bacteria | 3526 |
| 1515 | nmdc:mga0sz30_24146_c1 | 3300050516 | Bacteria | 2479 |
| 1516 | nmdc:mga0sz30_6332_c1 | 3300050516 | Bacteria | 4391 |
| 1517 | Ga0495601_0005224 | 3300053077 | Bacteria | 7554 |
| 1518 | Ga0500610_0025769 | 3300053079 | Bacteria | 2936 |
| 1519 | Ga0495619_0023985 | 3300053085 | Bacteria | 3912 |
| 1520 | Ga0495619_0048368 | 3300053085 | Bacteria | 2802 |
| 1521 | Ga0500578_0000652 | 3300053086 | Bacteria | 41736 |
| 1522 | Ga0500646_0002088 | 3300053090 | Bacteria | 5207 |
| 1523 | Ga0500651_0038486 | 3300053093 | Bacteria | 3013 |
| 1524 | Ga0500593_011591 | 3300053117 | Bacteria | 3724 |
| 1525 | Ga0500593_011860 | 3300053117 | Bacteria | 3683 |
| 1526 | Ga0500594_0005824 | 3300053118 | Bacteria | 2743 |
| 1527 | Ga0500621_000009 | 3300053126 | Bacteria | 173209 |
| 1528 | Ga0500652_000885 | 3300053131 | Bacteria | 9913 |
| 1529 | Ga0500658_0000507 | 3300053134 | Bacteria | 16624 |
| 1530 | Ga0500658_0000854 | 3300053134 | Bacteria | 12508 |
| 1531 | Ga0500658_0007664 | 3300053134 | Bacteria | 3988 |
| 1532 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 1533 | Ga0500559_0014012 | 3300053136 | Bacteria | 3389 |
| 1534 | Ga0500568_0000554 | 3300053139 | Bacteria | 27551 |
| 1535 | Ga0500574_000659 | 3300053141 | Bacteria | 4520 |
| 1536 | Ga0500590_037396 | 3300053148 | Bacteria | 2508 |
| 1537 | Ga0500616_0011698 | 3300053153 | Bacteria | 5168 |
| 1538 | Ga0500616_0049014 | 3300053153 | Bacteria | 2237 |
| 1539 | Ga0500619_001082 | 3300053154 | Bacteria | 4728 |
| 1540 | Ga0500622_0000124 | 3300053156 | Bacteria | 81245 |
| 1541 | Ga0500622_0003679 | 3300053156 | Bacteria | 10064 |
| 1542 | Ga0500622_0005264 | 3300053156 | Bacteria | 7806 |
| 1543 | Ga0500622_0018184 | 3300053156 | Bacteria | 3737 |
| 1544 | Ga0500645_001181 | 3300053730 | Bacteria | 13913 |
| 1545 | Ga0500645_010134 | 3300053730 | Bacteria | 3132 |
| 1546 | Ga0500661_003043 | 3300055283 | Bacteria | 3151 |
| 1547 | Ga0590071_001042 | 3300059421 | Bacteria | 7524 |
| 1548 | Ga0501082_0059346 | 3300060353 | Bacteria | 3297 |
| 1549 | Ga0501082_0092527 | 3300060353 | Bacteria | 2612 |
| 1550 | Ga0501082_0201357 | 3300060353 | Bacteria | 1732 |
| 1551 | Ga0501082_0258310 | 3300060353 | Bacteria | 1515 |
| 1552 | 2511244604 | 2511231002 | Bacteria | 5042903 |
| 1553 | 2511382598 | 2511231025 | Bacteria | 5324661 |
| 1554 | 2511435976 | 2511231035 | Bacteria | 5341610 |
| 1555 | 2513231038 | 2513020051 | Bacteria | 6053213 |
| 1556 | 2513955020 | 2513237150 | Bacteria | 6553639 |
| 1557 | 2514041404 | 2513237165 | Bacteria | 6771773 |
| 1558 | 2548499014 | 2547132374 | Bacteria | 5530232 |
| 1559 | 2550697409 | 2548876994 | Bacteria | 4904866 |
| 1560 | 2587728288 | 2585428057 | Bacteria | 6737412 |
| 1561 | 2587734506 | 2585428058 | Bacteria | 6853932 |
| 1562 | 2587754215 | 2585428062 | Bacteria | 6842168 |
| 1563 | 2588295004 | 2588253510 | Bacteria | 6901809 |
| 1564 | 2599623384 | 2599185214 | Bacteria | 8209958 |
| 1565 | 2599675398 | 2599185226 | Bacteria | 8233575 |
| 1566 | 2599680989 | 2599185227 | Bacteria | 8246414 |
| 1567 | 2599693004 | 2599185229 | Bacteria | 8216126 |
| 1568 | 2608671670 | 2608642108 | Bacteria | 4104624 |
| 1569 | 2643744991 | 2643221544 | Bacteria | 5886209 |
| 1570 | 2643867780 | 2643221570 | Bacteria | 5103772 |
| 1571 | 2643971158 | 2643221592 | Bacteria | 6608788 |
| 1572 | 2643991642 | 2643221596 | Bacteria | 5006805 |
| 1573 | 2644062187 | 2643221609 | Bacteria | 6756331 |
| 1574 | 2644071375 | 2643221611 | Bacteria | 6820941 |
| 1575 | 2644142076 | 2643221625 | Bacteria | 6512927 |
| 1576 | 2644161853 | 2643221628 | Bacteria | 5745828 |
| 1577 | 2644222768 | 2643221639 | Bacteria | 6649903 |
| 1578 | 2644246838 | 2643221644 | Bacteria | 6865017 |
| 1579 | 2644260688 | 2643221646 | Bacteria | 6433402 |
| 1580 | 2644276301 | 2643221648 | Bacteria | 6521465 |
| 1581 | 2644293389 | 2643221652 | Bacteria | 5140275 |
| 1582 | 2644301399 | 2643221654 | Bacteria | 5273570 |
| 1583 | 2644325550 | 2643221658 | Bacteria | 6064537 |
| 1584 | 2644399269 | 2643221672 | Bacteria | 6322190 |
| 1585 | 2644467046 | 2643221683 | Bacteria | 5749203 |
| 1586 | 2644648471 | 2643221717 | Bacteria | 5676132 |
| 1587 | 2687581166 | 2687453129 | Bacteria | 4387428 |
| 1588 | 2722881999 | 2721755523 | Bacteria | 6430384 |
| 1589 | 2738718206 | 2738541277 | Bacteria | 7458140 |
| 1590 | 2738880404 | 2738541307 | Bacteria | 8606193 |
| 1591 | 2739058935 | 2738541337 | Bacteria | 6183410 |
| 1592 | 2739245798 | 2738543012 | Bacteria | 7115078 |
| 1593 | 2739248288 | 2738543013 | Bacteria | 5618633 |
| 1594 | 2739281393 | 2738543019 | Bacteria | 7459457 |
| 1595 | 2809126721 | 2808606414 | Bacteria | 4917181 |
| 1596 | 2816470492 | 2816332133 | Bacteria | 7249298 |
| 1597 | 2819594809 | 2818991445 | Bacteria | 4955017 |
| 1598 | 2819600560 | 2818991446 | Bacteria | 7757362 |
| 1599 | 2831267714 | 2831265667 | Bacteria | 7184833 |
| 1600 | 2831869231 | 2831864461 | Bacteria | 6502356 |
| 1601 | 2834643046 | 2834641062 | Bacteria | 5559922 |
| 1602 | 2838061558 | 2838054893 | Bacteria | 7451788 |
| 1603 | 2839143975 | 2839138175 | Bacteria | 6549354 |
| 1604 | 2842677540 | 2842677519 | Bacteria | 5615038 |
| 1605 | 2842718737 | 2842718218 | Bacteria | 4560148 |
| 1606 | 2842736352 | 2842733646 | Bacteria | 5716726 |
| 1607 | 2842748860 | 2842747753 | Bacteria | 5578255 |
| 1608 | 2844532303 | 2844528606 | Bacteria | 4733806 |
| 1609 | 2847797675 | 2847797336 | Bacteria | 5176640 |
| 1610 | 2855732098 | 2855730933 | Bacteria | 7047938 |
| 1611 | 2855768806 | 2855767633 | Bacteria | 7049357 |
| 1612 | 2857579865 | 2857576091 | Bacteria | 5465855 |
| 1613 | 2865014898 | 2865014394 | Bacteria | 4764573 |
| 1614 | 2869552047 | 2869551831 | Bacteria | 5474685 |
| 1615 | 2876602561 | 2876601092 | Bacteria | 5114497 |
| 1616 | 2881102988 | 2881101125 | Bacteria | 4590519 |
| 1617 | 2881415244 | 2881412998 | Bacteria | 6492157 |
| 1618 | 2881612502 | 2881609920 | Bacteria | 4405319 |
| 1619 | 2884811695 | 2884811622 | Bacteria | 5552861 |
| 1620 | 2884841319 | 2884836552 | Bacteria | 5219991 |
| 1621 | 2884856193 | 2884852848 | Bacteria | 5221161 |
| 1622 | 2885196925 | 2885192300 | Bacteria | 5882526 |
| 1623 | 2885198816 | 2885198086 | Bacteria | 7212419 |
| 1624 | 2885211804 | 2885211737 | Bacteria | 7212420 |
| 1625 | 2894024348 | 2894023352 | Bacteria | 5167372 |
| 1626 | 2896156881 | 2896154374 | Bacteria | 5221518 |
| 1627 | 2899928293 | 2899924645 | Bacteria | 7487985 |
| 1628 | 2904451830 | 2904449895 | Bacteria | 6927402 |
| 1629 | 2904462513 | 2904456579 | Bacteria | 6819253 |
| 1630 | 2904481717 | 2904479285 | Bacteria | 5073931 |
| 1631 | 2904545117 | 2904541872 | Bacteria | 8915136 |
| 1632 | 2908674513 | 2908669403 | Bacteria | 5740494 |
| 1633 | 2919467186 | 2919462493 | Bacteria | 5817112 |
| 1634 | 2919707145 | 2919704043 | Bacteria | 5560311 |
| 1635 | 2928041245 | 2928037797 | Bacteria | 7273642 |
| 1636 | 2928048087 | 2928044640 | Bacteria | 7271509 |
| 1637 | 2928055928 | 2928051484 | Bacteria | 7773759 |
| 1638 | 2928066591 | 2928064002 | Bacteria | 7419480 |
| 1639 | 2928077255 | 2928070936 | Bacteria | 8062541 |
| 1640 | 2928087556 | 2928084124 | Bacteria | 7159212 |
| 1641 | 2928120674 | 2928115317 | Bacteria | 6477646 |
| 1642 | 2929165295 | 2929160207 | Bacteria | 9075316 |
| 1643 | 2929523626 | 2929520902 | Bacteria | 6765052 |
| 1644 | 2939605626 | 2939602548 | Bacteria | 4950493 |
| 1645 | 2939635840 | 2939631187 | Bacteria | 6118131 |
| 1646 | 2945910100 | 2945909444 | Bacteria | 7065066 |
| 1647 | 2945946132 | 2945945610 | Bacteria | 5951079 |
| 1648 | 2945955243 | 2945951305 | Bacteria | 4918162 |
| 1649 | 2945975732 | 2945972063 | Bacteria | 6086495 |
| 1650 | 2945987884 | 2945984333 | Bacteria | 7358892 |
| 1651 | 2954768818 | 2954767861 | Bacteria | 5535784 |
| 1652 | 2974320379 | 2974320154 | Bacteria | 4571377 |
| 1653 | 2978977721 | 2978975091 | Bacteria | 4704313 |
| 1654 | 2990713910 | 2990710928 | Bacteria | 5002431 |
| 1655 | 3003667376 | 3003665799 | Bacteria | 7279786 |
| 1656 | 644748182 | 644736347 | Bacteria | 6476522 |
| 1657 | 8003403085 | 8003400568 | Bacteria | 5535898 |
| 1658 | 8016737616 | 8016733728 | Bacteria | 5274317 |
| 1659 | 8019504220 | 8019499862 | Bacteria | 5169538 |
| 1660 | 8055434797 | 8055431914 | Bacteria | 4551896 |
| 1661 | Ga0495625_0012405 | |||
| 1662 | JGI24739J22299_10000107 | |||
| 1663 | JGI25155J39150_1000022 | |||
| 1664 | JGI25156J39149_1000005 | |||
| 1665 | JGI25162J39368_1002554 | |||
| 1666 | JGI25154J39366_1000017 | |||
| 1667 | JGI25157J39369_1000003 | |||
| 1668 | JGI25157J39369_1000747 | |||
| 1669 | JGI25152J39213_1001428 | |||
| 1670 | JGI25150J39212_1001994 | |||
| 1671 | JGI25159J45721_1001646 | |||
| 1672 | JGI25159J45721_1001983 | |||
| 1673 | JGI25151J46595_10002783 | |||
| 1674 | JGI25151J46595_10003777 | |||
| 1675 | JGI25151J46595_10007702 | |||
| 1676 | JGI25151J46595_10009716 | |||
| 1677 | JGI25406J46586_10000977 | |||
| 1678 | JGI25153J46596_10005438 | |||
| 1679 | rootL2_10004438 | |||
| 1680 | rootL2_10021412 | |||
| 1681 | JGI25160J50197_1000273 | |||
| 1682 | JGI25161J50226_1000095 | |||
| 1683 | Ga0055532_1000271 | |||
| 1684 | Ga0055525_1000004 | |||
| 1685 | Ga0055527_1001088 | |||
| 1686 | Ga0055535_1000380 | |||
| 1687 | Ga0055542_1000062 | |||
| 1688 | Ga0055526_1000968 | |||
| 1689 | Ga0055526_1006110 | |||
| 1690 | Ga0055526_1006746 | |||
| 1691 | Ga0055526_1014527 | |||
| 1692 | Ga0055537_1000483 | |||
| 1693 | Ga0055537_1000717 | |||
| 1694 | Ga0055537_1002502 | |||
| 1695 | Ga0055524_1000073 | |||
| 1696 | Ga0055524_1000658 | |||
| 1697 | Ga0055524_1001688 | |||
| 1698 | Ga0055524_1022732 | |||
| 1699 | Ga0055536_1000060 | |||
| 1700 | Ga0055536_1004647 | |||
| 1701 | Ga0055536_1006788 | |||
| 1702 | Ga0055536_1022945 | |||
| 1703 | Ga0055534_1000337 | |||
| 1704 | Ga0055534_1000467 | |||
| 1705 | Ga0055534_1000548 | |||
| 1706 | Ga0055534_1000929 | |||
| 1707 | Ga0055534_1001861 | |||
| 1708 | Ga0055528_1007433 | |||
| 1709 | Ga0055530_10001136 | |||
| 1710 | Ga0055530_10004473 | |||
| 1711 | Ga0055530_10011023 | |||
| 1712 | Ga0055540_1000037 | |||
| 1713 | Ga0055540_1000202 | |||
| 1714 | Ga0055540_1001461 | |||
| 1715 | Ga0055540_1007521 | |||
| 1716 | Ga0055531_10000007 | |||
| 1717 | Ga0055531_10000112 | |||
| 1718 | Ga0055531_10001286 | |||
| 1719 | Ga0055531_10001923 | |||
| 1720 | Ga0055531_10011360 | |||
| 1721 | Ga0058692_1000039 | |||
| 1722 | Ga0058692_1000291 | |||
| 1723 | Ga0058692_1000442 | |||
| 1724 | Ga0058692_1000709 | |||
| 1725 | Ga0058692_1002728 | |||
| 1726 | Ga0058692_1003453 | |||
| 1727 | Ga0055543_1000218 | |||
| 1728 | Ga0055543_1002869 | |||
| 1729 | Ga0065165_1000016 | |||
| 1730 | Ga0065165_1000942 | |||
| 1731 | Ga0065165_1003934 | |||
| 1732 | Ga0065165_1013762 | |||
| 1733 | Ga0065165_1014362 | |||
| 1734 | Ga0065704_10072179 | |||
| 1735 | Ga0065704_10079023 | |||
| 1736 | Ga0065715_10179597 | |||
| 1737 | Ga0065707_10083647 | |||
| 1738 | Ga0065707_10143859 | |||
| 1739 | Ga0070658_10003011 | |||
| 1740 | Ga0070658_10037598 | |||
| 1741 | Ga0070658_10102728 | |||
| 1742 | Ga0070658_10154433 | |||
| 1743 | Ga0070676_10002537 | |||
| 1744 | Ga0070676_10044429 | |||
| 1745 | Ga0070683_100022694 | |||
| 1746 | Ga0070683_100057870 | |||
| 1747 | Ga0070690_100011726 | |||
| 1748 | Ga0070670_100000655 | |||
| 1749 | Ga0070670_100018023 | |||
| 1750 | Ga0070670_100018207 | |||
| 1751 | Ga0070670_100048709 | |||
| 1752 | Ga0070670_100056163 | |||
| 1753 | Ga0070670_100119152 | |||
| 1754 | Ga0070670_100140245 | |||
| 1755 | Ga0070670_100149189 | |||
| 1756 | Ga0070677_10026317 | |||
| 1757 | Ga0068869_100002039 | |||
| 1758 | Ga0068869_100041135 | |||
| 1759 | Ga0068869_100061697 | |||
| 1760 | Ga0070666_10027838 | |||
| 1761 | Ga0070680_100043209 | |||
| 1762 | Ga0070680_100074544 | |||
| 1763 | Ga0070680_100216976 | |||
| 1764 | Ga0070682_100045907 | |||
| 1765 | Ga0070682_100081811 | |||
| 1766 | Ga0068868_100001312 | |||
| 1767 | Ga0068868_100034469 | |||
| 1768 | Ga0068868_100059565 | |||
| 1769 | Ga0070660_100030267 | |||
| 1770 | Ga0070660_100058604 | |||
| 1771 | Ga0070660_100061785 | |||
| 1772 | Ga0070689_100035794 | |||
| 1773 | Ga0070661_100005150 | |||
| 1774 | Ga0070661_100014669 | |||
| 1775 | Ga0070661_100054923 | |||
| 1776 | Ga0070661_100106474 | |||
| 1777 | Ga0070661_100172581 | |||
| 1778 | Ga0070661_100234732 | |||
| 1779 | Ga0070692_10046303 | |||
| 1780 | Ga0070668_100010679 | |||
| 1781 | Ga0070668_100052341 | |||
| 1782 | Ga0070668_100058264 | |||
| 1783 | Ga0070668_100062460 | |||
| 1784 | Ga0070669_100005401 | |||
| 1785 | Ga0070669_100021493 | |||
| 1786 | Ga0070669_100074591 | |||
| 1787 | Ga0070669_100080628 | |||
| 1788 | Ga0070675_100002072 | |||
| 1789 | Ga0070675_100002276 | |||
| 1790 | Ga0070675_100058320 | |||
| 1791 | Ga0070675_100078798 | |||
| 1792 | Ga0070675_100208047 | |||
| 1793 | Ga0070671_100011136 | |||
| 1794 | Ga0070671_100014642 | |||
| 1795 | Ga0070671_100016334 | |||
| 1796 | Ga0070671_100039869 | |||
| 1797 | Ga0070671_100060152 | |||
| 1798 | Ga0070671_100062719 | |||
| 1799 | Ga0070671_100096888 | |||
| 1800 | Ga0070671_100280307 | |||
| 1801 | Ga0070674_100027721 | |||
| 1802 | Ga0070674_100035402 | |||
| 1803 | Ga0070674_100075881 | |||
| 1804 | Ga0070674_100116276 | |||
| 1805 | Ga0070673_100010612 | |||
| 1806 | Ga0070673_100013521 | |||
| 1807 | Ga0070673_100231207 | |||
| 1808 | Ga0070659_100000722 | |||
| 1809 | Ga0070659_100025249 | |||
| 1810 | Ga0070659_100028792 | |||
| 1811 | Ga0070659_100039166 | |||
| 1812 | Ga0070659_100163697 | |||
| 1813 | Ga0070667_100027408 | |||
| 1814 | Ga0070667_100063891 | |||
| 1815 | Ga0070667_100085520 | |||
| 1816 | Ga0070667_100152503 | |||
| 1817 | Ga0070709_10012257 | |||
| 1818 | Ga0070709_10012358 | |||
| 1819 | Ga0070709_10074315 | |||
| 1820 | Ga0070709_10116577 | |||
| 1821 | Ga0070714_100116842 | |||
| 1822 | Ga0070713_100012928 | |||
| 1823 | Ga0070713_100034409 | |||
| 1824 | Ga0070713_100128246 | |||
| 1825 | Ga0070710_10047349 | |||
| 1826 | Ga0070701_10053676 | |||
| 1827 | Ga0070701_10106001 | |||
| 1828 | Ga0070711_100004600 | |||
| 1829 | Ga0070711_100061747 | |||
| 1830 | Ga0070705_100136038 | |||
| 1831 | Ga0070700_100000839 | |||
| 1832 | Ga0070700_100077353 | |||
| 1833 | Ga0070700_100131794 | |||
| 1834 | Ga0070694_100017278 | |||
| 1835 | Ga0070694_100019073 | |||
| 1836 | Ga0070694_100065476 | |||
| 1837 | Ga0070694_100076118 | |||
| 1838 | Ga0070663_100012806 | |||
| 1839 | Ga0070663_100032290 | |||
| 1840 | Ga0070663_100088288 | |||
| 1841 | Ga0070678_100022651 | |||
| 1842 | Ga0070678_100023376 | |||
| 1843 | Ga0070678_100036246 | |||
| 1844 | Ga0070662_100001216 | |||
| 1845 | Ga0070662_100020556 | |||
| 1846 | Ga0070662_100020619 | |||
| 1847 | Ga0070662_100111838 | |||
| 1848 | Ga0070662_100141538 | |||
| 1849 | Ga0070681_10015201 | |||
| 1850 | Ga0070681_10017457 | |||
| 1851 | Ga0070681_10047156 | |||
| 1852 | Ga0070681_10098398 | |||
| 1853 | Ga0068867_100000081 | |||
| 1854 | Ga0068867_100001697 | |||
| 1855 | Ga0068867_100002106 | |||
| 1856 | Ga0068867_100024737 | |||
| 1857 | Ga0068867_100042493 | |||
| 1858 | Ga0068867_100042821 | |||
| 1859 | Ga0068867_100220926 | |||
| 1860 | Ga0070685_10084032 | |||
| 1861 | Ga0070706_100000463 | |||
| 1862 | Ga0070706_100067449 | |||
| 1863 | Ga0070706_100076557 | |||
| 1864 | Ga0070706_100215096 | |||
| 1865 | Ga0070707_100011237 | |||
| 1866 | Ga0070707_100075144 | |||
| 1867 | Ga0070707_100186478 | |||
| 1868 | Ga0070698_100038594 | |||
| 1869 | Ga0070698_100171427 | |||
| 1870 | Ga0070699_100012659 | |||
| 1871 | Ga0070699_100019325 | |||
| 1872 | Ga0070699_100027789 | |||
| 1873 | Ga0070699_100028721 | |||
| 1874 | Ga0070699_100043010 | |||
| 1875 | Ga0070679_100042804 | |||
| 1876 | Ga0070679_100043504 | |||
| 1877 | Ga0070679_100148911 | |||
| 1878 | Ga0070684_100019385 | |||
| 1879 | Ga0070684_100020668 | |||
| 1880 | Ga0070697_100033017 | |||
| 1881 | Ga0068853_100001296 | |||
| 1882 | Ga0068853_100020194 | |||
| 1883 | Ga0068853_100094553 | |||
| 1884 | Ga0070672_100002859 | |||
| 1885 | Ga0070672_100013320 | |||
| 1886 | Ga0070672_100018087 | |||
| 1887 | Ga0070672_100035554 | |||
| 1888 | Ga0070672_100041756 | |||
| 1889 | Ga0070672_100042391 | |||
| 1890 | Ga0070672_100272863 | |||
| 1891 | Ga0070695_100055428 | |||
| 1892 | Ga0070695_100114020 | |||
| 1893 | Ga0070696_100003263 | |||
| 1894 | Ga0070696_100035707 | |||
| 1895 | Ga0070696_100051492 | |||
| 1896 | Ga0070693_100007795 | |||
| 1897 | Ga0070693_100021450 | |||
| 1898 | Ga0070665_100013839 | |||
| 1899 | Ga0070665_100019707 | |||
| 1900 | Ga0070665_100022394 | |||
| 1901 | Ga0070665_100225384 | |||
| 1902 | Ga0070704_100004279 | |||
| 1903 | Ga0070704_100023273 | |||
| 1904 | Ga0070704_100237986 | |||
| 1905 | Ga0068855_100016883 | |||
| 1906 | Ga0068855_100019918 | |||
| 1907 | Ga0068855_100020624 | |||
| 1908 | Ga0068855_100033144 | |||
| 1909 | Ga0068855_100036519 | |||
| 1910 | Ga0068855_100043350 | |||
| 1911 | Ga0070664_100015251 | |||
| 1912 | Ga0070664_100023069 | |||
| 1913 | Ga0070664_100026646 | |||
| 1914 | Ga0070664_100052551 | |||
| 1915 | Ga0070664_100115380 | |||
| 1916 | Ga0068857_100094504 | |||
| 1917 | Ga0068857_100108286 | |||
| 1918 | Ga0068857_100199948 | |||
| 1919 | Ga0068854_100008019 | |||
| 1920 | Ga0068854_100016437 | |||
| 1921 | Ga0068854_100017824 | |||
| 1922 | Ga0068854_100027690 | |||
| 1923 | Ga0068854_100063337 | |||
| 1924 | Ga0068854_100113326 | |||
| 1925 | Ga0068856_100003497 | |||
| 1926 | Ga0068856_100052020 | |||
| 1927 | Ga0068856_100059045 | |||
| 1928 | Ga0068856_100079103 | |||
| 1929 | Ga0068852_100005381 | |||
| 1930 | Ga0068852_100011356 | |||
| 1931 | Ga0068852_100062192 | |||
| 1932 | Ga0068852_100071351 | |||
| 1933 | Ga0068852_100130031 | |||
| 1934 | Ga0068852_100224054 | |||
| 1935 | Ga0068859_100006667 | |||
| 1936 | Ga0068859_100066678 | |||
| 1937 | Ga0068859_100100311 | |||
| 1938 | Ga0068859_100101706 | |||
| 1939 | Ga0068864_100001804 | |||
| 1940 | Ga0068864_100006924 | |||
| 1941 | Ga0068864_100016465 | |||
| 1942 | Ga0068864_100023957 | |||
| 1943 | Ga0068864_100049117 | |||
| 1944 | Ga0068866_10006603 | |||
| 1945 | Ga0068866_10024029 | |||
| 1946 | Ga0068861_100001859 | |||
| 1947 | Ga0068861_100020979 | |||
| 1948 | Ga0068861_100024799 | |||
| 1949 | Ga0068861_100040101 | |||
| 1950 | Ga0068861_100204498 | |||
| 1951 | Ga0068851_10001662 | |||
| 1952 | Ga0068851_10027158 | |||
| 1953 | Ga0068863_100011245 | |||
| 1954 | Ga0068863_100025859 | |||
| 1955 | Ga0068858_100005397 | |||
| 1956 | Ga0068858_100015128 | |||
| 1957 | Ga0068858_100015409 | |||
| 1958 | Ga0068858_100071444 | |||
| 1959 | Ga0068860_100004248 | |||
| 1960 | Ga0068860_100004659 | |||
| 1961 | Ga0068860_100005775 | |||
| 1962 | Ga0068860_100043724 | |||
| 1963 | Ga0068860_100326033 | |||
| 1964 | Ga0068862_100004558 | |||
| 1965 | Ga0068862_100018849 | |||
| 1966 | Ga0068862_100088092 | |||
| 1967 | Ga0081455_10075970 | |||
| 1968 | Ga0081539_10000917 | |||
| 1969 | Ga0081539_10001716 | |||
| 1970 | Ga0070717_10205910 | |||
| 1971 | Ga0075365_10006309 | |||
| 1972 | Ga0075365_10010415 | |||
| 1973 | Ga0075365_10029292 | |||
| 1974 | Ga0075365_10048041 | |||
| 1975 | Ga0075365_10108442 | |||
| 1976 | Ga0075368_10044752 | |||
| 1977 | Ga0075363_100009368 | |||
| 1978 | Ga0075363_100014193 | |||
| 1979 | Ga0075363_100015200 | |||
| 1980 | Ga0075364_10065161 | |||
| 1981 | Ga0075364_10081682 | |||
| 1982 | Ga0075362_10005983 | |||
| 1983 | Ga0075362_10039533 | |||
| 1984 | Ga0075367_10013296 | |||
| 1985 | Ga0075367_10089875 | |||
| 1986 | Ga0075367_10104720 | |||
| 1987 | Ga0075369_10010911 | |||
| 1988 | Ga0075369_10013394 | |||
| 1989 | Ga0075366_10000565 | |||
| 1990 | Ga0075366_10003522 | |||
| 1991 | Ga0075366_10004894 | |||
| 1992 | Ga0075366_10007992 | |||
| 1993 | Ga0075366_10010633 | |||
| 1994 | Ga0075366_10023928 | |||
| 1995 | Ga0075366_10026377 | |||
| 1996 | Ga0075366_10028720 | |||
| 1997 | Ga0075366_10034048 | |||
| 1998 | Ga0075366_10040231 | |||
| 1999 | Ga0075366_10054534 | |||
| 2000 | Ga0075366_10074127 | |||
| 2001 | Ga0075366_10096754 | |||
| 2002 | Ga0075366_10119325 | |||
| 2003 | Ga0075366_10151653 | |||
| 2004 | Ga0097621_100009452 | |||
| 2005 | Ga0097621_100013544 | |||
| 2006 | Ga0097621_100018736 | |||
| 2007 | Ga0097621_100025502 | |||
| 2008 | Ga0097621_100026295 | |||
| 2009 | Ga0097621_100053592 | |||
| 2010 | Ga0097621_100130284 | |||
| 2011 | Ga0097621_100161786 | |||
| 2012 | Ga0097621_100255942 | |||
| 2013 | Ga0075370_10000350 | |||
| 2014 | Ga0075370_10001008 | |||
| 2015 | Ga0075370_10001666 | |||
| 2016 | Ga0075370_10004844 | |||
| 2017 | Ga0075370_10012071 | |||
| 2018 | Ga0075370_10012595 | |||
| 2019 | Ga0075370_10037247 | |||
| 2020 | Ga0075370_10068955 | |||
| 2021 | Ga0075370_10077352 | |||
| 2022 | Ga0068871_100006413 | |||
| 2023 | Ga0068871_100017680 | |||
| 2024 | Ga0068871_100017837 | |||
| 2025 | Ga0068871_100020611 | |||
| 2026 | Ga0068871_100026397 | |||
| 2027 | Ga0075428_100006866 | |||
| 2028 | Ga0075428_100059027 | |||
| 2029 | Ga0075428_100116127 | |||
| 2030 | Ga0075428_100185526 | |||
| 2031 | Ga0075430_100037043 | |||
| 2032 | Ga0075431_100009882 | |||
| 2033 | Ga0075431_100045869 | |||
| 2034 | Ga0075433_10270596 | |||
| 2035 | Ga0075434_100000247 | |||
| 2036 | Ga0075434_100016216 | |||
| 2037 | Ga0075429_100000463 | |||
| 2038 | Ga0075429_100012319 | |||
| 2039 | Ga0075429_100086523 | |||
| 2040 | Ga0068865_100041887 | |||
| 2041 | Ga0068865_100056658 | |||
| 2042 | Ga0068865_100061617 | |||
| 2043 | Ga0068865_100072442 | |||
| 2044 | Ga0068865_100169693 | |||
| 2045 | Ga0075436_100000153 | |||
| 2046 | Ga0075436_100002208 | |||
| 2047 | Ga0075436_100021164 | |||
| 2048 | Ga0075436_100031066 | |||
| 2049 | Ga0075436_100055576 | |||
| 2050 | Ga0097620_100006667 | |||
| 2051 | Ga0097620_100066676 | |||
| 2052 | Ga0097620_100100310 | |||
| 2053 | Ga0097620_100101706 | |||
| 2054 | Ga0079104_1000055 | |||
| 2055 | Ga0079104_1014636 | |||
| 2056 | Ga0099826_10000020 | |||
| 2057 | Ga0099826_10043559 | |||
| 2058 | Ga0099794_10021968 | |||
| 2059 | Ga0099795_10004825 | |||
| 2060 | Ga0099795_10021877 | |||
| 2061 | Ga0105251_10001513 | |||
| 2062 | Ga0105251_10011195 | |||
| 2063 | Ga0105244_10010701 | |||
| 2064 | Ga0105250_10003376 | |||
| 2065 | Ga0105240_10003800 | |||
| 2066 | Ga0105240_10018026 | |||
| 2067 | Ga0105240_10115080 | |||
| 2068 | Ga0105240_10149092 | |||
| 2069 | Ga0111539_10007501 | |||
| 2070 | Ga0111539_10046081 | |||
| 2071 | Ga0105245_10007918 | |||
| 2072 | Ga0105245_10088093 | |||
| 2073 | Ga0114129_10005167 | |||
| 2074 | Ga0114129_10018075 | |||
| 2075 | Ga0114129_10213674 | |||
| 2076 | Ga0105243_10004191 | |||
| 2077 | Ga0105243_10010403 | |||
| 2078 | Ga0105243_10043569 | |||
| 2079 | Ga0105243_10043909 | |||
| 2080 | Ga0105243_10071599 | |||
| 2081 | Ga0105243_10077762 | |||
| 2082 | Ga0105243_10093592 | |||
| 2083 | Ga0105241_10065167 | |||
| 2084 | Ga0105241_10089016 | |||
| 2085 | Ga0105241_10171876 | |||
| 2086 | Ga0105242_10001697 | |||
| 2087 | Ga0105242_10002028 | |||
| 2088 | Ga0105242_10040904 | |||
| 2089 | Ga0105242_10041709 | |||
| 2090 | Ga0105242_10075746 | |||
| 2091 | Ga0105242_10202976 | |||
| 2092 | Ga0105248_10002030 | |||
| 2093 | Ga0105248_10015980 | |||
| 2094 | Ga0105248_10024858 | |||
| 2095 | Ga0105248_10059994 | |||
| 2096 | Ga0105248_10066533 | |||
| 2097 | Ga0105248_10097012 | |||
| 2098 | Ga0105248_10127574 | |||
| 2099 | Ga0105248_10221961 | |||
| 2100 | Ga0105248_10333486 | |||
| 2101 | Ga0105237_10012592 | |||
| 2102 | Ga0105238_10006104 | |||
| 2103 | Ga0105238_10020927 | |||
| 2104 | Ga0105238_10096631 | |||
| 2105 | Ga0105238_10099453 | |||
| 2106 | Ga0105238_10109604 | |||
| 2107 | Ga0105238_10133369 | |||
| 2108 | Ga0105249_10001475 | |||
| 2109 | Ga0105249_10054022 | |||
| 2110 | Ga0105249_10153732 | |||
| 2111 | Ga0105249_10192154 | |||
| 2112 | Ga0105249_10237119 | |||
| 2113 | Ga0099796_10007483 | |||
| 2114 | Ga0105239_10046513 | |||
| 2115 | Ga0105239_10179760 | |||
| 2116 | Ga0105246_10002163 | |||
| 2117 | Ga0105246_10032227 | |||
| 2118 | Ga0105246_10141477 | |||
| 2119 | Ga0157319_1000008 | |||
| 2120 | Ga0157347_1000789 | |||
| 2121 | Ga0157373_10000081 | |||
| 2122 | Ga0157373_10008814 | |||
| 2123 | Ga0157373_10016114 | |||
| 2124 | Ga0157373_10018126 | |||
| 2125 | Ga0157373_10026235 | |||
| 2126 | Ga0157371_10001827 | |||
| 2127 | Ga0157371_10020896 | |||
| 2128 | Ga0157371_10065579 | |||
| 2129 | Ga0157371_10165541 | |||
| 2130 | Ga0157370_10027854 | |||
| 2131 | Ga0157370_10091315 | |||
| 2132 | Ga0157370_10227594 | |||
| 2133 | Ga0157369_10001065 | |||
| 2134 | Ga0157369_10002069 | |||
| 2135 | Ga0157369_10007564 | |||
| 2136 | Ga0157369_10083686 | |||
| 2137 | Ga0157369_10179640 | |||
| 2138 | Ga0157374_10042081 | |||
| 2139 | Ga0157374_10075672 | |||
| 2140 | Ga0157378_10001998 | |||
| 2141 | Ga0163162_10000314 | |||
| 2142 | Ga0163162_10016393 | |||
| 2143 | Ga0163162_10021214 | |||
| 2144 | Ga0163162_10030137 | |||
| 2145 | Ga0163162_10085712 | |||
| 2146 | Ga0163162_10119864 | |||
| 2147 | Ga0163162_10154753 | |||
| 2148 | Ga0163162_10168017 | |||
| 2149 | Ga0163162_10206137 | |||
| 2150 | Ga0157372_10001667 | |||
| 2151 | Ga0157372_10014005 | |||
| 2152 | Ga0157372_10133919 | |||
| 2153 | Ga0157372_10145265 | |||
| 2154 | Ga0157372_10152193 | |||
| 2155 | Ga0157372_10181148 | |||
| 2156 | Ga0157372_10246392 | |||
| 2157 | Ga0157372_10296465 | |||
| 2158 | Ga0157375_10010300 | |||
| 2159 | Ga0157375_10031315 | |||
| 2160 | Ga0157375_10061416 | |||
| 2161 | Ga0157375_10078372 | |||
| 2162 | Ga0157375_10154851 | |||
| 2163 | Ga0157375_10171662 | |||
| 2164 | Ga0157375_10296407 | |||
| 2165 | Ga0163163_10001639 | |||
| 2166 | Ga0163163_10063892 | |||
| 2167 | Ga0163163_10257800 | |||
| 2168 | Ga0163163_10382441 | |||
| 2169 | Ga0157380_10008262 | |||
| 2170 | Ga0157380_10022246 | |||
| 2171 | Ga0157380_10056722 | |||
| 2172 | Ga0182008_10004122 | |||
| 2173 | Ga0182008_10007102 | |||
| 2174 | Ga0182008_10009794 | |||
| 2175 | Ga0182008_10084240 | |||
| 2176 | Ga0157377_10000048 | |||
| 2177 | Ga0157379_10010467 | |||
| 2178 | Ga0157379_10030571 | |||
| 2179 | Ga0157379_10037678 | |||
| 2180 | Ga0157379_10050970 | |||
| 2181 | Ga0157379_10062117 | |||
| 2182 | Ga0157379_10104187 | |||
| 2183 | Ga0157379_10201015 | |||
| 2184 | Ga0157376_10001621 | |||
| 2185 | Ga0157376_10016439 | |||
| 2186 | Ga0157376_10036986 | |||
| 2187 | Ga0157376_10061988 | |||
| 2188 | Ga0157376_10063786 | |||
| 2189 | Ga0182006_1008526 | |||
| 2190 | Ga0182006_1014990 | |||
| 2191 | Ga0182006_1019059 | |||
| 2192 | Ga0182006_1046030 | |||
| 2193 | Ga0182007_10000642 | |||
| 2194 | Ga0182007_10003593 | |||
| 2195 | Ga0183362_10003 | |||
| 2196 | Ga0163161_10009943 | |||
| 2197 | Ga0163161_10033261 | |||
| 2198 | Ga0163161_10041651 | |||
| 2199 | Ga0163161_10063022 | |||
| 2200 | Ga0163161_10064942 | |||
| 2201 | Ga0163161_10094517 | |||
| 2202 | Ga0213872_10000093 | |||
| 2203 | Ga0213872_10000490 | |||
| 2204 | Ga0213872_10003115 | |||
| 2205 | Ga0213872_10005470 | |||
| 2206 | Ga0213872_10021144 | |||
| 2207 | Ga0209435_100002 | |||
| 2208 | Ga0209435_100018 | |||
| 2209 | Ga0209436_105519 | |||
| 2210 | Ga0209672_101322 | |||
| 2211 | Ga0209147_100051 | |||
| 2212 | Ga0209147_101675 | |||
| 2213 | Ga0209563_100013 | |||
| 2214 | Ga0209437_100136 | |||
| 2215 | Ga0209437_100145 | |||
| 2216 | Ga0209258_100154 | |||
| 2217 | Ga0209258_100760 | |||
| 2218 | Ga0207425_1000540 | |||
| 2219 | Ga0207425_1001617 | |||
| 2220 | Ga0207425_1002353 | |||
| 2221 | Ga0209646_1000001 | |||
| 2222 | Ga0209646_1000090 | |||
| 2223 | Ga0209026_1000001 | |||
| 2224 | Ga0209026_1000042 | |||
| 2225 | Ga0209148_1000145 | |||
| 2226 | Ga0209759_1000001 | |||
| 2227 | Ga0209759_1000933 | |||
| 2228 | Ga0209129_1000027 | |||
| 2229 | Ga0209129_1000054 | |||
| 2230 | Ga0209129_1002683 | |||
| 2231 | Ga0209129_1005664 | |||
| 2232 | Ga0209565_1000067 | |||
| 2233 | Ga0209565_1000092 | |||
| 2234 | Ga0209565_1000128 | |||
| 2235 | Ga0209565_1000648 | |||
| 2236 | Ga0209565_1000708 | |||
| 2237 | Ga0209565_1001327 | |||
| 2238 | Ga0209565_1002114 | |||
| 2239 | Ga0209455_1001361 | |||
| 2240 | Ga0209673_1000008 | |||
| 2241 | Ga0209673_1000097 | |||
| 2242 | Ga0209673_1000172 | |||
| 2243 | Ga0209673_1001430 | |||
| 2244 | Ga0209673_1006310 | |||
| 2245 | Ga0209673_1011746 | |||
| 2246 | Ga0209673_1017095 | |||
| 2247 | Ga0209130_1000072 | |||
| 2248 | Ga0209130_1000315 | |||
| 2249 | Ga0209130_1000954 | |||
| 2250 | Ga0209130_1001108 | |||
| 2251 | Ga0209130_1002024 | |||
| 2252 | Ga0209675_1000038 | |||
| 2253 | Ga0209675_1000221 | |||
| 2254 | Ga0209675_1000690 | |||
| 2255 | Ga0209675_1001507 | |||
| 2256 | Ga0209675_1003314 | |||
| 2257 | Ga0209675_1003374 | |||
| 2258 | Ga0209675_1004564 | |||
| 2259 | Ga0209675_1004790 | |||
| 2260 | Ga0209675_1006032 | |||
| 2261 | Ga0209675_1013233 | |||
| 2262 | Ga0209676_1000012 | |||
| 2263 | Ga0209676_1000023 | |||
| 2264 | Ga0209676_1000048 | |||
| 2265 | Ga0209676_1001679 | |||
| 2266 | Ga0209676_1007984 | |||
| 2267 | Ga0209025_1000026 | |||
| 2268 | Ga0209025_1000173 | |||
| 2269 | Ga0209025_1000174 | |||
| 2270 | Ga0209025_1001066 | |||
| 2271 | Ga0209025_1001606 | |||
| 2272 | Ga0209025_1001733 | |||
| 2273 | Ga0209025_1001987 | |||
| 2274 | Ga0209025_1002139 | |||
| 2275 | Ga0209025_1004985 | |||
| 2276 | Ga0209025_1005561 | |||
| 2277 | Ga0209025_1010865 | |||
| 2278 | Ga0209025_1020817 | |||
| 2279 | Ga0209025_1027510 | |||
| 2280 | Ga0209025_1030667 | |||
| 2281 | Ga0209025_1039297 | |||
| 2282 | Ga0209564_1000008 | |||
| 2283 | Ga0209564_1000139 | |||
| 2284 | Ga0209564_1000241 | |||
| 2285 | Ga0209564_1000435 | |||
| 2286 | Ga0209564_1000998 | |||
| 2287 | Ga0209564_1001515 | |||
| 2288 | Ga0209564_1002737 | |||
| 2289 | Ga0209564_1002822 | |||
| 2290 | Ga0209564_1003293 | |||
| 2291 | Ga0209564_1004319 | |||
| 2292 | Ga0209758_1000034 | |||
| 2293 | Ga0209758_1000052 | |||
| 2294 | Ga0209758_1000146 | |||
| 2295 | Ga0209758_1002271 | |||
| 2296 | Ga0209758_1004536 | |||
| 2297 | Ga0209050_1000012 | |||
| 2298 | Ga0209050_1000022 | |||
| 2299 | Ga0209050_1000165 | |||
| 2300 | Ga0209050_1000294 | |||
| 2301 | Ga0209050_1001032 | |||
| 2302 | Ga0209050_1002988 | |||
| 2303 | Ga0209050_1004806 | |||
| 2304 | Ga0209050_1008642 | |||
| 2305 | Ga0209050_1012744 | |||
| 2306 | Ga0209256_1000001 | |||
| 2307 | Ga0209256_1000103 | |||
| 2308 | Ga0209256_1000120 | |||
| 2309 | Ga0209256_1000165 | |||
| 2310 | Ga0209256_1000450 | |||
| 2311 | Ga0209256_1000912 | |||
| 2312 | Ga0209256_1001146 | |||
| 2313 | Ga0209256_1001845 | |||
| 2314 | Ga0209256_1023396 | |||
| 2315 | Ga0209256_1025211 | |||
| 2316 | Ga0207426_1000058 | |||
| 2317 | Ga0207426_1000067 | |||
| 2318 | Ga0207426_1000319 | |||
| 2319 | Ga0207426_1002937 | |||
| 2320 | Ga0209051_1000013 | |||
| 2321 | Ga0209051_1000018 | |||
| 2322 | Ga0209051_1000019 | |||
| 2323 | Ga0209051_1000235 | |||
| 2324 | Ga0209051_1000384 | |||
| 2325 | Ga0209051_1001398 | |||
| 2326 | Ga0209051_1002935 | |||
| 2327 | Ga0209051_1005813 | |||
| 2328 | Ga0209051_1007797 | |||
| 2329 | Ga0209257_1000021 | |||
| 2330 | Ga0209257_1000024 | |||
| 2331 | Ga0209257_1000042 | |||
| 2332 | Ga0209257_1000057 | |||
| 2333 | Ga0209257_1000096 | |||
| 2334 | Ga0209257_1000260 | |||
| 2335 | Ga0209257_1001206 | |||
| 2336 | Ga0209257_1010586 | |||
| 2337 | Ga0209257_1010643 | |||
| 2338 | Ga0207697_10016431 | |||
| 2339 | Ga0207656_10003460 | |||
| 2340 | Ga0207656_10006943 | |||
| 2341 | Ga0207696_1000557 | |||
| 2342 | Ga0207696_1003192 | |||
| 2343 | Ga0207696_1003996 | |||
| 2344 | Ga0207655_1000024 | |||
| 2345 | Ga0207655_1000639 | |||
| 2346 | Ga0207655_1000983 | |||
| 2347 | Ga0207655_1003550 | |||
| 2348 | Ga0207655_1030240 | |||
| 2349 | Ga0207713_1000043 | |||
| 2350 | Ga0207713_1008050 | |||
| 2351 | Ga0207713_1027146 | |||
| 2352 | Ga0207713_1042393 | |||
| 2353 | Ga0207682_10011302 | |||
| 2354 | Ga0207682_10015452 | |||
| 2355 | Ga0207682_10030730 | |||
| 2356 | Ga0207642_10052396 | |||
| 2357 | Ga0207688_10015371 | |||
| 2358 | Ga0207680_10001495 | |||
| 2359 | Ga0207699_10026650 | |||
| 2360 | Ga0207699_10067168 | |||
| 2361 | Ga0207645_10007473 | |||
| 2362 | Ga0207645_10052992 | |||
| 2363 | Ga0207645_10056229 | |||
| 2364 | Ga0207645_10129688 | |||
| 2365 | Ga0207645_10148073 | |||
| 2366 | Ga0207643_10027110 | |||
| 2367 | Ga0207643_10076978 | |||
| 2368 | Ga0207705_10008509 | |||
| 2369 | Ga0207705_10032151 | |||
| 2370 | Ga0207705_10060329 | |||
| 2371 | Ga0207684_10002070 | |||
| 2372 | Ga0207684_10031033 | |||
| 2373 | Ga0207654_10028201 | |||
| 2374 | Ga0207654_10036040 | |||
| 2375 | Ga0207654_10051850 | |||
| 2376 | Ga0207654_10141122 | |||
| 2377 | Ga0207707_10010626 | |||
| 2378 | Ga0207707_10016028 | |||
| 2379 | Ga0207707_10026595 | |||
| 2380 | Ga0207707_10040244 | |||
| 2381 | Ga0207695_10005351 | |||
| 2382 | Ga0207695_10023926 | |||
| 2383 | Ga0207695_10109358 | |||
| 2384 | Ga0207695_10261501 | |||
| 2385 | Ga0207671_10017114 | |||
| 2386 | Ga0207671_10032445 | |||
| 2387 | Ga0207693_10004206 | |||
| 2388 | Ga0207693_10024167 | |||
| 2389 | Ga0207660_10023901 | |||
| 2390 | Ga0207660_10061869 | |||
| 2391 | Ga0207660_10083826 | |||
| 2392 | Ga0207660_10123348 | |||
| 2393 | Ga0207660_10215822 | |||
| 2394 | Ga0207662_10061126 | |||
| 2395 | Ga0207657_10000447 | |||
| 2396 | Ga0207657_10003605 | |||
| 2397 | Ga0207657_10004258 | |||
| 2398 | Ga0207657_10027949 | |||
| 2399 | Ga0207649_10029633 | |||
| 2400 | Ga0207649_10051595 | |||
| 2401 | Ga0207649_10091531 | |||
| 2402 | Ga0207649_10111273 | |||
| 2403 | Ga0207652_10012394 | |||
| 2404 | Ga0207652_10015269 | |||
| 2405 | Ga0207652_10212603 | |||
| 2406 | Ga0207646_10002045 | |||
| 2407 | Ga0207646_10030455 | |||
| 2408 | Ga0207646_10083481 | |||
| 2409 | Ga0207646_10090569 | |||
| 2410 | Ga0207681_10043137 | |||
| 2411 | Ga0207681_10058220 | |||
| 2412 | Ga0207681_10063816 | |||
| 2413 | Ga0207681_10075638 | |||
| 2414 | Ga0207681_10081392 | |||
| 2415 | Ga0207681_10118513 | |||
| 2416 | Ga0207694_10017482 | |||
| 2417 | Ga0207694_10056941 | |||
| 2418 | Ga0207694_10079876 | |||
| 2419 | Ga0207650_10003707 | |||
| 2420 | Ga0207650_10014826 | |||
| 2421 | Ga0207650_10056430 | |||
| 2422 | Ga0207650_10096580 | |||
| 2423 | Ga0207650_10138665 | |||
| 2424 | Ga0207650_10225635 | |||
| 2425 | Ga0207659_10002055 | |||
| 2426 | Ga0207659_10002947 | |||
| 2427 | Ga0207659_10003098 | |||
| 2428 | Ga0207659_10058394 | |||
| 2429 | Ga0207687_10209821 | |||
| 2430 | Ga0207687_10213026 | |||
| 2431 | Ga0207700_10022967 | |||
| 2432 | Ga0207700_10032950 | |||
| 2433 | Ga0207700_10040172 | |||
| 2434 | Ga0207700_10139194 | |||
| 2435 | Ga0207700_10195604 | |||
| 2436 | Ga0207664_10050500 | |||
| 2437 | Ga0207664_10081866 | |||
| 2438 | Ga0207664_10090116 | |||
| 2439 | Ga0207644_10000130 | |||
| 2440 | Ga0207644_10002085 | |||
| 2441 | Ga0207644_10022846 | |||
| 2442 | Ga0207644_10067704 | |||
| 2443 | Ga0207644_10165726 | |||
| 2444 | Ga0207690_10003996 | |||
| 2445 | Ga0207690_10013485 | |||
| 2446 | Ga0207690_10037637 | |||
| 2447 | Ga0207690_10064410 | |||
| 2448 | Ga0207706_10000156 | |||
| 2449 | Ga0207706_10016017 | |||
| 2450 | Ga0207706_10025996 | |||
| 2451 | Ga0207706_10036971 | |||
| 2452 | Ga0207706_10054917 | |||
| 2453 | Ga0207706_10070546 | |||
| 2454 | Ga0207686_10011790 | |||
| 2455 | Ga0207686_10128851 | |||
| 2456 | Ga0207709_10000111 | |||
| 2457 | Ga0207709_10044565 | |||
| 2458 | Ga0207670_10004647 | |||
| 2459 | Ga0207670_10167009 | |||
| 2460 | Ga0207704_10010368 | |||
| 2461 | Ga0207704_10034820 | |||
| 2462 | Ga0207665_10002266 | |||
| 2463 | Ga0207691_10003386 | |||
| 2464 | Ga0207691_10010432 | |||
| 2465 | Ga0207691_10011577 | |||
| 2466 | Ga0207691_10019285 | |||
| 2467 | Ga0207691_10022541 | |||
| 2468 | Ga0207691_10032593 | |||
| 2469 | Ga0207691_10053626 | |||
| 2470 | Ga0207691_10057599 | |||
| 2471 | Ga0207711_10020362 | |||
| 2472 | Ga0207711_10021326 | |||
| 2473 | Ga0207711_10035493 | |||
| 2474 | Ga0207711_10053726 | |||
| 2475 | Ga0207711_10165679 | |||
| 2476 | Ga0207711_10174904 | |||
| 2477 | Ga0207689_10001818 | |||
| 2478 | Ga0207689_10015442 | |||
| 2479 | Ga0207661_10086402 | |||
| 2480 | Ga0207679_10007093 | |||
| 2481 | Ga0207679_10012131 | |||
| 2482 | Ga0207679_10033943 | |||
| 2483 | Ga0207679_10037700 | |||
| 2484 | Ga0207679_10147866 | |||
| 2485 | Ga0207667_10006776 | |||
| 2486 | Ga0207667_10010777 | |||
| 2487 | Ga0207667_10016009 | |||
| 2488 | Ga0207667_10019277 | |||
| 2489 | Ga0207667_10024536 | |||
| 2490 | Ga0207667_10110330 | |||
| 2491 | Ga0207667_10203748 | |||
| 2492 | Ga0207651_10001665 | |||
| 2493 | Ga0207651_10003976 | |||
| 2494 | Ga0207651_10005715 | |||
| 2495 | Ga0207651_10005940 | |||
| 2496 | Ga0207712_10008399 | |||
| 2497 | Ga0207712_10070498 | |||
| 2498 | Ga0207712_10206932 | |||
| 2499 | Ga0207668_10015585 | |||
| 2500 | Ga0207668_10084585 | |||
| 2501 | Ga0207668_10107123 | |||
| 2502 | Ga0207668_10134384 | |||
| 2503 | Ga0207668_10240887 | |||
| 2504 | Ga0207640_10037866 | |||
| 2505 | Ga0207640_10075079 | |||
| 2506 | Ga0207640_10101284 | |||
| 2507 | Ga0207658_10004458 | |||
| 2508 | Ga0207658_10004645 | |||
| 2509 | Ga0207658_10050936 | |||
| 2510 | Ga0207658_10083767 | |||
| 2511 | Ga0207677_10007151 | |||
| 2512 | Ga0207677_10018191 | |||
| 2513 | Ga0207677_10033477 | |||
| 2514 | Ga0207677_10040300 | |||
| 2515 | Ga0207677_10173075 | |||
| 2516 | Ga0207703_10002546 | |||
| 2517 | Ga0207703_10009968 | |||
| 2518 | Ga0207703_10012912 | |||
| 2519 | Ga0207703_10016647 | |||
| 2520 | Ga0207703_10042121 | |||
| 2521 | Ga0207703_10092086 | |||
| 2522 | Ga0207639_10013143 | |||
| 2523 | Ga0207639_10013776 | |||
| 2524 | Ga0207639_10059696 | |||
| 2525 | Ga0207639_10076160 | |||
| 2526 | Ga0207639_10126648 | |||
| 2527 | Ga0207639_10131754 | |||
| 2528 | Ga0207678_10030122 | |||
| 2529 | Ga0207678_10043272 | |||
| 2530 | Ga0207678_10050007 | |||
| 2531 | Ga0207678_10083673 | |||
| 2532 | Ga0207678_10149880 | |||
| 2533 | Ga0207678_10157414 | |||
| 2534 | Ga0207708_10001026 | |||
| 2535 | Ga0207708_10021822 | |||
| 2536 | Ga0207708_10092172 | |||
| 2537 | Ga0207708_10153052 | |||
| 2538 | Ga0207702_10002083 | |||
| 2539 | Ga0207702_10075064 | |||
| 2540 | Ga0207702_10133219 | |||
| 2541 | Ga0207641_10016950 | |||
| 2542 | Ga0207641_10032784 | |||
| 2543 | Ga0207641_10037962 | |||
| 2544 | Ga0207641_10091037 | |||
| 2545 | Ga0207641_10235396 | |||
| 2546 | Ga0207648_10000179 | |||
| 2547 | Ga0207648_10001876 | |||
| 2548 | Ga0207648_10002319 | |||
| 2549 | Ga0207648_10006478 | |||
| 2550 | Ga0207648_10006871 | |||
| 2551 | Ga0207648_10015767 | |||
| 2552 | Ga0207648_10021732 | |||
| 2553 | Ga0207648_10025102 | |||
| 2554 | Ga0207648_10047779 | |||
| 2555 | Ga0207648_10050843 | |||
| 2556 | Ga0207648_10057806 | |||
| 2557 | Ga0207648_10082099 | |||
| 2558 | Ga0207676_10001487 | |||
| 2559 | Ga0207676_10008447 | |||
| 2560 | Ga0207676_10009407 | |||
| 2561 | Ga0207676_10014048 | |||
| 2562 | Ga0207674_10004569 | |||
| 2563 | Ga0207674_10013444 | |||
| 2564 | Ga0207674_10041207 | |||
| 2565 | Ga0207674_10137304 | |||
| 2566 | Ga0207674_10188323 | |||
| 2567 | Ga0207675_100000704 | |||
| 2568 | Ga0207675_100001602 | |||
| 2569 | Ga0207675_100021533 | |||
| 2570 | Ga0207675_100022891 | |||
| 2571 | Ga0207675_100044251 | |||
| 2572 | Ga0207675_100046449 | |||
| 2573 | Ga0207675_100110243 | |||
| 2574 | Ga0207675_100129843 | |||
| 2575 | Ga0207675_100222980 | |||
| 2576 | Ga0207683_10013324 | |||
| 2577 | Ga0207683_10024002 | |||
| 2578 | Ga0207683_10026397 | |||
| 2579 | Ga0207683_10060473 | |||
| 2580 | Ga0207683_10079558 | |||
| 2581 | Ga0207683_10096370 | |||
| 2582 | Ga0207698_10001892 | |||
| 2583 | Ga0207698_10004332 | |||
| 2584 | Ga0207698_10020098 | |||
| 2585 | Ga0207698_10064780 | |||
| 2586 | Ga0207698_10065155 | |||
| 2587 | Ga0207698_10151001 | |||
| 2588 | Ga0209281_1000007 | |||
| 2589 | Ga0209281_1000455 | |||
| 2590 | Ga0209389_1000249 | |||
| 2591 | Ga0209371_1000061 | |||
| 2592 | Ga0209371_1000082 | |||
| 2593 | Ga0209371_1000119 | |||
| 2594 | Ga0209371_1000230 | |||
| 2595 | Ga0209371_1001086 | |||
| 2596 | Ga0209371_1001324 | |||
| 2597 | Ga0209371_1002070 | |||
| 2598 | Ga0210000_1002971 | |||
| 2599 | Ga0209999_1000743 | |||
| 2600 | Ga0209970_1000108 | |||
| 2601 | Ga0209983_1009217 | |||
| 2602 | Ga0209282_1000053 | |||
| 2603 | Ga0209282_1000250 | |||
| 2604 | Ga0209588_1004210 | |||
| 2605 | Ga0209971_1001384 | |||
| 2606 | Ga0209966_1006236 | |||
| 2607 | Ga0209974_10006556 | |||
| 2608 | Ga0209974_10006964 | |||
| 2609 | Ga0209974_10029859 | |||
| 2610 | Ga0207428_10003201 | |||
| 2611 | Ga0268266_10059218 | |||
| 2612 | Ga0268266_10095949 | |||
| 2613 | Ga0268266_10304796 | |||
| 2614 | Ga0268265_10004089 | |||
| 2615 | Ga0268265_10013992 | |||
| 2616 | Ga0268265_10076950 | |||
| 2617 | Ga0268265_10246391 | |||
| 2618 | Ga0268264_10000613 | |||
| 2619 | Ga0268264_10037899 | |||
| 2620 | Ga0268264_10073697 | |||
| 2621 | Ga0268264_10248016 | |||
| 2622 | Ga0268264_10271995 | |||
| 2623 | Ga0307517_10001395 | |||
| 2624 | Ga0307515_10000011 | |||
| 2625 | Ga0307515_10000213 | |||
| 2626 | Ga0307515_10000472 | |||
| 2627 | Ga0307515_10000655 | |||
| 2628 | Ga0307515_10003487 | |||
| 2629 | Ga0307515_10009632 | |||
| 2630 | Ga0307515_10048317 | |||
| 2631 | Ga0307515_10069340 | |||
| 2632 | Ga0307515_10201563 | |||
| 2633 | Ga0268256_1000059 | |||
| 2634 | Ga0268256_1000072 | |||
| 2635 | Ga0268256_1000096 | |||
| 2636 | Ga0268256_1001132 | |||
| 2637 | Ga0268256_1004087 | |||
| 2638 | Ga0268256_1009796 | |||
| 2639 | Ga0307511_10000043 | |||
| 2640 | Ga0316183_1035885 | |||
| 2641 | Ga0316182_1411781 | |||
| 2642 | Ga0265330_10000046 | |||
| 2643 | Ga0265332_10000028 | |||
| 2644 | Ga0265332_10000125 | |||
| 2645 | Ga0265332_10000951 | |||
| 2646 | Ga0265328_10003818 | |||
| 2647 | Ga0265328_10022676 | |||
| 2648 | Ga0265331_10001806 | |||
| 2649 | Ga0265327_10000012 | |||
| 2650 | Ga0265327_10001288 | |||
| 2651 | Ga0265327_10010084 | |||
| 2652 | Ga0265327_10011638 | |||
| 2653 | Ga0265327_10022614 | |||
| 2654 | Ga0265327_10034279 | |||
| 2655 | Ga0265316_10053940 | |||
| 2656 | Ga0265316_10224581 | |||
| 2657 | Ga0307513_10000117 | |||
| 2658 | Ga0307513_10002745 | |||
| 2659 | Ga0307513_10003270 | |||
| 2660 | Ga0307513_10008037 | |||
| 2661 | Ga0307513_10203007 | |||
| 2662 | Ga0307509_10003946 | |||
| 2663 | Ga0307509_10005133 | |||
| 2664 | Ga0307509_10046715 | |||
| 2665 | Ga0307509_10072791 | |||
| 2666 | Ga0307509_10113339 | |||
| 2667 | Ga0307408_100000023 | |||
| 2668 | Ga0307408_100000101 | |||
| 2669 | Ga0307408_100001843 | |||
| 2670 | Ga0307408_100004804 | |||
| 2671 | Ga0307408_100006023 | |||
| 2672 | Ga0307408_100016090 | |||
| 2673 | Ga0307408_100055479 | |||
| 2674 | Ga0307408_100085525 | |||
| 2675 | Ga0307508_10000404 | |||
| 2676 | Ga0307508_10003052 | |||
| 2677 | Ga0307514_10012483 | |||
| 2678 | Ga0307514_10089293 | |||
| 2679 | Ga0316575_10006695 | |||
| 2680 | Ga0316579_10000811 | |||
| 2681 | Ga0316579_10001459 | |||
| 2682 | Ga0265314_10000054 | |||
| 2683 | Ga0265314_10001039 | |||
| 2684 | Ga0316576_10009121 | |||
| 2685 | Ga0316576_10011214 | |||
| 2686 | Ga0316578_10035796 | |||
| 2687 | Ga0307516_10001586 | |||
| 2688 | Ga0307516_10002443 | |||
| 2689 | Ga0307516_10002741 | |||
| 2690 | Ga0307516_10020817 | |||
| 2691 | Ga0307405_10012732 | |||
| 2692 | Ga0307405_10055945 | |||
| 2693 | Ga0307405_10071978 | |||
| 2694 | Ga0307413_10001940 | |||
| 2695 | Ga0307410_10002072 | |||
| 2696 | Ga0307410_10009283 | |||
| 2697 | Ga0307410_10022186 | |||
| 2698 | Ga0307406_10005067 | |||
| 2699 | Ga0307406_10006267 | |||
| 2700 | Ga0307406_10006712 | |||
| 2701 | Ga0307406_10017326 | |||
| 2702 | Ga0307406_10042617 | |||
| 2703 | Ga0307406_10087961 | |||
| 2704 | Ga0307407_10113724 | |||
| 2705 | Ga0307412_10003320 | |||
| 2706 | Ga0307409_100009728 | |||
| 2707 | Ga0307409_100042544 | |||
| 2708 | Ga0307409_100142685 | |||
| 2709 | Ga0307409_100162078 | |||
| 2710 | Ga0307409_100213215 | |||
| 2711 | Ga0307409_100263934 | |||
| 2712 | Ga0307416_100006880 | |||
| 2713 | Ga0307416_100016563 | |||
| 2714 | Ga0307416_100175287 | |||
| 2715 | Ga0307416_100196800 | |||
| 2716 | Ga0307414_10066022 | |||
| 2717 | Ga0307414_10134074 | |||
| 2718 | Ga0307414_10180484 | |||
| 2719 | Ga0307411_10002409 | |||
| 2720 | Ga0307411_10008303 | |||
| 2721 | Ga0307411_10034617 | |||
| 2722 | Ga0307415_100003806 | |||
| 2723 | Ga0316593_10023515 | |||
| 2724 | Ga0307507_10075769 | |||
| 2725 | Ga0307507_10111544 | |||
| 2726 | Ga0307510_10035314 | |||
| 2727 | Ga0307510_10045636 | |||
| 2728 | Ga0316588_1003205 | |||
| 2729 | Ga0316596_1019472 | |||
| 2730 | Ga0373926_0029136 | |||
| 2731 | Ga0373932_0011766 | |||
| 2732 | Ga0373943_0035289 | |||
| 2733 | Ga0373955_0007829 | |||
| 2734 | Ga0316574_0000070 | |||
| 2735 | Ga0316574_0004300 | |||
| 2736 | Ga0373931_0010378 | |||
| 2737 | Ga0373931_0017241 | |||
| 2738 | Ga0373935_0067325 | |||
| 2739 | Ga0373927_0001348 | |||
| 2740 | Ga0373927_0031512 | |||
| 2741 | Ga0373927_0042538 | |||
| 2742 | Ga0373947_0054512 | |||
| 2743 | Ga0373947_0085900 | |||
| 2744 | Ga0373937_0004911 | |||
| 2745 | Ga0373937_0010376 | |||
| 2746 | Ga0373937_0012886 | |||
| 2747 | Ga0373937_0093628 | |||
| 2748 | Ga0373937_0121982 | |||
| 2749 | Ga0316582_0090752 | |||
| 2750 | Ga0316584_0182065 | |||
| 2751 | Ga0373925_0081460 | |||
| 2752 | Ga0373925_0082078 | |||
| 2753 | Ga0373925_0164082 | |||
| 2754 | Ga0395899_0000080 | |||
| 2755 | Ga0395899_0001691 | |||
| 2756 | Ga0395899_0004014 | |||
| 2757 | Ga0395899_0008709 | |||
| 2758 | Ga0395899_0019141 | |||
| 2759 | Ga0395899_0024423 | |||
| 2760 | Ga0395899_0096300 | |||
| 2761 | Ga0395899_0098267 | |||
| 2762 | Ga0395899_0102772 | |||
| 2763 | Ga0395900_0008285 | |||
| 2764 | Ga0395900_0009158 | |||
| 2765 | Ga0395900_0015158 | |||
| 2766 | Ga0395900_0026870 | |||
| 2767 | Ga0395900_0074221 | |||
| 2768 | Ga0395900_0084101 | |||
| 2769 | Ga0395898_0066398 | |||
| 2770 | Ga0395898_0072998 | |||
| 2771 | Ga0395898_0133020 | |||
| 2772 | Ga0395905_0000043 | |||
| 2773 | Ga0395905_0001875 | |||
| 2774 | Ga0395905_0007970 | |||
| 2775 | Ga0395905_0010328 | |||
| 2776 | Ga0395905_0018407 | |||
| 2777 | Ga0395905_0022866 | |||
| 2778 | Ga0395905_0034452 | |||
| 2779 | Ga0395905_0038287 | |||
| 2780 | Ga0395905_0082764 | |||
| 2781 | Ga0395905_0101488 | |||
| 2782 | Ga0395905_0202737 | |||
| 2783 | Ga0395905_0249584 | |||
| 2784 | Ga0395901_0013302 | |||
| 2785 | Ga0395901_0022794 | |||
| 2786 | Ga0395901_0022795 | |||
| 2787 | Ga0395901_0036328 | |||
| 2788 | Ga0395901_0055485 | |||
| 2789 | Ga0395901_0097568 | |||
| 2790 | Ga0395901_0115496 | |||
| 2791 | Ga0395901_0121820 | |||
| 2792 | Ga0395901_0190642 | |||
| 2793 | Ga0395901_0213305 | |||
| 2794 | Ga0395901_0324211 | |||
| 2795 | Ga0436365_0450647 | |||
| 2796 | Ga0436365_1569295 | |||
| 2797 | Ga0436360_0038189 | |||
| 2798 | Ga0436361_0101461 | |||
| 2799 | Ga0436361_0289802 | |||
| 2800 | Ga0436361_0487065 | |||
| 2801 | Ga0436361_0523658 | |||
| 2802 | Ga0436362_0477984 | |||
| 2803 | Ga0439436_0004746 | |||
| 2804 | Ga0439436_0004770 | |||
| 2805 | Ga0439436_0010792 | |||
| 2806 | Ga0439447_001550 | |||
| 2807 | Ga0439466_0000011 | |||
| 2808 | Ga0439466_0020815 | |||
| 2809 | Ga0439465_0004682 | |||
| 2810 | Ga0451853_2018397 | |||
| 2811 | Ga0439431_0002356 | |||
| 2812 | Ga0439431_0021691 | |||
| 2813 | Ga0439433_0006012 | |||
| 2814 | Ga0439437_001073 | |||
| 2815 | Ga0439442_006447 | |||
| 2816 | Ga0439445_0001102 | |||
| 2817 | Ga0439432_002129 | |||
| 2818 | Ga0439449_0000187 | |||
| 2819 | Ga0439449_0000620 | |||
| 2820 | Ga0439449_0001584 | |||
| 2821 | Ga0439452_002955 | |||
| 2822 | Ga0439452_004200 | |||
| 2823 | Ga0439456_007254 | |||
| 2824 | Ga0439462_0002391 | |||
| 2825 | Ga0450911_000281 | |||
| 2826 | Ga0450890_002116 | |||
| 2827 | Ga0450889_000109 | |||
| 2828 | Ga0450906_008422 | |||
| 2829 | Ga0450907_000007 | |||
| 2830 | Ga0450910_002890 | |||
| 2831 | Ga0439446_0002089 | |||
| 2832 | Ga0439446_0002260 | |||
| 2833 | Ga0439446_0011612 | |||
| 2834 | Ga0439434_0001503 | |||
| 2835 | Ga0439434_0007932 | |||
| 2836 | Ga0439434_0010725 | |||
| 2837 | Ga0439435_0000773 | |||
| 2838 | Ga0439435_0023924 | |||
| 2839 | Ga0439464_0012317 | |||
| 2840 | Ga0450918_000158 | |||
| 2841 | Ga0450893_0001452 | |||
| 2842 | Ga0451577_0000276 | |||
| 2843 | Ga0451577_0001377 | |||
| 2844 | Ga0451577_0037888 | |||
| 2845 | Ga0451577_0065997 | |||
| 2846 | Ga0451577_0096803 | |||
| 2847 | Ga0451577_0109094 | |||
| 2848 | Ga0451577_0135954 | |||
| 2849 | Ga0466969_0004750 | |||
| 2850 | Ga0466969_0006748 | |||
| 2851 | Ga0466972_0008433 | |||
| 2852 | Ga0453683_0007502 | |||
| 2853 | Ga0453683_0018762 | |||
| 2854 | Ga0466965_0006837 | |||
| 2855 | Ga0466965_0063016 | |||
| 2856 | Ga0466966_0020148 | |||
| 2857 | Ga0466961_0014008 | |||
| 2858 | Ga0466961_0069024 | |||
| 2859 | Ga0466961_0089172 | |||
| 2860 | Ga0453684_0000891 | |||
| 2861 | Ga0453684_0001215 | |||
| 2862 | Ga0453684_0063372 | |||
| 2863 | Ga0453684_0074838 | |||
| 2864 | Ga0453684_0275004 | |||
| 2865 | Ga0453684_0279876 | |||
| 2866 | Ga0466971_0030247 | |||
| 2867 | Ga0466957_0055469 | |||
| 2868 | Ga0466959_0126070 | |||
| 2869 | Ga0451576_0000381 | |||
| 2870 | Ga0451576_0001248 | |||
| 2871 | Ga0451576_0004449 | |||
| 2872 | Ga0451576_0023570 | |||
| 2873 | Ga0451576_0025162 | |||
| 2874 | Ga0451576_0037463 | |||
| 2875 | Ga0451576_0073694 | |||
| 2876 | Ga0451576_0075018 | |||
| 2877 | Ga0451576_0095370 | |||
| 2878 | Ga0451576_0102208 | |||
| 2879 | Ga0451576_0108446 | |||
| 2880 | Ga0451576_0112207 | |||
| 2881 | Ga0451576_0137068 | |||
| 2882 | Ga0451576_0246475 | |||
| 2883 | Ga0466958_0005009 | |||
| 2884 | Ga0466967_0168927 | |||
| 2885 | Ga0466967_0184275 | |||
| 2886 | Ga0495617_006149 | |||
| 2887 | Ga0495627_006447 | |||
| 2888 | Ga0495592_0000083 | |||
| 2889 | Ga0495590_0004124 | |||
| 2890 | Ga0495591_000010 | |||
| 2891 | Ga0495591_001545 | |||
| 2892 | Ga0495591_016234 | |||
| 2893 | Ga0495653_0075170 | |||
| 2894 | Ga0495650_0000034 | |||
| 2895 | Ga0495650_0013823 | |||
| 2896 | Ga0495580_0012135 | |||
| 2897 | Ga0495605_0002892 | |||
| 2898 | Ga0495639_0010783 | |||
| 2899 | Ga0495639_0014230 | |||
| 2900 | Ga0495664_0057886 | |||
| 2901 | Ga0495596_0003191 | |||
| 2902 | Ga0495596_0003690 | |||
| 2903 | Ga0495607_0002446 | |||
| 2904 | Ga0495607_0025190 | |||
| 2905 | Ga0495606_0000511 | |||
| 2906 | Ga0495608_0015861 | |||
| 2907 | Ga0495610_0002147 | |||
| 2908 | Ga0495610_0008257 | |||
| 2909 | Ga0495616_0003177 | |||
| 2910 | Ga0495616_0003776 | |||
| 2911 | Ga0495620_0010395 | |||
| 2912 | Ga0495631_0075004 | |||
| 2913 | Ga0495632_0006527 | |||
| 2914 | Ga0495632_0034565 | |||
| 2915 | Ga0495632_0047082 | |||
| 2916 | Ga0495643_0019675 | |||
| 2917 | Ga0495643_0033289 | |||
| 2918 | Ga0495644_0054049 | |||
| 2919 | Ga0495648_0041629 | |||
| 2920 | Ga0495648_0060928 | |||
| 2921 | Ga0495642_0031685 | |||
| 2922 | Ga0495652_0048893 | |||
| 2923 | Ga0495654_0000151 | |||
| 2924 | Ga0495654_0005248 | |||
| 2925 | Ga0495654_0005475 | |||
| 2926 | Ga0495654_0045127 | |||
| 2927 | Ga0495665_0010247 | |||
| 2928 | Ga0495587_0007225 | |||
| 2929 | Ga0495598_0017969 | |||
| 2930 | Ga0495597_0001315 | |||
| 2931 | Ga0495597_0066425 | |||
| 2932 | Ga0495645_0012915 | |||
| 2933 | Ga0495645_0148003 | |||
| 2934 | Ga0495667_0005954 | |||
| 2935 | Ga0495656_0000090 | |||
| 2936 | Ga0495656_0019103 | |||
| 2937 | Ga0495625_0001055 | |||
| 2938 | Ga0495625_0025375 | |||
| 2939 | Ga0495635_0016210 | |||
| 2940 | Ga0495635_0029296 | |||
| 2941 | Ga0495599_0003944 | |||
| 2942 | Ga0495623_0002115 | |||
| 2943 | Ga0495647_0007199 | |||
| 2944 | Ga0495658_0039464 | |||
| 2945 | Ga0495669_0006300 | |||
| 2946 | Ga0495669_0060059 | |||
| 2947 | Ga0495613_0122850 | |||
| 2948 | Ga0495671_0000586 | |||
| 2949 | Ga0495649_0002049 | |||
| 2950 | Ga0495649_0030910 | |||
| 2951 | Ga0495660_0000020 | |||
| 2952 | Ga0495660_0022000 | |||
| 2953 | Ga0495660_0131274 | |||
| 2954 | Ga0495581_0046287 | |||
| 2955 | Ga0495672_0000011 | |||
| 2956 | Ga0495672_0000040 | |||
| 2957 | Ga0495676_0022957 | |||
| 2958 | Ga0495680_0119611 | |||
| 2959 | Ga0495683_0035539 | |||
| 2960 | Ga0495687_001485 | |||
| 2961 | Ga0495677_0020104 | |||
| 2962 | Ga0495679_002610 | |||
| 2963 | Ga0495685_052242 | |||
| 2964 | Ga0495673_0000020 | |||
| 2965 | Ga0495684_0138161 | |||
| 2966 | Ga0495593_0023748 | |||
| 2967 | Ga0495614_0026926 | |||
| 2968 | Ga0496100_0089285 | |||
| 2969 | Ga0496100_0115867 | |||
| 2970 | Ga0496101_0000053 | |||
| 2971 | Ga0496101_0041259 | |||
| 2972 | Ga0496102_0003600 | |||
| 2973 | Ga0496102_0060046 | |||
| 2974 | Ga0496102_0082257 | |||
| 2975 | Ga0496102_0085748 | |||
| 2976 | Ga0496104_0006891 | |||
| 2977 | Ga0496105_0003958 | |||
| 2978 | Ga0496105_0010709 | |||
| 2979 | Ga0496105_0079874 | |||
| 2980 | Ga0496106_0032806 | |||
| 2981 | Ga0496107_0037525 | |||
| 2982 | Ga0496107_0137712 | |||
| 2983 | Ga0496107_0162446 | |||
| 2984 | Ga0496108_0275988 | |||
| 2985 | Ga0496109_0118029 | |||
| 2986 | Ga0496110_0008002 | |||
| 2987 | Ga0496110_0167068 | |||
| 2988 | Ga0496110_0176348 | |||
| 2989 | Ga0496110_0219326 | |||
| 2990 | Ga0496112_0081588 | |||
| 2991 | Ga0496113_0036962 | |||
| 2992 | Ga0496114_0083481 | |||
| 2993 | Ga0496114_0084255 | |||
| 2994 | Ga0496115_0027385 | |||
| 2995 | Ga0496116_0000129 | |||
| 2996 | Ga0496116_0000734 | |||
| 2997 | Ga0496116_0006777 | |||
| 2998 | Ga0496116_0009524 | |||
| 2999 | Ga0496116_0044616 | |||
| 3000 | Ga0496116_0053637 | |||
| 3001 | Ga0496117_0000092 | |||
| 3002 | Ga0496117_0000224 | |||
| 3003 | Ga0496117_0011620 | |||
| 3004 | Ga0496117_0015917 | |||
| 3005 | Ga0496117_0074534 | |||
| 3006 | Ga0496118_0000053 | |||
| 3007 | Ga0496118_0000718 | |||
| 3008 | Ga0496118_0006660 | |||
| 3009 | Ga0496118_0041408 | |||
| 3010 | Ga0496119_0000285 | |||
| 3011 | Ga0496119_0000555 | |||
| 3012 | Ga0496119_0002224 | |||
| 3013 | Ga0496119_0005370 | |||
| 3014 | Ga0496119_0067533 | |||
| 3015 | Ga0496120_0000024 | |||
| 3016 | Ga0496120_0000178 | |||
| 3017 | Ga0496120_0000388 | |||
| 3018 | Ga0496120_0000548 | |||
| 3019 | Ga0496120_0001587 | |||
| 3020 | Ga0496121_0000304 | |||
| 3021 | Ga0496121_0005682 | |||
| 3022 | Ga0496121_0027348 | |||
| 3023 | Ga0496121_0029597 | |||
| 3024 | Ga0496122_0001889 | |||
| 3025 | Ga0496122_0009582 | |||
| 3026 | Ga0496122_0010689 | |||
| 3027 | Ga0496123_0001035 | |||
| 3028 | Ga0496123_0002189 | |||
| 3029 | Ga0496123_0003349 | |||
| 3030 | Ga0496123_0019217 | |||
| 3031 | Ga0496123_0027207 | |||
| 3032 | Ga0496124_0000251 | |||
| 3033 | Ga0496124_0001528 | |||
| 3034 | Ga0496124_0026597 | |||
| 3035 | Ga0496124_0059353 | |||
| 3036 | Ga0496124_0064591 | |||
| 3037 | Ga0496124_0081532 | |||
| 3038 | Ga0496125_0001627 | |||
| 3039 | Ga0496125_0007136 | |||
| 3040 | Ga0496125_0037381 | |||
| 3041 | Ga0496125_0041178 | |||
| 3042 | Ga0496125_0067848 | |||
| 3043 | Ga0495678_002665 | |||
| 3044 | Ga0495682_0000022 | |||
| 3045 | Ga0501291_006589 | |||
| 3046 | Ga0501298_010776 | |||
| 3047 | Ga0501298_018127 | |||
| 3048 | Ga0501303_001929 | |||
| 3049 | Ga0501034_0074934 | |||
| 3050 | Ga0501036_0024340 | |||
| 3051 | Ga0501036_0055815 | |||
| 3052 | Ga0501039_0005064 | |||
| 3053 | Ga0501039_0130938 | |||
| 3054 | Ga0501040_0018020 | |||
| 3055 | Ga0501041_0051976 | |||
| 3056 | Ga0501041_0064562 | |||
| 3057 | Ga0501042_0025236 | |||
| 3058 | Ga0501042_0101347 | |||
| 3059 | Ga0501042_0171251 | |||
| 3060 | Ga0501043_0000057 | |||
| 3061 | Ga0501046_0000075 | |||
| 3062 | Ga0501046_0011964 | |||
| 3063 | Ga0501047_0000081 | |||
| 3064 | Ga0501047_0127977 | |||
| 3065 | Ga0501048_0003517 | |||
| 3066 | Ga0501048_0034983 | |||
| 3067 | Ga0501069_0002412 | |||
| 3068 | Ga0501070_0002316 | |||
| 3069 | Ga0501070_0089982 | |||
| 3070 | Ga0501070_0099387 | |||
| 3071 | Ga0501071_0091465 | |||
| 3072 | Ga0501072_0045021 | |||
| 3073 | Ga0501072_0064683 | |||
| 3074 | Ga0501073_0015213 | |||
| 3075 | Ga0501073_0057209 | |||
| 3076 | Ga0501074_0002551 | |||
| 3077 | Ga0501075_0033424 | |||
| 3078 | Ga0501076_0028788 | |||
| 3079 | Ga0501076_0104655 | |||
| 3080 | Ga0501211_001156 | |||
| 3081 | Ga0501222_000664 | |||
| 3082 | Ga0501227_004625 | |||
| 3083 | Ga0501235_004422 | |||
| 3084 | Ga0501249_006914 | |||
| 3085 | Ga0501253_001878 | |||
| 3086 | Ga0501221_000960 | |||
| 3087 | Ga0501229_000783 | |||
| 3088 | Ga0501079_0005427 | |||
| 3089 | Ga0501079_0016872 | |||
| 3090 | Ga0501079_0065864 | |||
| 3091 | Ga0501080_0004208 | |||
| 3092 | Ga0501080_0007125 | |||
| 3093 | Ga0501080_0061602 | |||
| 3094 | Ga0501080_0133218 | |||
| 3095 | Ga0501081_0013820 | |||
| 3096 | Ga0501081_0046984 | |||
| 3097 | Ga0501083_0001718 | |||
| 3098 | Ga0501083_0028189 | |||
| 3099 | Ga0501262_000577 | |||
| 3100 | Ga0501262_003349 | |||
| 3101 | Ga0501283_001053 | |||
| 3102 | Ga0501035_0248252 | |||
| 3103 | Ga0501044_0065371 | |||
| 3104 | Ga0501045_0004966 | |||
| 3105 | Ga0501045_0010264 | |||
| 3106 | Ga0501045_0023822 | |||
| 3107 | Ga0501045_0057455 | |||
| 3108 | nmdc:mga03683_19923_c1 | |||
| 3109 | nmdc:mga03683_21456_c1 | |||
| 3110 | nmdc:mga03n38_22636_c1 | |||
| 3111 | nmdc:mga03n38_64134_c1 | |||
| 3112 | nmdc:mga03n38_7643_c1 | |||
| 3113 | nmdc:mga00v17_21665_c1 | |||
| 3114 | nmdc:mga00v17_30925_c1 | |||
| 3115 | nmdc:mga00v17_51405_c1 | |||
| 3116 | nmdc:mga0yw44_110325_c1 | |||
| 3117 | nmdc:mga0yw44_14581_c1 | |||
| 3118 | nmdc:mga0yw44_785_c1 | |||
| 3119 | nmdc:mga0yw44_90550_c1 | |||
| 3120 | nmdc:mga0k408_100765_c1 | |||
| 3121 | nmdc:mga0k408_101141_c1 | |||
| 3122 | nmdc:mga0k408_118788_c1 | |||
| 3123 | nmdc:mga0k408_13542_c1 | |||
| 3124 | nmdc:mga0k408_138_c1 | |||
| 3125 | nmdc:mga0k408_16735_c1 | |||
| 3126 | nmdc:mga0k408_19960_c1 | |||
| 3127 | nmdc:mga0k408_2064_c1 | |||
| 3128 | nmdc:mga0k408_29331_c1 | |||
| 3129 | nmdc:mga0k408_34607_c1 | |||
| 3130 | nmdc:mga0k408_40887_c1 | |||
| 3131 | nmdc:mga0k408_42033_c1 | |||
| 3132 | nmdc:mga0k408_57440_c1 | |||
| 3133 | nmdc:mga0k408_576_c1 | |||
| 3134 | nmdc:mga0k408_5849_c1 | |||
| 3135 | nmdc:mga0k408_7033_c1 | |||
| 3136 | nmdc:mga0k408_7262_c1 | |||
| 3137 | nmdc:mga0k408_7453_c1 | |||
| 3138 | nmdc:mga0k408_8618_c1 | |||
| 3139 | nmdc:mga0k408_93429_c1 | |||
| 3140 | nmdc:mga06z11_18151_c1 | |||
| 3141 | nmdc:mga07m45_11357_c1 | |||
| 3142 | nmdc:mga07m45_1226_c1 | |||
| 3143 | nmdc:mga07m45_28774_c1 | |||
| 3144 | nmdc:mga07m45_31118_c1 | |||
| 3145 | nmdc:mga07m45_32283_c1 | |||
| 3146 | nmdc:mga07m45_3534_c1 | |||
| 3147 | nmdc:mga07m45_4924_c1 | |||
| 3148 | nmdc:mga07m45_639_c1 | |||
| 3149 | nmdc:mga07m45_9657_c1 | |||
| 3150 | nmdc:mga05p37_181_c1 | |||
| 3151 | nmdc:mga05p37_21359_c1 | |||
| 3152 | nmdc:mga05p37_241233_c1 | |||
| 3153 | nmdc:mga09592_1507_c1 | |||
| 3154 | nmdc:mga09592_239456_c1 | |||
| 3155 | nmdc:mga09592_64009_c1 | |||
| 3156 | nmdc:mga09592_64418_c1 | |||
| 3157 | nmdc:mga06r32_33024_c1 | |||
| 3158 | nmdc:mga06r32_73337_c1 | |||
| 3159 | nmdc:mga08y16_14999_c1 | |||
| 3160 | nmdc:mga08y16_18394_c1 | |||
| 3161 | nmdc:mga08y16_224_c1 | |||
| 3162 | nmdc:mga08y16_315156_c1 | |||
| 3163 | nmdc:mga0n895_10661_c1 | |||
| 3164 | nmdc:mga0n895_1144_c1 | |||
| 3165 | nmdc:mga0n895_278806_c1 | |||
| 3166 | nmdc:mga0rr50_42782_c1 | |||
| 3167 | nmdc:mga0rr50_60153_c1 | |||
| 3168 | nmdc:mga0rr50_7490_c1 | |||
| 3169 | nmdc:mga08x19_175135_c1 | |||
| 3170 | nmdc:mga08x19_219_c1 | |||
| 3171 | nmdc:mga08x19_63571_c1 | |||
| 3172 | nmdc:mga08x19_8071_c1 | |||
| 3173 | nmdc:mga0a205_15430_c1 | |||
| 3174 | nmdc:mga0sz30_10668_c1 | |||
| 3175 | nmdc:mga0sz30_24146_c1 | |||
| 3176 | nmdc:mga0sz30_6332_c1 | |||
| 3177 | Ga0495601_0005224 | |||
| 3178 | Ga0500610_0025769 | |||
| 3179 | Ga0495619_0023985 | |||
| 3180 | Ga0495619_0048368 | |||
| 3181 | Ga0500578_0000652 | |||
| 3182 | Ga0500646_0002088 | |||
| 3183 | Ga0500651_0038486 | |||
| 3184 | Ga0500593_011591 | |||
| 3185 | Ga0500593_011860 | |||
| 3186 | Ga0500594_0005824 | |||
| 3187 | Ga0500621_000009 | |||
| 3188 | Ga0500652_000885 | |||
| 3189 | Ga0500658_0000507 | |||
| 3190 | Ga0500658_0000854 | |||
| 3191 | Ga0500658_0007664 | |||
| 3192 | Ga0500559_0000019 | |||
| 3193 | Ga0500559_0014012 | |||
| 3194 | Ga0500568_0000554 | |||
| 3195 | Ga0500574_000659 | |||
| 3196 | Ga0500590_037396 | |||
| 3197 | Ga0500616_0011698 | |||
| 3198 | Ga0500616_0049014 | |||
| 3199 | Ga0500619_001082 | |||
| 3200 | Ga0500622_0000124 | |||
| 3201 | Ga0500622_0003679 | |||
| 3202 | Ga0500622_0005264 | |||
| 3203 | Ga0500622_0018184 | |||
| 3204 | Ga0500645_001181 | |||
| 3205 | Ga0500645_010134 | |||
| 3206 | Ga0500661_003043 | |||
| 3207 | Ga0590071_001042 | |||
| 3208 | Ga0501082_0059346 | |||
| 3209 | Ga0501082_0092527 | |||
| 3210 | Ga0501082_0201357 | |||
| 3211 | Ga0501082_0258310 | |||
| 3212 | 2511244604 | |||
| 3213 | 2511382598 | |||
| 3214 | 2511435976 | |||
| 3215 | 2513231038 | |||
| 3216 | 2513955020 | |||
| 3217 | 2514041404 | |||
| 3218 | 2548499014 | |||
| 3219 | 2550697409 | |||
| 3220 | 2587728288 | |||
| 3221 | 2587734506 | |||
| 3222 | 2587754215 | |||
| 3223 | 2588295004 | |||
| 3224 | 2599623384 | |||
| 3225 | 2599675398 | |||
| 3226 | 2599680989 | |||
| 3227 | 2599693004 | |||
| 3228 | 2608671670 | |||
| 3229 | 2643744991 | |||
| 3230 | 2643867780 | |||
| 3231 | 2643971158 | |||
| 3232 | 2643991642 | |||
| 3233 | 2644062187 | |||
| 3234 | 2644071375 | |||
| 3235 | 2644142076 | |||
| 3236 | 2644161853 | |||
| 3237 | 2644222768 | |||
| 3238 | 2644246838 | |||
| 3239 | 2644260688 | |||
| 3240 | 2644276301 | |||
| 3241 | 2644293389 | |||
| 3242 | 2644301399 | |||
| 3243 | 2644325550 | |||
| 3244 | 2644399269 | |||
| 3245 | 2644467046 | |||
| 3246 | 2644648471 | |||
| 3247 | 2687581166 | |||
| 3248 | 2722881999 | |||
| 3249 | 2738718206 | |||
| 3250 | 2738880404 | |||
| 3251 | 2739058935 | |||
| 3252 | 2739245798 | |||
| 3253 | 2739248288 | |||
| 3254 | 2739281393 | |||
| 3255 | 2809126721 | |||
| 3256 | 2816470492 | |||
| 3257 | 2819594809 | |||
| 3258 | 2819600560 | |||
| 3259 | 2831267714 | |||
| 3260 | 2831869231 | |||
| 3261 | 2834643046 | |||
| 3262 | 2838061558 | |||
| 3263 | 2839143975 | |||
| 3264 | 2842677540 | |||
| 3265 | 2842718737 | |||
| 3266 | 2842736352 | |||
| 3267 | 2842748860 | |||
| 3268 | 2844532303 | |||
| 3269 | 2847797675 | |||
| 3270 | 2855732098 | |||
| 3271 | 2855768806 | |||
| 3272 | 2857579865 | |||
| 3273 | 2865014898 | |||
| 3274 | 2869552047 | |||
| 3275 | 2876602561 | |||
| 3276 | 2881102988 | |||
| 3277 | 2881415244 | |||
| 3278 | 2881612502 | |||
| 3279 | 2884811695 | |||
| 3280 | 2884841319 | |||
| 3281 | 2884856193 | |||
| 3282 | 2885196925 | |||
| 3283 | 2885198816 | |||
| 3284 | 2885211804 | |||
| 3285 | 2894024348 | |||
| 3286 | 2896156881 | |||
| 3287 | 2899928293 | |||
| 3288 | 2904451830 | |||
| 3289 | 2904462513 | |||
| 3290 | 2904481717 | |||
| 3291 | 2904545117 | |||
| 3292 | 2908674513 | |||
| 3293 | 2919467186 | |||
| 3294 | 2919707145 | |||
| 3295 | 2928041245 | |||
| 3296 | 2928048087 | |||
| 3297 | 2928055928 | |||
| 3298 | 2928066591 | |||
| 3299 | 2928077255 | |||
| 3300 | 2928087556 | |||
| 3301 | 2928120674 | |||
| 3302 | 2929165295 | |||
| 3303 | 2929523626 | |||
| 3304 | 2939605626 | |||
| 3305 | 2939635840 | |||
| 3306 | 2945910100 | |||
| 3307 | 2945946132 | |||
| 3308 | 2945955243 | |||
| 3309 | 2945975732 | |||
| 3310 | 2945987884 | |||
| 3311 | 2954768818 | |||
| 3312 | 2974320379 | |||
| 3313 | 2978977721 | |||
| 3314 | 2990713910 | |||
| 3315 | 3003667376 | |||
| 3316 | 644748182 | |||
| 3317 | 8003403085 | |||
| 3318 | 8016737616 | |||
| 3319 | 8019504220 | |||
| 3320 | 8055434797 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4aq4-assembly1.cif.gz_A | substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli | 0.9958 | 26 | 437 |
| 4aq4-assembly1.cif.gz_A | substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli | 0.9792 | 26 | 437 |
| 6x84-assembly2.cif.gz_B | sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s | 0.9151 | 25 | 434 |
| 6x84-assembly2.cif.gz_B | sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s | 0.9047 | 25 | 434 |
| 7c0k-assembly1.cif.gz_A | crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) | 0.8939 | 23 | 429 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG80_145_437_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 1.001 | 145 | 437 | 3.40.190.10 |
| af_P0AG80_145_437_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9972 | 145 | 437 | 3.40.190.10 |
| 4aq4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9915 | 145 | 437 | 3.40.190.10 |
| 4aq4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.987 | 145 | 437 | 3.40.190.10 |
| 4aq4A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9673 | 26 | 382 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X2TAB2-F1-model_v4 | sn-glycerol-3-phosphate-binding periplasmic protein UgpB | 0.9976 | 19 | 437 |
GO:0016020
GO:0030288 GO:0055085 |
| AF-A0A0R3CB30-F1-model_v4 | sn-glycerol-3-phosphate-binding periplasmic protein UgpB | 0.9927 | 19 | 436 |
GO:0042597
|
| AF-A0A1G3RQS8-F1-model_v4 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein | 0.9908 | 35 | 437 |
GO:0030313
GO:0055085 |
| AF-J4WEL3-F1-model_v4 | Uncharacterized protein | 0.9862 | 19 | 133 |
|
| AF-A0A1G3RQS8-F1-model_v4 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein | 0.9811 | 35 | 437 |
GO:0030313
GO:0055085 |