F495247

General Info

Members Datasets Scaffolds Average Seq Length
1660 645 3320 436

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0012405|Ga0495625_0012405_2188_3693
Length 501
Sequence LEANGNAAPLRDARERAYGWVGGLSPLLPTLIRDINARVTNLPQTGGLVKSQSANPLTEQFMKIKLAAFAPGLLALALASPAHAQVEVQWWHSMTGGLNEWVNDLAKQFNESQKDYKIVPTFKGNYDESMTAAVAAFRAGNAPHILQVFEVGTATMMSAKGAIKPVGEVMKQSGVSFDPKAYVPAVSGYYTAPNGEMLSFPFNSSTTIFYYNKDAFKAAGLDPNKAPTTWPEVVAAAAKLKASGSKCPYTTSWMSWVHLESFSTWHNTLFATQNNGFGGPSARLAFNSPLHLRHFDNLANMSKQGLFVYKGRASVAVPSFVSGECAMLTGSSGSYADVSKGAKFAYGLAALPYYPDVPGAPQNTAIGGASLWVMSGKKPAEYKGVAEFFKFLSSPDVQSASHKRTGYLPITTAAYQLTEKSGFYTEKPGTDVAVTQMIRKTTDKSRGIRLGNFVQIRTIIDEETEQIWAGKKDAKTALNDAVKRGNEQLERFEKQNKAPAP

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
128 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
149 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
164 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
165 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
166 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
167 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
171 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
172 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
262 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
263 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
269 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
278 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
279 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
280 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
281 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
282 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
283 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
284 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
285 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
286 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
287 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
288 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
289 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
290 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
291 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
292 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
293 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
294 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
295 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
296 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
297 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
298 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
299 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
300 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
301 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
302 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
305 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
306 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
307 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
308 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
313 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
314 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
317 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
318 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
319 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
320 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
321 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
327 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
328 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
329 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
330 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
331 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
332 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
333 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
334 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
335 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
336 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
337 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
338 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
339 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
340 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
341 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
342 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
343 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
344 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
345 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
346 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
347 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
348 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
349 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
350 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
351 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
352 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
353 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
354 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
355 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
356 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
357 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
358 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
359 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
360 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
361 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
362 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
363 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
364 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
365 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
366 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
367 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
368 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
369 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
370 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
371 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
372 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
373 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
374 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
375 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
376 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
377 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
378 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
379 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
380 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
381 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
382 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
383 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
384 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
385 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
386 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
387 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
388 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
389 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
390 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
391 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
392 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
393 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
396 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
397 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
398 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
399 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
400 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
401 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
402 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
403 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
404 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
405 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
406 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
407 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
408 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
409 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
410 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
411 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
412 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
416 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
417 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
418 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
419 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
420 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
429 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
430 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
431 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
436 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
437 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
438 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
439 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
440 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
441 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
442 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
443 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
447 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
448 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
449 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
450 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
451 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
452 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
453 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
454 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
455 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
456 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
457 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
460 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
461 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
462 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
463 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
475 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
476 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
477 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
480 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
481 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
482 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
483 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
484 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
485 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
486 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
487 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
488 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
489 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
490 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
491 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
492 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
493 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
494 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
495 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
496 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
499 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
500 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
501 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
502 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
503 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
504 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
505 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
506 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
507 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
508 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
511 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
512 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
513 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
514 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
519 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
520 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
521 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
522 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
523 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
524 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
525 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
526 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
527 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
528 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
529 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
530 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
531 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
532 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
535 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
536 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
537 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
538 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
539 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
540 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
541 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
542 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
543 2547132374 Acidovorax radicis N35 Isolate Unclassified
544 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
545 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
546 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
547 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
548 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
549 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
550 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
551 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
552 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
553 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
554 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
555 2643221570 Acidovorax sp. Root568 Isolate Unclassified
556 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
557 2643221596 Acidovorax sp. Root70 Isolate Unclassified
558 2643221609 Acidovorax sp. Root217 Isolate Unclassified
559 2643221611 Acidovorax sp. Root219 Isolate Unclassified
560 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
561 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
562 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
563 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
564 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
565 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
566 2643221652 Acidovorax sp. Root402 Isolate Unclassified
567 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
568 2643221658 Variovorax sp. Root411 Isolate Unclassified
569 2643221672 Variovorax sp. Root434 Isolate Unclassified
570 2643221683 Variovorax sp. Root473 Isolate Unclassified
571 2643221717 Acidovorax sp. Root267 Isolate Unclassified
572 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
573 2721755523 Delftia sp. HK171 Isolate Unclassified
574 2738541277 Variovorax sp. GV051 Isolate Unclassified
575 2738541307 Variovorax sp. GV008 Isolate Unclassified
576 2738541337 Pelomonas sp. BT06 Isolate Unclassified
577 2738543012 Acidovorax sp. CF301 Isolate Unclassified
578 2738543013 Variovorax sp. BT01 Isolate Unclassified
579 2738543019 Variovorax sp. GV040 Isolate Unclassified
580 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
581 2816332133 Acidovorax radicis 2721A Isolate Unclassified
582 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
583 2818991446 Variovorax sp. 1180 Isolate Unclassified
584 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
585 2831864461 Roseateles noduli HZ7 Isolate Nodule
586 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
587 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
588 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
589 2842677519 Variovorax sp. R-72495 Isolate Unclassified
590 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
591 2842733646 Variovorax sp. R-72446 Isolate Unclassified
592 2842747753 Variovorax sp. R-72060 Isolate Unclassified
593 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
594 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
595 2855730933 Achromobacter sp. HZ28 Isolate Nodule
596 2855767633 Achromobacter sp. HZ34 Isolate Nodule
597 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
598 2865014394 Pantoea sp. R-71966 Isolate Unclassified
599 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
600 2876601092 Pantoea endophytica 596 Isolate Unclassified
601 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
602 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
603 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
604 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
605 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
606 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
607 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
608 2885198086 Variovorax sp. 679 Isolate Unclassified
609 2885211737 Variovorax sp. 553 Isolate Unclassified
610 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
611 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
612 2899924645 Variovorax sp. 369 Isolate Unclassified
613 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
614 2904456579 Variovorax sp. 2002 Isolate Unclassified
615 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
616 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
617 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
618 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
619 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
620 2928037797 Variovorax sp. 1126 Isolate Unclassified
621 2928044640 Variovorax sp. 1128 Isolate Unclassified
622 2928051484 Variovorax sp. 1133 Isolate Unclassified
623 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
624 2928070936 Variovorax gossypii 1167 Isolate Unclassified
625 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
626 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
627 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
628 2929520902 Variovorax beijingensis 502 Isolate Unclassified
629 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
630 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
631 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
632 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
633 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
634 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
635 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
636 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
637 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
638 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
639 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
640 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
641 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
642 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
643 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
644 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
645 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0.18
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.77
Nodule 1.14
Rhizoplane 1.87
Rhizosphere 69.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0012405 3300046660 Bacteria 6906
2 JGI24739J22299_10000107 3300001989 Bacteria 25402
3 JGI25155J39150_1000022 3300002704 Bacteria 142950
4 JGI25156J39149_1000005 3300002705 Bacteria 263980
5 JGI25162J39368_1002554 3300002737 Bacteria 6924
6 JGI25154J39366_1000017 3300002738 Bacteria 252448
7 JGI25157J39369_1000003 3300002741 Bacteria 274935
8 JGI25157J39369_1000747 3300002741 Bacteria 17104
9 JGI25152J39213_1001428 3300002773 Bacteria 10325
10 JGI25150J39212_1001994 3300002774 Bacteria 5335
11 JGI25159J45721_1001646 3300002987 Bacteria 9081
12 JGI25159J45721_1001983 3300002987 Bacteria 8149
13 JGI25151J46595_10002783 3300003187 Bacteria 10136
14 JGI25151J46595_10003777 3300003187 Bacteria 8216
15 JGI25151J46595_10007702 3300003187 Bacteria 5245
16 JGI25151J46595_10009716 3300003187 Bacteria 4532
17 JGI25406J46586_10000977 3300003203 Bacteria 13433
18 JGI25153J46596_10005438 3300003215 Bacteria 6684
19 rootL2_10004438 3300003322 Bacteria 5836
20 rootL2_10021412 3300003322 Bacteria 3310
21 JGI25160J50197_1000273 3300003354 Bacteria 38119
22 JGI25161J50226_1000095 3300003374 Bacteria 72343
23 Ga0055532_1000271 3300003758 Bacteria 33888
24 Ga0055525_1000004 3300003759 Bacteria 888039
25 Ga0055527_1001088 3300003760 Bacteria 6375
26 Ga0055535_1000380 3300003761 Bacteria 42008
27 Ga0055542_1000062 3300003762 Bacteria 161494
28 Ga0055526_1000968 3300003771 Bacteria 21218
29 Ga0055526_1006110 3300003771 Bacteria 6642
30 Ga0055526_1006746 3300003771 Bacteria 6148
31 Ga0055526_1014527 3300003771 Bacteria 3231
32 Ga0055537_1000483 3300003773 Bacteria 24708
33 Ga0055537_1000717 3300003773 Bacteria 17146
34 Ga0055537_1002502 3300003773 Bacteria 6113
35 Ga0055524_1000073 3300003775 Bacteria 123033
36 Ga0055524_1000658 3300003775 Bacteria 24412
37 Ga0055524_1001688 3300003775 Bacteria 12293
38 Ga0055524_1022732 3300003775 Bacteria 2039
39 Ga0055536_1000060 3300003781 Bacteria 102699
40 Ga0055536_1004647 3300003781 Bacteria 6945
41 Ga0055536_1006788 3300003781 Bacteria 5240
42 Ga0055536_1022945 3300003781 Bacteria 1847
43 Ga0055534_1000337 3300003784 Bacteria 30592
44 Ga0055534_1000467 3300003784 Bacteria 22933
45 Ga0055534_1000548 3300003784 Bacteria 20007
46 Ga0055534_1000929 3300003784 Bacteria 13182
47 Ga0055534_1001861 3300003784 Bacteria 7873
48 Ga0055528_1007433 3300003790 Bacteria 4844
49 Ga0055530_10001136 3300003791 Bacteria 20712
50 Ga0055530_10004473 3300003791 Bacteria 7172
51 Ga0055530_10011023 3300003791 Bacteria 3281
52 Ga0055540_1000037 3300003792 Bacteria 162957
53 Ga0055540_1000202 3300003792 Bacteria 57757
54 Ga0055540_1001461 3300003792 Bacteria 14088
55 Ga0055540_1007521 3300003792 Bacteria 4090
56 Ga0055531_10000007 3300003794 Bacteria 225289
57 Ga0055531_10000112 3300003794 Bacteria 89016
58 Ga0055531_10001286 3300003794 Bacteria 18915
59 Ga0055531_10001923 3300003794 Bacteria 14525
60 Ga0055531_10011360 3300003794 Bacteria 4307
61 Ga0058692_1000039 3300003856 Bacteria 133315
62 Ga0058692_1000291 3300003856 Bacteria 25903
63 Ga0058692_1000442 3300003856 Bacteria 18875
64 Ga0058692_1000709 3300003856 Bacteria 13656
65 Ga0058692_1002728 3300003856 Bacteria 5808
66 Ga0058692_1003453 3300003856 Bacteria 4872
67 Ga0055543_1000218 3300004625 Bacteria 46120
68 Ga0055543_1002869 3300004625 Bacteria 5424
69 Ga0065165_1000016 3300005262 Bacteria 286248
70 Ga0065165_1000942 3300005262 Bacteria 37104
71 Ga0065165_1003934 3300005262 Bacteria 9777
72 Ga0065165_1013762 3300005262 Bacteria 3188
73 Ga0065165_1014362 3300005262 Bacteria 3080
74 Ga0065704_10072179 3300005289 Bacteria 9000
75 Ga0065704_10079023 3300005289 Bacteria 4279
76 Ga0065715_10179597 3300005293 Bacteria 1486
77 Ga0065707_10083647 3300005295 Bacteria 8552
78 Ga0065707_10143859 3300005295 Bacteria 1738
79 Ga0070658_10003011 3300005327 Bacteria 13938
80 Ga0070658_10037598 3300005327 Bacteria 3903
81 Ga0070658_10102728 3300005327 Bacteria 2364
82 Ga0070658_10154433 3300005327 Bacteria 1923
83 Ga0070676_10002537 3300005328 Bacteria 9382
84 Ga0070676_10044429 3300005328 Bacteria 2585
85 Ga0070683_100022694 3300005329 Bacteria 5612
86 Ga0070683_100057870 3300005329 Bacteria 3601
87 Ga0070690_100011726 3300005330 Bacteria 5136
88 Ga0070670_100000655 3300005331 Bacteria 26906
89 Ga0070670_100018023 3300005331 Bacteria 6059
90 Ga0070670_100018207 3300005331 Bacteria 6027
91 Ga0070670_100048709 3300005331 Bacteria 3646
92 Ga0070670_100056163 3300005331 Bacteria 3379
93 Ga0070670_100119152 3300005331 Bacteria 2276
94 Ga0070670_100140245 3300005331 Bacteria 2090
95 Ga0070670_100149189 3300005331 Bacteria 2023
96 Ga0070677_10026317 3300005333 Bacteria 2180
97 Ga0068869_100002039 3300005334 Bacteria 12140
98 Ga0068869_100041135 3300005334 Bacteria 3308
99 Ga0068869_100061697 3300005334 Bacteria 2750
100 Ga0070666_10027838 3300005335 Bacteria 3705
101 Ga0070680_100043209 3300005336 Bacteria 3661
102 Ga0070680_100074544 3300005336 Bacteria 2792
103 Ga0070680_100216976 3300005336 Bacteria 1614
104 Ga0070682_100045907 3300005337 Bacteria 2710
105 Ga0070682_100081811 3300005337 Bacteria 2092
106 Ga0068868_100001312 3300005338 Bacteria 17144
107 Ga0068868_100034469 3300005338 Bacteria 3908
108 Ga0068868_100059565 3300005338 Bacteria 3021
109 Ga0070660_100030267 3300005339 Bacteria 4061
110 Ga0070660_100058604 3300005339 Bacteria 2985
111 Ga0070660_100061785 3300005339 Bacteria 2909
112 Ga0070689_100035794 3300005340 Bacteria 3794
113 Ga0070661_100005150 3300005344 Bacteria 9002
114 Ga0070661_100014669 3300005344 Bacteria 5525
115 Ga0070661_100054923 3300005344 Bacteria 2917
116 Ga0070661_100106474 3300005344 Bacteria 2091
117 Ga0070661_100172581 3300005344 Bacteria 1642
118 Ga0070661_100234732 3300005344 Bacteria 1410
119 Ga0070692_10046303 3300005345 Bacteria 2247
120 Ga0070668_100010679 3300005347 Bacteria 6828
121 Ga0070668_100052341 3300005347 Bacteria 3147
122 Ga0070668_100058264 3300005347 Bacteria 2988
123 Ga0070668_100062460 3300005347 Bacteria 2886
124 Ga0070669_100005401 3300005353 Bacteria 9218
125 Ga0070669_100021493 3300005353 Bacteria 4611
126 Ga0070669_100074591 3300005353 Bacteria 2515
127 Ga0070669_100080628 3300005353 Bacteria 2423
128 Ga0070675_100002072 3300005354 Bacteria 14858
129 Ga0070675_100002276 3300005354 Bacteria 14252
130 Ga0070675_100058320 3300005354 Bacteria 3184
131 Ga0070675_100078798 3300005354 Bacteria 2744
132 Ga0070675_100208047 3300005354 Bacteria 1700
133 Ga0070671_100011136 3300005355 Bacteria 7224
134 Ga0070671_100014642 3300005355 Bacteria 6341
135 Ga0070671_100016334 3300005355 Bacteria 6002
136 Ga0070671_100039869 3300005355 Bacteria 3899
137 Ga0070671_100060152 3300005355 Bacteria 3163
138 Ga0070671_100062719 3300005355 Bacteria 3094
139 Ga0070671_100096888 3300005355 Bacteria 2474
140 Ga0070671_100280307 3300005355 Bacteria 1418
141 Ga0070674_100027721 3300005356 Bacteria 3714
142 Ga0070674_100035402 3300005356 Bacteria 3343
143 Ga0070674_100075881 3300005356 Bacteria 2389
144 Ga0070674_100116276 3300005356 Bacteria 1973
145 Ga0070673_100010612 3300005364 Bacteria 6243
146 Ga0070673_100013521 3300005364 Bacteria 5651
147 Ga0070673_100231207 3300005364 Bacteria 1604
148 Ga0070659_100000722 3300005366 Bacteria 23972
149 Ga0070659_100025249 3300005366 Bacteria 4561
150 Ga0070659_100028792 3300005366 Bacteria 4291
151 Ga0070659_100039166 3300005366 Bacteria 3699
152 Ga0070659_100163697 3300005366 Bacteria 1820
153 Ga0070667_100027408 3300005367 Bacteria 4739
154 Ga0070667_100063891 3300005367 Bacteria 3122
155 Ga0070667_100085520 3300005367 Bacteria 2705
156 Ga0070667_100152503 3300005367 Bacteria 2030
157 Ga0070709_10012257 3300005434 Bacteria 4795
158 Ga0070709_10012358 3300005434 Bacteria 4777
159 Ga0070709_10074315 3300005434 Bacteria 2202
160 Ga0070709_10116577 3300005434 Bacteria 1803
161 Ga0070714_100116842 3300005435 Bacteria 2368
162 Ga0070713_100012928 3300005436 Bacteria 6144
163 Ga0070713_100034409 3300005436 Bacteria 4070
164 Ga0070713_100128246 3300005436 Bacteria 2234
165 Ga0070710_10047349 3300005437 Bacteria 2398
166 Ga0070701_10053676 3300005438 Bacteria 2099
167 Ga0070701_10106001 3300005438 Bacteria 1564
168 Ga0070711_100004600 3300005439 Bacteria 8166
169 Ga0070711_100061747 3300005439 Bacteria 2609
170 Ga0070705_100136038 3300005440 Bacteria 1610
171 Ga0070700_100000839 3300005441 Bacteria 15145
172 Ga0070700_100077353 3300005441 Bacteria 2139
173 Ga0070700_100131794 3300005441 Bacteria 1688
174 Ga0070694_100017278 3300005444 Bacteria 4556
175 Ga0070694_100019073 3300005444 Bacteria 4359
176 Ga0070694_100065476 3300005444 Bacteria 2490
177 Ga0070694_100076118 3300005444 Bacteria 2323
178 Ga0070663_100012806 3300005455 Bacteria 5320
179 Ga0070663_100032290 3300005455 Bacteria 3607
180 Ga0070663_100088288 3300005455 Bacteria 2292
181 Ga0070678_100022651 3300005456 Bacteria 4168
182 Ga0070678_100023376 3300005456 Bacteria 4118
183 Ga0070678_100036246 3300005456 Bacteria 3451
184 Ga0070662_100001216 3300005457 Bacteria 15804
185 Ga0070662_100020556 3300005457 Bacteria 4497
186 Ga0070662_100020619 3300005457 Bacteria 4493
187 Ga0070662_100111838 3300005457 Bacteria 2081
188 Ga0070662_100141538 3300005457 Bacteria 1865
189 Ga0070681_10015201 3300005458 Bacteria 7656
190 Ga0070681_10017457 3300005458 Bacteria 7173
191 Ga0070681_10047156 3300005458 Bacteria 4307
192 Ga0070681_10098398 3300005458 Bacteria 2871
193 Ga0068867_100000081 3300005459 Bacteria 59361
194 Ga0068867_100001697 3300005459 Bacteria 15357
195 Ga0068867_100002106 3300005459 Bacteria 13948
196 Ga0068867_100024737 3300005459 Bacteria 4303
197 Ga0068867_100042493 3300005459 Bacteria 3326
198 Ga0068867_100042821 3300005459 Bacteria 3314
199 Ga0068867_100220926 3300005459 Bacteria 1527
200 Ga0070685_10084032 3300005466 Bacteria 1914
201 Ga0070706_100000463 3300005467 Bacteria 48079
202 Ga0070706_100067449 3300005467 Bacteria 3309
203 Ga0070706_100076557 3300005467 Bacteria 3096
204 Ga0070706_100215096 3300005467 Bacteria 1794
205 Ga0070707_100011237 3300005468 Bacteria 8345
206 Ga0070707_100075144 3300005468 Bacteria 3259
207 Ga0070707_100186478 3300005468 Bacteria 2023
208 Ga0070698_100038594 3300005471 Bacteria 4920
209 Ga0070698_100171427 3300005471 Bacteria 2111
210 Ga0070699_100012659 3300005518 Bacteria 7276
211 Ga0070699_100019325 3300005518 Bacteria 5865
212 Ga0070699_100027789 3300005518 Bacteria 4878
213 Ga0070699_100028721 3300005518 Bacteria 4796
214 Ga0070699_100043010 3300005518 Bacteria 3910
215 Ga0070679_100042804 3300005530 Bacteria 4510
216 Ga0070679_100043504 3300005530 Bacteria 4473
217 Ga0070679_100148911 3300005530 Bacteria 2318
218 Ga0070684_100019385 3300005535 Bacteria 5626
219 Ga0070684_100020668 3300005535 Bacteria 5460
220 Ga0070697_100033017 3300005536 Bacteria 4167
221 Ga0068853_100001296 3300005539 Bacteria 17963
222 Ga0068853_100020194 3300005539 Bacteria 5538
223 Ga0068853_100094553 3300005539 Bacteria 2633
224 Ga0070672_100002859 3300005543 Bacteria 11085
225 Ga0070672_100013320 3300005543 Bacteria 5805
226 Ga0070672_100018087 3300005543 Bacteria 5088
227 Ga0070672_100035554 3300005543 Bacteria 3787
228 Ga0070672_100041756 3300005543 Bacteria 3528
229 Ga0070672_100042391 3300005543 Bacteria 3504
230 Ga0070672_100272863 3300005543 Bacteria 1428
231 Ga0070695_100055428 3300005545 Bacteria 2555
232 Ga0070695_100114020 3300005545 Bacteria 1839
233 Ga0070696_100003263 3300005546 Bacteria 10818
234 Ga0070696_100035707 3300005546 Bacteria 3424
235 Ga0070696_100051492 3300005546 Bacteria 2864
236 Ga0070693_100007795 3300005547 Bacteria 5251
237 Ga0070693_100021450 3300005547 Bacteria 3422
238 Ga0070665_100013839 3300005548 Bacteria 8114
239 Ga0070665_100019707 3300005548 Bacteria 6772
240 Ga0070665_100022394 3300005548 Bacteria 6358
241 Ga0070665_100225384 3300005548 Bacteria 1875
242 Ga0070704_100004279 3300005549 Bacteria 8250
243 Ga0070704_100023273 3300005549 Bacteria 4042
244 Ga0070704_100237986 3300005549 Bacteria 1489
245 Ga0068855_100016883 3300005563 Bacteria 8778
246 Ga0068855_100019918 3300005563 Bacteria 8057
247 Ga0068855_100020624 3300005563 Bacteria 7902
248 Ga0068855_100033144 3300005563 Bacteria 6167
249 Ga0068855_100036519 3300005563 Bacteria 5848
250 Ga0068855_100043350 3300005563 Bacteria 5330
251 Ga0070664_100015251 3300005564 Bacteria 6281
252 Ga0070664_100023069 3300005564 Bacteria 5136
253 Ga0070664_100026646 3300005564 Bacteria 4797
254 Ga0070664_100052551 3300005564 Bacteria 3452
255 Ga0070664_100115380 3300005564 Bacteria 2347
256 Ga0068857_100094504 3300005577 Bacteria 2677
257 Ga0068857_100108286 3300005577 Bacteria 2497
258 Ga0068857_100199948 3300005577 Bacteria 1822
259 Ga0068854_100008019 3300005578 Bacteria 6766
260 Ga0068854_100016437 3300005578 Bacteria 4933
261 Ga0068854_100017824 3300005578 Bacteria 4759
262 Ga0068854_100027690 3300005578 Bacteria 3909
263 Ga0068854_100063337 3300005578 Bacteria 2684
264 Ga0068854_100113326 3300005578 Bacteria 2048
265 Ga0068856_100003497 3300005614 Bacteria 15861
266 Ga0068856_100052020 3300005614 Bacteria 4038
267 Ga0068856_100059045 3300005614 Bacteria 3788
268 Ga0068856_100079103 3300005614 Bacteria 3260
269 Ga0068852_100005381 3300005616 Bacteria 9152
270 Ga0068852_100011356 3300005616 Bacteria 6701
271 Ga0068852_100062192 3300005616 Bacteria 3247
272 Ga0068852_100071351 3300005616 Bacteria 3049
273 Ga0068852_100130031 3300005616 Bacteria 2318
274 Ga0068852_100224054 3300005616 Bacteria 1789
275 Ga0068859_100006667 3300005617 Bacteria 11721
276 Ga0068859_100066678 3300005617 Bacteria 3634
277 Ga0068859_100100311 3300005617 Bacteria 2951
278 Ga0068859_100101706 3300005617 Bacteria 2931
279 Ga0068864_100001804 3300005618 Bacteria 17566
280 Ga0068864_100006924 3300005618 Bacteria 9300
281 Ga0068864_100016465 3300005618 Bacteria 6153
282 Ga0068864_100023957 3300005618 Bacteria 5130
283 Ga0068864_100049117 3300005618 Bacteria 3629
284 Ga0068866_10006603 3300005718 Bacteria 4838
285 Ga0068866_10024029 3300005718 Bacteria 2842
286 Ga0068861_100001859 3300005719 Bacteria 13589
287 Ga0068861_100020979 3300005719 Bacteria 4689
288 Ga0068861_100024799 3300005719 Bacteria 4341
289 Ga0068861_100040101 3300005719 Bacteria 3499
290 Ga0068861_100204498 3300005719 Bacteria 1659
291 Ga0068851_10001662 3300005834 Bacteria 9748
292 Ga0068851_10027158 3300005834 Bacteria 2819
293 Ga0068863_100011245 3300005841 Bacteria 8671
294 Ga0068863_100025859 3300005841 Bacteria 5600
295 Ga0068858_100005397 3300005842 Bacteria 12526
296 Ga0068858_100015128 3300005842 Bacteria 7256
297 Ga0068858_100015409 3300005842 Bacteria 7190
298 Ga0068858_100071444 3300005842 Bacteria 3219
299 Ga0068860_100004248 3300005843 Bacteria 14675
300 Ga0068860_100004659 3300005843 Bacteria 14002
301 Ga0068860_100005775 3300005843 Bacteria 12470
302 Ga0068860_100043724 3300005843 Bacteria 4271
303 Ga0068860_100326033 3300005843 Bacteria 1508
304 Ga0068862_100004558 3300005844 Bacteria 11686
305 Ga0068862_100018849 3300005844 Bacteria 5751
306 Ga0068862_100088092 3300005844 Bacteria 2700
307 Ga0081455_10075970 3300005937 Bacteria 2770
308 Ga0081539_10000917 3300005985 Bacteria 55614
309 Ga0081539_10001716 3300005985 Bacteria 35112
310 Ga0070717_10205910 3300006028 Bacteria 1725
311 Ga0075365_10006309 3300006038 Bacteria 6511
312 Ga0075365_10010415 3300006038 Bacteria 5415
313 Ga0075365_10029292 3300006038 Bacteria 3518
314 Ga0075365_10048041 3300006038 Bacteria 2808
315 Ga0075365_10108442 3300006038 Bacteria 1907
316 Ga0075368_10044752 3300006042 Bacteria 1747
317 Ga0075363_100009368 3300006048 Bacteria 4602
318 Ga0075363_100014193 3300006048 Bacteria 3885
319 Ga0075363_100015200 3300006048 Bacteria 3778
320 Ga0075364_10065161 3300006051 Bacteria 2391
321 Ga0075364_10081682 3300006051 Bacteria 2137
322 Ga0075362_10005983 3300006177 Bacteria 4499
323 Ga0075362_10039533 3300006177 Bacteria 2074
324 Ga0075367_10013296 3300006178 Bacteria 4420
325 Ga0075367_10089875 3300006178 Bacteria 1867
326 Ga0075367_10104720 3300006178 Bacteria 1732
327 Ga0075369_10010911 3300006186 Bacteria 3560
328 Ga0075369_10013394 3300006186 Bacteria 3255
329 Ga0075366_10000565 3300006195 Bacteria 17352
330 Ga0075366_10003522 3300006195 Bacteria 8269
331 Ga0075366_10004894 3300006195 Bacteria 7225
332 Ga0075366_10007992 3300006195 Bacteria 5859
333 Ga0075366_10010633 3300006195 Bacteria 5169
334 Ga0075366_10023928 3300006195 Bacteria 3559
335 Ga0075366_10026377 3300006195 Bacteria 3403
336 Ga0075366_10028720 3300006195 Bacteria 3265
337 Ga0075366_10034048 3300006195 Bacteria 3001
338 Ga0075366_10040231 3300006195 Bacteria 2765
339 Ga0075366_10054534 3300006195 Bacteria 2374
340 Ga0075366_10074127 3300006195 Bacteria 2029
341 Ga0075366_10096754 3300006195 Bacteria 1770
342 Ga0075366_10119325 3300006195 Bacteria 1589
343 Ga0075366_10151653 3300006195 Bacteria 1403
344 Ga0097621_100009452 3300006237 Bacteria 7077
345 Ga0097621_100013544 3300006237 Bacteria 6080
346 Ga0097621_100018736 3300006237 Bacteria 5295
347 Ga0097621_100025502 3300006237 Bacteria 4626
348 Ga0097621_100026295 3300006237 Bacteria 4563
349 Ga0097621_100053592 3300006237 Bacteria 3288
350 Ga0097621_100130284 3300006237 Bacteria 2141
351 Ga0097621_100161786 3300006237 Bacteria 1925
352 Ga0097621_100255942 3300006237 Bacteria 1535
353 Ga0075370_10000350 3300006353 Bacteria 16757
354 Ga0075370_10001008 3300006353 Bacteria 11658
355 Ga0075370_10001666 3300006353 Bacteria 9827
356 Ga0075370_10004844 3300006353 Bacteria 6598
357 Ga0075370_10012071 3300006353 Bacteria 4556
358 Ga0075370_10012595 3300006353 Bacteria 4475
359 Ga0075370_10037247 3300006353 Bacteria 2734
360 Ga0075370_10068955 3300006353 Bacteria 2020
361 Ga0075370_10077352 3300006353 Bacteria 1909
362 Ga0068871_100006413 3300006358 Bacteria 8323
363 Ga0068871_100017680 3300006358 Bacteria 5401
364 Ga0068871_100017837 3300006358 Bacteria 5381
365 Ga0068871_100020611 3300006358 Bacteria 5054
366 Ga0068871_100026397 3300006358 Bacteria 4532
367 Ga0075428_100006866 3300006844 Bacteria 12647
368 Ga0075428_100059027 3300006844 Bacteria 4201
369 Ga0075428_100116127 3300006844 Bacteria 2915
370 Ga0075428_100185526 3300006844 Bacteria 2251
371 Ga0075430_100037043 3300006846 Bacteria 4134
372 Ga0075431_100009882 3300006847 Bacteria 9579
373 Ga0075431_100045869 3300006847 Bacteria 4505
374 Ga0075433_10270596 3300006852 Bacteria 1505
375 Ga0075434_100000247 3300006871 Bacteria 37944
376 Ga0075434_100016216 3300006871 Bacteria 7162
377 Ga0075429_100000463 3300006880 Bacteria 30330
378 Ga0075429_100012319 3300006880 Bacteria 7418
379 Ga0075429_100086523 3300006880 Bacteria 2732
380 Ga0068865_100041887 3300006881 Bacteria 3119
381 Ga0068865_100056658 3300006881 Bacteria 2731
382 Ga0068865_100061617 3300006881 Bacteria 2630
383 Ga0068865_100072442 3300006881 Bacteria 2447
384 Ga0068865_100169693 3300006881 Bacteria 1671
385 Ga0075436_100000153 3300006914 Bacteria 42824
386 Ga0075436_100002208 3300006914 Bacteria 13443
387 Ga0075436_100021164 3300006914 Bacteria 4463
388 Ga0075436_100031066 3300006914 Bacteria 3676
389 Ga0075436_100055576 3300006914 Bacteria 2734
390 Ga0097620_100006667 3300006931 Bacteria 11721
391 Ga0097620_100066676 3300006931 Bacteria 3634
392 Ga0097620_100100310 3300006931 Bacteria 2951
393 Ga0097620_100101706 3300006931 Bacteria 2931
394 Ga0079104_1000055 3300006946 Bacteria 166522
395 Ga0079104_1014636 3300006946 Bacteria 2358
396 Ga0099826_10000020 3300006948 Bacteria 183920
397 Ga0099826_10043559 3300006948 Bacteria 3088
398 Ga0099794_10021968 3300007265 Bacteria 2904
399 Ga0099795_10004825 3300007788 Bacteria 3520
400 Ga0099795_10021877 3300007788 Bacteria 2104
401 Ga0105251_10001513 3300009011 Bacteria 19971
402 Ga0105251_10011195 3300009011 Bacteria 5137
403 Ga0105244_10010701 3300009036 Bacteria 5546
404 Ga0105250_10003376 3300009092 Bacteria 7576
405 Ga0105240_10003800 3300009093 Bacteria 23327
406 Ga0105240_10018026 3300009093 Bacteria 9496
407 Ga0105240_10115080 3300009093 Bacteria 3248
408 Ga0105240_10149092 3300009093 Bacteria 2788
409 Ga0111539_10007501 3300009094 Bacteria 13961
410 Ga0111539_10046081 3300009094 Bacteria 5218
411 Ga0105245_10007918 3300009098 Bacteria 9292
412 Ga0105245_10088093 3300009098 Bacteria 2850
413 Ga0114129_10005167 3300009147 Bacteria 18369
414 Ga0114129_10018075 3300009147 Bacteria 10043
415 Ga0114129_10213674 3300009147 Bacteria 2606
416 Ga0105243_10004191 3300009148 Bacteria 11432
417 Ga0105243_10010403 3300009148 Bacteria 7065
418 Ga0105243_10043569 3300009148 Bacteria 3517
419 Ga0105243_10043909 3300009148 Bacteria 3505
420 Ga0105243_10071599 3300009148 Bacteria 2804
421 Ga0105243_10077762 3300009148 Bacteria 2699
422 Ga0105243_10093592 3300009148 Bacteria 2480
423 Ga0105241_10065167 3300009174 Bacteria 2815
424 Ga0105241_10089016 3300009174 Bacteria 2432
425 Ga0105241_10171876 3300009174 Bacteria 1790
426 Ga0105242_10001697 3300009176 Bacteria 17431
427 Ga0105242_10002028 3300009176 Bacteria 15933
428 Ga0105242_10040904 3300009176 Bacteria 3736
429 Ga0105242_10041709 3300009176 Bacteria 3703
430 Ga0105242_10075746 3300009176 Bacteria 2802
431 Ga0105242_10202976 3300009176 Bacteria 1762
432 Ga0105248_10002030 3300009177 Bacteria 22461
433 Ga0105248_10015980 3300009177 Bacteria 8263
434 Ga0105248_10024858 3300009177 Bacteria 6658
435 Ga0105248_10059994 3300009177 Bacteria 4272
436 Ga0105248_10066533 3300009177 Bacteria 4046
437 Ga0105248_10097012 3300009177 Bacteria 3321
438 Ga0105248_10127574 3300009177 Bacteria 2870
439 Ga0105248_10221961 3300009177 Bacteria 2128
440 Ga0105248_10333486 3300009177 Bacteria 1708
441 Ga0105237_10012592 3300009545 Bacteria 8908
442 Ga0105238_10006104 3300009551 Bacteria 11950
443 Ga0105238_10020927 3300009551 Bacteria 6664
444 Ga0105238_10096631 3300009551 Bacteria 2940
445 Ga0105238_10099453 3300009551 Bacteria 2892
446 Ga0105238_10109604 3300009551 Bacteria 2742
447 Ga0105238_10133369 3300009551 Bacteria 2462
448 Ga0105249_10001475 3300009553 Bacteria 20614
449 Ga0105249_10054022 3300009553 Bacteria 3672
450 Ga0105249_10153732 3300009553 Bacteria 2217
451 Ga0105249_10192154 3300009553 Bacteria 1993
452 Ga0105249_10237119 3300009553 Bacteria 1802
453 Ga0099796_10007483 3300010159 Bacteria 2857
454 Ga0105239_10046513 3300010375 Bacteria 4755
455 Ga0105239_10179760 3300010375 Bacteria 2367
456 Ga0105246_10002163 3300011119 Bacteria 11864
457 Ga0105246_10032227 3300011119 Bacteria 3475
458 Ga0105246_10141477 3300011119 Bacteria 1810
459 Ga0157319_1000008 3300012497 Bacteria 315600
460 Ga0157347_1000789 3300012502 Bacteria 2232
461 Ga0157373_10000081 3300013100 Bacteria 82343
462 Ga0157373_10008814 3300013100 Bacteria 7474
463 Ga0157373_10016114 3300013100 Bacteria 5455
464 Ga0157373_10018126 3300013100 Bacteria 5126
465 Ga0157373_10026235 3300013100 Bacteria 4210
466 Ga0157371_10001827 3300013102 Bacteria 21447
467 Ga0157371_10020896 3300013102 Bacteria 4814
468 Ga0157371_10065579 3300013102 Bacteria 2572
469 Ga0157371_10165541 3300013102 Bacteria 1579
470 Ga0157370_10027854 3300013104 Bacteria 5568
471 Ga0157370_10091315 3300013104 Bacteria 2859
472 Ga0157370_10227594 3300013104 Bacteria 1726
473 Ga0157369_10001065 3300013105 Bacteria 34435
474 Ga0157369_10002069 3300013105 Bacteria 24238
475 Ga0157369_10007564 3300013105 Bacteria 12501
476 Ga0157369_10083686 3300013105 Bacteria 3412
477 Ga0157369_10179640 3300013105 Bacteria 2227
478 Ga0157374_10042081 3300013296 Bacteria 4213
479 Ga0157374_10075672 3300013296 Bacteria 3181
480 Ga0157378_10001998 3300013297 Bacteria 18236
481 Ga0163162_10000314 3300013306 Bacteria 44769
482 Ga0163162_10016393 3300013306 Bacteria 7242
483 Ga0163162_10021214 3300013306 Bacteria 6392
484 Ga0163162_10030137 3300013306 Bacteria 5375
485 Ga0163162_10085712 3300013306 Bacteria 3227
486 Ga0163162_10119864 3300013306 Bacteria 2734
487 Ga0163162_10154753 3300013306 Bacteria 2412
488 Ga0163162_10168017 3300013306 Bacteria 2318
489 Ga0163162_10206137 3300013306 Bacteria 2095
490 Ga0157372_10001667 3300013307 Bacteria 24062
491 Ga0157372_10014005 3300013307 Bacteria 8567
492 Ga0157372_10133919 3300013307 Bacteria 2853
493 Ga0157372_10145265 3300013307 Bacteria 2735
494 Ga0157372_10152193 3300013307 Bacteria 2671
495 Ga0157372_10181148 3300013307 Bacteria 2439
496 Ga0157372_10246392 3300013307 Bacteria 2074
497 Ga0157372_10296465 3300013307 Bacteria 1881
498 Ga0157375_10010300 3300013308 Bacteria 8228
499 Ga0157375_10031315 3300013308 Bacteria 5026
500 Ga0157375_10061416 3300013308 Bacteria 3731
501 Ga0157375_10078372 3300013308 Bacteria 3337
502 Ga0157375_10154851 3300013308 Bacteria 2430
503 Ga0157375_10171662 3300013308 Bacteria 2316
504 Ga0157375_10296407 3300013308 Bacteria 1780
505 Ga0163163_10001639 3300014325 Bacteria 18841
506 Ga0163163_10063892 3300014325 Bacteria 3652
507 Ga0163163_10257800 3300014325 Bacteria 1795
508 Ga0163163_10382441 3300014325 Bacteria 1465
509 Ga0157380_10008262 3300014326 Bacteria 7416
510 Ga0157380_10022246 3300014326 Bacteria 4768
511 Ga0157380_10056722 3300014326 Bacteria 3117
512 Ga0182008_10004122 3300014497 Bacteria 8561
513 Ga0182008_10007102 3300014497 Bacteria 6202
514 Ga0182008_10009794 3300014497 Bacteria 5157
515 Ga0182008_10084240 3300014497 Bacteria 1566
516 Ga0157377_10000048 3300014745 Bacteria 94061
517 Ga0157379_10010467 3300014968 Bacteria 8085
518 Ga0157379_10030571 3300014968 Bacteria 4795
519 Ga0157379_10037678 3300014968 Bacteria 4313
520 Ga0157379_10050970 3300014968 Bacteria 3696
521 Ga0157379_10062117 3300014968 Bacteria 3341
522 Ga0157379_10104187 3300014968 Bacteria 2546
523 Ga0157379_10201015 3300014968 Bacteria 1802
524 Ga0157376_10001621 3300014969 Bacteria 14892
525 Ga0157376_10016439 3300014969 Bacteria 5618
526 Ga0157376_10036986 3300014969 Bacteria 3958
527 Ga0157376_10061988 3300014969 Bacteria 3145
528 Ga0157376_10063786 3300014969 Bacteria 3105
529 Ga0182006_1008526 3300015261 Bacteria 4645
530 Ga0182006_1014990 3300015261 Bacteria 3330
531 Ga0182006_1019059 3300015261 Bacteria 2893
532 Ga0182006_1046030 3300015261 Bacteria 1696
533 Ga0182007_10000642 3300015262 Bacteria 20182
534 Ga0182007_10003593 3300015262 Bacteria 7284
535 Ga0183362_10003 3300015683 Bacteria 977584
536 Ga0163161_10009943 3300017792 Bacteria 6589
537 Ga0163161_10033261 3300017792 Bacteria 3684
538 Ga0163161_10041651 3300017792 Bacteria 3300
539 Ga0163161_10063022 3300017792 Bacteria 2702
540 Ga0163161_10064942 3300017792 Bacteria 2663
541 Ga0163161_10094517 3300017792 Bacteria 2216
542 Ga0213872_10000093 3300021361 Bacteria 83513
543 Ga0213872_10000490 3300021361 Bacteria 31612
544 Ga0213872_10003115 3300021361 Bacteria 9320
545 Ga0213872_10005470 3300021361 Bacteria 6529
546 Ga0213872_10021144 3300021361 Bacteria 2996
547 Ga0209435_100002 3300025206 Bacteria 794178
548 Ga0209435_100018 3300025206 Bacteria 274625
549 Ga0209436_105519 3300025208 Bacteria 2899
550 Ga0209672_101322 3300025228 Bacteria 9450
551 Ga0209147_100051 3300025229 Bacteria 274605
552 Ga0209147_101675 3300025229 Bacteria 7275
553 Ga0209563_100013 3300025230 Bacteria 941463
554 Ga0209437_100136 3300025233 Bacteria 176190
555 Ga0209437_100145 3300025233 Bacteria 163138
556 Ga0209258_100154 3300025242 Bacteria 158235
557 Ga0209258_100760 3300025242 Bacteria 20234
558 Ga0207425_1000540 3300025245 Bacteria 22766
559 Ga0207425_1001617 3300025245 Bacteria 9090
560 Ga0207425_1002353 3300025245 Bacteria 6746
561 Ga0209646_1000001 3300025246 Bacteria 3092932
562 Ga0209646_1000090 3300025246 Bacteria 189912
563 Ga0209026_1000001 3300025250 Bacteria 1228671
564 Ga0209026_1000042 3300025250 Bacteria 273111
565 Ga0209148_1000145 3300025254 Bacteria 161352
566 Ga0209759_1000001 3300025256 Bacteria 2799452
567 Ga0209759_1000933 3300025256 Bacteria 21089
568 Ga0209129_1000027 3300025258 Bacteria 409587
569 Ga0209129_1000054 3300025258 Bacteria 261997
570 Ga0209129_1002683 3300025258 Bacteria 8383
571 Ga0209129_1005664 3300025258 Bacteria 4321
572 Ga0209565_1000067 3300025263 Bacteria 171247
573 Ga0209565_1000092 3300025263 Bacteria 141563
574 Ga0209565_1000128 3300025263 Bacteria 108959
575 Ga0209565_1000648 3300025263 Bacteria 22443
576 Ga0209565_1000708 3300025263 Bacteria 20409
577 Ga0209565_1001327 3300025263 Bacteria 11327
578 Ga0209565_1002114 3300025263 Bacteria 7566
579 Ga0209455_1001361 3300025272 Bacteria 11209
580 Ga0209673_1000008 3300025273 Bacteria 626013
581 Ga0209673_1000097 3300025273 Bacteria 193482
582 Ga0209673_1000172 3300025273 Bacteria 133472
583 Ga0209673_1001430 3300025273 Bacteria 22800
584 Ga0209673_1006310 3300025273 Bacteria 5756
585 Ga0209673_1011746 3300025273 Bacteria 3587
586 Ga0209673_1017095 3300025273 Bacteria 2684
587 Ga0209130_1000072 3300025284 Bacteria 175726
588 Ga0209130_1000315 3300025284 Bacteria 56958
589 Ga0209130_1000954 3300025284 Bacteria 22871
590 Ga0209130_1001108 3300025284 Bacteria 19845
591 Ga0209130_1002024 3300025284 Bacteria 11039
592 Ga0209675_1000038 3300025291 Bacteria 250481
593 Ga0209675_1000221 3300025291 Bacteria 59141
594 Ga0209675_1000690 3300025291 Bacteria 23483
595 Ga0209675_1001507 3300025291 Bacteria 13323
596 Ga0209675_1003314 3300025291 Bacteria 7734
597 Ga0209675_1003374 3300025291 Bacteria 7626
598 Ga0209675_1004564 3300025291 Bacteria 6109
599 Ga0209675_1004790 3300025291 Bacteria 5878
600 Ga0209675_1006032 3300025291 Bacteria 4951
601 Ga0209675_1013233 3300025291 Bacteria 2598
602 Ga0209676_1000012 3300025292 Bacteria 841431
603 Ga0209676_1000023 3300025292 Bacteria 589732
604 Ga0209676_1000048 3300025292 Bacteria 403716
605 Ga0209676_1001679 3300025292 Bacteria 19202
606 Ga0209676_1007984 3300025292 Bacteria 4829
607 Ga0209025_1000026 3300025294 Bacteria 519850
608 Ga0209025_1000173 3300025294 Bacteria 159623
609 Ga0209025_1000174 3300025294 Bacteria 158915
610 Ga0209025_1001066 3300025294 Bacteria 39849
611 Ga0209025_1001606 3300025294 Bacteria 28358
612 Ga0209025_1001733 3300025294 Bacteria 26305
613 Ga0209025_1001987 3300025294 Bacteria 23455
614 Ga0209025_1002139 3300025294 Bacteria 22147
615 Ga0209025_1004985 3300025294 Bacteria 11107
616 Ga0209025_1005561 3300025294 Bacteria 10213
617 Ga0209025_1010865 3300025294 Bacteria 6101
618 Ga0209025_1020817 3300025294 Bacteria 3563
619 Ga0209025_1027510 3300025294 Bacteria 2818
620 Ga0209025_1030667 3300025294 Bacteria 2567
621 Ga0209025_1039297 3300025294 Bacteria 2066
622 Ga0209564_1000008 3300025295 Bacteria 953227
623 Ga0209564_1000139 3300025295 Bacteria 180328
624 Ga0209564_1000241 3300025295 Bacteria 118237
625 Ga0209564_1000435 3300025295 Bacteria 72434
626 Ga0209564_1000998 3300025295 Bacteria 35364
627 Ga0209564_1001515 3300025295 Bacteria 23174
628 Ga0209564_1002737 3300025295 Bacteria 13264
629 Ga0209564_1002822 3300025295 Bacteria 12877
630 Ga0209564_1003293 3300025295 Bacteria 11225
631 Ga0209564_1004319 3300025295 Bacteria 8779
632 Ga0209758_1000034 3300025297 Bacteria 467637
633 Ga0209758_1000052 3300025297 Bacteria 338962
634 Ga0209758_1000146 3300025297 Bacteria 169246
635 Ga0209758_1002271 3300025297 Bacteria 19909
636 Ga0209758_1004536 3300025297 Bacteria 11484
637 Ga0209050_1000012 3300025298 Bacteria 813717
638 Ga0209050_1000022 3300025298 Bacteria 565239
639 Ga0209050_1000165 3300025298 Bacteria 152109
640 Ga0209050_1000294 3300025298 Bacteria 105705
641 Ga0209050_1001032 3300025298 Bacteria 34539
642 Ga0209050_1002988 3300025298 Bacteria 13162
643 Ga0209050_1004806 3300025298 Bacteria 8889
644 Ga0209050_1008642 3300025298 Bacteria 5385
645 Ga0209050_1012744 3300025298 Bacteria 3820
646 Ga0209256_1000001 3300025299 Bacteria 2166974
647 Ga0209256_1000103 3300025299 Bacteria 193900
648 Ga0209256_1000120 3300025299 Bacteria 167691
649 Ga0209256_1000165 3300025299 Bacteria 135104
650 Ga0209256_1000450 3300025299 Bacteria 62771
651 Ga0209256_1000912 3300025299 Bacteria 36188
652 Ga0209256_1001146 3300025299 Bacteria 30061
653 Ga0209256_1001845 3300025299 Bacteria 19655
654 Ga0209256_1023396 3300025299 Bacteria 1843
655 Ga0209256_1025211 3300025299 Bacteria 1737
656 Ga0207426_1000058 3300025302 Bacteria 363857
657 Ga0207426_1000067 3300025302 Bacteria 342108
658 Ga0207426_1000319 3300025302 Bacteria 92696
659 Ga0207426_1002937 3300025302 Bacteria 10035
660 Ga0209051_1000013 3300025303 Bacteria 565239
661 Ga0209051_1000018 3300025303 Bacteria 527061
662 Ga0209051_1000019 3300025303 Bacteria 511268
663 Ga0209051_1000235 3300025303 Bacteria 92799
664 Ga0209051_1000384 3300025303 Bacteria 62340
665 Ga0209051_1001398 3300025303 Bacteria 20776
666 Ga0209051_1002935 3300025303 Bacteria 11678
667 Ga0209051_1005813 3300025303 Bacteria 7098
668 Ga0209051_1007797 3300025303 Bacteria 5785
669 Ga0209257_1000021 3300025304 Bacteria 771986
670 Ga0209257_1000024 3300025304 Bacteria 726068
671 Ga0209257_1000042 3300025304 Bacteria 537149
672 Ga0209257_1000057 3300025304 Bacteria 396985
673 Ga0209257_1000096 3300025304 Bacteria 259390
674 Ga0209257_1000260 3300025304 Bacteria 121653
675 Ga0209257_1001206 3300025304 Bacteria 32484
676 Ga0209257_1010586 3300025304 Bacteria 4634
677 Ga0209257_1010643 3300025304 Bacteria 4608
678 Ga0207697_10016431 3300025315 Bacteria 3049
679 Ga0207656_10003460 3300025321 Bacteria 5429
680 Ga0207656_10006943 3300025321 Bacteria 4105
681 Ga0207696_1000557 3300025711 Bacteria 29652
682 Ga0207696_1003192 3300025711 Bacteria 7579
683 Ga0207696_1003996 3300025711 Bacteria 6479
684 Ga0207655_1000024 3300025728 Bacteria 459774
685 Ga0207655_1000639 3300025728 Bacteria 41880
686 Ga0207655_1000983 3300025728 Bacteria 29240
687 Ga0207655_1003550 3300025728 Bacteria 11549
688 Ga0207655_1030240 3300025728 Bacteria 2522
689 Ga0207713_1000043 3300025735 Bacteria 241808
690 Ga0207713_1008050 3300025735 Bacteria 6124
691 Ga0207713_1027146 3300025735 Bacteria 2606
692 Ga0207713_1042393 3300025735 Bacteria 1890
693 Ga0207682_10011302 3300025893 Bacteria 3488
694 Ga0207682_10015452 3300025893 Bacteria 2971
695 Ga0207682_10030730 3300025893 Bacteria 2153
696 Ga0207642_10052396 3300025899 Bacteria 1851
697 Ga0207688_10015371 3300025901 Bacteria 4152
698 Ga0207680_10001495 3300025903 Bacteria 11047
699 Ga0207699_10026650 3300025906 Bacteria 3190
700 Ga0207699_10067168 3300025906 Bacteria 2179
701 Ga0207645_10007473 3300025907 Bacteria 7715
702 Ga0207645_10052992 3300025907 Bacteria 2592
703 Ga0207645_10056229 3300025907 Bacteria 2512
704 Ga0207645_10129688 3300025907 Bacteria 1641
705 Ga0207645_10148073 3300025907 Bacteria 1531
706 Ga0207643_10027110 3300025908 Bacteria 3175
707 Ga0207643_10076978 3300025908 Bacteria 1928
708 Ga0207705_10008509 3300025909 Bacteria 7487
709 Ga0207705_10032151 3300025909 Bacteria 3749
710 Ga0207705_10060329 3300025909 Bacteria 2739
711 Ga0207684_10002070 3300025910 Bacteria 20640
712 Ga0207684_10031033 3300025910 Bacteria 4548
713 Ga0207654_10028201 3300025911 Bacteria 3060
714 Ga0207654_10036040 3300025911 Bacteria 2761
715 Ga0207654_10051850 3300025911 Bacteria 2363
716 Ga0207654_10141122 3300025911 Bacteria 1536
717 Ga0207707_10010626 3300025912 Bacteria 7996
718 Ga0207707_10016028 3300025912 Bacteria 6536
719 Ga0207707_10026595 3300025912 Bacteria 5057
720 Ga0207707_10040244 3300025912 Bacteria 4082
721 Ga0207695_10005351 3300025913 Bacteria 17072
722 Ga0207695_10023926 3300025913 Bacteria 6890
723 Ga0207695_10109358 3300025913 Bacteria 2746
724 Ga0207695_10261501 3300025913 Bacteria 1628
725 Ga0207671_10017114 3300025914 Bacteria 5604
726 Ga0207671_10032445 3300025914 Bacteria 3888
727 Ga0207693_10004206 3300025915 Bacteria 12205
728 Ga0207693_10024167 3300025915 Bacteria 4825
729 Ga0207660_10023901 3300025917 Bacteria 4132
730 Ga0207660_10061869 3300025917 Bacteria 2696
731 Ga0207660_10083826 3300025917 Bacteria 2348
732 Ga0207660_10123348 3300025917 Bacteria 1965
733 Ga0207660_10215822 3300025917 Bacteria 1504
734 Ga0207662_10061126 3300025918 Bacteria 2261
735 Ga0207657_10000447 3300025919 Bacteria 43815
736 Ga0207657_10003605 3300025919 Bacteria 16496
737 Ga0207657_10004258 3300025919 Bacteria 15161
738 Ga0207657_10027949 3300025919 Bacteria 5156
739 Ga0207649_10029633 3300025920 Bacteria 3233
740 Ga0207649_10051595 3300025920 Bacteria 2548
741 Ga0207649_10091531 3300025920 Bacteria 1992
742 Ga0207649_10111273 3300025920 Bacteria 1830
743 Ga0207652_10012394 3300025921 Bacteria 6889
744 Ga0207652_10015269 3300025921 Bacteria 6234
745 Ga0207652_10212603 3300025921 Bacteria 1742
746 Ga0207646_10002045 3300025922 Bacteria 24234
747 Ga0207646_10030455 3300025922 Bacteria 4891
748 Ga0207646_10083481 3300025922 Bacteria 2857
749 Ga0207646_10090569 3300025922 Bacteria 2738
750 Ga0207681_10043137 3300025923 Bacteria 3017
751 Ga0207681_10058220 3300025923 Bacteria 2645
752 Ga0207681_10063816 3300025923 Bacteria 2541
753 Ga0207681_10075638 3300025923 Bacteria 2362
754 Ga0207681_10081392 3300025923 Bacteria 2286
755 Ga0207681_10118513 3300025923 Bacteria 1938
756 Ga0207694_10017482 3300025924 Bacteria 5419
757 Ga0207694_10056941 3300025924 Bacteria 3037
758 Ga0207694_10079876 3300025924 Bacteria 2566
759 Ga0207650_10003707 3300025925 Bacteria 10445
760 Ga0207650_10014826 3300025925 Bacteria 5421
761 Ga0207650_10056430 3300025925 Bacteria 2918
762 Ga0207650_10096580 3300025925 Bacteria 2267
763 Ga0207650_10138665 3300025925 Bacteria 1910
764 Ga0207650_10225635 3300025925 Bacteria 1509
765 Ga0207659_10002055 3300025926 Bacteria 11945
766 Ga0207659_10002947 3300025926 Bacteria 10134
767 Ga0207659_10003098 3300025926 Bacteria 9930
768 Ga0207659_10058394 3300025926 Bacteria 2769
769 Ga0207687_10209821 3300025927 Bacteria 1527
770 Ga0207687_10213026 3300025927 Bacteria 1517
771 Ga0207700_10022967 3300025928 Bacteria 4289
772 Ga0207700_10032950 3300025928 Bacteria 3702
773 Ga0207700_10040172 3300025928 Bacteria 3413
774 Ga0207700_10139194 3300025928 Bacteria 1992
775 Ga0207700_10195604 3300025928 Bacteria 1701
776 Ga0207664_10050500 3300025929 Bacteria 3280
777 Ga0207664_10081866 3300025929 Bacteria 2628
778 Ga0207664_10090116 3300025929 Bacteria 2512
779 Ga0207644_10000130 3300025931 Bacteria 54417
780 Ga0207644_10002085 3300025931 Bacteria 12942
781 Ga0207644_10022846 3300025931 Bacteria 4276
782 Ga0207644_10067704 3300025931 Bacteria 2603
783 Ga0207644_10165726 3300025931 Bacteria 1721
784 Ga0207690_10003996 3300025932 Bacteria 8718
785 Ga0207690_10013485 3300025932 Bacteria 4912
786 Ga0207690_10037637 3300025932 Bacteria 3142
787 Ga0207690_10064410 3300025932 Bacteria 2503
788 Ga0207706_10000156 3300025933 Bacteria 75583
789 Ga0207706_10016017 3300025933 Bacteria 6775
790 Ga0207706_10025996 3300025933 Bacteria 5242
791 Ga0207706_10036971 3300025933 Bacteria 4336
792 Ga0207706_10054917 3300025933 Bacteria 3514
793 Ga0207706_10070546 3300025933 Bacteria 3073
794 Ga0207686_10011790 3300025934 Bacteria 4794
795 Ga0207686_10128851 3300025934 Bacteria 1733
796 Ga0207709_10000111 3300025935 Bacteria 127580
797 Ga0207709_10044565 3300025935 Bacteria 2681
798 Ga0207670_10004647 3300025936 Bacteria 7440
799 Ga0207670_10167009 3300025936 Bacteria 1647
800 Ga0207704_10010368 3300025938 Bacteria 4544
801 Ga0207704_10034820 3300025938 Bacteria 2878
802 Ga0207665_10002266 3300025939 Bacteria 12985
803 Ga0207691_10003386 3300025940 Bacteria 15512
804 Ga0207691_10010432 3300025940 Bacteria 8913
805 Ga0207691_10011577 3300025940 Bacteria 8471
806 Ga0207691_10019285 3300025940 Bacteria 6456
807 Ga0207691_10022541 3300025940 Bacteria 5937
808 Ga0207691_10032593 3300025940 Bacteria 4858
809 Ga0207691_10053626 3300025940 Bacteria 3681
810 Ga0207691_10057599 3300025940 Bacteria 3536
811 Ga0207711_10020362 3300025941 Bacteria 5530
812 Ga0207711_10021326 3300025941 Bacteria 5413
813 Ga0207711_10035493 3300025941 Bacteria 4226
814 Ga0207711_10053726 3300025941 Bacteria 3455
815 Ga0207711_10165679 3300025941 Bacteria 2003
816 Ga0207711_10174904 3300025941 Bacteria 1950
817 Ga0207689_10001818 3300025942 Bacteria 20157
818 Ga0207689_10015442 3300025942 Bacteria 6465
819 Ga0207661_10086402 3300025944 Bacteria 2603
820 Ga0207679_10007093 3300025945 Bacteria 7101
821 Ga0207679_10012131 3300025945 Bacteria 5609
822 Ga0207679_10033943 3300025945 Bacteria 3595
823 Ga0207679_10037700 3300025945 Bacteria 3438
824 Ga0207679_10147866 3300025945 Bacteria 1908
825 Ga0207667_10006776 3300025949 Bacteria 13836
826 Ga0207667_10010777 3300025949 Bacteria 10663
827 Ga0207667_10016009 3300025949 Bacteria 8490
828 Ga0207667_10019277 3300025949 Bacteria 7621
829 Ga0207667_10024536 3300025949 Bacteria 6618
830 Ga0207667_10110330 3300025949 Bacteria 2838
831 Ga0207667_10203748 3300025949 Bacteria 2029
832 Ga0207651_10001665 3300025960 Bacteria 10209
833 Ga0207651_10003976 3300025960 Bacteria 7344
834 Ga0207651_10005715 3300025960 Bacteria 6421
835 Ga0207651_10005940 3300025960 Bacteria 6322
836 Ga0207712_10008399 3300025961 Bacteria 6524
837 Ga0207712_10070498 3300025961 Bacteria 2511
838 Ga0207712_10206932 3300025961 Bacteria 1560
839 Ga0207668_10015585 3300025972 Bacteria 4725
840 Ga0207668_10084585 3300025972 Bacteria 2312
841 Ga0207668_10107123 3300025972 Bacteria 2089
842 Ga0207668_10134384 3300025972 Bacteria 1893
843 Ga0207668_10240887 3300025972 Bacteria 1463
844 Ga0207640_10037866 3300025981 Bacteria 3038
845 Ga0207640_10075079 3300025981 Bacteria 2290
846 Ga0207640_10101284 3300025981 Bacteria 2020
847 Ga0207658_10004458 3300025986 Bacteria 9728
848 Ga0207658_10004645 3300025986 Bacteria 9520
849 Ga0207658_10050936 3300025986 Bacteria 3049
850 Ga0207658_10083767 3300025986 Bacteria 2452
851 Ga0207677_10007151 3300026023 Bacteria 6147
852 Ga0207677_10018191 3300026023 Bacteria 4213
853 Ga0207677_10033477 3300026023 Bacteria 3317
854 Ga0207677_10040300 3300026023 Bacteria 3078
855 Ga0207677_10173075 3300026023 Bacteria 1690
856 Ga0207703_10002546 3300026035 Bacteria 15741
857 Ga0207703_10009968 3300026035 Bacteria 7451
858 Ga0207703_10012912 3300026035 Bacteria 6510
859 Ga0207703_10016647 3300026035 Bacteria 5734
860 Ga0207703_10042121 3300026035 Bacteria 3661
861 Ga0207703_10092086 3300026035 Bacteria 2551
862 Ga0207639_10013143 3300026041 Bacteria 5785
863 Ga0207639_10013776 3300026041 Bacteria 5670
864 Ga0207639_10059696 3300026041 Bacteria 2939
865 Ga0207639_10076160 3300026041 Bacteria 2641
866 Ga0207639_10126648 3300026041 Bacteria 2107
867 Ga0207639_10131754 3300026041 Bacteria 2071
868 Ga0207678_10030122 3300026067 Bacteria 4738
869 Ga0207678_10043272 3300026067 Bacteria 3897
870 Ga0207678_10050007 3300026067 Bacteria 3612
871 Ga0207678_10083673 3300026067 Bacteria 2729
872 Ga0207678_10149880 3300026067 Bacteria 1991
873 Ga0207678_10157414 3300026067 Bacteria 1940
874 Ga0207708_10001026 3300026075 Bacteria 20900
875 Ga0207708_10021822 3300026075 Bacteria 4831
876 Ga0207708_10092172 3300026075 Bacteria 2337
877 Ga0207708_10153052 3300026075 Bacteria 1817
878 Ga0207702_10002083 3300026078 Bacteria 19317
879 Ga0207702_10075064 3300026078 Bacteria 2920
880 Ga0207702_10133219 3300026078 Bacteria 2239
881 Ga0207641_10016950 3300026088 Bacteria 5964
882 Ga0207641_10032784 3300026088 Bacteria 4314
883 Ga0207641_10037962 3300026088 Bacteria 4025
884 Ga0207641_10091037 3300026088 Bacteria 2669
885 Ga0207641_10235396 3300026088 Bacteria 1704
886 Ga0207648_10000179 3300026089 Bacteria 66602
887 Ga0207648_10001876 3300026089 Bacteria 22992
888 Ga0207648_10002319 3300026089 Bacteria 20537
889 Ga0207648_10006478 3300026089 Bacteria 11630
890 Ga0207648_10006871 3300026089 Bacteria 11280
891 Ga0207648_10015767 3300026089 Bacteria 6932
892 Ga0207648_10021732 3300026089 Bacteria 5765
893 Ga0207648_10025102 3300026089 Bacteria 5314
894 Ga0207648_10047779 3300026089 Bacteria 3750
895 Ga0207648_10050843 3300026089 Bacteria 3623
896 Ga0207648_10057806 3300026089 Bacteria 3384
897 Ga0207648_10082099 3300026089 Bacteria 2811
898 Ga0207676_10001487 3300026095 Bacteria 17339
899 Ga0207676_10008447 3300026095 Bacteria 7323
900 Ga0207676_10009407 3300026095 Bacteria 6955
901 Ga0207676_10014048 3300026095 Bacteria 5751
902 Ga0207674_10004569 3300026116 Bacteria 16624
903 Ga0207674_10013444 3300026116 Bacteria 9085
904 Ga0207674_10041207 3300026116 Bacteria 4777
905 Ga0207674_10137304 3300026116 Bacteria 2406
906 Ga0207674_10188323 3300026116 Bacteria 2013
907 Ga0207675_100000704 3300026118 Bacteria 33126
908 Ga0207675_100001602 3300026118 Bacteria 22678
909 Ga0207675_100021533 3300026118 Bacteria 6004
910 Ga0207675_100022891 3300026118 Bacteria 5812
911 Ga0207675_100044251 3300026118 Bacteria 4159
912 Ga0207675_100046449 3300026118 Bacteria 4057
913 Ga0207675_100110243 3300026118 Bacteria 2597
914 Ga0207675_100129843 3300026118 Bacteria 2389
915 Ga0207675_100222980 3300026118 Bacteria 1817
916 Ga0207683_10013324 3300026121 Bacteria 7011
917 Ga0207683_10024002 3300026121 Bacteria 5248
918 Ga0207683_10026397 3300026121 Bacteria 5012
919 Ga0207683_10060473 3300026121 Bacteria 3330
920 Ga0207683_10079558 3300026121 Bacteria 2906
921 Ga0207683_10096370 3300026121 Bacteria 2638
922 Ga0207698_10001892 3300026142 Bacteria 12258
923 Ga0207698_10004332 3300026142 Bacteria 8639
924 Ga0207698_10020098 3300026142 Bacteria 4590
925 Ga0207698_10064780 3300026142 Bacteria 2866
926 Ga0207698_10065155 3300026142 Bacteria 2860
927 Ga0207698_10151001 3300026142 Bacteria 2016
928 Ga0209281_1000007 3300027111 Bacteria 938265
929 Ga0209281_1000455 3300027111 Bacteria 58143
930 Ga0209389_1000249 3300027296 Bacteria 34712
931 Ga0209371_1000061 3300027312 Bacteria 223014
932 Ga0209371_1000082 3300027312 Bacteria 184560
933 Ga0209371_1000119 3300027312 Bacteria 133367
934 Ga0209371_1000230 3300027312 Bacteria 71436
935 Ga0209371_1001086 3300027312 Bacteria 20323
936 Ga0209371_1001324 3300027312 Bacteria 17288
937 Ga0209371_1002070 3300027312 Bacteria 11949
938 Ga0210000_1002971 3300027462 Bacteria 2423
939 Ga0209999_1000743 3300027543 Bacteria 5317
940 Ga0209970_1000108 3300027614 Bacteria 11841
941 Ga0209983_1009217 3300027665 Bacteria 2017
942 Ga0209282_1000053 3300027666 Bacteria 103311
943 Ga0209282_1000250 3300027666 Bacteria 26928
944 Ga0209588_1004210 3300027671 Bacteria 4044
945 Ga0209971_1001384 3300027682 Bacteria 6026
946 Ga0209966_1006236 3300027695 Bacteria 2067
947 Ga0209974_10006556 3300027876 Bacteria 4060
948 Ga0209974_10006964 3300027876 Bacteria 3914
949 Ga0209974_10029859 3300027876 Bacteria 1807
950 Ga0207428_10003201 3300027907 Bacteria 16012
951 Ga0268266_10059218 3300028379 Bacteria 3299
952 Ga0268266_10095949 3300028379 Bacteria 2605
953 Ga0268266_10304796 3300028379 Bacteria 1487
954 Ga0268265_10004089 3300028380 Bacteria 10253
955 Ga0268265_10013992 3300028380 Bacteria 5463
956 Ga0268265_10076950 3300028380 Bacteria 2619
957 Ga0268265_10246391 3300028380 Bacteria 1580
958 Ga0268264_10000613 3300028381 Bacteria 42687
959 Ga0268264_10037899 3300028381 Bacteria 3976
960 Ga0268264_10073697 3300028381 Bacteria 2898
961 Ga0268264_10248016 3300028381 Bacteria 1653
962 Ga0268264_10271995 3300028381 Bacteria 1583
963 Ga0307517_10001395 3300028786 Bacteria 40607
964 Ga0307515_10000011 3300028794 Bacteria 633903
965 Ga0307515_10000213 3300028794 Bacteria 142742
966 Ga0307515_10000472 3300028794 Bacteria 96172
967 Ga0307515_10000655 3300028794 Bacteria 79837
968 Ga0307515_10003487 3300028794 Bacteria 33051
969 Ga0307515_10009632 3300028794 Bacteria 18642
970 Ga0307515_10048317 3300028794 Bacteria 6436
971 Ga0307515_10069340 3300028794 Bacteria 4822
972 Ga0307515_10201563 3300028794 Bacteria 1864
973 Ga0268256_1000059 3300030500 Bacteria 223875
974 Ga0268256_1000072 3300030500 Bacteria 184436
975 Ga0268256_1000096 3300030500 Bacteria 139457
976 Ga0268256_1001132 3300030500 Bacteria 17288
977 Ga0268256_1004087 3300030500 Bacteria 6237
978 Ga0268256_1009796 3300030500 Bacteria 3146
979 Ga0307511_10000043 3300030521 Bacteria 101232
980 Ga0316183_1035885 3300030742 Bacteria 2538
981 Ga0316182_1411781 3300030745 Bacteria 2360
982 Ga0265330_10000046 3300031235 Bacteria 108853
983 Ga0265332_10000028 3300031238 Bacteria 184029
984 Ga0265332_10000125 3300031238 Bacteria 63932
985 Ga0265332_10000951 3300031238 Bacteria 17144
986 Ga0265328_10003818 3300031239 Bacteria 6620
987 Ga0265328_10022676 3300031239 Bacteria 2387
988 Ga0265331_10001806 3300031250 Bacteria 15206
989 Ga0265327_10000012 3300031251 Bacteria 530403
990 Ga0265327_10001288 3300031251 Bacteria 32919
991 Ga0265327_10010084 3300031251 Bacteria 6702
992 Ga0265327_10011638 3300031251 Bacteria 6033
993 Ga0265327_10022614 3300031251 Bacteria 3751
994 Ga0265327_10034279 3300031251 Bacteria 2819
995 Ga0265316_10053940 3300031344 Bacteria 3148
996 Ga0265316_10224581 3300031344 Bacteria 1385
997 Ga0307513_10000117 3300031456 Bacteria 110951
998 Ga0307513_10002745 3300031456 Bacteria 24211
999 Ga0307513_10003270 3300031456 Bacteria 22086
1000 Ga0307513_10008037 3300031456 Bacteria 13552
1001 Ga0307513_10203007 3300031456 Bacteria 1821
1002 Ga0307509_10003946 3300031507 Bacteria 21881
1003 Ga0307509_10005133 3300031507 Bacteria 18400
1004 Ga0307509_10046715 3300031507 Bacteria 4660
1005 Ga0307509_10072791 3300031507 Bacteria 3579
1006 Ga0307509_10113339 3300031507 Bacteria 2709
1007 Ga0307408_100000023 3300031548 Bacteria 295931
1008 Ga0307408_100000101 3300031548 Bacteria 94089
1009 Ga0307408_100001843 3300031548 Bacteria 15443
1010 Ga0307408_100004804 3300031548 Bacteria 9103
1011 Ga0307408_100006023 3300031548 Bacteria 8070
1012 Ga0307408_100016090 3300031548 Bacteria 4987
1013 Ga0307408_100055479 3300031548 Bacteria 2869
1014 Ga0307408_100085525 3300031548 Bacteria 2368
1015 Ga0307508_10000404 3300031616 Bacteria 51734
1016 Ga0307508_10003052 3300031616 Bacteria 17219
1017 Ga0307514_10012483 3300031649 Bacteria 7066
1018 Ga0307514_10089293 3300031649 Bacteria 2252
1019 Ga0316575_10006695 3300031665 Bacteria 4158
1020 Ga0316579_10000811 3300031691 Bacteria 10796
1021 Ga0316579_10001459 3300031691 Bacteria 8597
1022 Ga0265314_10000054 3300031711 Bacteria 184029
1023 Ga0265314_10001039 3300031711 Bacteria 32357
1024 Ga0316576_10009121 3300031727 Bacteria 6388
1025 Ga0316576_10011214 3300031727 Bacteria 5861
1026 Ga0316578_10035796 3300031728 Bacteria 2855
1027 Ga0307516_10001586 3300031730 Bacteria 31257
1028 Ga0307516_10002443 3300031730 Bacteria 24860
1029 Ga0307516_10002741 3300031730 Bacteria 23228
1030 Ga0307516_10020817 3300031730 Bacteria 6769
1031 Ga0307405_10012732 3300031731 Bacteria 4467
1032 Ga0307405_10055945 3300031731 Bacteria 2471
1033 Ga0307405_10071978 3300031731 Bacteria 2226
1034 Ga0307413_10001940 3300031824 Bacteria 8214
1035 Ga0307410_10002072 3300031852 Bacteria 9489
1036 Ga0307410_10009283 3300031852 Bacteria 5510
1037 Ga0307410_10022186 3300031852 Bacteria 3919
1038 Ga0307406_10005067 3300031901 Bacteria 7184
1039 Ga0307406_10006267 3300031901 Bacteria 6555
1040 Ga0307406_10006712 3300031901 Bacteria 6364
1041 Ga0307406_10017326 3300031901 Bacteria 4195
1042 Ga0307406_10042617 3300031901 Bacteria 2834
1043 Ga0307406_10087961 3300031901 Bacteria 2083
1044 Ga0307407_10113724 3300031903 Bacteria 1704
1045 Ga0307412_10003320 3300031911 Bacteria 8939
1046 Ga0307409_100009728 3300031995 Bacteria 5927
1047 Ga0307409_100042544 3300031995 Bacteria 3403
1048 Ga0307409_100142685 3300031995 Bacteria 2066
1049 Ga0307409_100162078 3300031995 Bacteria 1957
1050 Ga0307409_100213215 3300031995 Bacteria 1737
1051 Ga0307409_100263934 3300031995 Bacteria 1582
1052 Ga0307416_100006880 3300032002 Bacteria 7160
1053 Ga0307416_100016563 3300032002 Bacteria 5128
1054 Ga0307416_100175287 3300032002 Bacteria 2002
1055 Ga0307416_100196800 3300032002 Bacteria 1907
1056 Ga0307414_10066022 3300032004 Bacteria 2584
1057 Ga0307414_10134074 3300032004 Bacteria 1928
1058 Ga0307414_10180484 3300032004 Bacteria 1697
1059 Ga0307411_10002409 3300032005 Bacteria 8250
1060 Ga0307411_10008303 3300032005 Bacteria 5367
1061 Ga0307411_10034617 3300032005 Bacteria 3145
1062 Ga0307415_100003806 3300032126 Bacteria 7735
1063 Ga0316593_10023515 3300032168 Bacteria 1945
1064 Ga0307507_10075769 3300033179 Bacteria 3006
1065 Ga0307507_10111544 3300033179 Bacteria 2232
1066 Ga0307510_10035314 3300033180 Bacteria 5586
1067 Ga0307510_10045636 3300033180 Bacteria 4726
1068 Ga0316588_1003205 3300033528 Bacteria 2954
1069 Ga0316596_1019472 3300033541 Bacteria 1722
1070 Ga0373926_0029136 3300035083 Bacteria 1940
1071 Ga0373932_0011766 3300035112 Bacteria 2144
1072 Ga0373943_0035289 3300035170 Bacteria 2389
1073 Ga0373955_0007829 3300035172 Bacteria 4928
1074 Ga0316574_0000070 3300035398 Bacteria 27753
1075 Ga0316574_0004300 3300035398 Bacteria 7441
1076 Ga0373931_0010378 3300035691 Bacteria 4476
1077 Ga0373931_0017241 3300035691 Bacteria 3568
1078 Ga0373935_0067325 3300035692 Bacteria 2302
1079 Ga0373927_0001348 3300035695 Bacteria 18517
1080 Ga0373927_0031512 3300035695 Bacteria 3455
1081 Ga0373927_0042538 3300035695 Bacteria 2943
1082 Ga0373947_0054512 3300035725 Bacteria 2413
1083 Ga0373947_0085900 3300035725 Bacteria 1955
1084 Ga0373937_0004911 3300036401 Bacteria 11367
1085 Ga0373937_0010376 3300036401 Bacteria 8135
1086 Ga0373937_0012886 3300036401 Bacteria 7365
1087 Ga0373937_0093628 3300036401 Bacteria 2786
1088 Ga0373937_0121982 3300036401 Bacteria 2429
1089 Ga0316582_0090752 3300036647 Bacteria 2010
1090 Ga0316584_0182065 3300036712 Bacteria 1555
1091 Ga0373925_0081460 3300037068 Bacteria 2461
1092 Ga0373925_0082078 3300037068 Bacteria 2452
1093 Ga0373925_0164082 3300037068 Bacteria 1751
1094 Ga0395899_0000080 3300037312 Bacteria 171568
1095 Ga0395899_0001691 3300037312 Bacteria 18397
1096 Ga0395899_0004014 3300037312 Bacteria 11598
1097 Ga0395899_0008709 3300037312 Bacteria 7811
1098 Ga0395899_0019141 3300037312 Bacteria 5203
1099 Ga0395899_0024423 3300037312 Bacteria 4569
1100 Ga0395899_0096300 3300037312 Bacteria 2140
1101 Ga0395899_0098267 3300037312 Bacteria 2115
1102 Ga0395899_0102772 3300037312 Bacteria 2062
1103 Ga0395900_0008285 3300037418 Bacteria 10700
1104 Ga0395900_0009158 3300037418 Bacteria 10143
1105 Ga0395900_0015158 3300037418 Bacteria 7859
1106 Ga0395900_0026870 3300037418 Bacteria 5890
1107 Ga0395900_0074221 3300037418 Bacteria 3497
1108 Ga0395900_0084101 3300037418 Bacteria 3269
1109 Ga0395898_0066398 3300037466 Bacteria 3495
1110 Ga0395898_0072998 3300037466 Bacteria 3314
1111 Ga0395898_0133020 3300037466 Bacteria 2381
1112 Ga0395905_0000043 3300037471 Bacteria 247469
1113 Ga0395905_0001875 3300037471 Bacteria 24218
1114 Ga0395905_0007970 3300037471 Bacteria 10471
1115 Ga0395905_0010328 3300037471 Bacteria 9086
1116 Ga0395905_0018407 3300037471 Bacteria 6629
1117 Ga0395905_0022866 3300037471 Bacteria 5910
1118 Ga0395905_0034452 3300037471 Bacteria 4754
1119 Ga0395905_0038287 3300037471 Bacteria 4499
1120 Ga0395905_0082764 3300037471 Bacteria 3007
1121 Ga0395905_0101488 3300037471 Bacteria 2701
1122 Ga0395905_0202737 3300037471 Bacteria 1859
1123 Ga0395905_0249584 3300037471 Bacteria 1658
1124 Ga0395901_0013302 3300038443 Bacteria 8358
1125 Ga0395901_0022794 3300038443 Bacteria 6420
1126 Ga0395901_0022795 3300038443 Bacteria 6419
1127 Ga0395901_0036328 3300038443 Bacteria 5091
1128 Ga0395901_0055485 3300038443 Bacteria 4120
1129 Ga0395901_0097568 3300038443 Bacteria 3081
1130 Ga0395901_0115496 3300038443 Bacteria 2819
1131 Ga0395901_0121820 3300038443 Bacteria 2741
1132 Ga0395901_0190642 3300038443 Bacteria 2150
1133 Ga0395901_0213305 3300038443 Bacteria 2020
1134 Ga0395901_0324211 3300038443 Bacteria 1593
1135 Ga0436365_0450647 3300039437 Bacteria 5200
1136 Ga0436365_1569295 3300039437 Bacteria 3751
1137 Ga0436360_0038189 3300039438 Bacteria 2113
1138 Ga0436361_0101461 3300039447 Bacteria 19447
1139 Ga0436361_0289802 3300039447 Bacteria 31851
1140 Ga0436361_0487065 3300039447 Bacteria 63556
1141 Ga0436361_0523658 3300039447 Bacteria 15267
1142 Ga0436362_0477984 3300039453 Bacteria 2462
1143 Ga0439436_0004746 3300041404 Bacteria 4168
1144 Ga0439436_0004770 3300041404 Bacteria 4159
1145 Ga0439436_0010792 3300041404 Bacteria 2784
1146 Ga0439447_001550 3300041407 Bacteria 8402
1147 Ga0439466_0000011 3300041411 Bacteria 221134
1148 Ga0439466_0020815 3300041411 Bacteria 2333
1149 Ga0439465_0004682 3300041413 Bacteria 4413
1150 Ga0451853_2018397 3300041512 Bacteria 2495
1151 Ga0439431_0002356 3300041997 Bacteria 4179
1152 Ga0439431_0021691 3300041997 Bacteria 1543
1153 Ga0439433_0006012 3300041999 Bacteria 2609
1154 Ga0439437_001073 3300042000 Bacteria 2862
1155 Ga0439442_006447 3300042002 Bacteria 2356
1156 Ga0439445_0001102 3300042004 Bacteria 5773
1157 Ga0439432_002129 3300042006 Bacteria 7457
1158 Ga0439449_0000187 3300042007 Bacteria 21694
1159 Ga0439449_0000620 3300042007 Bacteria 13287
1160 Ga0439449_0001584 3300042007 Bacteria 8924
1161 Ga0439452_002955 3300042010 Bacteria 6052
1162 Ga0439452_004200 3300042010 Bacteria 4880
1163 Ga0439456_007254 3300042013 Bacteria 2272
1164 Ga0439462_0002391 3300042015 Bacteria 4351
1165 Ga0450911_000281 3300042115 Bacteria 18766
1166 Ga0450890_002116 3300042127 Bacteria 2780
1167 Ga0450889_000109 3300042144 Bacteria 8111
1168 Ga0450906_008422 3300042145 Bacteria 1995
1169 Ga0450907_000007 3300042146 Bacteria 111445
1170 Ga0450910_002890 3300042147 Bacteria 2263
1171 Ga0439446_0002089 3300042156 Bacteria 4744
1172 Ga0439446_0002260 3300042156 Bacteria 4600
1173 Ga0439446_0011612 3300042156 Bacteria 2394
1174 Ga0439434_0001503 3300042435 Bacteria 6708
1175 Ga0439434_0007932 3300042435 Bacteria 3112
1176 Ga0439434_0010725 3300042435 Bacteria 2703
1177 Ga0439435_0000773 3300042436 Bacteria 5374
1178 Ga0439435_0023924 3300042436 Bacteria 1607
1179 Ga0439464_0012317 3300042439 Bacteria 2276
1180 Ga0450918_000158 3300042531 Bacteria 14950
1181 Ga0450893_0001452 3300042532 Bacteria 3636
1182 Ga0451577_0000276 3300042876 Bacteria 99531
1183 Ga0451577_0001377 3300042876 Bacteria 32574
1184 Ga0451577_0037888 3300042876 Bacteria 4339
1185 Ga0451577_0065997 3300042876 Bacteria 3227
1186 Ga0451577_0096803 3300042876 Bacteria 2635
1187 Ga0451577_0109094 3300042876 Bacteria 2475
1188 Ga0451577_0135954 3300042876 Bacteria 2207
1189 Ga0466969_0004750 3300044656 Bacteria 7230
1190 Ga0466969_0006748 3300044656 Bacteria 6104
1191 Ga0466972_0008433 3300044658 Bacteria 5167
1192 Ga0453683_0007502 3300044673 Bacteria 7392
1193 Ga0453683_0018762 3300044673 Bacteria 4438
1194 Ga0466965_0006837 3300044683 Bacteria 5210
1195 Ga0466965_0063016 3300044683 Bacteria 1855
1196 Ga0466966_0020148 3300044684 Bacteria 4389
1197 Ga0466961_0014008 3300044693 Bacteria 5140
1198 Ga0466961_0069024 3300044693 Bacteria 2244
1199 Ga0466961_0089172 3300044693 Bacteria 1948
1200 Ga0453684_0000891 3300044712 Bacteria 99637
1201 Ga0453684_0001215 3300044712 Bacteria 79022
1202 Ga0453684_0063372 3300044712 Bacteria 4729
1203 Ga0453684_0074838 3300044712 Bacteria 4261
1204 Ga0453684_0275004 3300044712 Bacteria 1923
1205 Ga0453684_0279876 3300044712 Bacteria 1903
1206 Ga0466971_0030247 3300044719 Bacteria 2423
1207 Ga0466957_0055469 3300044842 Bacteria 2422
1208 Ga0466959_0126070 3300045049 Bacteria 1817
1209 Ga0451576_0000381 3300045051 Bacteria 104080
1210 Ga0451576_0001248 3300045051 Bacteria 44697
1211 Ga0451576_0004449 3300045051 Bacteria 18194
1212 Ga0451576_0023570 3300045051 Bacteria 6663
1213 Ga0451576_0025162 3300045051 Bacteria 6417
1214 Ga0451576_0037463 3300045051 Bacteria 5137
1215 Ga0451576_0073694 3300045051 Bacteria 3553
1216 Ga0451576_0075018 3300045051 Bacteria 3519
1217 Ga0451576_0095370 3300045051 Bacteria 3094
1218 Ga0451576_0102208 3300045051 Bacteria 2981
1219 Ga0451576_0108446 3300045051 Bacteria 2889
1220 Ga0451576_0112207 3300045051 Bacteria 2837
1221 Ga0451576_0137068 3300045051 Bacteria 2552
1222 Ga0451576_0246475 3300045051 Bacteria 1867
1223 Ga0466958_0005009 3300045836 Bacteria 7072
1224 Ga0466967_0168927 3300045976 Bacteria 2057
1225 Ga0466967_0184275 3300045976 Bacteria 1971
1226 Ga0495617_006149 3300046452 Bacteria 4225
1227 Ga0495627_006447 3300046453 Bacteria 4600
1228 Ga0495592_0000083 3300046454 Bacteria 83092
1229 Ga0495590_0004124 3300046457 Bacteria 5889
1230 Ga0495591_000010 3300046458 Bacteria 327794
1231 Ga0495591_001545 3300046458 Bacteria 14085
1232 Ga0495591_016234 3300046458 Bacteria 2603
1233 Ga0495653_0075170 3300046463 Bacteria 2515
1234 Ga0495650_0000034 3300046471 Bacteria 410132
1235 Ga0495650_0013823 3300046471 Bacteria 4243
1236 Ga0495580_0012135 3300046472 Bacteria 6626
1237 Ga0495605_0002892 3300046474 Bacteria 10422
1238 Ga0495639_0010783 3300046475 Bacteria 3933
1239 Ga0495639_0014230 3300046475 Bacteria 3443
1240 Ga0495664_0057886 3300046477 Bacteria 2306
1241 Ga0495596_0003191 3300046500 Bacteria 8438
1242 Ga0495596_0003690 3300046500 Bacteria 7654
1243 Ga0495607_0002446 3300046501 Bacteria 15121
1244 Ga0495607_0025190 3300046501 Bacteria 3702
1245 Ga0495606_0000511 3300046507 Bacteria 63022
1246 Ga0495608_0015861 3300046511 Bacteria 5214
1247 Ga0495610_0002147 3300046512 Bacteria 16766
1248 Ga0495610_0008257 3300046512 Bacteria 6772
1249 Ga0495616_0003177 3300046513 Bacteria 10604
1250 Ga0495616_0003776 3300046513 Bacteria 9662
1251 Ga0495620_0010395 3300046515 Bacteria 4912
1252 Ga0495631_0075004 3300046518 Bacteria 1460
1253 Ga0495632_0006527 3300046519 Bacteria 7487
1254 Ga0495632_0034565 3300046519 Bacteria 2586
1255 Ga0495632_0047082 3300046519 Bacteria 2140
1256 Ga0495643_0019675 3300046522 Bacteria 3902
1257 Ga0495643_0033289 3300046522 Bacteria 2853
1258 Ga0495644_0054049 3300046523 Bacteria 1508
1259 Ga0495648_0041629 3300046524 Bacteria 2899
1260 Ga0495648_0060928 3300046524 Bacteria 2243
1261 Ga0495642_0031685 3300046528 Bacteria 2120
1262 Ga0495652_0048893 3300046529 Bacteria 3622
1263 Ga0495654_0000151 3300046530 Bacteria 71530
1264 Ga0495654_0005248 3300046530 Bacteria 7561
1265 Ga0495654_0005475 3300046530 Bacteria 7363
1266 Ga0495654_0045127 3300046530 Bacteria 2176
1267 Ga0495665_0010247 3300046531 Bacteria 5072
1268 Ga0495587_0007225 3300046536 Bacteria 7207
1269 Ga0495598_0017969 3300046537 Bacteria 1831
1270 Ga0495597_0001315 3300046542 Bacteria 18215
1271 Ga0495597_0066425 3300046542 Bacteria 1563
1272 Ga0495645_0012915 3300046543 Bacteria 5896
1273 Ga0495645_0148003 3300046543 Bacteria 1634
1274 Ga0495667_0005954 3300046559 Bacteria 8251
1275 Ga0495656_0000090 3300046615 Bacteria 39387
1276 Ga0495656_0019103 3300046615 Bacteria 2641
1277 Ga0495625_0001055 3300046660 Bacteria 36138
1278 Ga0495625_0025375 3300046660 Bacteria 4496
1279 Ga0495635_0016210 3300046663 Bacteria 5201
1280 Ga0495635_0029296 3300046663 Bacteria 3827
1281 Ga0495599_0003944 3300046678 Bacteria 8726
1282 Ga0495623_0002115 3300046679 Bacteria 13286
1283 Ga0495647_0007199 3300046681 Bacteria 3720
1284 Ga0495658_0039464 3300046683 Bacteria 2619
1285 Ga0495669_0006300 3300046684 Bacteria 4954
1286 Ga0495669_0060059 3300046684 Bacteria 1718
1287 Ga0495613_0122850 3300046689 Bacteria 1863
1288 Ga0495671_0000586 3300046692 Bacteria 26926
1289 Ga0495649_0002049 3300046694 Bacteria 14526
1290 Ga0495649_0030910 3300046694 Bacteria 2955
1291 Ga0495660_0000020 3300046810 Bacteria 304768
1292 Ga0495660_0022000 3300046810 Bacteria 3645
1293 Ga0495660_0131274 3300046810 Bacteria 1256
1294 Ga0495581_0046287 3300047315 Bacteria 2513
1295 Ga0495672_0000011 3300047320 Bacteria 535362
1296 Ga0495672_0000040 3300047320 Bacteria 268573
1297 Ga0495676_0022957 3300047321 Bacteria 5421
1298 Ga0495680_0119611 3300047322 Bacteria 1946
1299 Ga0495683_0035539 3300047323 Bacteria 2532
1300 Ga0495687_001485 3300047443 Bacteria 21418
1301 Ga0495677_0020104 3300047445 Bacteria 2420
1302 Ga0495679_002610 3300047446 Bacteria 9059
1303 Ga0495685_052242 3300047447 Bacteria 1384
1304 Ga0495673_0000020 3300047469 Bacteria 548327
1305 Ga0495684_0138161 3300047471 Bacteria 1828
1306 Ga0495593_0023748 3300047673 Bacteria 3404
1307 Ga0495614_0026926 3300048089 Bacteria 2479
1308 Ga0496100_0089285 3300048903 Bacteria 2099
1309 Ga0496100_0115867 3300048903 Bacteria 1869
1310 Ga0496101_0000053 3300048904 Bacteria 139859
1311 Ga0496101_0041259 3300048904 Bacteria 3290
1312 Ga0496102_0003600 3300048905 Bacteria 13123
1313 Ga0496102_0060046 3300048905 Bacteria 3478
1314 Ga0496102_0082257 3300048905 Bacteria 2969
1315 Ga0496102_0085748 3300048905 Bacteria 2908
1316 Ga0496104_0006891 3300048907 Bacteria 10020
1317 Ga0496105_0003958 3300048908 Bacteria 11086
1318 Ga0496105_0010709 3300048908 Bacteria 7216
1319 Ga0496105_0079874 3300048908 Bacteria 2701
1320 Ga0496106_0032806 3300048909 Bacteria 3872
1321 Ga0496107_0037525 3300048910 Bacteria 3477
1322 Ga0496107_0137712 3300048910 Bacteria 1804
1323 Ga0496107_0162446 3300048910 Bacteria 1655
1324 Ga0496108_0275988 3300048911 Bacteria 1463
1325 Ga0496109_0118029 3300048912 Bacteria 2470
1326 Ga0496110_0008002 3300048913 Bacteria 8472
1327 Ga0496110_0167068 3300048913 Bacteria 1995
1328 Ga0496110_0176348 3300048913 Bacteria 1940
1329 Ga0496110_0219326 3300048913 Bacteria 1729
1330 Ga0496112_0081588 3300048915 Bacteria 3198
1331 Ga0496113_0036962 3300048916 Bacteria 3581
1332 Ga0496114_0083481 3300048917 Bacteria 2703
1333 Ga0496114_0084255 3300048917 Bacteria 2691
1334 Ga0496115_0027385 3300048918 Bacteria 4457
1335 Ga0496116_0000129 3300048919 Bacteria 158284
1336 Ga0496116_0000734 3300048919 Bacteria 41881
1337 Ga0496116_0006777 3300048919 Bacteria 10309
1338 Ga0496116_0009524 3300048919 Bacteria 8271
1339 Ga0496116_0044616 3300048919 Bacteria 3009
1340 Ga0496116_0053637 3300048919 Bacteria 2661
1341 Ga0496117_0000092 3300048920 Bacteria 202608
1342 Ga0496117_0000224 3300048920 Bacteria 106727
1343 Ga0496117_0011620 3300048920 Bacteria 7869
1344 Ga0496117_0015917 3300048920 Bacteria 6372
1345 Ga0496117_0074534 3300048920 Bacteria 2259
1346 Ga0496118_0000053 3300048921 Bacteria 235810
1347 Ga0496118_0000718 3300048921 Bacteria 53459
1348 Ga0496118_0006660 3300048921 Bacteria 12604
1349 Ga0496118_0041408 3300048921 Bacteria 3647
1350 Ga0496119_0000285 3300048922 Bacteria 70929
1351 Ga0496119_0000555 3300048922 Bacteria 50572
1352 Ga0496119_0002224 3300048922 Bacteria 21627
1353 Ga0496119_0005370 3300048922 Bacteria 12319
1354 Ga0496119_0067533 3300048922 Bacteria 2108
1355 Ga0496120_0000024 3300048923 Bacteria 236853
1356 Ga0496120_0000178 3300048923 Bacteria 107847
1357 Ga0496120_0000388 3300048923 Bacteria 70929
1358 Ga0496120_0000548 3300048923 Bacteria 57387
1359 Ga0496120_0001587 3300048923 Bacteria 26441
1360 Ga0496121_0000304 3300048924 Bacteria 102259
1361 Ga0496121_0005682 3300048924 Bacteria 15867
1362 Ga0496121_0027348 3300048924 Bacteria 5338
1363 Ga0496121_0029597 3300048924 Bacteria 5058
1364 Ga0496122_0001889 3300048925 Bacteria 31699
1365 Ga0496122_0009582 3300048925 Bacteria 10158
1366 Ga0496122_0010689 3300048925 Bacteria 9423
1367 Ga0496123_0001035 3300048926 Bacteria 42221
1368 Ga0496123_0002189 3300048926 Bacteria 24885
1369 Ga0496123_0003349 3300048926 Bacteria 18135
1370 Ga0496123_0019217 3300048926 Bacteria 5391
1371 Ga0496123_0027207 3300048926 Bacteria 4265
1372 Ga0496124_0000251 3300048927 Bacteria 103690
1373 Ga0496124_0001528 3300048927 Bacteria 33674
1374 Ga0496124_0026597 3300048927 Bacteria 5214
1375 Ga0496124_0059353 3300048927 Bacteria 3214
1376 Ga0496124_0064591 3300048927 Bacteria 3054
1377 Ga0496124_0081532 3300048927 Bacteria 2658
1378 Ga0496125_0001627 3300048928 Bacteria 31652
1379 Ga0496125_0007136 3300048928 Bacteria 11923
1380 Ga0496125_0037381 3300048928 Bacteria 4222
1381 Ga0496125_0041178 3300048928 Bacteria 3953
1382 Ga0496125_0067848 3300048928 Bacteria 2808
1383 Ga0495678_002665 3300049459 Bacteria 11815
1384 Ga0495682_0000022 3300049460 Bacteria 183265
1385 Ga0501291_006589 3300049514 Bacteria 1552
1386 Ga0501298_010776 3300049521 Bacteria 1578
1387 Ga0501298_018127 3300049521 Bacteria 1292
1388 Ga0501303_001929 3300049526 Bacteria 1572
1389 Ga0501034_0074934 3300049571 Bacteria 3392
1390 Ga0501036_0024340 3300049572 Bacteria 5104
1391 Ga0501036_0055815 3300049572 Bacteria 3347
1392 Ga0501039_0005064 3300049575 Bacteria 9993
1393 Ga0501039_0130938 3300049575 Bacteria 1969
1394 Ga0501040_0018020 3300049576 Bacteria 4688
1395 Ga0501041_0051976 3300049577 Bacteria 2498
1396 Ga0501041_0064562 3300049577 Bacteria 2242
1397 Ga0501042_0025236 3300049578 Bacteria 4174
1398 Ga0501042_0101347 3300049578 Bacteria 2071
1399 Ga0501042_0171251 3300049578 Bacteria 1566
1400 Ga0501043_0000057 3300049579 Bacteria 103997
1401 Ga0501046_0000075 3300049580 Bacteria 104000
1402 Ga0501046_0011964 3300049580 Bacteria 7403
1403 Ga0501047_0000081 3300049581 Bacteria 122697
1404 Ga0501047_0127977 3300049581 Bacteria 2420
1405 Ga0501048_0003517 3300049582 Bacteria 11908
1406 Ga0501048_0034983 3300049582 Bacteria 3619
1407 Ga0501069_0002412 3300049585 Bacteria 9502
1408 Ga0501070_0002316 3300049586 Bacteria 16713
1409 Ga0501070_0089982 3300049586 Bacteria 2540
1410 Ga0501070_0099387 3300049586 Bacteria 2407
1411 Ga0501071_0091465 3300049587 Bacteria 2235
1412 Ga0501072_0045021 3300049588 Bacteria 3469
1413 Ga0501072_0064683 3300049588 Bacteria 2884
1414 Ga0501073_0015213 3300049589 Bacteria 5581
1415 Ga0501073_0057209 3300049589 Bacteria 2727
1416 Ga0501074_0002551 3300049590 Bacteria 12709
1417 Ga0501075_0033424 3300049591 Bacteria 3826
1418 Ga0501076_0028788 3300049592 Bacteria 4317
1419 Ga0501076_0104655 3300049592 Bacteria 2284
1420 Ga0501211_001156 3300049658 Bacteria 2801
1421 Ga0501222_000664 3300049662 Bacteria 5028
1422 Ga0501227_004625 3300049665 Bacteria 2955
1423 Ga0501235_004422 3300049669 Bacteria 3035
1424 Ga0501249_006914 3300049679 Bacteria 2338
1425 Ga0501253_001878 3300049683 Bacteria 2254
1426 Ga0501221_000960 3300049704 Bacteria 4720
1427 Ga0501229_000783 3300049706 Bacteria 3588
1428 Ga0501079_0005427 3300049741 Bacteria 9500
1429 Ga0501079_0016872 3300049741 Bacteria 5576
1430 Ga0501079_0065864 3300049741 Bacteria 2795
1431 Ga0501080_0004208 3300049742 Bacteria 12772
1432 Ga0501080_0007125 3300049742 Bacteria 10095
1433 Ga0501080_0061602 3300049742 Bacteria 3493
1434 Ga0501080_0133218 3300049742 Bacteria 2300
1435 Ga0501081_0013820 3300049743 Bacteria 5313
1436 Ga0501081_0046984 3300049743 Bacteria 2969
1437 Ga0501083_0001718 3300049744 Bacteria 14921
1438 Ga0501083_0028189 3300049744 Bacteria 3872
1439 Ga0501262_000577 3300049759 Bacteria 4369
1440 Ga0501262_003349 3300049759 Bacteria 1834
1441 Ga0501283_001053 3300049779 Bacteria 3626
1442 Ga0501035_0248252 3300049822 Bacteria 1512
1443 Ga0501044_0065371 3300049823 Bacteria 3709
1444 Ga0501045_0004966 3300049824 Bacteria 9218
1445 Ga0501045_0010264 3300049824 Bacteria 6559
1446 Ga0501045_0023822 3300049824 Bacteria 4393
1447 Ga0501045_0057455 3300049824 Bacteria 2847
1448 nmdc:mga03683_19923_c1 3300050489 Bacteria 2567
1449 nmdc:mga03683_21456_c1 3300050489 Bacteria 2491
1450 nmdc:mga03n38_22636_c1 3300050490 Bacteria 2546
1451 nmdc:mga03n38_64134_c1 3300050490 Bacteria 1681
1452 nmdc:mga03n38_7643_c1 3300050490 Bacteria 3834
1453 nmdc:mga00v17_21665_c1 3300050491 Bacteria 3697
1454 nmdc:mga00v17_30925_c1 3300050491 Bacteria 3153
1455 nmdc:mga00v17_51405_c1 3300050491 Bacteria 2506
1456 nmdc:mga0yw44_110325_c1 3300050492 Bacteria 1762
1457 nmdc:mga0yw44_14581_c1 3300050492 Bacteria 4178
1458 nmdc:mga0yw44_785_c1 3300050492 Bacteria 5057
1459 nmdc:mga0yw44_90550_c1 3300050492 Bacteria 1932
1460 nmdc:mga0k408_100765_c1 3300050493 Bacteria 1703
1461 nmdc:mga0k408_101141_c1 3300050493 Bacteria 1699
1462 nmdc:mga0k408_118788_c1 3300050493 Bacteria 1565
1463 nmdc:mga0k408_13542_c1 3300050493 Bacteria 4476
1464 nmdc:mga0k408_138_c1 3300050493 Bacteria 36717
1465 nmdc:mga0k408_16735_c1 3300050493 Bacteria 4075
1466 nmdc:mga0k408_19960_c1 3300050493 Bacteria 3751
1467 nmdc:mga0k408_2064_c1 3300050493 Bacteria 10745
1468 nmdc:mga0k408_29331_c1 3300050493 Bacteria 3131
1469 nmdc:mga0k408_34607_c1 3300050493 Bacteria 2893
1470 nmdc:mga0k408_40887_c1 3300050493 Bacteria 2669
1471 nmdc:mga0k408_42033_c1 3300050493 Bacteria 2633
1472 nmdc:mga0k408_57440_c1 3300050493 Bacteria 2259
1473 nmdc:mga0k408_576_c1 3300050493 Bacteria 20303
1474 nmdc:mga0k408_5849_c1 3300050493 Bacteria 6553
1475 nmdc:mga0k408_7033_c1 3300050493 Bacteria 6006
1476 nmdc:mga0k408_7262_c1 3300050493 Bacteria 5921
1477 nmdc:mga0k408_7453_c1 3300050493 Bacteria 5843
1478 nmdc:mga0k408_8618_c1 3300050493 Bacteria 5479
1479 nmdc:mga0k408_93429_c1 3300050493 Bacteria 1769
1480 nmdc:mga06z11_18151_c1 3300050494 Bacteria 3208
1481 nmdc:mga07m45_11357_c1 3300050496 Bacteria 4677
1482 nmdc:mga07m45_1226_c1 3300050496 Bacteria 11616
1483 nmdc:mga07m45_28774_c1 3300050496 Bacteria 3068
1484 nmdc:mga07m45_31118_c1 3300050496 Bacteria 2297
1485 nmdc:mga07m45_32283_c1 3300050496 Bacteria 2904
1486 nmdc:mga07m45_3534_c1 3300050496 Bacteria 7549
1487 nmdc:mga07m45_4924_c1 3300050496 Bacteria 6581
1488 nmdc:mga07m45_639_c1 3300050496 Bacteria 13305
1489 nmdc:mga07m45_9657_c1 3300050496 Bacteria 5014
1490 nmdc:mga05p37_181_c1 3300050507 Bacteria 61821
1491 nmdc:mga05p37_21359_c1 3300050507 Bacteria 7840
1492 nmdc:mga05p37_241233_c1 3300050507 Bacteria 2173
1493 nmdc:mga09592_1507_c1 3300050508 Bacteria 18749
1494 nmdc:mga09592_239456_c1 3300050508 Bacteria 1572
1495 nmdc:mga09592_64009_c1 3300050508 Bacteria 3113
1496 nmdc:mga09592_64418_c1 3300050508 Bacteria 3103
1497 nmdc:mga06r32_33024_c1 3300050510 Bacteria 4873
1498 nmdc:mga06r32_73337_c1 3300050510 Bacteria 3316
1499 nmdc:mga08y16_14999_c1 3300050511 Bacteria 8151
1500 nmdc:mga08y16_18394_c1 3300050511 Bacteria 7366
1501 nmdc:mga08y16_224_c1 3300050511 Bacteria 50738
1502 nmdc:mga08y16_315156_c1 3300050511 Bacteria 1611
1503 nmdc:mga0n895_10661_c1 3300050512 Bacteria 8138
1504 nmdc:mga0n895_1144_c1 3300050512 Bacteria 19418
1505 nmdc:mga0n895_278806_c1 3300050512 Bacteria 1695
1506 nmdc:mga0rr50_42782_c1 3300050513 Bacteria 3310
1507 nmdc:mga0rr50_60153_c1 3300050513 Bacteria 2856
1508 nmdc:mga0rr50_7490_c1 3300050513 Bacteria 6737
1509 nmdc:mga08x19_175135_c1 3300050514 Bacteria 1462
1510 nmdc:mga08x19_219_c1 3300050514 Bacteria 43753
1511 nmdc:mga08x19_63571_c1 3300050514 Bacteria 2395
1512 nmdc:mga08x19_8071_c1 3300050514 Bacteria 6255
1513 nmdc:mga0a205_15430_c1 3300050515 Bacteria 7139
1514 nmdc:mga0sz30_10668_c1 3300050516 Bacteria 3526
1515 nmdc:mga0sz30_24146_c1 3300050516 Bacteria 2479
1516 nmdc:mga0sz30_6332_c1 3300050516 Bacteria 4391
1517 Ga0495601_0005224 3300053077 Bacteria 7554
1518 Ga0500610_0025769 3300053079 Bacteria 2936
1519 Ga0495619_0023985 3300053085 Bacteria 3912
1520 Ga0495619_0048368 3300053085 Bacteria 2802
1521 Ga0500578_0000652 3300053086 Bacteria 41736
1522 Ga0500646_0002088 3300053090 Bacteria 5207
1523 Ga0500651_0038486 3300053093 Bacteria 3013
1524 Ga0500593_011591 3300053117 Bacteria 3724
1525 Ga0500593_011860 3300053117 Bacteria 3683
1526 Ga0500594_0005824 3300053118 Bacteria 2743
1527 Ga0500621_000009 3300053126 Bacteria 173209
1528 Ga0500652_000885 3300053131 Bacteria 9913
1529 Ga0500658_0000507 3300053134 Bacteria 16624
1530 Ga0500658_0000854 3300053134 Bacteria 12508
1531 Ga0500658_0007664 3300053134 Bacteria 3988
1532 Ga0500559_0000019 3300053136 Bacteria 134862
1533 Ga0500559_0014012 3300053136 Bacteria 3389
1534 Ga0500568_0000554 3300053139 Bacteria 27551
1535 Ga0500574_000659 3300053141 Bacteria 4520
1536 Ga0500590_037396 3300053148 Bacteria 2508
1537 Ga0500616_0011698 3300053153 Bacteria 5168
1538 Ga0500616_0049014 3300053153 Bacteria 2237
1539 Ga0500619_001082 3300053154 Bacteria 4728
1540 Ga0500622_0000124 3300053156 Bacteria 81245
1541 Ga0500622_0003679 3300053156 Bacteria 10064
1542 Ga0500622_0005264 3300053156 Bacteria 7806
1543 Ga0500622_0018184 3300053156 Bacteria 3737
1544 Ga0500645_001181 3300053730 Bacteria 13913
1545 Ga0500645_010134 3300053730 Bacteria 3132
1546 Ga0500661_003043 3300055283 Bacteria 3151
1547 Ga0590071_001042 3300059421 Bacteria 7524
1548 Ga0501082_0059346 3300060353 Bacteria 3297
1549 Ga0501082_0092527 3300060353 Bacteria 2612
1550 Ga0501082_0201357 3300060353 Bacteria 1732
1551 Ga0501082_0258310 3300060353 Bacteria 1515
1552 2511244604 2511231002 Bacteria 5042903
1553 2511382598 2511231025 Bacteria 5324661
1554 2511435976 2511231035 Bacteria 5341610
1555 2513231038 2513020051 Bacteria 6053213
1556 2513955020 2513237150 Bacteria 6553639
1557 2514041404 2513237165 Bacteria 6771773
1558 2548499014 2547132374 Bacteria 5530232
1559 2550697409 2548876994 Bacteria 4904866
1560 2587728288 2585428057 Bacteria 6737412
1561 2587734506 2585428058 Bacteria 6853932
1562 2587754215 2585428062 Bacteria 6842168
1563 2588295004 2588253510 Bacteria 6901809
1564 2599623384 2599185214 Bacteria 8209958
1565 2599675398 2599185226 Bacteria 8233575
1566 2599680989 2599185227 Bacteria 8246414
1567 2599693004 2599185229 Bacteria 8216126
1568 2608671670 2608642108 Bacteria 4104624
1569 2643744991 2643221544 Bacteria 5886209
1570 2643867780 2643221570 Bacteria 5103772
1571 2643971158 2643221592 Bacteria 6608788
1572 2643991642 2643221596 Bacteria 5006805
1573 2644062187 2643221609 Bacteria 6756331
1574 2644071375 2643221611 Bacteria 6820941
1575 2644142076 2643221625 Bacteria 6512927
1576 2644161853 2643221628 Bacteria 5745828
1577 2644222768 2643221639 Bacteria 6649903
1578 2644246838 2643221644 Bacteria 6865017
1579 2644260688 2643221646 Bacteria 6433402
1580 2644276301 2643221648 Bacteria 6521465
1581 2644293389 2643221652 Bacteria 5140275
1582 2644301399 2643221654 Bacteria 5273570
1583 2644325550 2643221658 Bacteria 6064537
1584 2644399269 2643221672 Bacteria 6322190
1585 2644467046 2643221683 Bacteria 5749203
1586 2644648471 2643221717 Bacteria 5676132
1587 2687581166 2687453129 Bacteria 4387428
1588 2722881999 2721755523 Bacteria 6430384
1589 2738718206 2738541277 Bacteria 7458140
1590 2738880404 2738541307 Bacteria 8606193
1591 2739058935 2738541337 Bacteria 6183410
1592 2739245798 2738543012 Bacteria 7115078
1593 2739248288 2738543013 Bacteria 5618633
1594 2739281393 2738543019 Bacteria 7459457
1595 2809126721 2808606414 Bacteria 4917181
1596 2816470492 2816332133 Bacteria 7249298
1597 2819594809 2818991445 Bacteria 4955017
1598 2819600560 2818991446 Bacteria 7757362
1599 2831267714 2831265667 Bacteria 7184833
1600 2831869231 2831864461 Bacteria 6502356
1601 2834643046 2834641062 Bacteria 5559922
1602 2838061558 2838054893 Bacteria 7451788
1603 2839143975 2839138175 Bacteria 6549354
1604 2842677540 2842677519 Bacteria 5615038
1605 2842718737 2842718218 Bacteria 4560148
1606 2842736352 2842733646 Bacteria 5716726
1607 2842748860 2842747753 Bacteria 5578255
1608 2844532303 2844528606 Bacteria 4733806
1609 2847797675 2847797336 Bacteria 5176640
1610 2855732098 2855730933 Bacteria 7047938
1611 2855768806 2855767633 Bacteria 7049357
1612 2857579865 2857576091 Bacteria 5465855
1613 2865014898 2865014394 Bacteria 4764573
1614 2869552047 2869551831 Bacteria 5474685
1615 2876602561 2876601092 Bacteria 5114497
1616 2881102988 2881101125 Bacteria 4590519
1617 2881415244 2881412998 Bacteria 6492157
1618 2881612502 2881609920 Bacteria 4405319
1619 2884811695 2884811622 Bacteria 5552861
1620 2884841319 2884836552 Bacteria 5219991
1621 2884856193 2884852848 Bacteria 5221161
1622 2885196925 2885192300 Bacteria 5882526
1623 2885198816 2885198086 Bacteria 7212419
1624 2885211804 2885211737 Bacteria 7212420
1625 2894024348 2894023352 Bacteria 5167372
1626 2896156881 2896154374 Bacteria 5221518
1627 2899928293 2899924645 Bacteria 7487985
1628 2904451830 2904449895 Bacteria 6927402
1629 2904462513 2904456579 Bacteria 6819253
1630 2904481717 2904479285 Bacteria 5073931
1631 2904545117 2904541872 Bacteria 8915136
1632 2908674513 2908669403 Bacteria 5740494
1633 2919467186 2919462493 Bacteria 5817112
1634 2919707145 2919704043 Bacteria 5560311
1635 2928041245 2928037797 Bacteria 7273642
1636 2928048087 2928044640 Bacteria 7271509
1637 2928055928 2928051484 Bacteria 7773759
1638 2928066591 2928064002 Bacteria 7419480
1639 2928077255 2928070936 Bacteria 8062541
1640 2928087556 2928084124 Bacteria 7159212
1641 2928120674 2928115317 Bacteria 6477646
1642 2929165295 2929160207 Bacteria 9075316
1643 2929523626 2929520902 Bacteria 6765052
1644 2939605626 2939602548 Bacteria 4950493
1645 2939635840 2939631187 Bacteria 6118131
1646 2945910100 2945909444 Bacteria 7065066
1647 2945946132 2945945610 Bacteria 5951079
1648 2945955243 2945951305 Bacteria 4918162
1649 2945975732 2945972063 Bacteria 6086495
1650 2945987884 2945984333 Bacteria 7358892
1651 2954768818 2954767861 Bacteria 5535784
1652 2974320379 2974320154 Bacteria 4571377
1653 2978977721 2978975091 Bacteria 4704313
1654 2990713910 2990710928 Bacteria 5002431
1655 3003667376 3003665799 Bacteria 7279786
1656 644748182 644736347 Bacteria 6476522
1657 8003403085 8003400568 Bacteria 5535898
1658 8016737616 8016733728 Bacteria 5274317
1659 8019504220 8019499862 Bacteria 5169538
1660 8055434797 8055431914 Bacteria 4551896
1661 Ga0495625_0012405
1662 JGI24739J22299_10000107
1663 JGI25155J39150_1000022
1664 JGI25156J39149_1000005
1665 JGI25162J39368_1002554
1666 JGI25154J39366_1000017
1667 JGI25157J39369_1000003
1668 JGI25157J39369_1000747
1669 JGI25152J39213_1001428
1670 JGI25150J39212_1001994
1671 JGI25159J45721_1001646
1672 JGI25159J45721_1001983
1673 JGI25151J46595_10002783
1674 JGI25151J46595_10003777
1675 JGI25151J46595_10007702
1676 JGI25151J46595_10009716
1677 JGI25406J46586_10000977
1678 JGI25153J46596_10005438
1679 rootL2_10004438
1680 rootL2_10021412
1681 JGI25160J50197_1000273
1682 JGI25161J50226_1000095
1683 Ga0055532_1000271
1684 Ga0055525_1000004
1685 Ga0055527_1001088
1686 Ga0055535_1000380
1687 Ga0055542_1000062
1688 Ga0055526_1000968
1689 Ga0055526_1006110
1690 Ga0055526_1006746
1691 Ga0055526_1014527
1692 Ga0055537_1000483
1693 Ga0055537_1000717
1694 Ga0055537_1002502
1695 Ga0055524_1000073
1696 Ga0055524_1000658
1697 Ga0055524_1001688
1698 Ga0055524_1022732
1699 Ga0055536_1000060
1700 Ga0055536_1004647
1701 Ga0055536_1006788
1702 Ga0055536_1022945
1703 Ga0055534_1000337
1704 Ga0055534_1000467
1705 Ga0055534_1000548
1706 Ga0055534_1000929
1707 Ga0055534_1001861
1708 Ga0055528_1007433
1709 Ga0055530_10001136
1710 Ga0055530_10004473
1711 Ga0055530_10011023
1712 Ga0055540_1000037
1713 Ga0055540_1000202
1714 Ga0055540_1001461
1715 Ga0055540_1007521
1716 Ga0055531_10000007
1717 Ga0055531_10000112
1718 Ga0055531_10001286
1719 Ga0055531_10001923
1720 Ga0055531_10011360
1721 Ga0058692_1000039
1722 Ga0058692_1000291
1723 Ga0058692_1000442
1724 Ga0058692_1000709
1725 Ga0058692_1002728
1726 Ga0058692_1003453
1727 Ga0055543_1000218
1728 Ga0055543_1002869
1729 Ga0065165_1000016
1730 Ga0065165_1000942
1731 Ga0065165_1003934
1732 Ga0065165_1013762
1733 Ga0065165_1014362
1734 Ga0065704_10072179
1735 Ga0065704_10079023
1736 Ga0065715_10179597
1737 Ga0065707_10083647
1738 Ga0065707_10143859
1739 Ga0070658_10003011
1740 Ga0070658_10037598
1741 Ga0070658_10102728
1742 Ga0070658_10154433
1743 Ga0070676_10002537
1744 Ga0070676_10044429
1745 Ga0070683_100022694
1746 Ga0070683_100057870
1747 Ga0070690_100011726
1748 Ga0070670_100000655
1749 Ga0070670_100018023
1750 Ga0070670_100018207
1751 Ga0070670_100048709
1752 Ga0070670_100056163
1753 Ga0070670_100119152
1754 Ga0070670_100140245
1755 Ga0070670_100149189
1756 Ga0070677_10026317
1757 Ga0068869_100002039
1758 Ga0068869_100041135
1759 Ga0068869_100061697
1760 Ga0070666_10027838
1761 Ga0070680_100043209
1762 Ga0070680_100074544
1763 Ga0070680_100216976
1764 Ga0070682_100045907
1765 Ga0070682_100081811
1766 Ga0068868_100001312
1767 Ga0068868_100034469
1768 Ga0068868_100059565
1769 Ga0070660_100030267
1770 Ga0070660_100058604
1771 Ga0070660_100061785
1772 Ga0070689_100035794
1773 Ga0070661_100005150
1774 Ga0070661_100014669
1775 Ga0070661_100054923
1776 Ga0070661_100106474
1777 Ga0070661_100172581
1778 Ga0070661_100234732
1779 Ga0070692_10046303
1780 Ga0070668_100010679
1781 Ga0070668_100052341
1782 Ga0070668_100058264
1783 Ga0070668_100062460
1784 Ga0070669_100005401
1785 Ga0070669_100021493
1786 Ga0070669_100074591
1787 Ga0070669_100080628
1788 Ga0070675_100002072
1789 Ga0070675_100002276
1790 Ga0070675_100058320
1791 Ga0070675_100078798
1792 Ga0070675_100208047
1793 Ga0070671_100011136
1794 Ga0070671_100014642
1795 Ga0070671_100016334
1796 Ga0070671_100039869
1797 Ga0070671_100060152
1798 Ga0070671_100062719
1799 Ga0070671_100096888
1800 Ga0070671_100280307
1801 Ga0070674_100027721
1802 Ga0070674_100035402
1803 Ga0070674_100075881
1804 Ga0070674_100116276
1805 Ga0070673_100010612
1806 Ga0070673_100013521
1807 Ga0070673_100231207
1808 Ga0070659_100000722
1809 Ga0070659_100025249
1810 Ga0070659_100028792
1811 Ga0070659_100039166
1812 Ga0070659_100163697
1813 Ga0070667_100027408
1814 Ga0070667_100063891
1815 Ga0070667_100085520
1816 Ga0070667_100152503
1817 Ga0070709_10012257
1818 Ga0070709_10012358
1819 Ga0070709_10074315
1820 Ga0070709_10116577
1821 Ga0070714_100116842
1822 Ga0070713_100012928
1823 Ga0070713_100034409
1824 Ga0070713_100128246
1825 Ga0070710_10047349
1826 Ga0070701_10053676
1827 Ga0070701_10106001
1828 Ga0070711_100004600
1829 Ga0070711_100061747
1830 Ga0070705_100136038
1831 Ga0070700_100000839
1832 Ga0070700_100077353
1833 Ga0070700_100131794
1834 Ga0070694_100017278
1835 Ga0070694_100019073
1836 Ga0070694_100065476
1837 Ga0070694_100076118
1838 Ga0070663_100012806
1839 Ga0070663_100032290
1840 Ga0070663_100088288
1841 Ga0070678_100022651
1842 Ga0070678_100023376
1843 Ga0070678_100036246
1844 Ga0070662_100001216
1845 Ga0070662_100020556
1846 Ga0070662_100020619
1847 Ga0070662_100111838
1848 Ga0070662_100141538
1849 Ga0070681_10015201
1850 Ga0070681_10017457
1851 Ga0070681_10047156
1852 Ga0070681_10098398
1853 Ga0068867_100000081
1854 Ga0068867_100001697
1855 Ga0068867_100002106
1856 Ga0068867_100024737
1857 Ga0068867_100042493
1858 Ga0068867_100042821
1859 Ga0068867_100220926
1860 Ga0070685_10084032
1861 Ga0070706_100000463
1862 Ga0070706_100067449
1863 Ga0070706_100076557
1864 Ga0070706_100215096
1865 Ga0070707_100011237
1866 Ga0070707_100075144
1867 Ga0070707_100186478
1868 Ga0070698_100038594
1869 Ga0070698_100171427
1870 Ga0070699_100012659
1871 Ga0070699_100019325
1872 Ga0070699_100027789
1873 Ga0070699_100028721
1874 Ga0070699_100043010
1875 Ga0070679_100042804
1876 Ga0070679_100043504
1877 Ga0070679_100148911
1878 Ga0070684_100019385
1879 Ga0070684_100020668
1880 Ga0070697_100033017
1881 Ga0068853_100001296
1882 Ga0068853_100020194
1883 Ga0068853_100094553
1884 Ga0070672_100002859
1885 Ga0070672_100013320
1886 Ga0070672_100018087
1887 Ga0070672_100035554
1888 Ga0070672_100041756
1889 Ga0070672_100042391
1890 Ga0070672_100272863
1891 Ga0070695_100055428
1892 Ga0070695_100114020
1893 Ga0070696_100003263
1894 Ga0070696_100035707
1895 Ga0070696_100051492
1896 Ga0070693_100007795
1897 Ga0070693_100021450
1898 Ga0070665_100013839
1899 Ga0070665_100019707
1900 Ga0070665_100022394
1901 Ga0070665_100225384
1902 Ga0070704_100004279
1903 Ga0070704_100023273
1904 Ga0070704_100237986
1905 Ga0068855_100016883
1906 Ga0068855_100019918
1907 Ga0068855_100020624
1908 Ga0068855_100033144
1909 Ga0068855_100036519
1910 Ga0068855_100043350
1911 Ga0070664_100015251
1912 Ga0070664_100023069
1913 Ga0070664_100026646
1914 Ga0070664_100052551
1915 Ga0070664_100115380
1916 Ga0068857_100094504
1917 Ga0068857_100108286
1918 Ga0068857_100199948
1919 Ga0068854_100008019
1920 Ga0068854_100016437
1921 Ga0068854_100017824
1922 Ga0068854_100027690
1923 Ga0068854_100063337
1924 Ga0068854_100113326
1925 Ga0068856_100003497
1926 Ga0068856_100052020
1927 Ga0068856_100059045
1928 Ga0068856_100079103
1929 Ga0068852_100005381
1930 Ga0068852_100011356
1931 Ga0068852_100062192
1932 Ga0068852_100071351
1933 Ga0068852_100130031
1934 Ga0068852_100224054
1935 Ga0068859_100006667
1936 Ga0068859_100066678
1937 Ga0068859_100100311
1938 Ga0068859_100101706
1939 Ga0068864_100001804
1940 Ga0068864_100006924
1941 Ga0068864_100016465
1942 Ga0068864_100023957
1943 Ga0068864_100049117
1944 Ga0068866_10006603
1945 Ga0068866_10024029
1946 Ga0068861_100001859
1947 Ga0068861_100020979
1948 Ga0068861_100024799
1949 Ga0068861_100040101
1950 Ga0068861_100204498
1951 Ga0068851_10001662
1952 Ga0068851_10027158
1953 Ga0068863_100011245
1954 Ga0068863_100025859
1955 Ga0068858_100005397
1956 Ga0068858_100015128
1957 Ga0068858_100015409
1958 Ga0068858_100071444
1959 Ga0068860_100004248
1960 Ga0068860_100004659
1961 Ga0068860_100005775
1962 Ga0068860_100043724
1963 Ga0068860_100326033
1964 Ga0068862_100004558
1965 Ga0068862_100018849
1966 Ga0068862_100088092
1967 Ga0081455_10075970
1968 Ga0081539_10000917
1969 Ga0081539_10001716
1970 Ga0070717_10205910
1971 Ga0075365_10006309
1972 Ga0075365_10010415
1973 Ga0075365_10029292
1974 Ga0075365_10048041
1975 Ga0075365_10108442
1976 Ga0075368_10044752
1977 Ga0075363_100009368
1978 Ga0075363_100014193
1979 Ga0075363_100015200
1980 Ga0075364_10065161
1981 Ga0075364_10081682
1982 Ga0075362_10005983
1983 Ga0075362_10039533
1984 Ga0075367_10013296
1985 Ga0075367_10089875
1986 Ga0075367_10104720
1987 Ga0075369_10010911
1988 Ga0075369_10013394
1989 Ga0075366_10000565
1990 Ga0075366_10003522
1991 Ga0075366_10004894
1992 Ga0075366_10007992
1993 Ga0075366_10010633
1994 Ga0075366_10023928
1995 Ga0075366_10026377
1996 Ga0075366_10028720
1997 Ga0075366_10034048
1998 Ga0075366_10040231
1999 Ga0075366_10054534
2000 Ga0075366_10074127
2001 Ga0075366_10096754
2002 Ga0075366_10119325
2003 Ga0075366_10151653
2004 Ga0097621_100009452
2005 Ga0097621_100013544
2006 Ga0097621_100018736
2007 Ga0097621_100025502
2008 Ga0097621_100026295
2009 Ga0097621_100053592
2010 Ga0097621_100130284
2011 Ga0097621_100161786
2012 Ga0097621_100255942
2013 Ga0075370_10000350
2014 Ga0075370_10001008
2015 Ga0075370_10001666
2016 Ga0075370_10004844
2017 Ga0075370_10012071
2018 Ga0075370_10012595
2019 Ga0075370_10037247
2020 Ga0075370_10068955
2021 Ga0075370_10077352
2022 Ga0068871_100006413
2023 Ga0068871_100017680
2024 Ga0068871_100017837
2025 Ga0068871_100020611
2026 Ga0068871_100026397
2027 Ga0075428_100006866
2028 Ga0075428_100059027
2029 Ga0075428_100116127
2030 Ga0075428_100185526
2031 Ga0075430_100037043
2032 Ga0075431_100009882
2033 Ga0075431_100045869
2034 Ga0075433_10270596
2035 Ga0075434_100000247
2036 Ga0075434_100016216
2037 Ga0075429_100000463
2038 Ga0075429_100012319
2039 Ga0075429_100086523
2040 Ga0068865_100041887
2041 Ga0068865_100056658
2042 Ga0068865_100061617
2043 Ga0068865_100072442
2044 Ga0068865_100169693
2045 Ga0075436_100000153
2046 Ga0075436_100002208
2047 Ga0075436_100021164
2048 Ga0075436_100031066
2049 Ga0075436_100055576
2050 Ga0097620_100006667
2051 Ga0097620_100066676
2052 Ga0097620_100100310
2053 Ga0097620_100101706
2054 Ga0079104_1000055
2055 Ga0079104_1014636
2056 Ga0099826_10000020
2057 Ga0099826_10043559
2058 Ga0099794_10021968
2059 Ga0099795_10004825
2060 Ga0099795_10021877
2061 Ga0105251_10001513
2062 Ga0105251_10011195
2063 Ga0105244_10010701
2064 Ga0105250_10003376
2065 Ga0105240_10003800
2066 Ga0105240_10018026
2067 Ga0105240_10115080
2068 Ga0105240_10149092
2069 Ga0111539_10007501
2070 Ga0111539_10046081
2071 Ga0105245_10007918
2072 Ga0105245_10088093
2073 Ga0114129_10005167
2074 Ga0114129_10018075
2075 Ga0114129_10213674
2076 Ga0105243_10004191
2077 Ga0105243_10010403
2078 Ga0105243_10043569
2079 Ga0105243_10043909
2080 Ga0105243_10071599
2081 Ga0105243_10077762
2082 Ga0105243_10093592
2083 Ga0105241_10065167
2084 Ga0105241_10089016
2085 Ga0105241_10171876
2086 Ga0105242_10001697
2087 Ga0105242_10002028
2088 Ga0105242_10040904
2089 Ga0105242_10041709
2090 Ga0105242_10075746
2091 Ga0105242_10202976
2092 Ga0105248_10002030
2093 Ga0105248_10015980
2094 Ga0105248_10024858
2095 Ga0105248_10059994
2096 Ga0105248_10066533
2097 Ga0105248_10097012
2098 Ga0105248_10127574
2099 Ga0105248_10221961
2100 Ga0105248_10333486
2101 Ga0105237_10012592
2102 Ga0105238_10006104
2103 Ga0105238_10020927
2104 Ga0105238_10096631
2105 Ga0105238_10099453
2106 Ga0105238_10109604
2107 Ga0105238_10133369
2108 Ga0105249_10001475
2109 Ga0105249_10054022
2110 Ga0105249_10153732
2111 Ga0105249_10192154
2112 Ga0105249_10237119
2113 Ga0099796_10007483
2114 Ga0105239_10046513
2115 Ga0105239_10179760
2116 Ga0105246_10002163
2117 Ga0105246_10032227
2118 Ga0105246_10141477
2119 Ga0157319_1000008
2120 Ga0157347_1000789
2121 Ga0157373_10000081
2122 Ga0157373_10008814
2123 Ga0157373_10016114
2124 Ga0157373_10018126
2125 Ga0157373_10026235
2126 Ga0157371_10001827
2127 Ga0157371_10020896
2128 Ga0157371_10065579
2129 Ga0157371_10165541
2130 Ga0157370_10027854
2131 Ga0157370_10091315
2132 Ga0157370_10227594
2133 Ga0157369_10001065
2134 Ga0157369_10002069
2135 Ga0157369_10007564
2136 Ga0157369_10083686
2137 Ga0157369_10179640
2138 Ga0157374_10042081
2139 Ga0157374_10075672
2140 Ga0157378_10001998
2141 Ga0163162_10000314
2142 Ga0163162_10016393
2143 Ga0163162_10021214
2144 Ga0163162_10030137
2145 Ga0163162_10085712
2146 Ga0163162_10119864
2147 Ga0163162_10154753
2148 Ga0163162_10168017
2149 Ga0163162_10206137
2150 Ga0157372_10001667
2151 Ga0157372_10014005
2152 Ga0157372_10133919
2153 Ga0157372_10145265
2154 Ga0157372_10152193
2155 Ga0157372_10181148
2156 Ga0157372_10246392
2157 Ga0157372_10296465
2158 Ga0157375_10010300
2159 Ga0157375_10031315
2160 Ga0157375_10061416
2161 Ga0157375_10078372
2162 Ga0157375_10154851
2163 Ga0157375_10171662
2164 Ga0157375_10296407
2165 Ga0163163_10001639
2166 Ga0163163_10063892
2167 Ga0163163_10257800
2168 Ga0163163_10382441
2169 Ga0157380_10008262
2170 Ga0157380_10022246
2171 Ga0157380_10056722
2172 Ga0182008_10004122
2173 Ga0182008_10007102
2174 Ga0182008_10009794
2175 Ga0182008_10084240
2176 Ga0157377_10000048
2177 Ga0157379_10010467
2178 Ga0157379_10030571
2179 Ga0157379_10037678
2180 Ga0157379_10050970
2181 Ga0157379_10062117
2182 Ga0157379_10104187
2183 Ga0157379_10201015
2184 Ga0157376_10001621
2185 Ga0157376_10016439
2186 Ga0157376_10036986
2187 Ga0157376_10061988
2188 Ga0157376_10063786
2189 Ga0182006_1008526
2190 Ga0182006_1014990
2191 Ga0182006_1019059
2192 Ga0182006_1046030
2193 Ga0182007_10000642
2194 Ga0182007_10003593
2195 Ga0183362_10003
2196 Ga0163161_10009943
2197 Ga0163161_10033261
2198 Ga0163161_10041651
2199 Ga0163161_10063022
2200 Ga0163161_10064942
2201 Ga0163161_10094517
2202 Ga0213872_10000093
2203 Ga0213872_10000490
2204 Ga0213872_10003115
2205 Ga0213872_10005470
2206 Ga0213872_10021144
2207 Ga0209435_100002
2208 Ga0209435_100018
2209 Ga0209436_105519
2210 Ga0209672_101322
2211 Ga0209147_100051
2212 Ga0209147_101675
2213 Ga0209563_100013
2214 Ga0209437_100136
2215 Ga0209437_100145
2216 Ga0209258_100154
2217 Ga0209258_100760
2218 Ga0207425_1000540
2219 Ga0207425_1001617
2220 Ga0207425_1002353
2221 Ga0209646_1000001
2222 Ga0209646_1000090
2223 Ga0209026_1000001
2224 Ga0209026_1000042
2225 Ga0209148_1000145
2226 Ga0209759_1000001
2227 Ga0209759_1000933
2228 Ga0209129_1000027
2229 Ga0209129_1000054
2230 Ga0209129_1002683
2231 Ga0209129_1005664
2232 Ga0209565_1000067
2233 Ga0209565_1000092
2234 Ga0209565_1000128
2235 Ga0209565_1000648
2236 Ga0209565_1000708
2237 Ga0209565_1001327
2238 Ga0209565_1002114
2239 Ga0209455_1001361
2240 Ga0209673_1000008
2241 Ga0209673_1000097
2242 Ga0209673_1000172
2243 Ga0209673_1001430
2244 Ga0209673_1006310
2245 Ga0209673_1011746
2246 Ga0209673_1017095
2247 Ga0209130_1000072
2248 Ga0209130_1000315
2249 Ga0209130_1000954
2250 Ga0209130_1001108
2251 Ga0209130_1002024
2252 Ga0209675_1000038
2253 Ga0209675_1000221
2254 Ga0209675_1000690
2255 Ga0209675_1001507
2256 Ga0209675_1003314
2257 Ga0209675_1003374
2258 Ga0209675_1004564
2259 Ga0209675_1004790
2260 Ga0209675_1006032
2261 Ga0209675_1013233
2262 Ga0209676_1000012
2263 Ga0209676_1000023
2264 Ga0209676_1000048
2265 Ga0209676_1001679
2266 Ga0209676_1007984
2267 Ga0209025_1000026
2268 Ga0209025_1000173
2269 Ga0209025_1000174
2270 Ga0209025_1001066
2271 Ga0209025_1001606
2272 Ga0209025_1001733
2273 Ga0209025_1001987
2274 Ga0209025_1002139
2275 Ga0209025_1004985
2276 Ga0209025_1005561
2277 Ga0209025_1010865
2278 Ga0209025_1020817
2279 Ga0209025_1027510
2280 Ga0209025_1030667
2281 Ga0209025_1039297
2282 Ga0209564_1000008
2283 Ga0209564_1000139
2284 Ga0209564_1000241
2285 Ga0209564_1000435
2286 Ga0209564_1000998
2287 Ga0209564_1001515
2288 Ga0209564_1002737
2289 Ga0209564_1002822
2290 Ga0209564_1003293
2291 Ga0209564_1004319
2292 Ga0209758_1000034
2293 Ga0209758_1000052
2294 Ga0209758_1000146
2295 Ga0209758_1002271
2296 Ga0209758_1004536
2297 Ga0209050_1000012
2298 Ga0209050_1000022
2299 Ga0209050_1000165
2300 Ga0209050_1000294
2301 Ga0209050_1001032
2302 Ga0209050_1002988
2303 Ga0209050_1004806
2304 Ga0209050_1008642
2305 Ga0209050_1012744
2306 Ga0209256_1000001
2307 Ga0209256_1000103
2308 Ga0209256_1000120
2309 Ga0209256_1000165
2310 Ga0209256_1000450
2311 Ga0209256_1000912
2312 Ga0209256_1001146
2313 Ga0209256_1001845
2314 Ga0209256_1023396
2315 Ga0209256_1025211
2316 Ga0207426_1000058
2317 Ga0207426_1000067
2318 Ga0207426_1000319
2319 Ga0207426_1002937
2320 Ga0209051_1000013
2321 Ga0209051_1000018
2322 Ga0209051_1000019
2323 Ga0209051_1000235
2324 Ga0209051_1000384
2325 Ga0209051_1001398
2326 Ga0209051_1002935
2327 Ga0209051_1005813
2328 Ga0209051_1007797
2329 Ga0209257_1000021
2330 Ga0209257_1000024
2331 Ga0209257_1000042
2332 Ga0209257_1000057
2333 Ga0209257_1000096
2334 Ga0209257_1000260
2335 Ga0209257_1001206
2336 Ga0209257_1010586
2337 Ga0209257_1010643
2338 Ga0207697_10016431
2339 Ga0207656_10003460
2340 Ga0207656_10006943
2341 Ga0207696_1000557
2342 Ga0207696_1003192
2343 Ga0207696_1003996
2344 Ga0207655_1000024
2345 Ga0207655_1000639
2346 Ga0207655_1000983
2347 Ga0207655_1003550
2348 Ga0207655_1030240
2349 Ga0207713_1000043
2350 Ga0207713_1008050
2351 Ga0207713_1027146
2352 Ga0207713_1042393
2353 Ga0207682_10011302
2354 Ga0207682_10015452
2355 Ga0207682_10030730
2356 Ga0207642_10052396
2357 Ga0207688_10015371
2358 Ga0207680_10001495
2359 Ga0207699_10026650
2360 Ga0207699_10067168
2361 Ga0207645_10007473
2362 Ga0207645_10052992
2363 Ga0207645_10056229
2364 Ga0207645_10129688
2365 Ga0207645_10148073
2366 Ga0207643_10027110
2367 Ga0207643_10076978
2368 Ga0207705_10008509
2369 Ga0207705_10032151
2370 Ga0207705_10060329
2371 Ga0207684_10002070
2372 Ga0207684_10031033
2373 Ga0207654_10028201
2374 Ga0207654_10036040
2375 Ga0207654_10051850
2376 Ga0207654_10141122
2377 Ga0207707_10010626
2378 Ga0207707_10016028
2379 Ga0207707_10026595
2380 Ga0207707_10040244
2381 Ga0207695_10005351
2382 Ga0207695_10023926
2383 Ga0207695_10109358
2384 Ga0207695_10261501
2385 Ga0207671_10017114
2386 Ga0207671_10032445
2387 Ga0207693_10004206
2388 Ga0207693_10024167
2389 Ga0207660_10023901
2390 Ga0207660_10061869
2391 Ga0207660_10083826
2392 Ga0207660_10123348
2393 Ga0207660_10215822
2394 Ga0207662_10061126
2395 Ga0207657_10000447
2396 Ga0207657_10003605
2397 Ga0207657_10004258
2398 Ga0207657_10027949
2399 Ga0207649_10029633
2400 Ga0207649_10051595
2401 Ga0207649_10091531
2402 Ga0207649_10111273
2403 Ga0207652_10012394
2404 Ga0207652_10015269
2405 Ga0207652_10212603
2406 Ga0207646_10002045
2407 Ga0207646_10030455
2408 Ga0207646_10083481
2409 Ga0207646_10090569
2410 Ga0207681_10043137
2411 Ga0207681_10058220
2412 Ga0207681_10063816
2413 Ga0207681_10075638
2414 Ga0207681_10081392
2415 Ga0207681_10118513
2416 Ga0207694_10017482
2417 Ga0207694_10056941
2418 Ga0207694_10079876
2419 Ga0207650_10003707
2420 Ga0207650_10014826
2421 Ga0207650_10056430
2422 Ga0207650_10096580
2423 Ga0207650_10138665
2424 Ga0207650_10225635
2425 Ga0207659_10002055
2426 Ga0207659_10002947
2427 Ga0207659_10003098
2428 Ga0207659_10058394
2429 Ga0207687_10209821
2430 Ga0207687_10213026
2431 Ga0207700_10022967
2432 Ga0207700_10032950
2433 Ga0207700_10040172
2434 Ga0207700_10139194
2435 Ga0207700_10195604
2436 Ga0207664_10050500
2437 Ga0207664_10081866
2438 Ga0207664_10090116
2439 Ga0207644_10000130
2440 Ga0207644_10002085
2441 Ga0207644_10022846
2442 Ga0207644_10067704
2443 Ga0207644_10165726
2444 Ga0207690_10003996
2445 Ga0207690_10013485
2446 Ga0207690_10037637
2447 Ga0207690_10064410
2448 Ga0207706_10000156
2449 Ga0207706_10016017
2450 Ga0207706_10025996
2451 Ga0207706_10036971
2452 Ga0207706_10054917
2453 Ga0207706_10070546
2454 Ga0207686_10011790
2455 Ga0207686_10128851
2456 Ga0207709_10000111
2457 Ga0207709_10044565
2458 Ga0207670_10004647
2459 Ga0207670_10167009
2460 Ga0207704_10010368
2461 Ga0207704_10034820
2462 Ga0207665_10002266
2463 Ga0207691_10003386
2464 Ga0207691_10010432
2465 Ga0207691_10011577
2466 Ga0207691_10019285
2467 Ga0207691_10022541
2468 Ga0207691_10032593
2469 Ga0207691_10053626
2470 Ga0207691_10057599
2471 Ga0207711_10020362
2472 Ga0207711_10021326
2473 Ga0207711_10035493
2474 Ga0207711_10053726
2475 Ga0207711_10165679
2476 Ga0207711_10174904
2477 Ga0207689_10001818
2478 Ga0207689_10015442
2479 Ga0207661_10086402
2480 Ga0207679_10007093
2481 Ga0207679_10012131
2482 Ga0207679_10033943
2483 Ga0207679_10037700
2484 Ga0207679_10147866
2485 Ga0207667_10006776
2486 Ga0207667_10010777
2487 Ga0207667_10016009
2488 Ga0207667_10019277
2489 Ga0207667_10024536
2490 Ga0207667_10110330
2491 Ga0207667_10203748
2492 Ga0207651_10001665
2493 Ga0207651_10003976
2494 Ga0207651_10005715
2495 Ga0207651_10005940
2496 Ga0207712_10008399
2497 Ga0207712_10070498
2498 Ga0207712_10206932
2499 Ga0207668_10015585
2500 Ga0207668_10084585
2501 Ga0207668_10107123
2502 Ga0207668_10134384
2503 Ga0207668_10240887
2504 Ga0207640_10037866
2505 Ga0207640_10075079
2506 Ga0207640_10101284
2507 Ga0207658_10004458
2508 Ga0207658_10004645
2509 Ga0207658_10050936
2510 Ga0207658_10083767
2511 Ga0207677_10007151
2512 Ga0207677_10018191
2513 Ga0207677_10033477
2514 Ga0207677_10040300
2515 Ga0207677_10173075
2516 Ga0207703_10002546
2517 Ga0207703_10009968
2518 Ga0207703_10012912
2519 Ga0207703_10016647
2520 Ga0207703_10042121
2521 Ga0207703_10092086
2522 Ga0207639_10013143
2523 Ga0207639_10013776
2524 Ga0207639_10059696
2525 Ga0207639_10076160
2526 Ga0207639_10126648
2527 Ga0207639_10131754
2528 Ga0207678_10030122
2529 Ga0207678_10043272
2530 Ga0207678_10050007
2531 Ga0207678_10083673
2532 Ga0207678_10149880
2533 Ga0207678_10157414
2534 Ga0207708_10001026
2535 Ga0207708_10021822
2536 Ga0207708_10092172
2537 Ga0207708_10153052
2538 Ga0207702_10002083
2539 Ga0207702_10075064
2540 Ga0207702_10133219
2541 Ga0207641_10016950
2542 Ga0207641_10032784
2543 Ga0207641_10037962
2544 Ga0207641_10091037
2545 Ga0207641_10235396
2546 Ga0207648_10000179
2547 Ga0207648_10001876
2548 Ga0207648_10002319
2549 Ga0207648_10006478
2550 Ga0207648_10006871
2551 Ga0207648_10015767
2552 Ga0207648_10021732
2553 Ga0207648_10025102
2554 Ga0207648_10047779
2555 Ga0207648_10050843
2556 Ga0207648_10057806
2557 Ga0207648_10082099
2558 Ga0207676_10001487
2559 Ga0207676_10008447
2560 Ga0207676_10009407
2561 Ga0207676_10014048
2562 Ga0207674_10004569
2563 Ga0207674_10013444
2564 Ga0207674_10041207
2565 Ga0207674_10137304
2566 Ga0207674_10188323
2567 Ga0207675_100000704
2568 Ga0207675_100001602
2569 Ga0207675_100021533
2570 Ga0207675_100022891
2571 Ga0207675_100044251
2572 Ga0207675_100046449
2573 Ga0207675_100110243
2574 Ga0207675_100129843
2575 Ga0207675_100222980
2576 Ga0207683_10013324
2577 Ga0207683_10024002
2578 Ga0207683_10026397
2579 Ga0207683_10060473
2580 Ga0207683_10079558
2581 Ga0207683_10096370
2582 Ga0207698_10001892
2583 Ga0207698_10004332
2584 Ga0207698_10020098
2585 Ga0207698_10064780
2586 Ga0207698_10065155
2587 Ga0207698_10151001
2588 Ga0209281_1000007
2589 Ga0209281_1000455
2590 Ga0209389_1000249
2591 Ga0209371_1000061
2592 Ga0209371_1000082
2593 Ga0209371_1000119
2594 Ga0209371_1000230
2595 Ga0209371_1001086
2596 Ga0209371_1001324
2597 Ga0209371_1002070
2598 Ga0210000_1002971
2599 Ga0209999_1000743
2600 Ga0209970_1000108
2601 Ga0209983_1009217
2602 Ga0209282_1000053
2603 Ga0209282_1000250
2604 Ga0209588_1004210
2605 Ga0209971_1001384
2606 Ga0209966_1006236
2607 Ga0209974_10006556
2608 Ga0209974_10006964
2609 Ga0209974_10029859
2610 Ga0207428_10003201
2611 Ga0268266_10059218
2612 Ga0268266_10095949
2613 Ga0268266_10304796
2614 Ga0268265_10004089
2615 Ga0268265_10013992
2616 Ga0268265_10076950
2617 Ga0268265_10246391
2618 Ga0268264_10000613
2619 Ga0268264_10037899
2620 Ga0268264_10073697
2621 Ga0268264_10248016
2622 Ga0268264_10271995
2623 Ga0307517_10001395
2624 Ga0307515_10000011
2625 Ga0307515_10000213
2626 Ga0307515_10000472
2627 Ga0307515_10000655
2628 Ga0307515_10003487
2629 Ga0307515_10009632
2630 Ga0307515_10048317
2631 Ga0307515_10069340
2632 Ga0307515_10201563
2633 Ga0268256_1000059
2634 Ga0268256_1000072
2635 Ga0268256_1000096
2636 Ga0268256_1001132
2637 Ga0268256_1004087
2638 Ga0268256_1009796
2639 Ga0307511_10000043
2640 Ga0316183_1035885
2641 Ga0316182_1411781
2642 Ga0265330_10000046
2643 Ga0265332_10000028
2644 Ga0265332_10000125
2645 Ga0265332_10000951
2646 Ga0265328_10003818
2647 Ga0265328_10022676
2648 Ga0265331_10001806
2649 Ga0265327_10000012
2650 Ga0265327_10001288
2651 Ga0265327_10010084
2652 Ga0265327_10011638
2653 Ga0265327_10022614
2654 Ga0265327_10034279
2655 Ga0265316_10053940
2656 Ga0265316_10224581
2657 Ga0307513_10000117
2658 Ga0307513_10002745
2659 Ga0307513_10003270
2660 Ga0307513_10008037
2661 Ga0307513_10203007
2662 Ga0307509_10003946
2663 Ga0307509_10005133
2664 Ga0307509_10046715
2665 Ga0307509_10072791
2666 Ga0307509_10113339
2667 Ga0307408_100000023
2668 Ga0307408_100000101
2669 Ga0307408_100001843
2670 Ga0307408_100004804
2671 Ga0307408_100006023
2672 Ga0307408_100016090
2673 Ga0307408_100055479
2674 Ga0307408_100085525
2675 Ga0307508_10000404
2676 Ga0307508_10003052
2677 Ga0307514_10012483
2678 Ga0307514_10089293
2679 Ga0316575_10006695
2680 Ga0316579_10000811
2681 Ga0316579_10001459
2682 Ga0265314_10000054
2683 Ga0265314_10001039
2684 Ga0316576_10009121
2685 Ga0316576_10011214
2686 Ga0316578_10035796
2687 Ga0307516_10001586
2688 Ga0307516_10002443
2689 Ga0307516_10002741
2690 Ga0307516_10020817
2691 Ga0307405_10012732
2692 Ga0307405_10055945
2693 Ga0307405_10071978
2694 Ga0307413_10001940
2695 Ga0307410_10002072
2696 Ga0307410_10009283
2697 Ga0307410_10022186
2698 Ga0307406_10005067
2699 Ga0307406_10006267
2700 Ga0307406_10006712
2701 Ga0307406_10017326
2702 Ga0307406_10042617
2703 Ga0307406_10087961
2704 Ga0307407_10113724
2705 Ga0307412_10003320
2706 Ga0307409_100009728
2707 Ga0307409_100042544
2708 Ga0307409_100142685
2709 Ga0307409_100162078
2710 Ga0307409_100213215
2711 Ga0307409_100263934
2712 Ga0307416_100006880
2713 Ga0307416_100016563
2714 Ga0307416_100175287
2715 Ga0307416_100196800
2716 Ga0307414_10066022
2717 Ga0307414_10134074
2718 Ga0307414_10180484
2719 Ga0307411_10002409
2720 Ga0307411_10008303
2721 Ga0307411_10034617
2722 Ga0307415_100003806
2723 Ga0316593_10023515
2724 Ga0307507_10075769
2725 Ga0307507_10111544
2726 Ga0307510_10035314
2727 Ga0307510_10045636
2728 Ga0316588_1003205
2729 Ga0316596_1019472
2730 Ga0373926_0029136
2731 Ga0373932_0011766
2732 Ga0373943_0035289
2733 Ga0373955_0007829
2734 Ga0316574_0000070
2735 Ga0316574_0004300
2736 Ga0373931_0010378
2737 Ga0373931_0017241
2738 Ga0373935_0067325
2739 Ga0373927_0001348
2740 Ga0373927_0031512
2741 Ga0373927_0042538
2742 Ga0373947_0054512
2743 Ga0373947_0085900
2744 Ga0373937_0004911
2745 Ga0373937_0010376
2746 Ga0373937_0012886
2747 Ga0373937_0093628
2748 Ga0373937_0121982
2749 Ga0316582_0090752
2750 Ga0316584_0182065
2751 Ga0373925_0081460
2752 Ga0373925_0082078
2753 Ga0373925_0164082
2754 Ga0395899_0000080
2755 Ga0395899_0001691
2756 Ga0395899_0004014
2757 Ga0395899_0008709
2758 Ga0395899_0019141
2759 Ga0395899_0024423
2760 Ga0395899_0096300
2761 Ga0395899_0098267
2762 Ga0395899_0102772
2763 Ga0395900_0008285
2764 Ga0395900_0009158
2765 Ga0395900_0015158
2766 Ga0395900_0026870
2767 Ga0395900_0074221
2768 Ga0395900_0084101
2769 Ga0395898_0066398
2770 Ga0395898_0072998
2771 Ga0395898_0133020
2772 Ga0395905_0000043
2773 Ga0395905_0001875
2774 Ga0395905_0007970
2775 Ga0395905_0010328
2776 Ga0395905_0018407
2777 Ga0395905_0022866
2778 Ga0395905_0034452
2779 Ga0395905_0038287
2780 Ga0395905_0082764
2781 Ga0395905_0101488
2782 Ga0395905_0202737
2783 Ga0395905_0249584
2784 Ga0395901_0013302
2785 Ga0395901_0022794
2786 Ga0395901_0022795
2787 Ga0395901_0036328
2788 Ga0395901_0055485
2789 Ga0395901_0097568
2790 Ga0395901_0115496
2791 Ga0395901_0121820
2792 Ga0395901_0190642
2793 Ga0395901_0213305
2794 Ga0395901_0324211
2795 Ga0436365_0450647
2796 Ga0436365_1569295
2797 Ga0436360_0038189
2798 Ga0436361_0101461
2799 Ga0436361_0289802
2800 Ga0436361_0487065
2801 Ga0436361_0523658
2802 Ga0436362_0477984
2803 Ga0439436_0004746
2804 Ga0439436_0004770
2805 Ga0439436_0010792
2806 Ga0439447_001550
2807 Ga0439466_0000011
2808 Ga0439466_0020815
2809 Ga0439465_0004682
2810 Ga0451853_2018397
2811 Ga0439431_0002356
2812 Ga0439431_0021691
2813 Ga0439433_0006012
2814 Ga0439437_001073
2815 Ga0439442_006447
2816 Ga0439445_0001102
2817 Ga0439432_002129
2818 Ga0439449_0000187
2819 Ga0439449_0000620
2820 Ga0439449_0001584
2821 Ga0439452_002955
2822 Ga0439452_004200
2823 Ga0439456_007254
2824 Ga0439462_0002391
2825 Ga0450911_000281
2826 Ga0450890_002116
2827 Ga0450889_000109
2828 Ga0450906_008422
2829 Ga0450907_000007
2830 Ga0450910_002890
2831 Ga0439446_0002089
2832 Ga0439446_0002260
2833 Ga0439446_0011612
2834 Ga0439434_0001503
2835 Ga0439434_0007932
2836 Ga0439434_0010725
2837 Ga0439435_0000773
2838 Ga0439435_0023924
2839 Ga0439464_0012317
2840 Ga0450918_000158
2841 Ga0450893_0001452
2842 Ga0451577_0000276
2843 Ga0451577_0001377
2844 Ga0451577_0037888
2845 Ga0451577_0065997
2846 Ga0451577_0096803
2847 Ga0451577_0109094
2848 Ga0451577_0135954
2849 Ga0466969_0004750
2850 Ga0466969_0006748
2851 Ga0466972_0008433
2852 Ga0453683_0007502
2853 Ga0453683_0018762
2854 Ga0466965_0006837
2855 Ga0466965_0063016
2856 Ga0466966_0020148
2857 Ga0466961_0014008
2858 Ga0466961_0069024
2859 Ga0466961_0089172
2860 Ga0453684_0000891
2861 Ga0453684_0001215
2862 Ga0453684_0063372
2863 Ga0453684_0074838
2864 Ga0453684_0275004
2865 Ga0453684_0279876
2866 Ga0466971_0030247
2867 Ga0466957_0055469
2868 Ga0466959_0126070
2869 Ga0451576_0000381
2870 Ga0451576_0001248
2871 Ga0451576_0004449
2872 Ga0451576_0023570
2873 Ga0451576_0025162
2874 Ga0451576_0037463
2875 Ga0451576_0073694
2876 Ga0451576_0075018
2877 Ga0451576_0095370
2878 Ga0451576_0102208
2879 Ga0451576_0108446
2880 Ga0451576_0112207
2881 Ga0451576_0137068
2882 Ga0451576_0246475
2883 Ga0466958_0005009
2884 Ga0466967_0168927
2885 Ga0466967_0184275
2886 Ga0495617_006149
2887 Ga0495627_006447
2888 Ga0495592_0000083
2889 Ga0495590_0004124
2890 Ga0495591_000010
2891 Ga0495591_001545
2892 Ga0495591_016234
2893 Ga0495653_0075170
2894 Ga0495650_0000034
2895 Ga0495650_0013823
2896 Ga0495580_0012135
2897 Ga0495605_0002892
2898 Ga0495639_0010783
2899 Ga0495639_0014230
2900 Ga0495664_0057886
2901 Ga0495596_0003191
2902 Ga0495596_0003690
2903 Ga0495607_0002446
2904 Ga0495607_0025190
2905 Ga0495606_0000511
2906 Ga0495608_0015861
2907 Ga0495610_0002147
2908 Ga0495610_0008257
2909 Ga0495616_0003177
2910 Ga0495616_0003776
2911 Ga0495620_0010395
2912 Ga0495631_0075004
2913 Ga0495632_0006527
2914 Ga0495632_0034565
2915 Ga0495632_0047082
2916 Ga0495643_0019675
2917 Ga0495643_0033289
2918 Ga0495644_0054049
2919 Ga0495648_0041629
2920 Ga0495648_0060928
2921 Ga0495642_0031685
2922 Ga0495652_0048893
2923 Ga0495654_0000151
2924 Ga0495654_0005248
2925 Ga0495654_0005475
2926 Ga0495654_0045127
2927 Ga0495665_0010247
2928 Ga0495587_0007225
2929 Ga0495598_0017969
2930 Ga0495597_0001315
2931 Ga0495597_0066425
2932 Ga0495645_0012915
2933 Ga0495645_0148003
2934 Ga0495667_0005954
2935 Ga0495656_0000090
2936 Ga0495656_0019103
2937 Ga0495625_0001055
2938 Ga0495625_0025375
2939 Ga0495635_0016210
2940 Ga0495635_0029296
2941 Ga0495599_0003944
2942 Ga0495623_0002115
2943 Ga0495647_0007199
2944 Ga0495658_0039464
2945 Ga0495669_0006300
2946 Ga0495669_0060059
2947 Ga0495613_0122850
2948 Ga0495671_0000586
2949 Ga0495649_0002049
2950 Ga0495649_0030910
2951 Ga0495660_0000020
2952 Ga0495660_0022000
2953 Ga0495660_0131274
2954 Ga0495581_0046287
2955 Ga0495672_0000011
2956 Ga0495672_0000040
2957 Ga0495676_0022957
2958 Ga0495680_0119611
2959 Ga0495683_0035539
2960 Ga0495687_001485
2961 Ga0495677_0020104
2962 Ga0495679_002610
2963 Ga0495685_052242
2964 Ga0495673_0000020
2965 Ga0495684_0138161
2966 Ga0495593_0023748
2967 Ga0495614_0026926
2968 Ga0496100_0089285
2969 Ga0496100_0115867
2970 Ga0496101_0000053
2971 Ga0496101_0041259
2972 Ga0496102_0003600
2973 Ga0496102_0060046
2974 Ga0496102_0082257
2975 Ga0496102_0085748
2976 Ga0496104_0006891
2977 Ga0496105_0003958
2978 Ga0496105_0010709
2979 Ga0496105_0079874
2980 Ga0496106_0032806
2981 Ga0496107_0037525
2982 Ga0496107_0137712
2983 Ga0496107_0162446
2984 Ga0496108_0275988
2985 Ga0496109_0118029
2986 Ga0496110_0008002
2987 Ga0496110_0167068
2988 Ga0496110_0176348
2989 Ga0496110_0219326
2990 Ga0496112_0081588
2991 Ga0496113_0036962
2992 Ga0496114_0083481
2993 Ga0496114_0084255
2994 Ga0496115_0027385
2995 Ga0496116_0000129
2996 Ga0496116_0000734
2997 Ga0496116_0006777
2998 Ga0496116_0009524
2999 Ga0496116_0044616
3000 Ga0496116_0053637
3001 Ga0496117_0000092
3002 Ga0496117_0000224
3003 Ga0496117_0011620
3004 Ga0496117_0015917
3005 Ga0496117_0074534
3006 Ga0496118_0000053
3007 Ga0496118_0000718
3008 Ga0496118_0006660
3009 Ga0496118_0041408
3010 Ga0496119_0000285
3011 Ga0496119_0000555
3012 Ga0496119_0002224
3013 Ga0496119_0005370
3014 Ga0496119_0067533
3015 Ga0496120_0000024
3016 Ga0496120_0000178
3017 Ga0496120_0000388
3018 Ga0496120_0000548
3019 Ga0496120_0001587
3020 Ga0496121_0000304
3021 Ga0496121_0005682
3022 Ga0496121_0027348
3023 Ga0496121_0029597
3024 Ga0496122_0001889
3025 Ga0496122_0009582
3026 Ga0496122_0010689
3027 Ga0496123_0001035
3028 Ga0496123_0002189
3029 Ga0496123_0003349
3030 Ga0496123_0019217
3031 Ga0496123_0027207
3032 Ga0496124_0000251
3033 Ga0496124_0001528
3034 Ga0496124_0026597
3035 Ga0496124_0059353
3036 Ga0496124_0064591
3037 Ga0496124_0081532
3038 Ga0496125_0001627
3039 Ga0496125_0007136
3040 Ga0496125_0037381
3041 Ga0496125_0041178
3042 Ga0496125_0067848
3043 Ga0495678_002665
3044 Ga0495682_0000022
3045 Ga0501291_006589
3046 Ga0501298_010776
3047 Ga0501298_018127
3048 Ga0501303_001929
3049 Ga0501034_0074934
3050 Ga0501036_0024340
3051 Ga0501036_0055815
3052 Ga0501039_0005064
3053 Ga0501039_0130938
3054 Ga0501040_0018020
3055 Ga0501041_0051976
3056 Ga0501041_0064562
3057 Ga0501042_0025236
3058 Ga0501042_0101347
3059 Ga0501042_0171251
3060 Ga0501043_0000057
3061 Ga0501046_0000075
3062 Ga0501046_0011964
3063 Ga0501047_0000081
3064 Ga0501047_0127977
3065 Ga0501048_0003517
3066 Ga0501048_0034983
3067 Ga0501069_0002412
3068 Ga0501070_0002316
3069 Ga0501070_0089982
3070 Ga0501070_0099387
3071 Ga0501071_0091465
3072 Ga0501072_0045021
3073 Ga0501072_0064683
3074 Ga0501073_0015213
3075 Ga0501073_0057209
3076 Ga0501074_0002551
3077 Ga0501075_0033424
3078 Ga0501076_0028788
3079 Ga0501076_0104655
3080 Ga0501211_001156
3081 Ga0501222_000664
3082 Ga0501227_004625
3083 Ga0501235_004422
3084 Ga0501249_006914
3085 Ga0501253_001878
3086 Ga0501221_000960
3087 Ga0501229_000783
3088 Ga0501079_0005427
3089 Ga0501079_0016872
3090 Ga0501079_0065864
3091 Ga0501080_0004208
3092 Ga0501080_0007125
3093 Ga0501080_0061602
3094 Ga0501080_0133218
3095 Ga0501081_0013820
3096 Ga0501081_0046984
3097 Ga0501083_0001718
3098 Ga0501083_0028189
3099 Ga0501262_000577
3100 Ga0501262_003349
3101 Ga0501283_001053
3102 Ga0501035_0248252
3103 Ga0501044_0065371
3104 Ga0501045_0004966
3105 Ga0501045_0010264
3106 Ga0501045_0023822
3107 Ga0501045_0057455
3108 nmdc:mga03683_19923_c1
3109 nmdc:mga03683_21456_c1
3110 nmdc:mga03n38_22636_c1
3111 nmdc:mga03n38_64134_c1
3112 nmdc:mga03n38_7643_c1
3113 nmdc:mga00v17_21665_c1
3114 nmdc:mga00v17_30925_c1
3115 nmdc:mga00v17_51405_c1
3116 nmdc:mga0yw44_110325_c1
3117 nmdc:mga0yw44_14581_c1
3118 nmdc:mga0yw44_785_c1
3119 nmdc:mga0yw44_90550_c1
3120 nmdc:mga0k408_100765_c1
3121 nmdc:mga0k408_101141_c1
3122 nmdc:mga0k408_118788_c1
3123 nmdc:mga0k408_13542_c1
3124 nmdc:mga0k408_138_c1
3125 nmdc:mga0k408_16735_c1
3126 nmdc:mga0k408_19960_c1
3127 nmdc:mga0k408_2064_c1
3128 nmdc:mga0k408_29331_c1
3129 nmdc:mga0k408_34607_c1
3130 nmdc:mga0k408_40887_c1
3131 nmdc:mga0k408_42033_c1
3132 nmdc:mga0k408_57440_c1
3133 nmdc:mga0k408_576_c1
3134 nmdc:mga0k408_5849_c1
3135 nmdc:mga0k408_7033_c1
3136 nmdc:mga0k408_7262_c1
3137 nmdc:mga0k408_7453_c1
3138 nmdc:mga0k408_8618_c1
3139 nmdc:mga0k408_93429_c1
3140 nmdc:mga06z11_18151_c1
3141 nmdc:mga07m45_11357_c1
3142 nmdc:mga07m45_1226_c1
3143 nmdc:mga07m45_28774_c1
3144 nmdc:mga07m45_31118_c1
3145 nmdc:mga07m45_32283_c1
3146 nmdc:mga07m45_3534_c1
3147 nmdc:mga07m45_4924_c1
3148 nmdc:mga07m45_639_c1
3149 nmdc:mga07m45_9657_c1
3150 nmdc:mga05p37_181_c1
3151 nmdc:mga05p37_21359_c1
3152 nmdc:mga05p37_241233_c1
3153 nmdc:mga09592_1507_c1
3154 nmdc:mga09592_239456_c1
3155 nmdc:mga09592_64009_c1
3156 nmdc:mga09592_64418_c1
3157 nmdc:mga06r32_33024_c1
3158 nmdc:mga06r32_73337_c1
3159 nmdc:mga08y16_14999_c1
3160 nmdc:mga08y16_18394_c1
3161 nmdc:mga08y16_224_c1
3162 nmdc:mga08y16_315156_c1
3163 nmdc:mga0n895_10661_c1
3164 nmdc:mga0n895_1144_c1
3165 nmdc:mga0n895_278806_c1
3166 nmdc:mga0rr50_42782_c1
3167 nmdc:mga0rr50_60153_c1
3168 nmdc:mga0rr50_7490_c1
3169 nmdc:mga08x19_175135_c1
3170 nmdc:mga08x19_219_c1
3171 nmdc:mga08x19_63571_c1
3172 nmdc:mga08x19_8071_c1
3173 nmdc:mga0a205_15430_c1
3174 nmdc:mga0sz30_10668_c1
3175 nmdc:mga0sz30_24146_c1
3176 nmdc:mga0sz30_6332_c1
3177 Ga0495601_0005224
3178 Ga0500610_0025769
3179 Ga0495619_0023985
3180 Ga0495619_0048368
3181 Ga0500578_0000652
3182 Ga0500646_0002088
3183 Ga0500651_0038486
3184 Ga0500593_011591
3185 Ga0500593_011860
3186 Ga0500594_0005824
3187 Ga0500621_000009
3188 Ga0500652_000885
3189 Ga0500658_0000507
3190 Ga0500658_0000854
3191 Ga0500658_0007664
3192 Ga0500559_0000019
3193 Ga0500559_0014012
3194 Ga0500568_0000554
3195 Ga0500574_000659
3196 Ga0500590_037396
3197 Ga0500616_0011698
3198 Ga0500616_0049014
3199 Ga0500619_001082
3200 Ga0500622_0000124
3201 Ga0500622_0003679
3202 Ga0500622_0005264
3203 Ga0500622_0018184
3204 Ga0500645_001181
3205 Ga0500645_010134
3206 Ga0500661_003043
3207 Ga0590071_001042
3208 Ga0501082_0059346
3209 Ga0501082_0092527
3210 Ga0501082_0201357
3211 Ga0501082_0258310
3212 2511244604
3213 2511382598
3214 2511435976
3215 2513231038
3216 2513955020
3217 2514041404
3218 2548499014
3219 2550697409
3220 2587728288
3221 2587734506
3222 2587754215
3223 2588295004
3224 2599623384
3225 2599675398
3226 2599680989
3227 2599693004
3228 2608671670
3229 2643744991
3230 2643867780
3231 2643971158
3232 2643991642
3233 2644062187
3234 2644071375
3235 2644142076
3236 2644161853
3237 2644222768
3238 2644246838
3239 2644260688
3240 2644276301
3241 2644293389
3242 2644301399
3243 2644325550
3244 2644399269
3245 2644467046
3246 2644648471
3247 2687581166
3248 2722881999
3249 2738718206
3250 2738880404
3251 2739058935
3252 2739245798
3253 2739248288
3254 2739281393
3255 2809126721
3256 2816470492
3257 2819594809
3258 2819600560
3259 2831267714
3260 2831869231
3261 2834643046
3262 2838061558
3263 2839143975
3264 2842677540
3265 2842718737
3266 2842736352
3267 2842748860
3268 2844532303
3269 2847797675
3270 2855732098
3271 2855768806
3272 2857579865
3273 2865014898
3274 2869552047
3275 2876602561
3276 2881102988
3277 2881415244
3278 2881612502
3279 2884811695
3280 2884841319
3281 2884856193
3282 2885196925
3283 2885198816
3284 2885211804
3285 2894024348
3286 2896156881
3287 2899928293
3288 2904451830
3289 2904462513
3290 2904481717
3291 2904545117
3292 2908674513
3293 2919467186
3294 2919707145
3295 2928041245
3296 2928048087
3297 2928055928
3298 2928066591
3299 2928077255
3300 2928087556
3301 2928120674
3302 2929165295
3303 2929523626
3304 2939605626
3305 2939635840
3306 2945910100
3307 2945946132
3308 2945955243
3309 2945975732
3310 2945987884
3311 2954768818
3312 2974320379
3313 2978977721
3314 2990713910
3315 3003667376
3316 644748182
3317 8003403085
3318 8016737616
3319 8019504220
3320 8055434797

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

95

399

0.88

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

104

431

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq4-assembly1.cif.gz_A substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli 0.9958 26 437
4aq4-assembly1.cif.gz_A substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli 0.9792 26 437
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.9151 25 434
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.9047 25 434
7c0k-assembly1.cif.gz_A crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) 0.8939 23 429
ID Description Score Start End Superfamily
af_P0AG80_145_437_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 1.001 145 437 3.40.190.10
af_P0AG80_145_437_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9972 145 437 3.40.190.10
4aq4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9915 145 437 3.40.190.10
4aq4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.987 145 437 3.40.190.10
4aq4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9673 26 382 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2X2TAB2-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.9976 19 437 GO:0016020
GO:0030288
GO:0055085
AF-A0A0R3CB30-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.9927 19 436 GO:0042597
AF-A0A1G3RQS8-F1-model_v4 sn-glycerol-3-phosphate ABC transporter substrate-binding protein 0.9908 35 437 GO:0030313
GO:0055085
AF-J4WEL3-F1-model_v4 Uncharacterized protein 0.9862 19 133
AF-A0A1G3RQS8-F1-model_v4 sn-glycerol-3-phosphate ABC transporter substrate-binding protein 0.9811 35 437 GO:0030313
GO:0055085

Map