F495248

General Info

Members Datasets Scaffolds Average Seq Length
1661 575 3323 296

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0156289|Ga0436363_0156289_99_1067
Length 322
Sequence MNVEVKPAAVLADMLADAPMIESIGVVGAGQMGNGIAHVCAQASLSVVLLDVAQDALDKAITTISRNMDRQAQRGTLSVEQKSAAIARIQTSTDYAAFAGCFFVVEAATEKESVKLAILRSLTPHLKPSCLLASNTSSIPITRLAAATDRPEKFIGMHFMNPVPVMKLVEIIRGIATTDATYALVRDLALGLDKTPVEVRDFPGFISNRVLLPMINEAIYALYEGVASAEAIDTVMKLGMNHPMGPLTLADFIGLDTCLAIMNVLYDGFGDSKYRPCPLLKQYVAAGWLGKKSGRGFYHYAADGKASAAGSNGAAKPAATTA

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
231 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
232 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
273 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
274 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
275 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
278 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
279 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
280 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
281 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
282 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
283 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
284 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
377 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
378 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
379 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
380 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
381 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
382 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
383 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
384 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
385 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
386 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
387 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
388 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
389 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
390 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
391 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
394 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
395 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
396 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
397 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
398 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
399 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
412 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
413 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
414 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
415 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
418 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
419 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
420 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
421 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
422 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
425 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
426 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
427 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
428 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
429 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
432 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
433 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
434 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
441 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
445 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
446 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
447 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
448 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
449 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
450 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
451 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
452 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
453 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
454 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
455 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
456 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
457 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
458 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
459 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
460 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
461 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
462 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
463 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
464 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
465 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
466 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
467 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
468 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
469 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
470 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
471 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
472 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
473 2738541278 Niastella sp. CF465 Isolate Unclassified
474 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
475 2738541283 Pedobacter sp. OK701 Isolate Unclassified
476 2738541284 Pedobacter sp. YR016 Isolate Unclassified
477 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
478 2738541302 Pedobacter sp. CF074 Isolate Unclassified
479 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
480 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
481 2738543023 Pedobacter sp. OK628 Isolate Unclassified
482 2739367651 Pedobacter sp. OK291 Isolate Unclassified
483 2739367663 Pedobacter sp. YR510 Isolate Unclassified
484 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
485 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
486 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
487 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
488 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
489 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
490 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
491 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
492 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
493 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
494 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
495 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
496 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
497 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
498 2818991437 Pedobacter terrae 518 Isolate Unclassified
499 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
500 2818991444 Filimonas endophytica 3197 Isolate Unclassified
501 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
502 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
503 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
504 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
505 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
506 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
507 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
508 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
509 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
510 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
511 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
512 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
513 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
514 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
515 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
516 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
517 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
518 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
519 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
520 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
521 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
522 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
523 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
524 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
525 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
526 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
527 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
528 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
529 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
530 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
531 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
532 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
533 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
534 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
535 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
536 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
537 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
538 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
539 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
540 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
541 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
542 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
543 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
544 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
545 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
546 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
547 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
548 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
549 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
550 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
551 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
552 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
553 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
554 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
555 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
556 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
557 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
558 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
559 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
560 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
561 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
562 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
563 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
564 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
565 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
566 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
567 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
568 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
569 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
570 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
571 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
572 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
573 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
574 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
575 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.81
Metatranscriptomes 0.24
Isolates 7.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 6.56
Nodule 0.12
Rhizoplane 0.6
Rhizosphere 82.36
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0156289 3300039450 Bacteria 1221
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 SwRhRL2b_contig_2173254 2162886007 Bacteria 3520
4 SwRhRL2b_contig_2434048 2162886007 Bacteria 3550
5 SwRhRL2b_contig_2678590 2162886007 Bacteria 9311
6 JGI24739J22299_10010206 3300001989 Bacteria 3489
7 JGI24739J22299_10013537 3300001989 Bacteria 2976
8 JGI24737J22298_10038410 3300001990 Bacteria 1474
9 JGI24735J21928_10027358 3300002067 Bacteria 1709
10 JGI25154J39366_1000019 3300002738 Bacteria 234419
11 JGI25152J39213_1000894 3300002773 Bacteria 14641
12 JGI25150J39212_1000051 3300002774 Bacteria 72281
13 Ga0006759J45824_1089253 3300003163 Bacteria 1179
14 JGI25151J46595_10000205 3300003187 Bacteria 72281
15 JGI25153J46596_10000144 3300003215 Bacteria 72281
16 JGI25153J46596_10000324 3300003215 Bacteria 34778
17 rootH1_10001951 3300003316 Bacteria 18746
18 rootH1_10004056 3300003316 Bacteria 10350
19 rootH1_10004056 3300003323 Bacteria 14628
20 rootH2_10000230 3300003320 Bacteria 58157
21 rootH2_10025473 3300003320 Bacteria 20163
22 rootH2_10030707 3300003320 Bacteria 10843
23 rootH2_10032420 3300003320 Bacteria 4102
24 rootH2_10105619 3300003320 Bacteria 5272
25 rootH2_10110894 3300003320 Bacteria 1212
26 rootH2_10141236 3300003320 Bacteria 9169
27 rootH2_10161305 3300003320 Bacteria 5862
28 rootL2_10036423 3300003322 Bacteria 5523
29 rootH1_10000188 3300003323 Bacteria 3844
30 rootH1_10009140 3300003323 Bacteria 116095
31 rootH1_10010000 3300003323 Bacteria 7142
32 rootH1_10020851 3300003323 Bacteria 4197
33 rootH1_10021086 3300003323 Bacteria 19057
34 rootH1_10031539 3300003323 Bacteria 15372
35 rootH1_10048247 3300003323 Bacteria 4942
36 rootH1_10087740 3300003323 Bacteria 2894
37 rootH1_10097804 3300003323 Bacteria 3577
38 rootH1_10196799 3300003323 Bacteria 7745
39 rootH1_10239411 3300003323 Bacteria 1233
40 JGI25160J50197_1013603 3300003354 Bacteria 2765
41 JGI25160J50197_1015581 3300003354 Bacteria 2490
42 JGI25160J50197_1045618 3300003354 Bacteria 968
43 Ga0006562J51391_1006008 3300003578 Bacteria 7207
44 Ga0032354_1091257 3300003693 Bacteria 1161
45 Ga0055542_1003789 3300003762 Bacteria 3931
46 Ga0055526_1011612 3300003771 Bacteria 3946
47 Ga0055536_1000030 3300003781 Bacteria 153926
48 Ga0055534_1003684 3300003784 Bacteria 4740
49 Ga0055528_1000360 3300003790 Bacteria 37052
50 Ga0055530_10000723 3300003791 Bacteria 27721
51 Ga0055530_10010766 3300003791 Bacteria 3343
52 Ga0055531_10000153 3300003794 Bacteria 80166
53 Ga0055531_10000156 3300003794 Bacteria 78858
54 Ga0055543_1009253 3300004625 Bacteria 2129
55 Ga0065165_1000402 3300005262 Bacteria 69844
56 Ga0065165_1000835 3300005262 Bacteria 40473
57 Ga0065165_1010985 3300005262 Bacteria 3839
58 Ga0065714_10002361 3300005288 Bacteria 37849
59 Ga0065714_10003057 3300005288 Bacteria 24007
60 Ga0065714_10003305 3300005288 Bacteria 11301
61 Ga0065714_10024048 3300005288 Bacteria 2169
62 Ga0065714_10064513 3300005288 Bacteria 45040
63 Ga0065714_10064933 3300005288 Bacteria 15206
64 Ga0065714_10067901 3300005288 Bacteria 5122
65 Ga0065714_10080906 3300005288 Bacteria 2409
66 Ga0065714_10132309 3300005288 Bacteria 1228
67 Ga0065714_10138407 3300005288 Bacteria 1190
68 Ga0065704_10000238 3300005289 Bacteria 87424
69 Ga0065704_10070140 3300005289 Bacteria 482257
70 Ga0065704_10070945 3300005289 Bacteria 14340
71 Ga0065704_10071089 3300005289 Bacteria 13245
72 Ga0065704_10071898 3300005289 Bacteria 9663
73 Ga0065704_10072798 3300005289 Bacteria 7990
74 Ga0065704_10173413 3300005289 Bacteria 1278
75 Ga0065712_10000992 3300005290 Bacteria 8632
76 Ga0065712_10099414 3300005290 Bacteria 2055
77 Ga0065712_10172843 3300005290 Bacteria 1234
78 Ga0065715_10101395 3300005293 Bacteria 3200
79 Ga0065715_10248732 3300005293 Bacteria 1174
80 Ga0065707_10172508 3300005295 Bacteria 1474
81 Ga0070658_10000019 3300005327 Bacteria 194742
82 Ga0070658_10000620 3300005327 Bacteria 30623
83 Ga0070676_10000165 3300005328 Bacteria 26705
84 Ga0070676_10004448 3300005328 Bacteria 7378
85 Ga0070676_10009053 3300005328 Bacteria 5386
86 Ga0070683_100000490 3300005329 Bacteria 27911
87 Ga0070683_100008790 3300005329 Bacteria 8589
88 Ga0070683_100019095 3300005329 Bacteria 6082
89 Ga0070683_100033031 3300005329 Bacteria 4715
90 Ga0070683_100037917 3300005329 Bacteria 4414
91 Ga0070683_100214037 3300005329 Bacteria 1831
92 Ga0070690_100014558 3300005330 Bacteria 4668
93 Ga0070690_100222605 3300005330 Bacteria 1323
94 Ga0070670_100023449 3300005331 Bacteria 5312
95 Ga0070670_100045231 3300005331 Bacteria 3783
96 Ga0070670_100045675 3300005331 Bacteria 3766
97 Ga0070670_100124091 3300005331 Bacteria 2228
98 Ga0070670_100322721 3300005331 Bacteria 1353
99 Ga0068869_100035053 3300005334 Bacteria 3555
100 Ga0068869_100222530 3300005334 Bacteria 1497
101 Ga0068869_100278780 3300005334 Bacteria 1344
102 Ga0070666_10000149 3300005335 Bacteria 47838
103 Ga0070666_10026992 3300005335 Bacteria 3757
104 Ga0070666_10045180 3300005335 Bacteria 2952
105 Ga0070666_10101986 3300005335 Bacteria 1978
106 Ga0070666_10113350 3300005335 Bacteria 1876
107 Ga0070666_10124451 3300005335 Bacteria 1789
108 Ga0070680_100013984 3300005336 Bacteria 6264
109 Ga0070680_100109344 3300005336 Bacteria 2300
110 Ga0070680_100290676 3300005336 Bacteria 1385
111 Ga0070682_100000005 3300005337 Bacteria 386439
112 Ga0070682_100000353 3300005337 Bacteria 31269
113 Ga0070682_100000455 3300005337 Bacteria 25816
114 Ga0070682_100052137 3300005337 Bacteria 2560
115 Ga0070682_100055112 3300005337 Bacteria 2496
116 Ga0070682_100080907 3300005337 Bacteria 2102
117 Ga0070682_100397247 3300005337 Bacteria 1042
118 Ga0068868_100001512 3300005338 Bacteria 15994
119 Ga0068868_100009759 3300005338 Bacteria 6925
120 Ga0068868_100035335 3300005338 Bacteria 3863
121 Ga0068868_100095591 3300005338 Bacteria 2399
122 Ga0068868_100315327 3300005338 Bacteria 1331
123 Ga0068868_100542909 3300005338 Bacteria 1024
124 Ga0070660_100013586 3300005339 Bacteria 5847
125 Ga0070660_100024845 3300005339 Bacteria 4450
126 Ga0070660_100028630 3300005339 Bacteria 4170
127 Ga0070660_100086147 3300005339 Bacteria 2471
128 Ga0070660_100118568 3300005339 Bacteria 2111
129 Ga0070660_100302607 3300005339 Bacteria 1311
130 Ga0070660_100338361 3300005339 Bacteria 1238
131 Ga0070689_100007084 3300005340 Bacteria 7810
132 Ga0070689_100027440 3300005340 Bacteria 4293
133 Ga0070689_100053460 3300005340 Bacteria 3126
134 Ga0070689_100063420 3300005340 Bacteria 2876
135 Ga0070689_100079996 3300005340 Bacteria 2565
136 Ga0070689_100104131 3300005340 Bacteria 2250
137 Ga0070691_10000108 3300005341 Bacteria 24654
138 Ga0070691_10012823 3300005341 Bacteria 3841
139 Ga0070687_100004245 3300005343 Bacteria 5694
140 Ga0070687_100017865 3300005343 Bacteria 3272
141 Ga0070687_100169158 3300005343 Bacteria 1299
142 Ga0070661_100013211 3300005344 Bacteria 5797
143 Ga0070661_100014716 3300005344 Bacteria 5517
144 Ga0070661_100212627 3300005344 Bacteria 1481
145 Ga0070668_100000116 3300005347 Bacteria 49265
146 Ga0070668_100041075 3300005347 Bacteria 3543
147 Ga0070668_100344354 3300005347 Bacteria 1260
148 Ga0070668_100445138 3300005347 Bacteria 1113
149 Ga0070669_100001238 3300005353 Bacteria 18500
150 Ga0070669_100021706 3300005353 Bacteria 4589
151 Ga0070675_100007791 3300005354 Bacteria 8295
152 Ga0070675_100021277 3300005354 Bacteria 5182
153 Ga0070675_100023522 3300005354 Bacteria 4928
154 Ga0070675_100027436 3300005354 Bacteria 4574
155 Ga0070675_100259399 3300005354 Bacteria 1523
156 Ga0070675_100449113 3300005354 Bacteria 1156
157 Ga0070671_100007630 3300005355 Bacteria 8653
158 Ga0070671_100173151 3300005355 Bacteria 1826
159 Ga0070671_100278658 3300005355 Bacteria 1422
160 Ga0070673_100000521 3300005364 Bacteria 20630
161 Ga0070673_100002836 3300005364 Bacteria 10670
162 Ga0070673_100026243 3300005364 Bacteria 4301
163 Ga0070673_100050105 3300005364 Bacteria 3263
164 Ga0070673_100086001 3300005364 Bacteria 2561
165 Ga0070673_100236278 3300005364 Bacteria 1587
166 Ga0070673_100317680 3300005364 Bacteria 1375
167 Ga0070673_100481225 3300005364 Bacteria 1120
168 Ga0070673_100601736 3300005364 Bacteria 1003
169 Ga0070688_100020624 3300005365 Bacteria 3834
170 Ga0070688_100058227 3300005365 Bacteria 2432
171 Ga0070688_100088239 3300005365 Bacteria 2022
172 Ga0070688_100198694 3300005365 Bacteria 1402
173 Ga0070659_100000854 3300005366 Bacteria 22245
174 Ga0070659_100015398 3300005366 Bacteria 5728
175 Ga0070659_100064896 3300005366 Bacteria 2891
176 Ga0070659_100082653 3300005366 Bacteria 2566
177 Ga0070659_100194917 3300005366 Bacteria 1666
178 Ga0070667_100000652 3300005367 Bacteria 33714
179 Ga0070667_100037432 3300005367 Bacteria 4067
180 Ga0070667_100062287 3300005367 Bacteria 3159
181 Ga0070667_100062561 3300005367 Bacteria 3153
182 Ga0070667_100097378 3300005367 Bacteria 2538
183 Ga0070667_100221593 3300005367 Bacteria 1684
184 Ga0070714_100019735 3300005435 Bacteria 5497
185 Ga0070714_100028118 3300005435 Bacteria 4662
186 Ga0070701_10063559 3300005438 Bacteria 1953
187 Ga0070705_100078932 3300005440 Bacteria 2015
188 Ga0070700_100313123 3300005441 Bacteria 1150
189 Ga0070708_100131227 3300005445 Bacteria 2319
190 Ga0070708_100149144 3300005445 Bacteria 2174
191 Ga0070663_100077955 3300005455 Bacteria 2427
192 Ga0070678_100021123 3300005456 Bacteria 4287
193 Ga0070678_100035033 3300005456 Bacteria 3501
194 Ga0070662_100000185 3300005457 Bacteria 36147
195 Ga0070662_100001619 3300005457 Bacteria 13887
196 Ga0070662_100043870 3300005457 Bacteria 3201
197 Ga0070662_100054985 3300005457 Bacteria 2886
198 Ga0070681_10005301 3300005458 Bacteria 12452
199 Ga0070681_10038676 3300005458 Bacteria 4782
200 Ga0070681_10147632 3300005458 Bacteria 2279
201 Ga0070681_10150936 3300005458 Bacteria 2250
202 Ga0070681_10203847 3300005458 Bacteria 1895
203 Ga0070681_10358338 3300005458 Bacteria 1369
204 Ga0068867_100001301 3300005459 Bacteria 17246
205 Ga0068867_100001831 3300005459 Bacteria 14825
206 Ga0068867_100017992 3300005459 Bacteria 5021
207 Ga0068867_100019059 3300005459 Bacteria 4885
208 Ga0068867_100042333 3300005459 Bacteria 3331
209 Ga0068867_100108711 3300005459 Bacteria 2127
210 Ga0068867_100112021 3300005459 Bacteria 2098
211 Ga0068867_100140983 3300005459 Bacteria 1884
212 Ga0068867_100153104 3300005459 Bacteria 1813
213 Ga0070685_10029690 3300005466 Bacteria 3040
214 Ga0070685_10055309 3300005466 Bacteria 2305
215 Ga0070685_10219722 3300005466 Bacteria 1244
216 Ga0070706_100001897 3300005467 Bacteria 21585
217 Ga0070698_100004450 3300005471 Bacteria 15399
218 Ga0070698_100006719 3300005471 Bacteria 12477
219 Ga0070698_100046304 3300005471 Bacteria 4447
220 Ga0070698_100065647 3300005471 Bacteria 3653
221 Ga0070698_100085777 3300005471 Bacteria 3135
222 Ga0070699_100000898 3300005518 Bacteria 27761
223 Ga0070699_100005118 3300005518 Bacteria 11532
224 Ga0070679_100000684 3300005530 Bacteria 29020
225 Ga0070679_100000973 3300005530 Bacteria 24934
226 Ga0070679_100017813 3300005530 Bacteria 6879
227 Ga0070679_100055296 3300005530 Bacteria 3952
228 Ga0070679_100058796 3300005530 Bacteria 3831
229 Ga0070679_100157974 3300005530 Bacteria 2242
230 Ga0070679_100165970 3300005530 Bacteria 2181
231 Ga0070679_100170362 3300005530 Bacteria 2150
232 Ga0070679_100249019 3300005530 Bacteria 1733
233 Ga0070684_100001352 3300005535 Bacteria 17565
234 Ga0070684_100003219 3300005535 Bacteria 12214
235 Ga0070684_100022740 3300005535 Bacteria 5233
236 Ga0070684_100024742 3300005535 Bacteria 5039
237 Ga0070684_100039209 3300005535 Bacteria 4073
238 Ga0070684_100086908 3300005535 Bacteria 2776
239 Ga0070684_100099941 3300005535 Bacteria 2590
240 Ga0070684_100209603 3300005535 Bacteria 1776
241 Ga0070684_100597227 3300005535 Bacteria 1026
242 Ga0068853_100003822 3300005539 Bacteria 11533
243 Ga0068853_100003840 3300005539 Bacteria 11512
244 Ga0068853_100010559 3300005539 Bacteria 7467
245 Ga0068853_100014740 3300005539 Bacteria 6415
246 Ga0068853_100018808 3300005539 Bacteria 5721
247 Ga0068853_100034968 3300005539 Bacteria 4266
248 Ga0068853_100040230 3300005539 Bacteria 3988
249 Ga0068853_100055268 3300005539 Bacteria 3422
250 Ga0068853_100057677 3300005539 Bacteria 3351
251 Ga0068853_100088732 3300005539 Bacteria 2715
252 Ga0068853_100134213 3300005539 Bacteria 2218
253 Ga0068853_100135766 3300005539 Bacteria 2205
254 Ga0068853_100304975 3300005539 Bacteria 1473
255 Ga0070672_100000038 3300005543 Bacteria 57709
256 Ga0070672_100019728 3300005543 Bacteria 4900
257 Ga0070672_100054264 3300005543 Bacteria 3137
258 Ga0070672_100329967 3300005543 Bacteria 1298
259 Ga0070686_100000009 3300005544 Bacteria 202453
260 Ga0070686_100084247 3300005544 Bacteria 2112
261 Ga0070686_100152913 3300005544 Bacteria 1618
262 Ga0070686_100253836 3300005544 Bacteria 1286
263 Ga0070686_100314805 3300005544 Bacteria 1165
264 Ga0070695_100171337 3300005545 Bacteria 1531
265 Ga0070696_100000338 3300005546 Bacteria 28429
266 Ga0070696_100096932 3300005546 Bacteria 2108
267 Ga0070693_100022172 3300005547 Bacteria 3372
268 Ga0070665_100000003 3300005548 Bacteria 811857
269 Ga0070665_100000013 3300005548 Bacteria 484927
270 Ga0070665_100000504 3300005548 Bacteria 55959
271 Ga0068855_100000424 3300005563 Bacteria 52152
272 Ga0068855_100002280 3300005563 Bacteria 23696
273 Ga0068855_100004799 3300005563 Bacteria 16505
274 Ga0068855_100004987 3300005563 Bacteria 16203
275 Ga0068855_100007323 3300005563 Bacteria 13371
276 Ga0068855_100032608 3300005563 Bacteria 6218
277 Ga0068855_100051013 3300005563 Bacteria 4874
278 Ga0068855_100091566 3300005563 Bacteria 3507
279 Ga0068855_100099457 3300005563 Bacteria 3350
280 Ga0068855_100133364 3300005563 Bacteria 2835
281 Ga0068855_100171289 3300005563 Bacteria 2459
282 Ga0068855_100239514 3300005563 Bacteria 2028
283 Ga0068855_100440427 3300005563 Bacteria 1423
284 Ga0070664_100000887 3300005564 Bacteria 23244
285 Ga0070664_100027435 3300005564 Bacteria 4732
286 Ga0070664_100096084 3300005564 Bacteria 2571
287 Ga0070664_100218197 3300005564 Bacteria 1706
288 Ga0070664_100269108 3300005564 Bacteria 1534
289 Ga0068857_100001871 3300005577 Bacteria 16937
290 Ga0068857_100030476 3300005577 Bacteria 4763
291 Ga0068857_100037108 3300005577 Bacteria 4316
292 Ga0068857_100086576 3300005577 Bacteria 2802
293 Ga0068857_100090030 3300005577 Bacteria 2746
294 Ga0068857_100099568 3300005577 Bacteria 2608
295 Ga0068857_100125945 3300005577 Bacteria 2308
296 Ga0068857_100150650 3300005577 Bacteria 2107
297 Ga0068857_100551347 3300005577 Bacteria 1086
298 Ga0068854_100000001 3300005578 Bacteria 608908
299 Ga0068854_100037888 3300005578 Bacteria 3387
300 Ga0068854_100058665 3300005578 Bacteria 2779
301 Ga0068854_100059696 3300005578 Bacteria 2757
302 Ga0068854_100162486 3300005578 Bacteria 1731
303 Ga0068854_100179910 3300005578 Bacteria 1651
304 Ga0068854_100388785 3300005578 Bacteria 1151
305 Ga0068856_100000092 3300005614 Bacteria 84781
306 Ga0068856_100015638 3300005614 Bacteria 7335
307 Ga0068856_100063370 3300005614 Bacteria 3653
308 Ga0068856_100065310 3300005614 Bacteria 3596
309 Ga0068856_100104346 3300005614 Bacteria 2828
310 Ga0068856_100117548 3300005614 Bacteria 2659
311 Ga0068852_100000207 3300005616 Bacteria 39824
312 Ga0068852_100000372 3300005616 Bacteria 30292
313 Ga0068852_100001739 3300005616 Bacteria 14830
314 Ga0068852_100049153 3300005616 Bacteria 3607
315 Ga0068852_100056318 3300005616 Bacteria 3397
316 Ga0068852_100074782 3300005616 Bacteria 2985
317 Ga0068852_100157239 3300005616 Bacteria 2119
318 Ga0068852_100319746 3300005616 Bacteria 1507
319 Ga0068852_100501042 3300005616 Bacteria 1209
320 Ga0068859_100000037 3300005617 Bacteria 165480
321 Ga0068859_100000297 3300005617 Bacteria 49416
322 Ga0068859_100012921 3300005617 Bacteria 8389
323 Ga0068859_100018938 3300005617 Bacteria 6915
324 Ga0068859_100032567 3300005617 Bacteria 5235
325 Ga0068859_100038533 3300005617 Bacteria 4795
326 Ga0068859_100041123 3300005617 Bacteria 4644
327 Ga0068859_100060520 3300005617 Bacteria 3815
328 Ga0068859_100066417 3300005617 Bacteria 3642
329 Ga0068859_100119093 3300005617 Bacteria 2706
330 Ga0068859_100125357 3300005617 Bacteria 2637
331 Ga0068864_100001608 3300005618 Bacteria 18629
332 Ga0068864_100033690 3300005618 Bacteria 4355
333 Ga0068864_100056794 3300005618 Bacteria 3381
334 Ga0068864_100082848 3300005618 Bacteria 2816
335 Ga0068864_100112111 3300005618 Bacteria 2430
336 Ga0068864_100153123 3300005618 Bacteria 2090
337 Ga0068861_100024095 3300005719 Bacteria 4397
338 Ga0068861_100046336 3300005719 Bacteria 3277
339 Ga0068861_100426160 3300005719 Bacteria 1183
340 Ga0068851_10000211 3300005834 Bacteria 27822
341 Ga0068851_10004628 3300005834 Bacteria 6210
342 Ga0068851_10058142 3300005834 Bacteria 1975
343 Ga0068851_10081233 3300005834 Bacteria 1693
344 Ga0068851_10159207 3300005834 Bacteria 1239
345 Ga0068851_10230800 3300005834 Bacteria 1043
346 Ga0068870_10026851 3300005840 Bacteria 2874
347 Ga0068863_100004928 3300005841 Bacteria 13158
348 Ga0068863_100010020 3300005841 Bacteria 9222
349 Ga0068863_100024182 3300005841 Bacteria 5795
350 Ga0068863_100087086 3300005841 Bacteria 2959
351 Ga0068863_100127460 3300005841 Bacteria 2429
352 Ga0068863_100229108 3300005841 Bacteria 1792
353 Ga0068863_100277979 3300005841 Bacteria 1622
354 Ga0068863_100459948 3300005841 Bacteria 1250
355 Ga0068858_100045372 3300005842 Bacteria 4073
356 Ga0068858_100191217 3300005842 Bacteria 1934
357 Ga0068860_100000060 3300005843 Bacteria 195631
358 Ga0068860_100001930 3300005843 Bacteria 21943
359 Ga0068860_100002513 3300005843 Bacteria 19240
360 Ga0068860_100003819 3300005843 Bacteria 15494
361 Ga0068860_100006581 3300005843 Bacteria 11668
362 Ga0068860_100008084 3300005843 Bacteria 10475
363 Ga0068860_100017699 3300005843 Bacteria 6941
364 Ga0068860_100023835 3300005843 Bacteria 5917
365 Ga0068860_100038051 3300005843 Bacteria 4603
366 Ga0068860_100519160 3300005843 Bacteria 1191
367 Ga0068862_100009911 3300005844 Bacteria 7870
368 Ga0068862_100019107 3300005844 Bacteria 5713
369 Ga0068862_100202793 3300005844 Bacteria 1789
370 Ga0068862_100445040 3300005844 Bacteria 1220
371 Ga0081539_10000377 3300005985 Bacteria 97368
372 Ga0070716_100207196 3300006173 Bacteria 1308
373 Ga0075366_10000849 3300006195 Bacteria 14722
374 Ga0075366_10021480 3300006195 Bacteria 3752
375 Ga0075366_10053427 3300006195 Bacteria 2400
376 Ga0075366_10118894 3300006195 Bacteria 1592
377 Ga0097621_100000054 3300006237 Bacteria 59756
378 Ga0097621_100000538 3300006237 Bacteria 26658
379 Ga0097621_100003328 3300006237 Bacteria 11058
380 Ga0097621_100007933 3300006237 Bacteria 7618
381 Ga0097621_100009287 3300006237 Bacteria 7135
382 Ga0097621_100088709 3300006237 Bacteria 2584
383 Ga0097621_100121199 3300006237 Bacteria 2218
384 Ga0097621_100122047 3300006237 Bacteria 2211
385 Ga0097621_100502867 3300006237 Bacteria 1098
386 Ga0068871_100000145 3300006358 Bacteria 46320
387 Ga0068871_100000452 3300006358 Bacteria 28201
388 Ga0068871_100003693 3300006358 Bacteria 10518
389 Ga0068871_100008083 3300006358 Bacteria 7553
390 Ga0068871_100019024 3300006358 Bacteria 5235
391 Ga0068871_100588731 3300006358 Bacteria 1011
392 Ga0075428_100025789 3300006844 Bacteria 6510
393 Ga0075428_100217290 3300006844 Bacteria 2065
394 Ga0075428_100482962 3300006844 Bacteria 1326
395 Ga0075430_100002888 3300006846 Bacteria 14388
396 Ga0075430_100088252 3300006846 Bacteria 2595
397 Ga0075429_100005622 3300006880 Bacteria 10805
398 Ga0075429_100035668 3300006880 Bacteria 4326
399 Ga0075429_100098599 3300006880 Bacteria 2549
400 Ga0068865_100000051 3300006881 Bacteria 65346
401 Ga0068865_100001621 3300006881 Bacteria 13188
402 Ga0068865_100034481 3300006881 Bacteria 3396
403 Ga0068865_100072902 3300006881 Bacteria 2440
404 Ga0068865_100135783 3300006881 Bacteria 1848
405 Ga0097620_100000037 3300006931 Bacteria 165480
406 Ga0097620_100000297 3300006931 Bacteria 49416
407 Ga0097620_100012921 3300006931 Bacteria 8389
408 Ga0097620_100018938 3300006931 Bacteria 6915
409 Ga0097620_100032569 3300006931 Bacteria 5235
410 Ga0097620_100038533 3300006931 Bacteria 4795
411 Ga0097620_100041125 3300006931 Bacteria 4644
412 Ga0097620_100060522 3300006931 Bacteria 3815
413 Ga0097620_100066417 3300006931 Bacteria 3642
414 Ga0097620_100119099 3300006931 Bacteria 2706
415 Ga0097620_100125356 3300006931 Bacteria 2637
416 Ga0097620_100184357 3300006931 Bacteria 2171
417 Ga0105251_10046770 3300009011 Bacteria 2081
418 Ga0105244_10000004 3300009036 Bacteria 492478
419 Ga0105244_10000050 3300009036 Bacteria 138868
420 Ga0105240_10000288 3300009093 Bacteria 98146
421 Ga0105240_10000486 3300009093 Bacteria 73492
422 Ga0105240_10001336 3300009093 Bacteria 42397
423 Ga0105240_10002538 3300009093 Bacteria 29284
424 Ga0105240_10002890 3300009093 Bacteria 27120
425 Ga0105240_10035851 3300009093 Bacteria 6388
426 Ga0105240_10036520 3300009093 Bacteria 6319
427 Ga0105240_10036908 3300009093 Bacteria 6283
428 Ga0105240_10039015 3300009093 Bacteria 6086
429 Ga0105240_10058938 3300009093 Bacteria 4793
430 Ga0105240_10090460 3300009093 Bacteria 3740
431 Ga0105240_10091789 3300009093 Bacteria 3709
432 Ga0105240_10113122 3300009093 Bacteria 3280
433 Ga0105240_10354242 3300009093 Bacteria 1664
434 Ga0105240_10356391 3300009093 Bacteria 1658
435 Ga0105240_10399782 3300009093 Bacteria 1548
436 Ga0105240_10618733 3300009093 Bacteria 1190
437 Ga0111539_10010702 3300009094 Bacteria 11550
438 Ga0111539_10057146 3300009094 Bacteria 4634
439 Ga0111539_10109423 3300009094 Bacteria 3243
440 Ga0111539_10430513 3300009094 Bacteria 1536
441 Ga0105245_10069229 3300009098 Bacteria 3199
442 Ga0105247_10124201 3300009101 Bacteria 1676
443 Ga0114129_10062706 3300009147 Bacteria 5192
444 Ga0114129_10217408 3300009147 Bacteria 2580
445 Ga0114129_10881896 3300009147 Bacteria 1135
446 Ga0105243_10000714 3300009148 Bacteria 31987
447 Ga0105241_10000144 3300009174 Bacteria 50819
448 Ga0105241_10000159 3300009174 Bacteria 49102
449 Ga0105241_10009012 3300009174 Bacteria 7337
450 Ga0105241_10016889 3300009174 Bacteria 5357
451 Ga0105241_10023476 3300009174 Bacteria 4574
452 Ga0105241_10026541 3300009174 Bacteria 4310
453 Ga0105241_10128325 3300009174 Bacteria 2050
454 Ga0105241_10479124 3300009174 Bacteria 1106
455 Ga0105242_10008025 3300009176 Bacteria 8131
456 Ga0105242_10012643 3300009176 Bacteria 6500
457 Ga0105242_10019823 3300009176 Bacteria 5268
458 Ga0105242_10074643 3300009176 Bacteria 2822
459 Ga0105242_10145055 3300009176 Bacteria 2064
460 Ga0105242_10201298 3300009176 Bacteria 1769
461 Ga0105242_10303376 3300009176 Bacteria 1458
462 Ga0105242_10455481 3300009176 Bacteria 1207
463 Ga0105242_10609050 3300009176 Bacteria 1056
464 Ga0105237_10000340 3300009545 Bacteria 65768
465 Ga0105237_10001447 3300009545 Bacteria 31365
466 Ga0105237_10002246 3300009545 Bacteria 24061
467 Ga0105237_10002692 3300009545 Bacteria 21745
468 Ga0105237_10003438 3300009545 Bacteria 18794
469 Ga0105237_10003874 3300009545 Bacteria 17567
470 Ga0105237_10006527 3300009545 Bacteria 12911
471 Ga0105237_10014277 3300009545 Bacteria 8317
472 Ga0105237_10020082 3300009545 Bacteria 6896
473 Ga0105237_10037688 3300009545 Bacteria 4885
474 Ga0105237_10050656 3300009545 Bacteria 4172
475 Ga0105237_10082559 3300009545 Bacteria 3204
476 Ga0105237_10574565 3300009545 Bacteria 1134
477 Ga0105238_10001478 3300009551 Bacteria 23578
478 Ga0105238_10033082 3300009551 Bacteria 5261
479 Ga0105238_10178291 3300009551 Bacteria 2101
480 Ga0105249_10006624 3300009553 Bacteria 10077
481 Ga0105249_10019222 3300009553 Bacteria 6092
482 Ga0105249_10020766 3300009553 Bacteria 5873
483 Ga0105249_10024592 3300009553 Bacteria 5414
484 Ga0105249_10039265 3300009553 Bacteria 4297
485 Ga0105249_10109118 3300009553 Bacteria 2613
486 Ga0105249_10140985 3300009553 Bacteria 2312
487 Ga0105249_10171192 3300009553 Bacteria 2106
488 Ga0105249_10181116 3300009553 Bacteria 2050
489 Ga0105249_10273496 3300009553 Bacteria 1684
490 Ga0105249_10283010 3300009553 Bacteria 1657
491 Ga0105249_10303249 3300009553 Bacteria 1603
492 Ga0105249_10312134 3300009553 Bacteria 1581
493 Ga0105239_10000002 3300010375 Bacteria 610298
494 Ga0105239_10003371 3300010375 Bacteria 19606
495 Ga0105239_10004649 3300010375 Bacteria 16319
496 Ga0105239_10005221 3300010375 Bacteria 15287
497 Ga0105239_10007261 3300010375 Bacteria 12728
498 Ga0105239_10007528 3300010375 Bacteria 12487
499 Ga0105239_10009550 3300010375 Bacteria 10916
500 Ga0105239_10013160 3300010375 Bacteria 9192
501 Ga0105239_10022636 3300010375 Bacteria 6928
502 Ga0105239_10026857 3300010375 Bacteria 6336
503 Ga0105239_10043544 3300010375 Bacteria 4921
504 Ga0105239_10048749 3300010375 Bacteria 4644
505 Ga0105239_10059029 3300010375 Bacteria 4210
506 Ga0105239_10064731 3300010375 Bacteria 4014
507 Ga0105239_10071969 3300010375 Bacteria 3799
508 Ga0105239_10105947 3300010375 Bacteria 3114
509 Ga0105239_10106259 3300010375 Bacteria 3110
510 Ga0105239_10156519 3300010375 Bacteria 2545
511 Ga0105239_10420467 3300010375 Bacteria 1514
512 Ga0105246_10031234 3300011119 Bacteria 3523
513 Ga0105246_10161198 3300011119 Bacteria 1709
514 Ga0105246_10204698 3300011119 Bacteria 1537
515 Ga0157373_10000002 3300013100 Bacteria 750094
516 Ga0157373_10000022 3300013100 Bacteria 164884
517 Ga0157373_10000240 3300013100 Bacteria 44977
518 Ga0157373_10003717 3300013100 Bacteria 11545
519 Ga0157373_10010053 3300013100 Bacteria 6971
520 Ga0157373_10016960 3300013100 Bacteria 5306
521 Ga0157373_10024848 3300013100 Bacteria 4337
522 Ga0157373_10041929 3300013100 Bacteria 3273
523 Ga0157373_10043691 3300013100 Bacteria 3200
524 Ga0157373_10156476 3300013100 Bacteria 1603
525 Ga0157373_10197718 3300013100 Bacteria 1417
526 Ga0157373_10218164 3300013100 Bacteria 1345
527 Ga0157373_10384962 3300013100 Bacteria 1004
528 Ga0157371_10000034 3300013102 Bacteria 223947
529 Ga0157371_10000052 3300013102 Bacteria 179522
530 Ga0157371_10000315 3300013102 Bacteria 62944
531 Ga0157371_10001806 3300013102 Bacteria 21624
532 Ga0157371_10001838 3300013102 Bacteria 21398
533 Ga0157371_10002042 3300013102 Bacteria 19900
534 Ga0157371_10002767 3300013102 Bacteria 16483
535 Ga0157371_10009079 3300013102 Bacteria 7857
536 Ga0157371_10019323 3300013102 Bacteria 5027
537 Ga0157371_10025742 3300013102 Bacteria 4284
538 Ga0157371_10030858 3300013102 Bacteria 3863
539 Ga0157371_10032647 3300013102 Bacteria 3745
540 Ga0157371_10032676 3300013102 Bacteria 3743
541 Ga0157371_10035173 3300013102 Bacteria 3591
542 Ga0157371_10051810 3300013102 Bacteria 2916
543 Ga0157371_10069008 3300013102 Bacteria 2502
544 Ga0157371_10103420 3300013102 Bacteria 2021
545 Ga0157371_10103550 3300013102 Bacteria 2020
546 Ga0157371_10145591 3300013102 Bacteria 1688
547 Ga0157371_10159989 3300013102 Bacteria 1608
548 Ga0157371_10442534 3300013102 Bacteria 955
549 Ga0157370_10001848 3300013104 Bacteria 26098
550 Ga0157370_10003381 3300013104 Bacteria 18754
551 Ga0157370_10006627 3300013104 Bacteria 12725
552 Ga0157370_10006991 3300013104 Bacteria 12324
553 Ga0157370_10007182 3300013104 Bacteria 12153
554 Ga0157370_10007499 3300013104 Bacteria 11852
555 Ga0157370_10010995 3300013104 Bacteria 9492
556 Ga0157370_10014889 3300013104 Bacteria 7935
557 Ga0157370_10022321 3300013104 Bacteria 6299
558 Ga0157370_10027225 3300013104 Bacteria 5637
559 Ga0157370_10035152 3300013104 Bacteria 4873
560 Ga0157370_10040466 3300013104 Bacteria 4500
561 Ga0157370_10041127 3300013104 Bacteria 4462
562 Ga0157370_10062774 3300013104 Bacteria 3522
563 Ga0157370_10064117 3300013104 Bacteria 3479
564 Ga0157370_10066514 3300013104 Bacteria 3408
565 Ga0157370_10116882 3300013104 Bacteria 2491
566 Ga0157370_10158000 3300013104 Bacteria 2109
567 Ga0157370_10191187 3300013104 Bacteria 1900
568 Ga0157370_10204600 3300013104 Bacteria 1831
569 Ga0157370_10295832 3300013104 Bacteria 1495
570 Ga0157370_10308836 3300013104 Bacteria 1459
571 Ga0157370_10502848 3300013104 Bacteria 1113
572 Ga0157369_10000002 3300013105 Bacteria 524510
573 Ga0157369_10000546 3300013105 Bacteria 49491
574 Ga0157369_10002262 3300013105 Bacteria 23146
575 Ga0157369_10012625 3300013105 Bacteria 9578
576 Ga0157369_10064429 3300013105 Bacteria 3947
577 Ga0157369_10123229 3300013105 Bacteria 2749
578 Ga0157369_10126597 3300013105 Bacteria 2708
579 Ga0157369_10165029 3300013105 Bacteria 2336
580 Ga0157369_10198778 3300013105 Bacteria 2105
581 Ga0157369_10214794 3300013105 Bacteria 2015
582 Ga0157369_10220944 3300013105 Bacteria 1983
583 Ga0157369_10228004 3300013105 Bacteria 1948
584 Ga0157369_10228096 3300013105 Bacteria 1948
585 Ga0157369_10229542 3300013105 Bacteria 1941
586 Ga0157369_10304194 3300013105 Bacteria 1658
587 Ga0157369_10310389 3300013105 Bacteria 1640
588 Ga0157374_10000007 3300013296 Bacteria 595643
589 Ga0157374_10001618 3300013296 Bacteria 18887
590 Ga0157374_10006545 3300013296 Bacteria 9895
591 Ga0157374_10009663 3300013296 Bacteria 8282
592 Ga0157374_10041358 3300013296 Bacteria 4248
593 Ga0157374_10046398 3300013296 Bacteria 4024
594 Ga0157374_10091140 3300013296 Bacteria 2907
595 Ga0157374_10109266 3300013296 Bacteria 2658
596 Ga0157374_10157830 3300013296 Bacteria 2208
597 Ga0157374_10201422 3300013296 Bacteria 1949
598 Ga0157374_10419676 3300013296 Bacteria 1337
599 Ga0157378_10006148 3300013297 Bacteria 10518
600 Ga0157378_10019271 3300013297 Bacteria 5997
601 Ga0157378_10019552 3300013297 Bacteria 5954
602 Ga0157378_10038445 3300013297 Bacteria 4241
603 Ga0157378_10079509 3300013297 Bacteria 2960
604 Ga0157378_10098479 3300013297 Bacteria 2666
605 Ga0157378_10141317 3300013297 Bacteria 2236
606 Ga0157378_10261061 3300013297 Bacteria 1662
607 Ga0157378_10536456 3300013297 Bacteria 1174
608 Ga0163162_10000064 3300013306 Bacteria 103542
609 Ga0163162_10000213 3300013306 Bacteria 53744
610 Ga0163162_10000330 3300013306 Bacteria 43379
611 Ga0163162_10000386 3300013306 Bacteria 40256
612 Ga0163162_10000487 3300013306 Bacteria 36809
613 Ga0163162_10000942 3300013306 Bacteria 27029
614 Ga0163162_10002936 3300013306 Bacteria 16266
615 Ga0163162_10009251 3300013306 Bacteria 9586
616 Ga0163162_10182430 3300013306 Bacteria 2225
617 Ga0163162_10192462 3300013306 Bacteria 2167
618 Ga0163162_10192528 3300013306 Bacteria 2167
619 Ga0163162_10354953 3300013306 Bacteria 1599
620 Ga0163162_10435430 3300013306 Bacteria 1443
621 Ga0163162_10499781 3300013306 Bacteria 1346
622 Ga0157372_10000186 3300013307 Bacteria 68701
623 Ga0157372_10001707 3300013307 Bacteria 23820
624 Ga0157372_10001805 3300013307 Bacteria 23257
625 Ga0157372_10003368 3300013307 Bacteria 17241
626 Ga0157372_10005795 3300013307 Bacteria 13155
627 Ga0157372_10010801 3300013307 Bacteria 9720
628 Ga0157372_10013159 3300013307 Bacteria 8828
629 Ga0157372_10015096 3300013307 Bacteria 8268
630 Ga0157372_10019462 3300013307 Bacteria 7317
631 Ga0157372_10053501 3300013307 Bacteria 4500
632 Ga0157372_10054631 3300013307 Bacteria 4456
633 Ga0157372_10070389 3300013307 Bacteria 3936
634 Ga0157372_10083574 3300013307 Bacteria 3617
635 Ga0157372_10136917 3300013307 Bacteria 2821
636 Ga0157372_10145531 3300013307 Bacteria 2733
637 Ga0157372_10150168 3300013307 Bacteria 2689
638 Ga0157372_10195265 3300013307 Bacteria 2345
639 Ga0157372_10429567 3300013307 Bacteria 1540
640 Ga0157372_10482947 3300013307 Bacteria 1444
641 Ga0157372_10578885 3300013307 Bacteria 1308
642 Ga0157372_10686438 3300013307 Bacteria 1192
643 Ga0157372_10864322 3300013307 Bacteria 1050
644 Ga0157375_10000178 3300013308 Bacteria 59417
645 Ga0157375_10000548 3300013308 Bacteria 33804
646 Ga0157375_10000813 3300013308 Bacteria 27357
647 Ga0157375_10015502 3300013308 Bacteria 6823
648 Ga0157375_10022597 3300013308 Bacteria 5791
649 Ga0157375_10032794 3300013308 Bacteria 4929
650 Ga0157375_10054458 3300013308 Bacteria 3940
651 Ga0157375_10076124 3300013308 Bacteria 3382
652 Ga0157375_10091194 3300013308 Bacteria 3108
653 Ga0157375_10182179 3300013308 Bacteria 2252
654 Ga0157375_10185943 3300013308 Bacteria 2231
655 Ga0157375_10439993 3300013308 Bacteria 1469
656 Ga0157375_10589767 3300013308 Bacteria 1271
657 Ga0163163_10000046 3300014325 Bacteria 133543
658 Ga0163163_10000218 3300014325 Bacteria 59659
659 Ga0163163_10002472 3300014325 Bacteria 15623
660 Ga0163163_10075694 3300014325 Bacteria 3359
661 Ga0163163_10137520 3300014325 Bacteria 2484
662 Ga0163163_10189930 3300014325 Bacteria 2102
663 Ga0157380_10008479 3300014326 Bacteria 7342
664 Ga0157380_10081357 3300014326 Bacteria 2649
665 Ga0157380_10102557 3300014326 Bacteria 2386
666 Ga0157380_10111320 3300014326 Bacteria 2301
667 Ga0182008_10000010 3300014497 Bacteria 301527
668 Ga0182008_10000129 3300014497 Bacteria 57359
669 Ga0182008_10000726 3300014497 Bacteria 23436
670 Ga0182008_10001151 3300014497 Bacteria 18248
671 Ga0157377_10008517 3300014745 Bacteria 5005
672 Ga0157377_10068354 3300014745 Bacteria 2047
673 Ga0157377_10068656 3300014745 Bacteria 2043
674 Ga0157377_10304580 3300014745 Bacteria 1053
675 Ga0157379_10000020 3300014968 Bacteria 92868
676 Ga0157379_10063857 3300014968 Bacteria 3291
677 Ga0157379_10104067 3300014968 Bacteria 2548
678 Ga0157376_10000297 3300014969 Bacteria 33467
679 Ga0157376_10001923 3300014969 Bacteria 13869
680 Ga0157376_10010993 3300014969 Bacteria 6651
681 Ga0157376_10152574 3300014969 Bacteria 2085
682 Ga0157376_10198771 3300014969 Bacteria 1843
683 Ga0157376_10386664 3300014969 Bacteria 1349
684 Ga0157376_10464473 3300014969 Bacteria 1237
685 Ga0182006_1000012 3300015261 Bacteria 394239
686 Ga0182006_1000505 3300015261 Bacteria 29828
687 Ga0182006_1002042 3300015261 Bacteria 11329
688 Ga0182006_1002694 3300015261 Bacteria 9542
689 Ga0182006_1003243 3300015261 Bacteria 8439
690 Ga0182006_1009439 3300015261 Bacteria 4370
691 Ga0182006_1061253 3300015261 Bacteria 1419
692 Ga0182007_10000001 3300015262 Bacteria 1127301
693 Ga0182007_10035102 3300015262 Bacteria 1690
694 Ga0182005_1000023 3300015265 Bacteria 246328
695 Ga0183373_1003 3300015682 Bacteria 558813
696 Ga0163161_10000007 3300017792 Bacteria 301614
697 Ga0163161_10000224 3300017792 Bacteria 51786
698 Ga0163161_10000950 3300017792 Bacteria 22231
699 Ga0163161_10001201 3300017792 Bacteria 19515
700 Ga0163161_10001536 3300017792 Bacteria 17042
701 Ga0163161_10002262 3300017792 Bacteria 13802
702 Ga0163161_10175262 3300017792 Bacteria 1641
703 Ga0206356_11441053 3300020070 Bacteria 10504
704 Ga0213872_10027527 3300021361 Bacteria 2609
705 Ga0213874_10055996 3300021377 Bacteria 1223
706 Ga0213876_10019878 3300021384 Bacteria 3547
707 Ga0213876_10041036 3300021384 Bacteria 2445
708 Ga0213876_10053991 3300021384 Bacteria 2122
709 Ga0213875_10001725 3300021388 Bacteria 13710
710 Ga0213875_10002342 3300021388 Bacteria 11447
711 Ga0213875_10046959 3300021388 Bacteria 2026
712 Ga0209436_100215 3300025208 Bacteria 26688
713 Ga0209258_100068 3300025242 Bacteria 286288
714 Ga0207425_1000007 3300025245 Bacteria 777411
715 Ga0209646_1000003 3300025246 Bacteria 1160860
716 Ga0209646_1000557 3300025246 Bacteria 15708
717 Ga0209646_1006591 3300025246 Bacteria 1943
718 Ga0209026_1000351 3300025250 Bacteria 43657
719 Ga0209026_1001293 3300025250 Bacteria 11348
720 Ga0209026_1001890 3300025250 Bacteria 8522
721 Ga0209148_1000182 3300025254 Bacteria 123558
722 Ga0209129_1000006 3300025258 Bacteria 777761
723 Ga0209233_1001459 3300025261 Bacteria 9332
724 Ga0209673_1000194 3300025273 Bacteria 122640
725 Ga0209130_1001519 3300025284 Bacteria 14922
726 Ga0209675_1000116 3300025291 Bacteria 111613
727 Ga0209676_1000001 3300025292 Bacteria 1852142
728 Ga0209025_1000025 3300025294 Bacteria 524454
729 Ga0209564_1002770 3300025295 Bacteria 13142
730 Ga0209564_1018457 3300025295 Bacteria 2656
731 Ga0209564_1032622 3300025295 Bacteria 1565
732 Ga0209758_1000016 3300025297 Bacteria 778557
733 Ga0209758_1005012 3300025297 Bacteria 10564
734 Ga0209758_1005299 3300025297 Bacteria 10069
735 Ga0209758_1006844 3300025297 Bacteria 7984
736 Ga0209050_1000018 3300025298 Bacteria 723263
737 Ga0209050_1000765 3300025298 Bacteria 46179
738 Ga0209050_1005793 3300025298 Bacteria 7598
739 Ga0207426_1000051 3300025302 Bacteria 391700
740 Ga0207426_1000698 3300025302 Bacteria 40078
741 Ga0207426_1003100 3300025302 Bacteria 9502
742 Ga0207426_1003377 3300025302 Bacteria 8755
743 Ga0207426_1033695 3300025302 Bacteria 1649
744 Ga0209257_1000001 3300025304 Bacteria 2274655
745 Ga0209257_1000005 3300025304 Bacteria 1592528
746 Ga0207697_10041542 3300025315 Bacteria 1888
747 Ga0207656_10001225 3300025321 Bacteria 8462
748 Ga0207656_10053808 3300025321 Bacteria 1748
749 Ga0207655_1000008 3300025728 Bacteria 734289
750 Ga0207655_1000480 3300025728 Bacteria 51524
751 Ga0207682_10005264 3300025893 Bacteria 5291
752 Ga0207642_10013913 3300025899 Bacteria 2952
753 Ga0207710_10001860 3300025900 Bacteria 10160
754 Ga0207680_10000122 3300025903 Bacteria 36234
755 Ga0207680_10026027 3300025903 Bacteria 3237
756 Ga0207647_10000011 3300025904 Bacteria 156667
757 Ga0207647_10000030 3300025904 Bacteria 106974
758 Ga0207647_10000093 3300025904 Bacteria 68094
759 Ga0207647_10175645 3300025904 Bacteria 1246
760 Ga0207645_10000652 3300025907 Bacteria 28838
761 Ga0207645_10000716 3300025907 Bacteria 27613
762 Ga0207645_10009152 3300025907 Bacteria 6867
763 Ga0207643_10001321 3300025908 Bacteria 14375
764 Ga0207705_10000069 3300025909 Bacteria 133094
765 Ga0207705_10013031 3300025909 Bacteria 6001
766 Ga0207705_10038520 3300025909 Bacteria 3423
767 Ga0207705_10134475 3300025909 Unclassified 1842
768 Ga0207705_10214348 3300025909 Bacteria 1461
769 Ga0207684_10022615 3300025910 Bacteria 5366
770 Ga0207654_10000765 3300025911 Bacteria 17701
771 Ga0207654_10003555 3300025911 Bacteria 7880
772 Ga0207654_10003795 3300025911 Bacteria 7619
773 Ga0207707_10000317 3300025912 Bacteria 50861
774 Ga0207707_10012901 3300025912 Bacteria 7273
775 Ga0207707_10031015 3300025912 Bacteria 4676
776 Ga0207707_10084341 3300025912 Bacteria 2775
777 Ga0207695_10000064 3300025913 Bacteria 346010
778 Ga0207695_10000130 3300025913 Bacteria 224214
779 Ga0207695_10000170 3300025913 Bacteria 192469
780 Ga0207695_10001063 3300025913 Bacteria 48025
781 Ga0207695_10001252 3300025913 Bacteria 43328
782 Ga0207695_10003137 3300025913 Bacteria 23613
783 Ga0207695_10005821 3300025913 Bacteria 16211
784 Ga0207695_10007582 3300025913 Bacteria 13759
785 Ga0207695_10022346 3300025913 Bacteria 7183
786 Ga0207695_10029276 3300025913 Bacteria 6090
787 Ga0207695_10061629 3300025913 Bacteria 3876
788 Ga0207695_10088895 3300025913 Bacteria 3108
789 Ga0207695_10120409 3300025913 Bacteria 2593
790 Ga0207695_10304710 3300025913 Bacteria 1484
791 Ga0207671_10001726 3300025914 Bacteria 24605
792 Ga0207671_10002818 3300025914 Bacteria 18085
793 Ga0207671_10004790 3300025914 Bacteria 12750
794 Ga0207671_10008461 3300025914 Bacteria 8723
795 Ga0207671_10021002 3300025914 Bacteria 4962
796 Ga0207671_10035702 3300025914 Bacteria 3687
797 Ga0207671_10056473 3300025914 Bacteria 2909
798 Ga0207660_10001972 3300025917 Bacteria 13679
799 Ga0207660_10070780 3300025917 Bacteria 2536
800 Ga0207660_10164749 3300025917 Bacteria 1713
801 Ga0207662_10007258 3300025918 Bacteria 6025
802 Ga0207662_10008205 3300025918 Bacteria 5714
803 Ga0207662_10052087 3300025918 Bacteria 2436
804 Ga0207662_10055033 3300025918 Bacteria 2374
805 Ga0207662_10087399 3300025918 Bacteria 1912
806 Ga0207657_10016490 3300025919 Bacteria 7124
807 Ga0207657_10023752 3300025919 Bacteria 5701
808 Ga0207657_10037451 3300025919 Bacteria 4330
809 Ga0207657_10049987 3300025919 Bacteria 3640
810 Ga0207657_10084882 3300025919 Bacteria 2653
811 Ga0207657_10159740 3300025919 Bacteria 1831
812 Ga0207649_10014837 3300025920 Bacteria 4370
813 Ga0207652_10000013 3300025921 Bacteria 222247
814 Ga0207652_10000035 3300025921 Bacteria 138263
815 Ga0207652_10000456 3300025921 Bacteria 42137
816 Ga0207652_10004312 3300025921 Bacteria 11594
817 Ga0207652_10011733 3300025921 Bacteria 7072
818 Ga0207652_10039216 3300025921 Bacteria 4019
819 Ga0207652_10163411 3300025921 Bacteria 1996
820 Ga0207681_10054364 3300025923 Bacteria 2722
821 Ga0207681_10069179 3300025923 Bacteria 2455
822 Ga0207681_10071584 3300025923 Bacteria 2419
823 Ga0207694_10016025 3300025924 Bacteria 5656
824 Ga0207694_10020911 3300025924 Bacteria 4955
825 Ga0207694_10066212 3300025924 Bacteria 2818
826 Ga0207694_10117772 3300025924 Bacteria 2118
827 Ga0207650_10005437 3300025925 Bacteria 8696
828 Ga0207650_10012262 3300025925 Bacteria 5915
829 Ga0207650_10188420 3300025925 Bacteria 1647
830 Ga0207650_10240509 3300025925 Bacteria 1463
831 Ga0207650_10295995 3300025925 Bacteria 1321
832 Ga0207650_10441955 3300025925 Bacteria 1081
833 Ga0207659_10012869 3300025926 Bacteria 5341
834 Ga0207659_10020238 3300025926 Bacteria 4396
835 Ga0207659_10060146 3300025926 Bacteria 2733
836 Ga0207659_10284745 3300025926 Bacteria 1352
837 Ga0207664_10023739 3300025929 Bacteria 4599
838 Ga0207644_10008482 3300025931 Bacteria 6728
839 Ga0207644_10014222 3300025931 Bacteria 5322
840 Ga0207644_10097628 3300025931 Bacteria 2201
841 Ga0207690_10003762 3300025932 Bacteria 8994
842 Ga0207690_10039633 3300025932 Bacteria 3075
843 Ga0207690_10060194 3300025932 Bacteria 2576
844 Ga0207690_10076772 3300025932 Bacteria 2320
845 Ga0207690_10270110 3300025932 Bacteria 1321
846 Ga0207706_10000243 3300025933 Bacteria 59842
847 Ga0207706_10000960 3300025933 Bacteria 29510
848 Ga0207706_10007335 3300025933 Bacteria 10196
849 Ga0207706_10029076 3300025933 Bacteria 4935
850 Ga0207706_10074559 3300025933 Bacteria 2984
851 Ga0207686_10000893 3300025934 Bacteria 17996
852 Ga0207686_10196389 3300025934 Bacteria 1442
853 Ga0207686_10292736 3300025934 Bacteria 1206
854 Ga0207709_10000385 3300025935 Bacteria 43862
855 Ga0207670_10010640 3300025936 Bacteria 5308
856 Ga0207670_10067313 3300025936 Bacteria 2464
857 Ga0207670_10069241 3300025936 Bacteria 2433
858 Ga0207670_10237539 3300025936 Bacteria 1402
859 Ga0207704_10000046 3300025938 Bacteria 86187
860 Ga0207704_10001715 3300025938 Bacteria 9809
861 Ga0207704_10055723 3300025938 Bacteria 2417
862 Ga0207704_10251117 3300025938 Bacteria 1328
863 Ga0207665_10198606 3300025939 Bacteria 1460
864 Ga0207691_10000013 3300025940 Bacteria 147349
865 Ga0207691_10023117 3300025940 Bacteria 5853
866 Ga0207691_10037040 3300025940 Bacteria 4518
867 Ga0207691_10151805 3300025940 Bacteria 2036
868 Ga0207691_10269584 3300025940 Bacteria 1466
869 Ga0207689_10018622 3300025942 Bacteria 5858
870 Ga0207689_10030399 3300025942 Bacteria 4501
871 Ga0207689_10037050 3300025942 Bacteria 4048
872 Ga0207689_10047129 3300025942 Bacteria 3560
873 Ga0207689_10134090 3300025942 Bacteria 2039
874 Ga0207689_10177894 3300025942 Bacteria 1754
875 Ga0207689_10273500 3300025942 Bacteria 1398
876 Ga0207689_10317289 3300025942 Bacteria 1293
877 Ga0207661_10002525 3300025944 Bacteria 12595
878 Ga0207661_10004578 3300025944 Bacteria 9691
879 Ga0207661_10034379 3300025944 Bacteria 3941
880 Ga0207661_10114832 3300025944 Bacteria 2283
881 Ga0207661_10319741 3300025944 Bacteria 1395
882 Ga0207679_10001836 3300025945 Bacteria 13215
883 Ga0207679_10085593 3300025945 Bacteria 2422
884 Ga0207679_10124602 3300025945 Bacteria 2057
885 Ga0207679_10168844 3300025945 Bacteria 1799
886 Ga0207679_10484342 3300025945 Bacteria 1102
887 Ga0207667_10000239 3300025949 Bacteria 76776
888 Ga0207667_10000409 3300025949 Bacteria 58374
889 Ga0207667_10000876 3300025949 Bacteria 38469
890 Ga0207667_10001727 3300025949 Bacteria 27517
891 Ga0207667_10003906 3300025949 Bacteria 18334
892 Ga0207667_10007947 3300025949 Bacteria 12658
893 Ga0207667_10009468 3300025949 Bacteria 11471
894 Ga0207667_10009667 3300025949 Bacteria 11342
895 Ga0207667_10010158 3300025949 Bacteria 11026
896 Ga0207667_10013674 3300025949 Bacteria 9276
897 Ga0207667_10038396 3300025949 Bacteria 5115
898 Ga0207667_10048086 3300025949 Bacteria 4512
899 Ga0207667_10051902 3300025949 Bacteria 4321
900 Ga0207667_10116102 3300025949 Bacteria 2758
901 Ga0207667_10195020 3300025949 Bacteria 2078
902 Ga0207651_10000468 3300025960 Bacteria 17037
903 Ga0207651_10104611 3300025960 Bacteria 2110
904 Ga0207651_10208329 3300025960 Bacteria 1572
905 Ga0207651_10436841 3300025960 Bacteria 1120
906 Ga0207651_10494415 3300025960 Bacteria 1056
907 Ga0207712_10004227 3300025961 Bacteria 9060
908 Ga0207712_10005693 3300025961 Bacteria 7856
909 Ga0207712_10008770 3300025961 Bacteria 6396
910 Ga0207712_10021924 3300025961 Bacteria 4199
911 Ga0207712_10096244 3300025961 Bacteria 2191
912 Ga0207668_10000295 3300025972 Bacteria 32756
913 Ga0207668_10123391 3300025972 Bacteria 1965
914 Ga0207668_10159509 3300025972 Bacteria 1756
915 Ga0207668_10325537 3300025972 Bacteria 1277
916 Ga0207668_10448565 3300025972 Bacteria 1100
917 Ga0207640_10000003 3300025981 Bacteria 505282
918 Ga0207640_10026917 3300025981 Bacteria 3498
919 Ga0207640_10093250 3300025981 Bacteria 2091
920 Ga0207658_10005989 3300025986 Bacteria 8313
921 Ga0207658_10058238 3300025986 Bacteria 2874
922 Ga0207658_10131215 3300025986 Bacteria 2013
923 Ga0207658_10131331 3300025986 Bacteria 2012
924 Ga0207677_10009715 3300026023 Bacteria 5419
925 Ga0207677_10528906 3300026023 Bacteria 1024
926 Ga0207703_10001005 3300026035 Bacteria 27079
927 Ga0207703_10030189 3300026035 Bacteria 4282
928 Ga0207703_10088782 3300026035 Bacteria 2595
929 Ga0207639_10001884 3300026041 Bacteria 14093
930 Ga0207639_10003462 3300026041 Bacteria 10618
931 Ga0207639_10003621 3300026041 Bacteria 10377
932 Ga0207639_10009995 3300026041 Bacteria 6558
933 Ga0207639_10015497 3300026041 Bacteria 5380
934 Ga0207639_10022128 3300026041 Bacteria 4577
935 Ga0207639_10095011 3300026041 Bacteria 2394
936 Ga0207639_10155125 3300026041 Bacteria 1922
937 Ga0207639_10315236 3300026041 Bacteria 1387
938 Ga0207639_10425471 3300026041 Bacteria 1201
939 Ga0207678_10019032 3300026067 Bacteria 6031
940 Ga0207678_10032984 3300026067 Bacteria 4512
941 Ga0207678_10133369 3300026067 Bacteria 2119
942 Ga0207678_10368085 3300026067 Bacteria 1241
943 Ga0207702_10001849 3300026078 Bacteria 20848
944 Ga0207702_10025828 3300026078 Bacteria 4875
945 Ga0207702_10034899 3300026078 Bacteria 4206
946 Ga0207702_10045223 3300026078 Bacteria 3704
947 Ga0207702_10082017 3300026078 Bacteria 2803
948 Ga0207702_10139415 3300026078 Bacteria 2192
949 Ga0207702_10335977 3300026078 Bacteria 1442
950 Ga0207702_10422683 3300026078 Bacteria 1289
951 Ga0207641_10000121 3300026088 Bacteria 114943
952 Ga0207641_10007872 3300026088 Bacteria 8841
953 Ga0207641_10017376 3300026088 Bacteria 5889
954 Ga0207641_10026539 3300026088 Bacteria 4782
955 Ga0207641_10169730 3300026088 Bacteria 1990
956 Ga0207641_10187368 3300026088 Bacteria 1899
957 Ga0207641_10220352 3300026088 Bacteria 1759
958 Ga0207641_10236040 3300026088 Bacteria 1702
959 Ga0207648_10000257 3300026089 Bacteria 57438
960 Ga0207648_10006608 3300026089 Bacteria 11516
961 Ga0207648_10013283 3300026089 Bacteria 7671
962 Ga0207648_10024715 3300026089 Bacteria 5358
963 Ga0207648_10038642 3300026089 Bacteria 4199
964 Ga0207648_10067003 3300026089 Bacteria 3131
965 Ga0207648_10295816 3300026089 Bacteria 1451
966 Ga0207676_10001058 3300026095 Bacteria 20966
967 Ga0207676_10013780 3300026095 Bacteria 5804
968 Ga0207676_10030767 3300026095 Bacteria 4032
969 Ga0207676_10078717 3300026095 Bacteria 2671
970 Ga0207676_10084159 3300026095 Bacteria 2592
971 Ga0207676_10222150 3300026095 Bacteria 1683
972 Ga0207674_10001258 3300026116 Bacteria 33135
973 Ga0207674_10026912 3300026116 Bacteria 6099
974 Ga0207674_10029400 3300026116 Bacteria 5785
975 Ga0207674_10050362 3300026116 Bacteria 4255
976 Ga0207674_10067559 3300026116 Bacteria 3599
977 Ga0207674_10108632 3300026116 Bacteria 2750
978 Ga0207674_10141577 3300026116 Bacteria 2364
979 Ga0207674_10254511 3300026116 Bacteria 1703
980 Ga0207674_10293853 3300026116 Bacteria 1573
981 Ga0207674_10526691 3300026116 Bacteria 1142
982 Ga0207675_100000762 3300026118 Bacteria 32039
983 Ga0207675_100016606 3300026118 Bacteria 6875
984 Ga0207675_100039146 3300026118 Bacteria 4425
985 Ga0207675_100083763 3300026118 Bacteria 2991
986 Ga0207675_100091523 3300026118 Bacteria 2860
987 Ga0207675_100165899 3300026118 Bacteria 2109
988 Ga0207675_100297429 3300026118 Bacteria 1571
989 Ga0207683_10020515 3300026121 Bacteria 5653
990 Ga0207683_10101735 3300026121 Bacteria 2566
991 Ga0207698_10001507 3300026142 Bacteria 13555
992 Ga0207698_10015124 3300026142 Bacteria 5158
993 Ga0207698_10021343 3300026142 Bacteria 4476
994 Ga0207698_10089483 3300026142 Bacteria 2514
995 Ga0207698_10133598 3300026142 Bacteria 2125
996 Ga0207698_10256356 3300026142 Bacteria 1604
997 Ga0207698_10272969 3300026142 Bacteria 1560
998 Ga0207698_10377523 3300026142 Bacteria 1347
999 Ga0207698_10471918 3300026142 Bacteria 1215
1000 Ga0209281_1000116 3300027111 Bacteria 209707
1001 Ga0210002_1021460 3300027617 Bacteria 1044
1002 Ga0209974_10035082 3300027876 Bacteria 1665
1003 Ga0207428_10013193 3300027907 Bacteria 7233
1004 Ga0207428_10035988 3300027907 Bacteria 4041
1005 Ga0207428_10324915 3300027907 Bacteria 1136
1006 Ga0268266_10000024 3300028379 Bacteria 490820
1007 Ga0268266_10000078 3300028379 Bacteria 213632
1008 Ga0268266_10002084 3300028379 Bacteria 22148
1009 Ga0268266_10015921 3300028379 Bacteria 6435
1010 Ga0268265_10013369 3300028380 Bacteria 5577
1011 Ga0268265_10196297 3300028380 Bacteria 1747
1012 Ga0268265_10281367 3300028380 Bacteria 1488
1013 Ga0268265_10292717 3300028380 Bacteria 1462
1014 Ga0268264_10000109 3300028381 Bacteria 208477
1015 Ga0268264_10004538 3300028381 Bacteria 11831
1016 Ga0268264_10005427 3300028381 Bacteria 10800
1017 Ga0268264_10005664 3300028381 Bacteria 10587
1018 Ga0268264_10014974 3300028381 Bacteria 6365
1019 Ga0268264_10020798 3300028381 Bacteria 5362
1020 Ga0268264_10036652 3300028381 Bacteria 4041
1021 Ga0268264_10082072 3300028381 Bacteria 2757
1022 Ga0268264_10310871 3300028381 Bacteria 1487
1023 Ga0307517_10018951 3300028786 Bacteria 8861
1024 Ga0307517_10051260 3300028786 Bacteria 4171
1025 Ga0307515_10000010 3300028794 Bacteria 651586
1026 Ga0307515_10000061 3300028794 Bacteria 251841
1027 Ga0307515_10000469 3300028794 Bacteria 96345
1028 Ga0307515_10000778 3300028794 Bacteria 73451
1029 Ga0307515_10003029 3300028794 Bacteria 35637
1030 Ga0307515_10011558 3300028794 Bacteria 16742
1031 Ga0307515_10261059 3300028794 Bacteria 1468
1032 Ga0307515_10368975 3300028794 Bacteria 1073
1033 Ga0265338_10077514 3300028800 Bacteria 2809
1034 Ga0265338_10078686 3300028800 Bacteria 2779
1035 Ga0265324_10043029 3300029957 Bacteria 1560
1036 Ga0307511_10000455 3300030521 Bacteria 44094
1037 Ga0307511_10143505 3300030521 Bacteria 1394
1038 Ga0316177_1124334 3300030731 Bacteria 3217
1039 Ga0316183_1174733 3300030742 Bacteria 32145
1040 Ga0316181_1092606 3300030744 Bacteria 18862
1041 Ga0265331_10038163 3300031250 Bacteria 2349
1042 Ga0265327_10000051 3300031251 Bacteria 257963
1043 Ga0265327_10000219 3300031251 Bacteria 116606
1044 Ga0265327_10014024 3300031251 Bacteria 5277
1045 Ga0307513_10011590 3300031456 Bacteria 10947
1046 Ga0307513_10354056 3300031456 Bacteria 1215
1047 Ga0307509_10029926 3300031507 Bacteria 6031
1048 Ga0307509_10066464 3300031507 Bacteria 3783
1049 Ga0307509_10110275 3300031507 Bacteria 2758
1050 Ga0307408_100000801 3300031548 Bacteria 25175
1051 Ga0307408_100003540 3300031548 Bacteria 10633
1052 Ga0307408_100019914 3300031548 Bacteria 4521
1053 Ga0265313_10025066 3300031595 Bacteria 3171
1054 Ga0265314_10069177 3300031711 Bacteria 2370
1055 Ga0316576_10117690 3300031727 Bacteria 1994
1056 Ga0307516_10005541 3300031730 Bacteria 15056
1057 Ga0307516_10049737 3300031730 Bacteria 4117
1058 Ga0307516_10114825 3300031730 Bacteria 2490
1059 Ga0307405_10000002 3300031731 Bacteria 575196
1060 Ga0307405_10000026 3300031731 Bacteria 118954
1061 Ga0307405_10032191 3300031731 Bacteria 3097
1062 Ga0307413_10000019 3300031824 Bacteria 45584
1063 Ga0307413_10015140 3300031824 Bacteria 3944
1064 Ga0307410_10024479 3300031852 Bacteria 3772
1065 Ga0307406_10000038 3300031901 Bacteria 76386
1066 Ga0307406_10001880 3300031901 Bacteria 11460
1067 Ga0307406_10009431 3300031901 Bacteria 5472
1068 Ga0307406_10130235 3300031901 Bacteria 1765
1069 Ga0307407_10000032 3300031903 Bacteria 87003
1070 Ga0307407_10002036 3300031903 Bacteria 7714
1071 Ga0307412_10000007 3300031911 Bacteria 486267
1072 Ga0307412_10000018 3300031911 Bacteria 284374
1073 Ga0307412_10000175 3300031911 Bacteria 45704
1074 Ga0307412_10002066 3300031911 Bacteria 11141
1075 Ga0307412_10007859 3300031911 Bacteria 6073
1076 Ga0307412_10010470 3300031911 Bacteria 5342
1077 Ga0307412_10043584 3300031911 Bacteria 2922
1078 Ga0307409_100087536 3300031995 Bacteria 2539
1079 Ga0307416_100000003 3300032002 Bacteria 509060
1080 Ga0307416_100000045 3300032002 Bacteria 126832
1081 Ga0307416_100012288 3300032002 Bacteria 5760
1082 Ga0307416_100040565 3300032002 Bacteria 3618
1083 Ga0307414_10000001 3300032004 Bacteria 1352954
1084 Ga0307414_10000048 3300032004 Bacteria 130217
1085 Ga0307414_10000200 3300032004 Bacteria 40376
1086 Ga0307414_10008062 3300032004 Bacteria 5952
1087 Ga0307414_10008445 3300032004 Bacteria 5839
1088 Ga0307414_10021005 3300032004 Bacteria 4084
1089 Ga0307414_10042757 3300032004 Bacteria 3081
1090 Ga0307414_10063408 3300032004 Bacteria 2626
1091 Ga0307414_10079718 3300032004 Bacteria 2391
1092 Ga0307414_10105158 3300032004 Bacteria 2133
1093 Ga0307414_10108215 3300032004 Bacteria 2108
1094 Ga0307414_10187639 3300032004 Bacteria 1670
1095 Ga0307414_10364447 3300032004 Bacteria 1244
1096 Ga0307411_10000013 3300032005 Bacteria 145335
1097 Ga0307411_10011513 3300032005 Bacteria 4779
1098 Ga0307411_10158471 3300032005 Bacteria 1692
1099 Ga0307415_100257726 3300032126 Bacteria 1421
1100 Ga0307415_100480271 3300032126 Bacteria 1082
1101 Ga0316583_10002539 3300032133 Bacteria 6356
1102 Ga0316583_10058520 3300032133 Bacteria 1352
1103 Ga0307510_10001211 3300033180 Bacteria 27977
1104 Ga0307510_10029288 3300033180 Bacteria 6270
1105 Ga0316574_0096071 3300035398 Bacteria 1893
1106 Ga0373935_0118781 3300035692 Bacteria 1764
1107 Ga0373935_0132040 3300035692 Bacteria 1679
1108 Ga0373927_0157505 3300035695 Bacteria 1488
1109 Ga0373937_0250921 3300036401 Bacteria 1668
1110 Ga0316584_0065713 3300036712 Bacteria 2718
1111 Ga0373925_0130635 3300037068 Bacteria 1958
1112 Ga0395899_0000950 3300037312 Bacteria 27103
1113 Ga0395899_0002365 3300037312 Bacteria 15356
1114 Ga0395899_0002966 3300037312 Bacteria 13583
1115 Ga0395899_0021120 3300037312 Bacteria 4937
1116 Ga0395899_0026711 3300037312 Bacteria 4355
1117 Ga0395899_0092688 3300037312 Bacteria 2187
1118 Ga0395899_0139949 3300037312 Bacteria 1722
1119 Ga0395900_0000014 3300037418 Bacteria 386513
1120 Ga0395900_0002099 3300037418 Bacteria 22311
1121 Ga0395900_0019416 3300037418 Bacteria 6929
1122 Ga0395900_0020465 3300037418 Bacteria 6754
1123 Ga0395900_0022668 3300037418 Bacteria 6426
1124 Ga0395900_0057377 3300037418 Bacteria 4008
1125 Ga0395900_0085018 3300037418 Bacteria 3252
1126 Ga0395900_0163868 3300037418 Bacteria 2266
1127 Ga0395900_0200879 3300037418 Bacteria 2017
1128 Ga0395900_0297733 3300037418 Bacteria 1600
1129 Ga0395898_0003279 3300037466 Bacteria 18196
1130 Ga0395898_0053462 3300037466 Bacteria 3944
1131 Ga0395898_0108210 3300037466 Bacteria 2665
1132 Ga0395898_0143181 3300037466 Bacteria 2289
1133 Ga0395898_0175655 3300037466 Bacteria 2047
1134 Ga0395898_0233397 3300037466 Bacteria 1754
1135 Ga0395905_0000037 3300037471 Bacteria 261808
1136 Ga0395905_0000145 3300037471 Bacteria 116795
1137 Ga0395905_0007667 3300037471 Bacteria 10708
1138 Ga0395905_0010753 3300037471 Bacteria 8873
1139 Ga0395905_0146491 3300037471 Bacteria 2222
1140 Ga0395905_0177710 3300037471 Bacteria 1998
1141 Ga0436364_0124774 3300037853 Bacteria 12232
1142 Ga0436364_0263606 3300037853 Bacteria 1678
1143 Ga0436364_0335834 3300037853 Bacteria 10527
1144 Ga0436364_0527339 3300037853 Bacteria 2143
1145 Ga0436364_0680771 3300037853 Bacteria 4849
1146 Ga0436364_0711825 3300037853 Bacteria 1723
1147 Ga0436364_1395677 3300037853 Bacteria 5660
1148 Ga0395901_0000117 3300038443 Bacteria 105071
1149 Ga0395901_0008828 3300038443 Bacteria 10202
1150 Ga0395901_0020717 3300038443 Bacteria 6731
1151 Ga0395901_0028625 3300038443 Bacteria 5730
1152 Ga0395901_0108578 3300038443 Bacteria 2913
1153 Ga0395901_0150985 3300038443 Bacteria 2441
1154 Ga0395901_0221536 3300038443 Bacteria 1977
1155 Ga0395901_0285876 3300038443 Bacteria 1712
1156 Ga0436365_0187021 3300039437 Bacteria 7066
1157 Ga0436365_0614130 3300039437 Bacteria 27402
1158 Ga0436365_0692375 3300039437 Bacteria 2549
1159 Ga0436365_1167736 3300039437 Bacteria 1128
1160 Ga0436365_1431762 3300039437 Bacteria 1161
1161 Ga0436365_1705244 3300039437 Bacteria 1631
1162 Ga0436360_0238484 3300039438 Bacteria 1013
1163 Ga0436360_0552842 3300039438 Bacteria 1800
1164 Ga0436360_0858616 3300039438 Bacteria 1112
1165 Ga0436360_0912519 3300039438 Bacteria 1115
1166 Ga0436360_1172065 3300039438 Bacteria 1016
1167 Ga0436360_1357712 3300039438 Bacteria 2403
1168 Ga0436361_0108982 3300039447 Bacteria 1076
1169 Ga0436361_0191006 3300039447 Bacteria 14062
1170 Ga0436361_0286485 3300039447 Bacteria 6704
1171 Ga0436361_0640991 3300039447 Bacteria 7674
1172 Ga0436361_1096116 3300039447 Bacteria 1236
1173 Ga0436361_1131553 3300039447 Bacteria 1692
1174 Ga0436363_0107063 3300039450 Bacteria 1671
1175 Ga0436363_1014168 3300039450 Bacteria 1485
1176 Ga0436363_1327048 3300039450 Bacteria 3252
1177 Ga0436363_1429132 3300039450 Bacteria 1546
1178 Ga0436362_0528742 3300039453 Bacteria 2125
1179 Ga0436362_1161122 3300039453 Bacteria 1301
1180 Ga0439436_0018190 3300041404 Bacteria 2101
1181 Ga0439439_0021425 3300041406 Bacteria 1611
1182 Ga0439447_002503 3300041407 Bacteria 6684
1183 Ga0439466_0003065 3300041411 Bacteria 6506
1184 Ga0439465_0001507 3300041413 Bacteria 7555
1185 Ga0451807_0790979 3300041486 Bacteria 1428
1186 Ga0451837_1313197 3300041494 Bacteria 1446
1187 Ga0451841_0285170 3300041498 Bacteria 1048
1188 Ga0439441_032938 3300042001 Bacteria 1012
1189 Ga0439445_0002356 3300042004 Bacteria 4198
1190 Ga0439449_0051049 3300042007 Bacteria 1530
1191 Ga0439457_002980 3300042014 Bacteria 4704
1192 Ga0439462_0004484 3300042015 Bacteria 3411
1193 Ga0450899_006776 3300042135 Bacteria 1244
1194 Ga0451577_0001803 3300042876 Bacteria 27398
1195 Ga0451577_0009458 3300042876 Bacteria 9386
1196 Ga0451577_0052398 3300042876 Bacteria 3644
1197 Ga0451577_0053025 3300042876 Bacteria 3621
1198 Ga0466972_0000013 3300044658 Bacteria 229345
1199 Ga0466966_0000045 3300044684 Bacteria 92504
1200 Ga0466961_0002285 3300044693 Bacteria 11905
1201 Ga0466964_0057032 3300044706 Bacteria 1616
1202 Ga0453684_0000132 3300044712 Bacteria 331157
1203 Ga0453684_0001324 3300044712 Bacteria 73175
1204 Ga0453684_0001992 3300044712 Bacteria 52379
1205 Ga0453684_0085930 3300044712 Bacteria 3907
1206 Ga0453684_0116908 3300044712 Bacteria 3228
1207 Ga0453684_0124951 3300044712 Bacteria 3098
1208 Ga0453684_0206628 3300044712 Bacteria 2285
1209 Ga0453684_0208460 3300044712 Bacteria 2274
1210 Ga0453684_0237329 3300044712 Bacteria 2101
1211 Ga0453684_0440157 3300044712 Bacteria 1453
1212 Ga0453684_0939380 3300044712 Bacteria 924
1213 Ga0466968_0106048 3300044735 Bacteria 1259
1214 Ga0466970_0019422 3300044765 Bacteria 3524
1215 Ga0466957_0000156 3300044842 Bacteria 29671
1216 Ga0466957_0192797 3300044842 Bacteria 1336
1217 Ga0466957_0301490 3300044842 Bacteria 1077
1218 Ga0466959_0000023 3300045049 Bacteria 124545
1219 Ga0466959_0002751 3300045049 Bacteria 11327
1220 Ga0466959_0117825 3300045049 Bacteria 1890
1221 Ga0466959_0133933 3300045049 Bacteria 1755
1222 Ga0451576_0000012 3300045051 Bacteria 674684
1223 Ga0451576_0003337 3300045051 Bacteria 22238
1224 Ga0451576_0010351 3300045051 Bacteria 10708
1225 Ga0451576_0035608 3300045051 Bacteria 5280
1226 Ga0451576_0385547 3300045051 Bacteria 1469
1227 Ga0451576_0817388 3300045051 Bacteria 978
1228 Ga0466967_0039205 3300045976 Bacteria 4071
1229 Ga0495627_000002 3300046453 Bacteria 903861
1230 Ga0495627_039056 3300046453 Bacteria 1465
1231 Ga0495592_0087566 3300046454 Bacteria 2240
1232 Ga0495590_0016811 3300046457 Bacteria 2640
1233 Ga0495638_0000003 3300046460 Bacteria 888792
1234 Ga0495638_0028263 3300046460 Bacteria 3623
1235 Ga0495650_0000014 3300046471 Bacteria 581606
1236 Ga0495650_0075015 3300046471 Bacteria 1317
1237 Ga0495580_0110399 3300046472 Bacteria 1910
1238 Ga0495664_0039169 3300046477 Bacteria 2800
1239 Ga0495585_0001092 3300046492 Bacteria 22350
1240 Ga0495585_0002645 3300046492 Bacteria 12593
1241 Ga0495596_0005716 3300046500 Bacteria 5836
1242 Ga0495596_0071405 3300046500 Bacteria 1348
1243 Ga0495607_0117693 3300046501 Bacteria 1399
1244 Ga0495606_0000096 3300046507 Bacteria 151500
1245 Ga0495606_0009086 3300046507 Bacteria 8468
1246 Ga0495606_0077987 3300046507 Bacteria 2067
1247 Ga0495606_0096851 3300046507 Bacteria 1804
1248 Ga0495610_0000009 3300046512 Bacteria 554843
1249 Ga0495610_0000427 3300046512 Bacteria 43336
1250 Ga0495610_0000472 3300046512 Bacteria 41524
1251 Ga0495610_0000791 3300046512 Bacteria 29641
1252 Ga0495616_0006078 3300046513 Bacteria 7357
1253 Ga0495628_0107843 3300046516 Bacteria 2144
1254 Ga0495630_0046886 3300046517 Bacteria 3231
1255 Ga0495630_0087576 3300046517 Bacteria 2352
1256 Ga0495631_0014272 3300046518 Bacteria 3838
1257 Ga0495632_0001031 3300046519 Bacteria 24102
1258 Ga0495637_0046286 3300046520 Bacteria 1841
1259 Ga0495643_0007955 3300046522 Bacteria 6760
1260 Ga0495643_0212208 3300046522 Bacteria 923
1261 Ga0495648_0022634 3300046524 Bacteria 4320
1262 Ga0495652_0166635 3300046529 Bacteria 1705
1263 Ga0495652_0363210 3300046529 Bacteria 1034
1264 Ga0495654_0000001 3300046530 Bacteria 1513197
1265 Ga0495586_0209159 3300046535 Bacteria 1107
1266 Ga0495587_0163765 3300046536 Bacteria 1265
1267 Ga0495609_0000130 3300046538 Bacteria 81359
1268 Ga0495609_0065609 3300046538 Bacteria 1600
1269 Ga0495621_0010363 3300046539 Bacteria 2849
1270 Ga0495633_0000002 3300046558 Bacteria 488754
1271 Ga0495633_0000058 3300046558 Bacteria 147584
1272 Ga0495633_0000081 3300046558 Bacteria 125903
1273 Ga0495633_0003017 3300046558 Bacteria 11482
1274 Ga0495633_0050424 3300046558 Bacteria 1962
1275 Ga0495668_0000003 3300046616 Bacteria 695023
1276 Ga0495668_0000677 3300046616 Bacteria 41080
1277 Ga0495668_0001458 3300046616 Bacteria 22752
1278 Ga0495634_0004906 3300046642 Bacteria 10354
1279 Ga0495611_0006112 3300046648 Bacteria 5137
1280 Ga0495625_0000003 3300046660 Bacteria 686847
1281 Ga0495625_0000846 3300046660 Bacteria 41815
1282 Ga0495625_0001053 3300046660 Bacteria 36204
1283 Ga0495625_0007782 3300046660 Bacteria 9252
1284 Ga0495625_0081162 3300046660 Bacteria 2257
1285 Ga0495625_0219254 3300046660 Bacteria 1247
1286 Ga0495661_0001756 3300046665 Bacteria 17434
1287 Ga0495661_0063170 3300046665 Bacteria 2190
1288 Ga0495657_0156168 3300046675 Bacteria 1414
1289 Ga0495623_0043173 3300046679 Bacteria 2870
1290 Ga0495658_0011980 3300046683 Bacteria 4378
1291 Ga0495658_0024033 3300046683 Bacteria 3241
1292 Ga0495658_0271174 3300046683 Bacteria 1070
1293 Ga0495613_0086982 3300046689 Bacteria 2266
1294 Ga0495649_0000002 3300046694 Bacteria 1093458
1295 Ga0495674_0032089 3300047319 Bacteria 4767
1296 Ga0495672_0011633 3300047320 Bacteria 6197
1297 Ga0495672_0012039 3300047320 Bacteria 6058
1298 Ga0495672_0139392 3300047320 Bacteria 1268
1299 Ga0495687_000014 3300047443 Bacteria 366896
1300 Ga0495687_001036 3300047443 Bacteria 27592
1301 Ga0495687_001602 3300047443 Bacteria 20428
1302 Ga0495673_0045627 3300047469 Bacteria 1947
1303 Ga0495684_0133622 3300047471 Bacteria 1862
1304 Ga0495684_0272103 3300047471 Bacteria 1225
1305 Ga0495686_0000022 3300047472 Bacteria 403456
1306 Ga0495686_0000034 3300047472 Bacteria 325038
1307 Ga0495686_0000367 3300047472 Bacteria 73112
1308 Ga0495686_0001743 3300047472 Bacteria 22322
1309 Ga0495686_0003019 3300047472 Bacteria 14949
1310 Ga0495686_0010729 3300047472 Bacteria 6497
1311 Ga0495686_0036083 3300047472 Bacteria 3173
1312 Ga0495686_0048951 3300047472 Bacteria 2662
1313 Ga0495614_0017370 3300048089 Bacteria 3126
1314 Ga0496101_0013706 3300048904 Bacteria 5437
1315 Ga0496103_0059333 3300048906 Bacteria 2377
1316 Ga0496108_0014827 3300048911 Bacteria 6360
1317 Ga0496109_0340482 3300048912 Bacteria 1416
1318 Ga0496114_0294137 3300048917 Bacteria 1433
1319 Ga0496114_0368449 3300048917 Bacteria 1271
1320 Ga0496115_0087065 3300048918 Bacteria 2549
1321 Ga0496115_0281224 3300048918 Bacteria 1366
1322 Ga0496116_0000022 3300048919 Bacteria 482506
1323 Ga0496116_0000047 3300048919 Bacteria 315121
1324 Ga0496117_0000074 3300048920 Bacteria 232732
1325 Ga0496118_0001188 3300048921 Bacteria 40165
1326 Ga0496118_0023205 3300048921 Bacteria 5396
1327 Ga0496118_0153203 3300048921 Bacteria 1439
1328 Ga0496119_0000426 3300048922 Bacteria 58016
1329 Ga0496121_0000343 3300048924 Bacteria 96972
1330 Ga0496121_0009602 3300048924 Bacteria 11085
1331 Ga0496121_0064683 3300048924 Bacteria 2981
1332 Ga0496122_0000354 3300048925 Bacteria 98798
1333 Ga0496122_0000357 3300048925 Bacteria 98456
1334 Ga0496122_0000598 3300048925 Bacteria 74168
1335 Ga0496122_0000789 3300048925 Bacteria 60958
1336 Ga0496122_0003624 3300048925 Bacteria 20088
1337 Ga0496122_0014216 3300048925 Bacteria 7713
1338 Ga0496123_0001991 3300048926 Bacteria 26413
1339 Ga0496123_0002415 3300048926 Bacteria 23304
1340 Ga0496123_0007740 3300048926 Bacteria 10030
1341 Ga0496123_0094824 3300048926 Bacteria 1757
1342 Ga0496124_0005359 3300048927 Bacteria 14481
1343 Ga0496124_0092182 3300048927 Bacteria 2468
1344 Ga0496124_0175115 3300048927 Bacteria 1657
1345 Ga0496125_0000050 3300048928 Bacteria 286703
1346 Ga0496125_0000286 3300048928 Bacteria 99915
1347 Ga0496125_0001036 3300048928 Bacteria 43109
1348 Ga0496125_0020214 3300048928 Bacteria 6256
1349 Ga0496126_0001468 3300048929 Bacteria 36714
1350 Ga0496126_0009501 3300048929 Bacteria 10319
1351 Ga0496126_0057468 3300048929 Bacteria 3512
1352 Ga0496126_0065319 3300048929 Unclassified 3257
1353 Ga0496126_0100998 3300048929 Bacteria 2524
1354 Ga0496126_0272877 3300048929 Bacteria 1403
1355 Ga0501298_000106 3300049521 Bacteria 9717
1356 Ga0501031_0000757 3300049568 Bacteria 19442
1357 Ga0501032_0007292 3300049569 Bacteria 8093
1358 Ga0501032_0023495 3300049569 Bacteria 4258
1359 Ga0501032_0065860 3300049569 Bacteria 2422
1360 Ga0501033_0000028 3300049570 Bacteria 161436
1361 Ga0501033_0012561 3300049570 Bacteria 6462
1362 Ga0501034_0000074 3300049571 Bacteria 175369
1363 Ga0501034_0000115 3300049571 Bacteria 146825
1364 Ga0501034_0000363 3300049571 Bacteria 77256
1365 Ga0501034_0085615 3300049571 Bacteria 3153
1366 Ga0501034_0093171 3300049571 Bacteria 3009
1367 Ga0501034_0190810 3300049571 Bacteria 2011
1368 Ga0501034_0255519 3300049571 Bacteria 1696
1369 Ga0501034_0298918 3300049571 Bacteria 1547
1370 Ga0501036_0002989 3300049572 Bacteria 13442
1371 Ga0501036_0061774 3300049572 Bacteria 3173
1372 Ga0501036_0190302 3300049572 Bacteria 1726
1373 Ga0501037_0153691 3300049573 Bacteria 1643
1374 Ga0501038_0013147 3300049574 Bacteria 7549
1375 Ga0501038_0209966 3300049574 Bacteria 1558
1376 Ga0501039_0003283 3300049575 Bacteria 12098
1377 Ga0501043_0002401 3300049579 Bacteria 15856
1378 Ga0501043_0140515 3300049579 Bacteria 1891
1379 Ga0501043_0211969 3300049579 Bacteria 1501
1380 Ga0501046_0015984 3300049580 Bacteria 6294
1381 Ga0501047_0006088 3300049581 Bacteria 11338
1382 Ga0501047_0007483 3300049581 Bacteria 10275
1383 Ga0501047_0018935 3300049581 Bacteria 6603
1384 Ga0501047_0021293 3300049581 Bacteria 6224
1385 Ga0501047_0128891 3300049581 Bacteria 2410
1386 Ga0501048_0027732 3300049582 Bacteria 4112
1387 Ga0501048_0035049 3300049582 Bacteria 3615
1388 Ga0501048_0330527 3300049582 Bacteria 1086
1389 Ga0501068_0203530 3300049584 Bacteria 1256
1390 Ga0501069_0215862 3300049585 Bacteria 1114
1391 Ga0501069_0216348 3300049585 Bacteria 1113
1392 Ga0501070_0014181 3300049586 Bacteria 6706
1393 Ga0501070_0167148 3300049586 Bacteria 1812
1394 Ga0501070_0208243 3300049586 Bacteria 1605
1395 Ga0501070_0426641 3300049586 Bacteria 1070
1396 Ga0501073_0058809 3300049589 Bacteria 2686
1397 Ga0501073_0094268 3300049589 Bacteria 2079
1398 Ga0501074_0000815 3300049590 Bacteria 19756
1399 Ga0501076_0276247 3300049592 Bacteria 1376
1400 Ga0501206_019302 3300049653 Bacteria 964
1401 Ga0501207_002619 3300049654 Bacteria 2343
1402 Ga0501207_012747 3300049654 Bacteria 1267
1403 Ga0501223_001886 3300049663 Bacteria 4727
1404 Ga0501223_002515 3300049663 Bacteria 4058
1405 Ga0501223_005427 3300049663 Bacteria 2678
1406 Ga0501224_001146 3300049664 Bacteria 3461
1407 Ga0501235_002262 3300049669 Bacteria 4144
1408 Ga0501243_002218 3300049675 Bacteria 2830
1409 Ga0501249_000021 3300049679 Bacteria 94598
1410 Ga0501257_001165 3300049686 Bacteria 5373
1411 Ga0501259_000663 3300049688 Bacteria 5508
1412 Ga0501259_006093 3300049688 Bacteria 1914
1413 Ga0501261_001376 3300049690 Bacteria 2979
1414 Ga0501219_000283 3300049703 Bacteria 9024
1415 Ga0501221_001422 3300049704 Bacteria 3956
1416 Ga0501225_0000104 3300049705 Bacteria 26591
1417 Ga0501225_0000966 3300049705 Bacteria 8993
1418 Ga0501225_0008139 3300049705 Bacteria 3015
1419 Ga0501225_0020594 3300049705 Bacteria 1823
1420 Ga0501225_0037668 3300049705 Bacteria 1333
1421 Ga0501234_015381 3300049707 Bacteria 1204
1422 Ga0501245_001190 3300049708 Bacteria 3360
1423 Ga0501080_0030430 3300049742 Bacteria 5029
1424 Ga0501080_0193060 3300049742 Bacteria 1871
1425 Ga0501080_0216519 3300049742 Bacteria 1754
1426 Ga0501080_0219204 3300049742 Bacteria 1741
1427 Ga0501083_0094683 3300049744 Bacteria 1971
1428 Ga0501083_0232891 3300049744 Bacteria 1199
1429 Ga0501232_005086 3300049757 Bacteria 1290
1430 Ga0501241_000046 3300049758 Bacteria 36316
1431 Ga0501241_001023 3300049758 Bacteria 5913
1432 Ga0501241_004726 3300049758 Bacteria 2542
1433 Ga0501241_010751 3300049758 Bacteria 1662
1434 Ga0501264_000172 3300049761 Bacteria 10543
1435 Ga0501266_000005 3300049763 Bacteria 346750
1436 Ga0501266_003461 3300049763 Bacteria 1957
1437 Ga0501269_000938 3300049766 Bacteria 4248
1438 Ga0501269_006791 3300049766 Bacteria 1382
1439 Ga0501279_010928 3300049775 Bacteria 1224
1440 Ga0501280_000623 3300049776 Bacteria 8087
1441 Ga0501035_0005702 3300049822 Bacteria 11748
1442 Ga0501035_0006466 3300049822 Bacteria 11007
1443 Ga0501035_0012462 3300049822 Bacteria 7857
1444 Ga0501035_0182177 3300049822 Bacteria 1809
1445 Ga0501035_0443991 3300049822 Bacteria 1074
1446 Ga0501044_0001410 3300049823 Bacteria 28196
1447 Ga0501044_0013587 3300049823 Bacteria 8799
1448 Ga0501044_0044477 3300049823 Bacteria 4607
1449 Ga0501044_0074255 3300049823 Bacteria 3455
1450 Ga0501044_0075975 3300049823 Bacteria 3411
1451 Ga0501044_0169498 3300049823 Bacteria 2155
1452 Ga0501044_0534921 3300049823 Bacteria 1070
1453 Ga0501045_0000380 3300049824 Bacteria 26716
1454 Ga0501045_0186382 3300049824 Bacteria 1546
1455 Ga0501284_00041 3300050005 Bacteria 50589
1456 nmdc:mga0k408_10430_c1 3300050493 Bacteria 5023
1457 nmdc:mga0k408_175_c1 3300050493 Bacteria 32183
1458 nmdc:mga0k408_70668_c1 3300050493 Bacteria 2037
1459 nmdc:mga05p37_1489_c1 3300050507 Bacteria 27247
1460 nmdc:mga05p37_235392_c1 3300050507 Bacteria 2204
1461 nmdc:mga09592_320113_c1 3300050508 Bacteria 1344
1462 nmdc:mga09592_33821_c1 3300050508 Bacteria 4270
1463 nmdc:mga09592_58488_c1 3300050508 Bacteria 3259
1464 nmdc:mga09592_8374_c1 3300050508 Bacteria 8405
1465 nmdc:mga0qj67_44032_c1 3300050509 Bacteria 3516
1466 nmdc:mga0qj67_79577_c1 3300050509 Bacteria 2625
1467 nmdc:mga08y16_130587_c1 3300050511 Bacteria 2612
1468 nmdc:mga08y16_226436_c1 3300050511 Bacteria 1935
1469 nmdc:mga08y16_29337_c1 3300050511 Bacteria 5796
1470 nmdc:mga08y16_58894_c1 3300050511 Bacteria 4013
1471 nmdc:mga08y16_8584_c1 3300050511 Bacteria 10706
1472 nmdc:mga0n895_193849_c1 3300050512 Bacteria 2063
1473 Ga0495619_0234385 3300053085 Bacteria 1272
1474 Ga0500578_0000155 3300053086 Bacteria 80380
1475 Ga0500578_0031314 3300053086 Bacteria 3418
1476 Ga0500644_0000267 3300053088 Bacteria 29406
1477 Ga0500646_0001240 3300053090 Bacteria 6842
1478 Ga0500646_0008454 3300053090 Bacteria 2632
1479 Ga0500646_0029674 3300053090 Bacteria 1498
1480 Ga0500647_0106336 3300053091 Bacteria 1337
1481 Ga0500583_0000043 3300053092 Bacteria 81313
1482 Ga0500583_0002749 3300053092 Bacteria 5369
1483 Ga0500583_0017441 3300053092 Bacteria 2893
1484 Ga0500583_0094654 3300053092 Bacteria 1457
1485 Ga0500651_0001157 3300053093 Bacteria 13091
1486 Ga0500566_0037856 3300053094 Bacteria 2793
1487 Ga0500640_001728 3300053095 Bacteria 6819
1488 Ga0500641_0000027 3300053096 Bacteria 106908
1489 Ga0500641_0000083 3300053096 Bacteria 37649
1490 Ga0500641_0000415 3300053096 Bacteria 15797
1491 Ga0500641_0051164 3300053096 Bacteria 1699
1492 Ga0500554_000172 3300053102 Bacteria 13381
1493 Ga0500556_0066938 3300053104 Bacteria 1335
1494 Ga0500569_000319 3300053109 Bacteria 7709
1495 Ga0500595_000017 3300053119 Bacteria 206032
1496 Ga0500608_000329 3300053122 Bacteria 18275
1497 Ga0500614_000174 3300053123 Bacteria 16459
1498 Ga0500614_010475 3300053123 Bacteria 1992
1499 Ga0500618_000004 3300053125 Bacteria 293180
1500 Ga0500618_005734 3300053125 Bacteria 3742
1501 Ga0500652_004080 3300053131 Bacteria 4485
1502 Ga0500658_0000550 3300053134 Bacteria 15772
1503 Ga0500559_0006396 3300053136 Bacteria 5322
1504 Ga0500559_0015345 3300053136 Bacteria 3235
1505 Ga0500559_0025420 3300053136 Bacteria 2519
1506 Ga0500559_0036704 3300053136 Bacteria 2121
1507 Ga0500568_0004600 3300053139 Bacteria 7343
1508 Ga0500568_0100822 3300053139 Bacteria 1083
1509 Ga0500577_0006687 3300053142 Bacteria 3195
1510 Ga0500589_047465 3300053147 Bacteria 1999
1511 Ga0500590_079001 3300053148 Bacteria 1620
1512 Ga0500604_0001214 3300053151 Bacteria 7176
1513 Ga0500616_0000007 3300053153 Bacteria 836875
1514 Ga0500616_0004544 3300053153 Bacteria 9826
1515 Ga0500616_0014667 3300053153 Bacteria 4496
1516 Ga0500619_034142 3300053154 Bacteria 1570
1517 Ga0500622_0000003 3300053156 Bacteria 613483
1518 Ga0500622_0000841 3300053156 Bacteria 26265
1519 Ga0500622_0000864 3300053156 Bacteria 25792
1520 Ga0500622_0001251 3300053156 Bacteria 20775
1521 Ga0500622_0001894 3300053156 Bacteria 15796
1522 Ga0500622_0009447 3300053156 Bacteria 5396
1523 Ga0500633_0076677 3300053160 Bacteria 1203
1524 Ga0500636_0040285 3300053177 Bacteria 2763
1525 Ga0500584_042747 3300053726 Bacteria 2072
1526 Ga0500611_000077 3300053727 Bacteria 38126
1527 Ga0501084_0111865 3300054114 Bacteria 2295
1528 Ga0501084_0186693 3300054114 Bacteria 1749
1529 Ga0501082_0145745 3300060353 Bacteria 2055
1530 Ga0501082_0407727 3300060353 Bacteria 1186
1531 2511234315 2511231000 Bacteria 4488346
1532 2513235376 2513020052 Bacteria 5120511
1533 2520878810 2519899754 Bacteria 5336938
1534 2524006061 2523533629 Bacteria 2982326
1535 2585143354 2582581278 Bacteria 5296881
1536 2585159642 2582581281 Bacteria 4487904
1537 2585163895 2582581282 Bacteria 4495830
1538 2585425082 2582581873 Bacteria 3032664
1539 2586209490 2585427687 Bacteria 5544917
1540 2587677701 2585428045 Bacteria 5203023
1541 2587746850 2585428060 Bacteria 5304711
1542 2587750912 2585428061 Bacteria 3939663
1543 2587867936 2585428095 Bacteria 3789702
1544 2587943368 2585428115 Bacteria 4420269
1545 2588209617 2585428182 Bacteria 5007281
1546 2588213908 2585428183 Bacteria 5166119
1547 2588218471 2585428184 Bacteria 4978681
1548 2588225838 2585428185 Bacteria 4969476
1549 2588231654 2585428187 Bacteria 4629388
1550 2588444917 2588253712 Bacteria 5403181
1551 2590601215 2588254255 Bacteria 5014294
1552 2590612499 2588254257 Bacteria 5436094
1553 2599478512 2599185184 Bacteria 6430550
1554 2644011480 2643221600 Bacteria 5530138
1555 2644369881 2643221667 Bacteria 5627472
1556 2644642276 2643221716 Bacteria 4986332
1557 2644685273 2643221725 Bacteria 5087956
1558 2729199225 2728369107 Bacteria 5082720
1559 2738700650 2738541273 Bacteria 4048577
1560 2738726304 2738541278 Bacteria 9755573
1561 2738731932 2738541279 Bacteria 6149495
1562 2738756548 2738541283 Bacteria 7222293
1563 2738760872 2738541284 Bacteria 5199923
1564 2738764497 2738541285 Bacteria 6150075
1565 2738853633 2738541302 Bacteria 5944758
1566 2739213512 2738543007 Bacteria 6149845
1567 2739254399 2738543014 Bacteria 4048139
1568 2739303987 2738543023 Bacteria 6767879
1569 2739588866 2739367651 Bacteria 6359826
1570 2739645252 2739367663 Bacteria 5040914
1571 2740000777 2739367857 Bacteria 5433684
1572 2740005593 2739367858 Bacteria 5432813
1573 2740032952 2739367866 Bacteria 4215900
1574 2740058414 2739367874 Bacteria 4872888
1575 2753671161 2751185877 Bacteria 4921427
1576 2765573323 2765235839 Bacteria 5314748
1577 2772604137 2772190705 Bacteria 4666226
1578 2775672471 2775506739 Bacteria 3855222
1579 2776613057 2775506987 Bacteria 5373360
1580 2802654188 2802428842 Bacteria 4926114
1581 2816873727 2816332188 Bacteria 5133218
1582 2817415787 2816332280 Bacteria 5109718
1583 2817482047 2816332295 Bacteria 4352468
1584 2817620853 2816332336 Bacteria 5207640
1585 2819548026 2818991437 Bacteria 5805520
1586 2819572546 2818991442 Bacteria 8318214
1587 2819588583 2818991444 Bacteria 6968812
1588 2819680683 2818991460 Bacteria 7595395
1589 2821140061 2821136567 Bacteria 8080116
1590 2833644144 2833640130 Bacteria 4858325
1591 2839992780 2839989709 Bacteria 3773432
1592 2842085015 2842083920 Bacteria 4857652
1593 2842726316 2842722452 Bacteria 6263924
1594 2842906804 2842903701 Bacteria 6986368
1595 2842910567 2842909656 Bacteria 6185908
1596 2849282178 2849281842 Bacteria 6065644
1597 2852623436 2852623160 Bacteria 4376875
1598 2852627318 2852627209 Bacteria 5896285
1599 2852674229 2852673933 Bacteria 3347676
1600 2857460809 2857460504 Bacteria 5194327
1601 2857614526 2857613821 Bacteria 4917088
1602 2857619091 2857618242 Bacteria 5635925
1603 2857628992 2857627736 Bacteria 5625397
1604 2871720718 2871720351 Bacteria 4862476
1605 2881248478 2881247448 Bacteria 3717788
1606 2881360433 2881359912 Bacteria 4935907
1607 2881955939 2881955468 Bacteria 3545609
1608 2884635304 2884634485 Bacteria 3928637
1609 2884795426 2884791551 Bacteria 8511252
1610 2884937686 2884933994 Bacteria 4535041
1611 2888579942 2888578766 Bacteria 6743310
1612 2889291005 2889290771 Bacteria 5530962
1613 2896087952 2896085136 Bacteria 6129793
1614 2896112334 2896109856 Bacteria 7140722
1615 2898907899 2898907183 Bacteria 4067722
1616 2902048831 2902048731 Bacteria 4976191
1617 2903898576 2903895155 Bacteria 5258610
1618 2904419812 2904419702 Bacteria 5166287
1619 2904445515 2904445276 Bacteria 5310396
1620 2904472182 2904467357 Bacteria 8057758
1621 2904556601 2904555929 Bacteria 5218588
1622 2905999660 2905999023 Bacteria 4591259
1623 2910247597 2910245624 Bacteria 6935613
1624 2915610539 2915606848 Bacteria 6032732
1625 2919098902 2919097161 Bacteria 3860339
1626 2919187353 2919186247 Bacteria 6244071
1627 2919194073 2919191525 Bacteria 5765973
1628 2919400459 2919399522 Bacteria 5164947
1629 2919441655 2919437846 Bacteria 6199444
1630 2919509873 2919509842 Bacteria 4104664
1631 2919687159 2919683626 Bacteria 5534354
1632 2919693203 2919692658 Bacteria 5943958
1633 2928080436 2928078545 Bacteria 6534839
1634 2928149392 2928147474 Bacteria 6512076
1635 2928510871 2928510474 Bacteria 4815308
1636 2929153032 2929150217 Bacteria 5462483
1637 2929179002 2929177148 Bacteria 7883697
1638 2929189385 2929183550 Bacteria 6377511
1639 2929244898 2929239360 Bacteria 7745570
1640 2929927142 2929921140 Bacteria 8649150
1641 2932083223 2932082852 Bacteria 6563563
1642 2939665379 2939664404 Bacteria 6364494
1643 2945927748 2945924605 Bacteria 4296724
1644 2945981405 2945977869 Bacteria 7777518
1645 2946000883 2945997725 Bacteria 6404843
1646 2946019196 2946013367 Bacteria 7766675
1647 2954017790 2954016120 Bacteria 6446024
1648 2958463360 2958458903 Bacteria 5301041
1649 2958515315 2958512119 Bacteria 4528530
1650 2965323455 2965320100 Bacteria 3975600
1651 2977245670 2977243572 Bacteria 4374394
1652 2977269696 2977268062 Bacteria 5243061
1653 2984575319 2984572630 Bacteria 4186940
1654 2984608773 2984606641 Bacteria 4186971
1655 2993373042 2993372514 Bacteria 4214139
1656 2993483726 2993480792 Bacteria 4022225
1657 3006862476 3006858327 Bacteria 4317835
1658 8036738090 8036736890 Bacteria 2944828
1659 8054308239 8054307821 Bacteria 5212224
1660 8055421464 8055419101 Bacteria 5289643
1661 8055594064 8055592153 Bacteria 5961247
1662 8056443925 8056440228 Bacteria 4946504
1663 Ga0436363_0156289
1664 SwRhRL2b_contig_1663050
1665 SwRhRL2b_contig_2173254
1666 SwRhRL2b_contig_2434048
1667 SwRhRL2b_contig_2678590
1668 JGI24739J22299_10010206
1669 JGI24739J22299_10013537
1670 JGI24737J22298_10038410
1671 JGI24735J21928_10027358
1672 JGI25154J39366_1000019
1673 JGI25152J39213_1000894
1674 JGI25150J39212_1000051
1675 Ga0006759J45824_1089253
1676 JGI25151J46595_10000205
1677 JGI25153J46596_10000144
1678 JGI25153J46596_10000324
1679 rootH1_10001951
1680 rootH1_10004056
1681 rootH2_10000230
1682 rootH2_10025473
1683 rootH2_10030707
1684 rootH2_10032420
1685 rootH2_10105619
1686 rootH2_10110894
1687 rootH2_10141236
1688 rootH2_10161305
1689 rootL2_10036423
1690 rootH1_10000188
1691 rootH1_10009140
1692 rootH1_10010000
1693 rootH1_10020851
1694 rootH1_10021086
1695 rootH1_10031539
1696 rootH1_10048247
1697 rootH1_10087740
1698 rootH1_10097804
1699 rootH1_10196799
1700 rootH1_10239411
1701 JGI25160J50197_1013603
1702 JGI25160J50197_1015581
1703 JGI25160J50197_1045618
1704 Ga0006562J51391_1006008
1705 Ga0032354_1091257
1706 Ga0055542_1003789
1707 Ga0055526_1011612
1708 Ga0055536_1000030
1709 Ga0055534_1003684
1710 Ga0055528_1000360
1711 Ga0055530_10000723
1712 Ga0055530_10010766
1713 Ga0055531_10000153
1714 Ga0055531_10000156
1715 Ga0055543_1009253
1716 Ga0065165_1000402
1717 Ga0065165_1000835
1718 Ga0065165_1010985
1719 Ga0065714_10002361
1720 Ga0065714_10003057
1721 Ga0065714_10003305
1722 Ga0065714_10024048
1723 Ga0065714_10064513
1724 Ga0065714_10064933
1725 Ga0065714_10067901
1726 Ga0065714_10080906
1727 Ga0065714_10132309
1728 Ga0065714_10138407
1729 Ga0065704_10000238
1730 Ga0065704_10070140
1731 Ga0065704_10070945
1732 Ga0065704_10071089
1733 Ga0065704_10071898
1734 Ga0065704_10072798
1735 Ga0065704_10173413
1736 Ga0065712_10000992
1737 Ga0065712_10099414
1738 Ga0065712_10172843
1739 Ga0065715_10101395
1740 Ga0065715_10248732
1741 Ga0065707_10172508
1742 Ga0070658_10000019
1743 Ga0070658_10000620
1744 Ga0070676_10000165
1745 Ga0070676_10004448
1746 Ga0070676_10009053
1747 Ga0070683_100000490
1748 Ga0070683_100008790
1749 Ga0070683_100019095
1750 Ga0070683_100033031
1751 Ga0070683_100037917
1752 Ga0070683_100214037
1753 Ga0070690_100014558
1754 Ga0070690_100222605
1755 Ga0070670_100023449
1756 Ga0070670_100045231
1757 Ga0070670_100045675
1758 Ga0070670_100124091
1759 Ga0070670_100322721
1760 Ga0068869_100035053
1761 Ga0068869_100222530
1762 Ga0068869_100278780
1763 Ga0070666_10000149
1764 Ga0070666_10026992
1765 Ga0070666_10045180
1766 Ga0070666_10101986
1767 Ga0070666_10113350
1768 Ga0070666_10124451
1769 Ga0070680_100013984
1770 Ga0070680_100109344
1771 Ga0070680_100290676
1772 Ga0070682_100000005
1773 Ga0070682_100000353
1774 Ga0070682_100000455
1775 Ga0070682_100052137
1776 Ga0070682_100055112
1777 Ga0070682_100080907
1778 Ga0070682_100397247
1779 Ga0068868_100001512
1780 Ga0068868_100009759
1781 Ga0068868_100035335
1782 Ga0068868_100095591
1783 Ga0068868_100315327
1784 Ga0068868_100542909
1785 Ga0070660_100013586
1786 Ga0070660_100024845
1787 Ga0070660_100028630
1788 Ga0070660_100086147
1789 Ga0070660_100118568
1790 Ga0070660_100302607
1791 Ga0070660_100338361
1792 Ga0070689_100007084
1793 Ga0070689_100027440
1794 Ga0070689_100053460
1795 Ga0070689_100063420
1796 Ga0070689_100079996
1797 Ga0070689_100104131
1798 Ga0070691_10000108
1799 Ga0070691_10012823
1800 Ga0070687_100004245
1801 Ga0070687_100017865
1802 Ga0070687_100169158
1803 Ga0070661_100013211
1804 Ga0070661_100014716
1805 Ga0070661_100212627
1806 Ga0070668_100000116
1807 Ga0070668_100041075
1808 Ga0070668_100344354
1809 Ga0070668_100445138
1810 Ga0070669_100001238
1811 Ga0070669_100021706
1812 Ga0070675_100007791
1813 Ga0070675_100021277
1814 Ga0070675_100023522
1815 Ga0070675_100027436
1816 Ga0070675_100259399
1817 Ga0070675_100449113
1818 Ga0070671_100007630
1819 Ga0070671_100173151
1820 Ga0070671_100278658
1821 Ga0070673_100000521
1822 Ga0070673_100002836
1823 Ga0070673_100026243
1824 Ga0070673_100050105
1825 Ga0070673_100086001
1826 Ga0070673_100236278
1827 Ga0070673_100317680
1828 Ga0070673_100481225
1829 Ga0070673_100601736
1830 Ga0070688_100020624
1831 Ga0070688_100058227
1832 Ga0070688_100088239
1833 Ga0070688_100198694
1834 Ga0070659_100000854
1835 Ga0070659_100015398
1836 Ga0070659_100064896
1837 Ga0070659_100082653
1838 Ga0070659_100194917
1839 Ga0070667_100000652
1840 Ga0070667_100037432
1841 Ga0070667_100062287
1842 Ga0070667_100062561
1843 Ga0070667_100097378
1844 Ga0070667_100221593
1845 Ga0070714_100019735
1846 Ga0070714_100028118
1847 Ga0070701_10063559
1848 Ga0070705_100078932
1849 Ga0070700_100313123
1850 Ga0070708_100131227
1851 Ga0070708_100149144
1852 Ga0070663_100077955
1853 Ga0070678_100021123
1854 Ga0070678_100035033
1855 Ga0070662_100000185
1856 Ga0070662_100001619
1857 Ga0070662_100043870
1858 Ga0070662_100054985
1859 Ga0070681_10005301
1860 Ga0070681_10038676
1861 Ga0070681_10147632
1862 Ga0070681_10150936
1863 Ga0070681_10203847
1864 Ga0070681_10358338
1865 Ga0068867_100001301
1866 Ga0068867_100001831
1867 Ga0068867_100017992
1868 Ga0068867_100019059
1869 Ga0068867_100042333
1870 Ga0068867_100108711
1871 Ga0068867_100112021
1872 Ga0068867_100140983
1873 Ga0068867_100153104
1874 Ga0070685_10029690
1875 Ga0070685_10055309
1876 Ga0070685_10219722
1877 Ga0070706_100001897
1878 Ga0070698_100004450
1879 Ga0070698_100006719
1880 Ga0070698_100046304
1881 Ga0070698_100065647
1882 Ga0070698_100085777
1883 Ga0070699_100000898
1884 Ga0070699_100005118
1885 Ga0070679_100000684
1886 Ga0070679_100000973
1887 Ga0070679_100017813
1888 Ga0070679_100055296
1889 Ga0070679_100058796
1890 Ga0070679_100157974
1891 Ga0070679_100165970
1892 Ga0070679_100170362
1893 Ga0070679_100249019
1894 Ga0070684_100001352
1895 Ga0070684_100003219
1896 Ga0070684_100022740
1897 Ga0070684_100024742
1898 Ga0070684_100039209
1899 Ga0070684_100086908
1900 Ga0070684_100099941
1901 Ga0070684_100209603
1902 Ga0070684_100597227
1903 Ga0068853_100003822
1904 Ga0068853_100003840
1905 Ga0068853_100010559
1906 Ga0068853_100014740
1907 Ga0068853_100018808
1908 Ga0068853_100034968
1909 Ga0068853_100040230
1910 Ga0068853_100055268
1911 Ga0068853_100057677
1912 Ga0068853_100088732
1913 Ga0068853_100134213
1914 Ga0068853_100135766
1915 Ga0068853_100304975
1916 Ga0070672_100000038
1917 Ga0070672_100019728
1918 Ga0070672_100054264
1919 Ga0070672_100329967
1920 Ga0070686_100000009
1921 Ga0070686_100084247
1922 Ga0070686_100152913
1923 Ga0070686_100253836
1924 Ga0070686_100314805
1925 Ga0070695_100171337
1926 Ga0070696_100000338
1927 Ga0070696_100096932
1928 Ga0070693_100022172
1929 Ga0070665_100000003
1930 Ga0070665_100000013
1931 Ga0070665_100000504
1932 Ga0068855_100000424
1933 Ga0068855_100002280
1934 Ga0068855_100004799
1935 Ga0068855_100004987
1936 Ga0068855_100007323
1937 Ga0068855_100032608
1938 Ga0068855_100051013
1939 Ga0068855_100091566
1940 Ga0068855_100099457
1941 Ga0068855_100133364
1942 Ga0068855_100171289
1943 Ga0068855_100239514
1944 Ga0068855_100440427
1945 Ga0070664_100000887
1946 Ga0070664_100027435
1947 Ga0070664_100096084
1948 Ga0070664_100218197
1949 Ga0070664_100269108
1950 Ga0068857_100001871
1951 Ga0068857_100030476
1952 Ga0068857_100037108
1953 Ga0068857_100086576
1954 Ga0068857_100090030
1955 Ga0068857_100099568
1956 Ga0068857_100125945
1957 Ga0068857_100150650
1958 Ga0068857_100551347
1959 Ga0068854_100000001
1960 Ga0068854_100037888
1961 Ga0068854_100058665
1962 Ga0068854_100059696
1963 Ga0068854_100162486
1964 Ga0068854_100179910
1965 Ga0068854_100388785
1966 Ga0068856_100000092
1967 Ga0068856_100015638
1968 Ga0068856_100063370
1969 Ga0068856_100065310
1970 Ga0068856_100104346
1971 Ga0068856_100117548
1972 Ga0068852_100000207
1973 Ga0068852_100000372
1974 Ga0068852_100001739
1975 Ga0068852_100049153
1976 Ga0068852_100056318
1977 Ga0068852_100074782
1978 Ga0068852_100157239
1979 Ga0068852_100319746
1980 Ga0068852_100501042
1981 Ga0068859_100000037
1982 Ga0068859_100000297
1983 Ga0068859_100012921
1984 Ga0068859_100018938
1985 Ga0068859_100032567
1986 Ga0068859_100038533
1987 Ga0068859_100041123
1988 Ga0068859_100060520
1989 Ga0068859_100066417
1990 Ga0068859_100119093
1991 Ga0068859_100125357
1992 Ga0068864_100001608
1993 Ga0068864_100033690
1994 Ga0068864_100056794
1995 Ga0068864_100082848
1996 Ga0068864_100112111
1997 Ga0068864_100153123
1998 Ga0068861_100024095
1999 Ga0068861_100046336
2000 Ga0068861_100426160
2001 Ga0068851_10000211
2002 Ga0068851_10004628
2003 Ga0068851_10058142
2004 Ga0068851_10081233
2005 Ga0068851_10159207
2006 Ga0068851_10230800
2007 Ga0068870_10026851
2008 Ga0068863_100004928
2009 Ga0068863_100010020
2010 Ga0068863_100024182
2011 Ga0068863_100087086
2012 Ga0068863_100127460
2013 Ga0068863_100229108
2014 Ga0068863_100277979
2015 Ga0068863_100459948
2016 Ga0068858_100045372
2017 Ga0068858_100191217
2018 Ga0068860_100000060
2019 Ga0068860_100001930
2020 Ga0068860_100002513
2021 Ga0068860_100003819
2022 Ga0068860_100006581
2023 Ga0068860_100008084
2024 Ga0068860_100017699
2025 Ga0068860_100023835
2026 Ga0068860_100038051
2027 Ga0068860_100519160
2028 Ga0068862_100009911
2029 Ga0068862_100019107
2030 Ga0068862_100202793
2031 Ga0068862_100445040
2032 Ga0081539_10000377
2033 Ga0070716_100207196
2034 Ga0075366_10000849
2035 Ga0075366_10021480
2036 Ga0075366_10053427
2037 Ga0075366_10118894
2038 Ga0097621_100000054
2039 Ga0097621_100000538
2040 Ga0097621_100003328
2041 Ga0097621_100007933
2042 Ga0097621_100009287
2043 Ga0097621_100088709
2044 Ga0097621_100121199
2045 Ga0097621_100122047
2046 Ga0097621_100502867
2047 Ga0068871_100000145
2048 Ga0068871_100000452
2049 Ga0068871_100003693
2050 Ga0068871_100008083
2051 Ga0068871_100019024
2052 Ga0068871_100588731
2053 Ga0075428_100025789
2054 Ga0075428_100217290
2055 Ga0075428_100482962
2056 Ga0075430_100002888
2057 Ga0075430_100088252
2058 Ga0075429_100005622
2059 Ga0075429_100035668
2060 Ga0075429_100098599
2061 Ga0068865_100000051
2062 Ga0068865_100001621
2063 Ga0068865_100034481
2064 Ga0068865_100072902
2065 Ga0068865_100135783
2066 Ga0097620_100000037
2067 Ga0097620_100000297
2068 Ga0097620_100012921
2069 Ga0097620_100018938
2070 Ga0097620_100032569
2071 Ga0097620_100038533
2072 Ga0097620_100041125
2073 Ga0097620_100060522
2074 Ga0097620_100066417
2075 Ga0097620_100119099
2076 Ga0097620_100125356
2077 Ga0097620_100184357
2078 Ga0105251_10046770
2079 Ga0105244_10000004
2080 Ga0105244_10000050
2081 Ga0105240_10000288
2082 Ga0105240_10000486
2083 Ga0105240_10001336
2084 Ga0105240_10002538
2085 Ga0105240_10002890
2086 Ga0105240_10035851
2087 Ga0105240_10036520
2088 Ga0105240_10036908
2089 Ga0105240_10039015
2090 Ga0105240_10058938
2091 Ga0105240_10090460
2092 Ga0105240_10091789
2093 Ga0105240_10113122
2094 Ga0105240_10354242
2095 Ga0105240_10356391
2096 Ga0105240_10399782
2097 Ga0105240_10618733
2098 Ga0111539_10010702
2099 Ga0111539_10057146
2100 Ga0111539_10109423
2101 Ga0111539_10430513
2102 Ga0105245_10069229
2103 Ga0105247_10124201
2104 Ga0114129_10062706
2105 Ga0114129_10217408
2106 Ga0114129_10881896
2107 Ga0105243_10000714
2108 Ga0105241_10000144
2109 Ga0105241_10000159
2110 Ga0105241_10009012
2111 Ga0105241_10016889
2112 Ga0105241_10023476
2113 Ga0105241_10026541
2114 Ga0105241_10128325
2115 Ga0105241_10479124
2116 Ga0105242_10008025
2117 Ga0105242_10012643
2118 Ga0105242_10019823
2119 Ga0105242_10074643
2120 Ga0105242_10145055
2121 Ga0105242_10201298
2122 Ga0105242_10303376
2123 Ga0105242_10455481
2124 Ga0105242_10609050
2125 Ga0105237_10000340
2126 Ga0105237_10001447
2127 Ga0105237_10002246
2128 Ga0105237_10002692
2129 Ga0105237_10003438
2130 Ga0105237_10003874
2131 Ga0105237_10006527
2132 Ga0105237_10014277
2133 Ga0105237_10020082
2134 Ga0105237_10037688
2135 Ga0105237_10050656
2136 Ga0105237_10082559
2137 Ga0105237_10574565
2138 Ga0105238_10001478
2139 Ga0105238_10033082
2140 Ga0105238_10178291
2141 Ga0105249_10006624
2142 Ga0105249_10019222
2143 Ga0105249_10020766
2144 Ga0105249_10024592
2145 Ga0105249_10039265
2146 Ga0105249_10109118
2147 Ga0105249_10140985
2148 Ga0105249_10171192
2149 Ga0105249_10181116
2150 Ga0105249_10273496
2151 Ga0105249_10283010
2152 Ga0105249_10303249
2153 Ga0105249_10312134
2154 Ga0105239_10000002
2155 Ga0105239_10003371
2156 Ga0105239_10004649
2157 Ga0105239_10005221
2158 Ga0105239_10007261
2159 Ga0105239_10007528
2160 Ga0105239_10009550
2161 Ga0105239_10013160
2162 Ga0105239_10022636
2163 Ga0105239_10026857
2164 Ga0105239_10043544
2165 Ga0105239_10048749
2166 Ga0105239_10059029
2167 Ga0105239_10064731
2168 Ga0105239_10071969
2169 Ga0105239_10105947
2170 Ga0105239_10106259
2171 Ga0105239_10156519
2172 Ga0105239_10420467
2173 Ga0105246_10031234
2174 Ga0105246_10161198
2175 Ga0105246_10204698
2176 Ga0157373_10000002
2177 Ga0157373_10000022
2178 Ga0157373_10000240
2179 Ga0157373_10003717
2180 Ga0157373_10010053
2181 Ga0157373_10016960
2182 Ga0157373_10024848
2183 Ga0157373_10041929
2184 Ga0157373_10043691
2185 Ga0157373_10156476
2186 Ga0157373_10197718
2187 Ga0157373_10218164
2188 Ga0157373_10384962
2189 Ga0157371_10000034
2190 Ga0157371_10000052
2191 Ga0157371_10000315
2192 Ga0157371_10001806
2193 Ga0157371_10001838
2194 Ga0157371_10002042
2195 Ga0157371_10002767
2196 Ga0157371_10009079
2197 Ga0157371_10019323
2198 Ga0157371_10025742
2199 Ga0157371_10030858
2200 Ga0157371_10032647
2201 Ga0157371_10032676
2202 Ga0157371_10035173
2203 Ga0157371_10051810
2204 Ga0157371_10069008
2205 Ga0157371_10103420
2206 Ga0157371_10103550
2207 Ga0157371_10145591
2208 Ga0157371_10159989
2209 Ga0157371_10442534
2210 Ga0157370_10001848
2211 Ga0157370_10003381
2212 Ga0157370_10006627
2213 Ga0157370_10006991
2214 Ga0157370_10007182
2215 Ga0157370_10007499
2216 Ga0157370_10010995
2217 Ga0157370_10014889
2218 Ga0157370_10022321
2219 Ga0157370_10027225
2220 Ga0157370_10035152
2221 Ga0157370_10040466
2222 Ga0157370_10041127
2223 Ga0157370_10062774
2224 Ga0157370_10064117
2225 Ga0157370_10066514
2226 Ga0157370_10116882
2227 Ga0157370_10158000
2228 Ga0157370_10191187
2229 Ga0157370_10204600
2230 Ga0157370_10295832
2231 Ga0157370_10308836
2232 Ga0157370_10502848
2233 Ga0157369_10000002
2234 Ga0157369_10000546
2235 Ga0157369_10002262
2236 Ga0157369_10012625
2237 Ga0157369_10064429
2238 Ga0157369_10123229
2239 Ga0157369_10126597
2240 Ga0157369_10165029
2241 Ga0157369_10198778
2242 Ga0157369_10214794
2243 Ga0157369_10220944
2244 Ga0157369_10228004
2245 Ga0157369_10228096
2246 Ga0157369_10229542
2247 Ga0157369_10304194
2248 Ga0157369_10310389
2249 Ga0157374_10000007
2250 Ga0157374_10001618
2251 Ga0157374_10006545
2252 Ga0157374_10009663
2253 Ga0157374_10041358
2254 Ga0157374_10046398
2255 Ga0157374_10091140
2256 Ga0157374_10109266
2257 Ga0157374_10157830
2258 Ga0157374_10201422
2259 Ga0157374_10419676
2260 Ga0157378_10006148
2261 Ga0157378_10019271
2262 Ga0157378_10019552
2263 Ga0157378_10038445
2264 Ga0157378_10079509
2265 Ga0157378_10098479
2266 Ga0157378_10141317
2267 Ga0157378_10261061
2268 Ga0157378_10536456
2269 Ga0163162_10000064
2270 Ga0163162_10000213
2271 Ga0163162_10000330
2272 Ga0163162_10000386
2273 Ga0163162_10000487
2274 Ga0163162_10000942
2275 Ga0163162_10002936
2276 Ga0163162_10009251
2277 Ga0163162_10182430
2278 Ga0163162_10192462
2279 Ga0163162_10192528
2280 Ga0163162_10354953
2281 Ga0163162_10435430
2282 Ga0163162_10499781
2283 Ga0157372_10000186
2284 Ga0157372_10001707
2285 Ga0157372_10001805
2286 Ga0157372_10003368
2287 Ga0157372_10005795
2288 Ga0157372_10010801
2289 Ga0157372_10013159
2290 Ga0157372_10015096
2291 Ga0157372_10019462
2292 Ga0157372_10053501
2293 Ga0157372_10054631
2294 Ga0157372_10070389
2295 Ga0157372_10083574
2296 Ga0157372_10136917
2297 Ga0157372_10145531
2298 Ga0157372_10150168
2299 Ga0157372_10195265
2300 Ga0157372_10429567
2301 Ga0157372_10482947
2302 Ga0157372_10578885
2303 Ga0157372_10686438
2304 Ga0157372_10864322
2305 Ga0157375_10000178
2306 Ga0157375_10000548
2307 Ga0157375_10000813
2308 Ga0157375_10015502
2309 Ga0157375_10022597
2310 Ga0157375_10032794
2311 Ga0157375_10054458
2312 Ga0157375_10076124
2313 Ga0157375_10091194
2314 Ga0157375_10182179
2315 Ga0157375_10185943
2316 Ga0157375_10439993
2317 Ga0157375_10589767
2318 Ga0163163_10000046
2319 Ga0163163_10000218
2320 Ga0163163_10002472
2321 Ga0163163_10075694
2322 Ga0163163_10137520
2323 Ga0163163_10189930
2324 Ga0157380_10008479
2325 Ga0157380_10081357
2326 Ga0157380_10102557
2327 Ga0157380_10111320
2328 Ga0182008_10000010
2329 Ga0182008_10000129
2330 Ga0182008_10000726
2331 Ga0182008_10001151
2332 Ga0157377_10008517
2333 Ga0157377_10068354
2334 Ga0157377_10068656
2335 Ga0157377_10304580
2336 Ga0157379_10000020
2337 Ga0157379_10063857
2338 Ga0157379_10104067
2339 Ga0157376_10000297
2340 Ga0157376_10001923
2341 Ga0157376_10010993
2342 Ga0157376_10152574
2343 Ga0157376_10198771
2344 Ga0157376_10386664
2345 Ga0157376_10464473
2346 Ga0182006_1000012
2347 Ga0182006_1000505
2348 Ga0182006_1002042
2349 Ga0182006_1002694
2350 Ga0182006_1003243
2351 Ga0182006_1009439
2352 Ga0182006_1061253
2353 Ga0182007_10000001
2354 Ga0182007_10035102
2355 Ga0182005_1000023
2356 Ga0183373_1003
2357 Ga0163161_10000007
2358 Ga0163161_10000224
2359 Ga0163161_10000950
2360 Ga0163161_10001201
2361 Ga0163161_10001536
2362 Ga0163161_10002262
2363 Ga0163161_10175262
2364 Ga0206356_11441053
2365 Ga0213872_10027527
2366 Ga0213874_10055996
2367 Ga0213876_10019878
2368 Ga0213876_10041036
2369 Ga0213876_10053991
2370 Ga0213875_10001725
2371 Ga0213875_10002342
2372 Ga0213875_10046959
2373 Ga0209436_100215
2374 Ga0209258_100068
2375 Ga0207425_1000007
2376 Ga0209646_1000003
2377 Ga0209646_1000557
2378 Ga0209646_1006591
2379 Ga0209026_1000351
2380 Ga0209026_1001293
2381 Ga0209026_1001890
2382 Ga0209148_1000182
2383 Ga0209129_1000006
2384 Ga0209233_1001459
2385 Ga0209673_1000194
2386 Ga0209130_1001519
2387 Ga0209675_1000116
2388 Ga0209676_1000001
2389 Ga0209025_1000025
2390 Ga0209564_1002770
2391 Ga0209564_1018457
2392 Ga0209564_1032622
2393 Ga0209758_1000016
2394 Ga0209758_1005012
2395 Ga0209758_1005299
2396 Ga0209758_1006844
2397 Ga0209050_1000018
2398 Ga0209050_1000765
2399 Ga0209050_1005793
2400 Ga0207426_1000051
2401 Ga0207426_1000698
2402 Ga0207426_1003100
2403 Ga0207426_1003377
2404 Ga0207426_1033695
2405 Ga0209257_1000001
2406 Ga0209257_1000005
2407 Ga0207697_10041542
2408 Ga0207656_10001225
2409 Ga0207656_10053808
2410 Ga0207655_1000008
2411 Ga0207655_1000480
2412 Ga0207682_10005264
2413 Ga0207642_10013913
2414 Ga0207710_10001860
2415 Ga0207680_10000122
2416 Ga0207680_10026027
2417 Ga0207647_10000011
2418 Ga0207647_10000030
2419 Ga0207647_10000093
2420 Ga0207647_10175645
2421 Ga0207645_10000652
2422 Ga0207645_10000716
2423 Ga0207645_10009152
2424 Ga0207643_10001321
2425 Ga0207705_10000069
2426 Ga0207705_10013031
2427 Ga0207705_10038520
2428 Ga0207705_10134475
2429 Ga0207705_10214348
2430 Ga0207684_10022615
2431 Ga0207654_10000765
2432 Ga0207654_10003555
2433 Ga0207654_10003795
2434 Ga0207707_10000317
2435 Ga0207707_10012901
2436 Ga0207707_10031015
2437 Ga0207707_10084341
2438 Ga0207695_10000064
2439 Ga0207695_10000130
2440 Ga0207695_10000170
2441 Ga0207695_10001063
2442 Ga0207695_10001252
2443 Ga0207695_10003137
2444 Ga0207695_10005821
2445 Ga0207695_10007582
2446 Ga0207695_10022346
2447 Ga0207695_10029276
2448 Ga0207695_10061629
2449 Ga0207695_10088895
2450 Ga0207695_10120409
2451 Ga0207695_10304710
2452 Ga0207671_10001726
2453 Ga0207671_10002818
2454 Ga0207671_10004790
2455 Ga0207671_10008461
2456 Ga0207671_10021002
2457 Ga0207671_10035702
2458 Ga0207671_10056473
2459 Ga0207660_10001972
2460 Ga0207660_10070780
2461 Ga0207660_10164749
2462 Ga0207662_10007258
2463 Ga0207662_10008205
2464 Ga0207662_10052087
2465 Ga0207662_10055033
2466 Ga0207662_10087399
2467 Ga0207657_10016490
2468 Ga0207657_10023752
2469 Ga0207657_10037451
2470 Ga0207657_10049987
2471 Ga0207657_10084882
2472 Ga0207657_10159740
2473 Ga0207649_10014837
2474 Ga0207652_10000013
2475 Ga0207652_10000035
2476 Ga0207652_10000456
2477 Ga0207652_10004312
2478 Ga0207652_10011733
2479 Ga0207652_10039216
2480 Ga0207652_10163411
2481 Ga0207681_10054364
2482 Ga0207681_10069179
2483 Ga0207681_10071584
2484 Ga0207694_10016025
2485 Ga0207694_10020911
2486 Ga0207694_10066212
2487 Ga0207694_10117772
2488 Ga0207650_10005437
2489 Ga0207650_10012262
2490 Ga0207650_10188420
2491 Ga0207650_10240509
2492 Ga0207650_10295995
2493 Ga0207650_10441955
2494 Ga0207659_10012869
2495 Ga0207659_10020238
2496 Ga0207659_10060146
2497 Ga0207659_10284745
2498 Ga0207664_10023739
2499 Ga0207644_10008482
2500 Ga0207644_10014222
2501 Ga0207644_10097628
2502 Ga0207690_10003762
2503 Ga0207690_10039633
2504 Ga0207690_10060194
2505 Ga0207690_10076772
2506 Ga0207690_10270110
2507 Ga0207706_10000243
2508 Ga0207706_10000960
2509 Ga0207706_10007335
2510 Ga0207706_10029076
2511 Ga0207706_10074559
2512 Ga0207686_10000893
2513 Ga0207686_10196389
2514 Ga0207686_10292736
2515 Ga0207709_10000385
2516 Ga0207670_10010640
2517 Ga0207670_10067313
2518 Ga0207670_10069241
2519 Ga0207670_10237539
2520 Ga0207704_10000046
2521 Ga0207704_10001715
2522 Ga0207704_10055723
2523 Ga0207704_10251117
2524 Ga0207665_10198606
2525 Ga0207691_10000013
2526 Ga0207691_10023117
2527 Ga0207691_10037040
2528 Ga0207691_10151805
2529 Ga0207691_10269584
2530 Ga0207689_10018622
2531 Ga0207689_10030399
2532 Ga0207689_10037050
2533 Ga0207689_10047129
2534 Ga0207689_10134090
2535 Ga0207689_10177894
2536 Ga0207689_10273500
2537 Ga0207689_10317289
2538 Ga0207661_10002525
2539 Ga0207661_10004578
2540 Ga0207661_10034379
2541 Ga0207661_10114832
2542 Ga0207661_10319741
2543 Ga0207679_10001836
2544 Ga0207679_10085593
2545 Ga0207679_10124602
2546 Ga0207679_10168844
2547 Ga0207679_10484342
2548 Ga0207667_10000239
2549 Ga0207667_10000409
2550 Ga0207667_10000876
2551 Ga0207667_10001727
2552 Ga0207667_10003906
2553 Ga0207667_10007947
2554 Ga0207667_10009468
2555 Ga0207667_10009667
2556 Ga0207667_10010158
2557 Ga0207667_10013674
2558 Ga0207667_10038396
2559 Ga0207667_10048086
2560 Ga0207667_10051902
2561 Ga0207667_10116102
2562 Ga0207667_10195020
2563 Ga0207651_10000468
2564 Ga0207651_10104611
2565 Ga0207651_10208329
2566 Ga0207651_10436841
2567 Ga0207651_10494415
2568 Ga0207712_10004227
2569 Ga0207712_10005693
2570 Ga0207712_10008770
2571 Ga0207712_10021924
2572 Ga0207712_10096244
2573 Ga0207668_10000295
2574 Ga0207668_10123391
2575 Ga0207668_10159509
2576 Ga0207668_10325537
2577 Ga0207668_10448565
2578 Ga0207640_10000003
2579 Ga0207640_10026917
2580 Ga0207640_10093250
2581 Ga0207658_10005989
2582 Ga0207658_10058238
2583 Ga0207658_10131215
2584 Ga0207658_10131331
2585 Ga0207677_10009715
2586 Ga0207677_10528906
2587 Ga0207703_10001005
2588 Ga0207703_10030189
2589 Ga0207703_10088782
2590 Ga0207639_10001884
2591 Ga0207639_10003462
2592 Ga0207639_10003621
2593 Ga0207639_10009995
2594 Ga0207639_10015497
2595 Ga0207639_10022128
2596 Ga0207639_10095011
2597 Ga0207639_10155125
2598 Ga0207639_10315236
2599 Ga0207639_10425471
2600 Ga0207678_10019032
2601 Ga0207678_10032984
2602 Ga0207678_10133369
2603 Ga0207678_10368085
2604 Ga0207702_10001849
2605 Ga0207702_10025828
2606 Ga0207702_10034899
2607 Ga0207702_10045223
2608 Ga0207702_10082017
2609 Ga0207702_10139415
2610 Ga0207702_10335977
2611 Ga0207702_10422683
2612 Ga0207641_10000121
2613 Ga0207641_10007872
2614 Ga0207641_10017376
2615 Ga0207641_10026539
2616 Ga0207641_10169730
2617 Ga0207641_10187368
2618 Ga0207641_10220352
2619 Ga0207641_10236040
2620 Ga0207648_10000257
2621 Ga0207648_10006608
2622 Ga0207648_10013283
2623 Ga0207648_10024715
2624 Ga0207648_10038642
2625 Ga0207648_10067003
2626 Ga0207648_10295816
2627 Ga0207676_10001058
2628 Ga0207676_10013780
2629 Ga0207676_10030767
2630 Ga0207676_10078717
2631 Ga0207676_10084159
2632 Ga0207676_10222150
2633 Ga0207674_10001258
2634 Ga0207674_10026912
2635 Ga0207674_10029400
2636 Ga0207674_10050362
2637 Ga0207674_10067559
2638 Ga0207674_10108632
2639 Ga0207674_10141577
2640 Ga0207674_10254511
2641 Ga0207674_10293853
2642 Ga0207674_10526691
2643 Ga0207675_100000762
2644 Ga0207675_100016606
2645 Ga0207675_100039146
2646 Ga0207675_100083763
2647 Ga0207675_100091523
2648 Ga0207675_100165899
2649 Ga0207675_100297429
2650 Ga0207683_10020515
2651 Ga0207683_10101735
2652 Ga0207698_10001507
2653 Ga0207698_10015124
2654 Ga0207698_10021343
2655 Ga0207698_10089483
2656 Ga0207698_10133598
2657 Ga0207698_10256356
2658 Ga0207698_10272969
2659 Ga0207698_10377523
2660 Ga0207698_10471918
2661 Ga0209281_1000116
2662 Ga0210002_1021460
2663 Ga0209974_10035082
2664 Ga0207428_10013193
2665 Ga0207428_10035988
2666 Ga0207428_10324915
2667 Ga0268266_10000024
2668 Ga0268266_10000078
2669 Ga0268266_10002084
2670 Ga0268266_10015921
2671 Ga0268265_10013369
2672 Ga0268265_10196297
2673 Ga0268265_10281367
2674 Ga0268265_10292717
2675 Ga0268264_10000109
2676 Ga0268264_10004538
2677 Ga0268264_10005427
2678 Ga0268264_10005664
2679 Ga0268264_10014974
2680 Ga0268264_10020798
2681 Ga0268264_10036652
2682 Ga0268264_10082072
2683 Ga0268264_10310871
2684 Ga0307517_10018951
2685 Ga0307517_10051260
2686 Ga0307515_10000010
2687 Ga0307515_10000061
2688 Ga0307515_10000469
2689 Ga0307515_10000778
2690 Ga0307515_10003029
2691 Ga0307515_10011558
2692 Ga0307515_10261059
2693 Ga0307515_10368975
2694 Ga0265338_10077514
2695 Ga0265338_10078686
2696 Ga0265324_10043029
2697 Ga0307511_10000455
2698 Ga0307511_10143505
2699 Ga0316177_1124334
2700 Ga0316183_1174733
2701 Ga0316181_1092606
2702 Ga0265331_10038163
2703 Ga0265327_10000051
2704 Ga0265327_10000219
2705 Ga0265327_10014024
2706 Ga0307513_10011590
2707 Ga0307513_10354056
2708 Ga0307509_10029926
2709 Ga0307509_10066464
2710 Ga0307509_10110275
2711 Ga0307408_100000801
2712 Ga0307408_100003540
2713 Ga0307408_100019914
2714 Ga0265313_10025066
2715 Ga0265314_10069177
2716 Ga0316576_10117690
2717 Ga0307516_10005541
2718 Ga0307516_10049737
2719 Ga0307516_10114825
2720 Ga0307405_10000002
2721 Ga0307405_10000026
2722 Ga0307405_10032191
2723 Ga0307413_10000019
2724 Ga0307413_10015140
2725 Ga0307410_10024479
2726 Ga0307406_10000038
2727 Ga0307406_10001880
2728 Ga0307406_10009431
2729 Ga0307406_10130235
2730 Ga0307407_10000032
2731 Ga0307407_10002036
2732 Ga0307412_10000007
2733 Ga0307412_10000018
2734 Ga0307412_10000175
2735 Ga0307412_10002066
2736 Ga0307412_10007859
2737 Ga0307412_10010470
2738 Ga0307412_10043584
2739 Ga0307409_100087536
2740 Ga0307416_100000003
2741 Ga0307416_100000045
2742 Ga0307416_100012288
2743 Ga0307416_100040565
2744 Ga0307414_10000001
2745 Ga0307414_10000048
2746 Ga0307414_10000200
2747 Ga0307414_10008062
2748 Ga0307414_10008445
2749 Ga0307414_10021005
2750 Ga0307414_10042757
2751 Ga0307414_10063408
2752 Ga0307414_10079718
2753 Ga0307414_10105158
2754 Ga0307414_10108215
2755 Ga0307414_10187639
2756 Ga0307414_10364447
2757 Ga0307411_10000013
2758 Ga0307411_10011513
2759 Ga0307411_10158471
2760 Ga0307415_100257726
2761 Ga0307415_100480271
2762 Ga0316583_10002539
2763 Ga0316583_10058520
2764 Ga0307510_10001211
2765 Ga0307510_10029288
2766 Ga0316574_0096071
2767 Ga0373935_0118781
2768 Ga0373935_0132040
2769 Ga0373927_0157505
2770 Ga0373937_0250921
2771 Ga0316584_0065713
2772 Ga0373925_0130635
2773 Ga0395899_0000950
2774 Ga0395899_0002365
2775 Ga0395899_0002966
2776 Ga0395899_0021120
2777 Ga0395899_0026711
2778 Ga0395899_0092688
2779 Ga0395899_0139949
2780 Ga0395900_0000014
2781 Ga0395900_0002099
2782 Ga0395900_0019416
2783 Ga0395900_0020465
2784 Ga0395900_0022668
2785 Ga0395900_0057377
2786 Ga0395900_0085018
2787 Ga0395900_0163868
2788 Ga0395900_0200879
2789 Ga0395900_0297733
2790 Ga0395898_0003279
2791 Ga0395898_0053462
2792 Ga0395898_0108210
2793 Ga0395898_0143181
2794 Ga0395898_0175655
2795 Ga0395898_0233397
2796 Ga0395905_0000037
2797 Ga0395905_0000145
2798 Ga0395905_0007667
2799 Ga0395905_0010753
2800 Ga0395905_0146491
2801 Ga0395905_0177710
2802 Ga0436364_0124774
2803 Ga0436364_0263606
2804 Ga0436364_0335834
2805 Ga0436364_0527339
2806 Ga0436364_0680771
2807 Ga0436364_0711825
2808 Ga0436364_1395677
2809 Ga0395901_0000117
2810 Ga0395901_0008828
2811 Ga0395901_0020717
2812 Ga0395901_0028625
2813 Ga0395901_0108578
2814 Ga0395901_0150985
2815 Ga0395901_0221536
2816 Ga0395901_0285876
2817 Ga0436365_0187021
2818 Ga0436365_0614130
2819 Ga0436365_0692375
2820 Ga0436365_1167736
2821 Ga0436365_1431762
2822 Ga0436365_1705244
2823 Ga0436360_0238484
2824 Ga0436360_0552842
2825 Ga0436360_0858616
2826 Ga0436360_0912519
2827 Ga0436360_1172065
2828 Ga0436360_1357712
2829 Ga0436361_0108982
2830 Ga0436361_0191006
2831 Ga0436361_0286485
2832 Ga0436361_0640991
2833 Ga0436361_1096116
2834 Ga0436361_1131553
2835 Ga0436363_0107063
2836 Ga0436363_1014168
2837 Ga0436363_1327048
2838 Ga0436363_1429132
2839 Ga0436362_0528742
2840 Ga0436362_1161122
2841 Ga0439436_0018190
2842 Ga0439439_0021425
2843 Ga0439447_002503
2844 Ga0439466_0003065
2845 Ga0439465_0001507
2846 Ga0451807_0790979
2847 Ga0451837_1313197
2848 Ga0451841_0285170
2849 Ga0439441_032938
2850 Ga0439445_0002356
2851 Ga0439449_0051049
2852 Ga0439457_002980
2853 Ga0439462_0004484
2854 Ga0450899_006776
2855 Ga0451577_0001803
2856 Ga0451577_0009458
2857 Ga0451577_0052398
2858 Ga0451577_0053025
2859 Ga0466972_0000013
2860 Ga0466966_0000045
2861 Ga0466961_0002285
2862 Ga0466964_0057032
2863 Ga0453684_0000132
2864 Ga0453684_0001324
2865 Ga0453684_0001992
2866 Ga0453684_0085930
2867 Ga0453684_0116908
2868 Ga0453684_0124951
2869 Ga0453684_0206628
2870 Ga0453684_0208460
2871 Ga0453684_0237329
2872 Ga0453684_0440157
2873 Ga0453684_0939380
2874 Ga0466968_0106048
2875 Ga0466970_0019422
2876 Ga0466957_0000156
2877 Ga0466957_0192797
2878 Ga0466957_0301490
2879 Ga0466959_0000023
2880 Ga0466959_0002751
2881 Ga0466959_0117825
2882 Ga0466959_0133933
2883 Ga0451576_0000012
2884 Ga0451576_0003337
2885 Ga0451576_0010351
2886 Ga0451576_0035608
2887 Ga0451576_0385547
2888 Ga0451576_0817388
2889 Ga0466967_0039205
2890 Ga0495627_000002
2891 Ga0495627_039056
2892 Ga0495592_0087566
2893 Ga0495590_0016811
2894 Ga0495638_0000003
2895 Ga0495638_0028263
2896 Ga0495650_0000014
2897 Ga0495650_0075015
2898 Ga0495580_0110399
2899 Ga0495664_0039169
2900 Ga0495585_0001092
2901 Ga0495585_0002645
2902 Ga0495596_0005716
2903 Ga0495596_0071405
2904 Ga0495607_0117693
2905 Ga0495606_0000096
2906 Ga0495606_0009086
2907 Ga0495606_0077987
2908 Ga0495606_0096851
2909 Ga0495610_0000009
2910 Ga0495610_0000427
2911 Ga0495610_0000472
2912 Ga0495610_0000791
2913 Ga0495616_0006078
2914 Ga0495628_0107843
2915 Ga0495630_0046886
2916 Ga0495630_0087576
2917 Ga0495631_0014272
2918 Ga0495632_0001031
2919 Ga0495637_0046286
2920 Ga0495643_0007955
2921 Ga0495643_0212208
2922 Ga0495648_0022634
2923 Ga0495652_0166635
2924 Ga0495652_0363210
2925 Ga0495654_0000001
2926 Ga0495586_0209159
2927 Ga0495587_0163765
2928 Ga0495609_0000130
2929 Ga0495609_0065609
2930 Ga0495621_0010363
2931 Ga0495633_0000002
2932 Ga0495633_0000058
2933 Ga0495633_0000081
2934 Ga0495633_0003017
2935 Ga0495633_0050424
2936 Ga0495668_0000003
2937 Ga0495668_0000677
2938 Ga0495668_0001458
2939 Ga0495634_0004906
2940 Ga0495611_0006112
2941 Ga0495625_0000003
2942 Ga0495625_0000846
2943 Ga0495625_0001053
2944 Ga0495625_0007782
2945 Ga0495625_0081162
2946 Ga0495625_0219254
2947 Ga0495661_0001756
2948 Ga0495661_0063170
2949 Ga0495657_0156168
2950 Ga0495623_0043173
2951 Ga0495658_0011980
2952 Ga0495658_0024033
2953 Ga0495658_0271174
2954 Ga0495613_0086982
2955 Ga0495649_0000002
2956 Ga0495674_0032089
2957 Ga0495672_0011633
2958 Ga0495672_0012039
2959 Ga0495672_0139392
2960 Ga0495687_000014
2961 Ga0495687_001036
2962 Ga0495687_001602
2963 Ga0495673_0045627
2964 Ga0495684_0133622
2965 Ga0495684_0272103
2966 Ga0495686_0000022
2967 Ga0495686_0000034
2968 Ga0495686_0000367
2969 Ga0495686_0001743
2970 Ga0495686_0003019
2971 Ga0495686_0010729
2972 Ga0495686_0036083
2973 Ga0495686_0048951
2974 Ga0495614_0017370
2975 Ga0496101_0013706
2976 Ga0496103_0059333
2977 Ga0496108_0014827
2978 Ga0496109_0340482
2979 Ga0496114_0294137
2980 Ga0496114_0368449
2981 Ga0496115_0087065
2982 Ga0496115_0281224
2983 Ga0496116_0000022
2984 Ga0496116_0000047
2985 Ga0496117_0000074
2986 Ga0496118_0001188
2987 Ga0496118_0023205
2988 Ga0496118_0153203
2989 Ga0496119_0000426
2990 Ga0496121_0000343
2991 Ga0496121_0009602
2992 Ga0496121_0064683
2993 Ga0496122_0000354
2994 Ga0496122_0000357
2995 Ga0496122_0000598
2996 Ga0496122_0000789
2997 Ga0496122_0003624
2998 Ga0496122_0014216
2999 Ga0496123_0001991
3000 Ga0496123_0002415
3001 Ga0496123_0007740
3002 Ga0496123_0094824
3003 Ga0496124_0005359
3004 Ga0496124_0092182
3005 Ga0496124_0175115
3006 Ga0496125_0000050
3007 Ga0496125_0000286
3008 Ga0496125_0001036
3009 Ga0496125_0020214
3010 Ga0496126_0001468
3011 Ga0496126_0009501
3012 Ga0496126_0057468
3013 Ga0496126_0065319
3014 Ga0496126_0100998
3015 Ga0496126_0272877
3016 Ga0501298_000106
3017 Ga0501031_0000757
3018 Ga0501032_0007292
3019 Ga0501032_0023495
3020 Ga0501032_0065860
3021 Ga0501033_0000028
3022 Ga0501033_0012561
3023 Ga0501034_0000074
3024 Ga0501034_0000115
3025 Ga0501034_0000363
3026 Ga0501034_0085615
3027 Ga0501034_0093171
3028 Ga0501034_0190810
3029 Ga0501034_0255519
3030 Ga0501034_0298918
3031 Ga0501036_0002989
3032 Ga0501036_0061774
3033 Ga0501036_0190302
3034 Ga0501037_0153691
3035 Ga0501038_0013147
3036 Ga0501038_0209966
3037 Ga0501039_0003283
3038 Ga0501043_0002401
3039 Ga0501043_0140515
3040 Ga0501043_0211969
3041 Ga0501046_0015984
3042 Ga0501047_0006088
3043 Ga0501047_0007483
3044 Ga0501047_0018935
3045 Ga0501047_0021293
3046 Ga0501047_0128891
3047 Ga0501048_0027732
3048 Ga0501048_0035049
3049 Ga0501048_0330527
3050 Ga0501068_0203530
3051 Ga0501069_0215862
3052 Ga0501069_0216348
3053 Ga0501070_0014181
3054 Ga0501070_0167148
3055 Ga0501070_0208243
3056 Ga0501070_0426641
3057 Ga0501073_0058809
3058 Ga0501073_0094268
3059 Ga0501074_0000815
3060 Ga0501076_0276247
3061 Ga0501206_019302
3062 Ga0501207_002619
3063 Ga0501207_012747
3064 Ga0501223_001886
3065 Ga0501223_002515
3066 Ga0501223_005427
3067 Ga0501224_001146
3068 Ga0501235_002262
3069 Ga0501243_002218
3070 Ga0501249_000021
3071 Ga0501257_001165
3072 Ga0501259_000663
3073 Ga0501259_006093
3074 Ga0501261_001376
3075 Ga0501219_000283
3076 Ga0501221_001422
3077 Ga0501225_0000104
3078 Ga0501225_0000966
3079 Ga0501225_0008139
3080 Ga0501225_0020594
3081 Ga0501225_0037668
3082 Ga0501234_015381
3083 Ga0501245_001190
3084 Ga0501080_0030430
3085 Ga0501080_0193060
3086 Ga0501080_0216519
3087 Ga0501080_0219204
3088 Ga0501083_0094683
3089 Ga0501083_0232891
3090 Ga0501232_005086
3091 Ga0501241_000046
3092 Ga0501241_001023
3093 Ga0501241_004726
3094 Ga0501241_010751
3095 Ga0501264_000172
3096 Ga0501266_000005
3097 Ga0501266_003461
3098 Ga0501269_000938
3099 Ga0501269_006791
3100 Ga0501279_010928
3101 Ga0501280_000623
3102 Ga0501035_0005702
3103 Ga0501035_0006466
3104 Ga0501035_0012462
3105 Ga0501035_0182177
3106 Ga0501035_0443991
3107 Ga0501044_0001410
3108 Ga0501044_0013587
3109 Ga0501044_0044477
3110 Ga0501044_0074255
3111 Ga0501044_0075975
3112 Ga0501044_0169498
3113 Ga0501044_0534921
3114 Ga0501045_0000380
3115 Ga0501045_0186382
3116 Ga0501284_00041
3117 nmdc:mga0k408_10430_c1
3118 nmdc:mga0k408_175_c1
3119 nmdc:mga0k408_70668_c1
3120 nmdc:mga05p37_1489_c1
3121 nmdc:mga05p37_235392_c1
3122 nmdc:mga09592_320113_c1
3123 nmdc:mga09592_33821_c1
3124 nmdc:mga09592_58488_c1
3125 nmdc:mga09592_8374_c1
3126 nmdc:mga0qj67_44032_c1
3127 nmdc:mga0qj67_79577_c1
3128 nmdc:mga08y16_130587_c1
3129 nmdc:mga08y16_226436_c1
3130 nmdc:mga08y16_29337_c1
3131 nmdc:mga08y16_58894_c1
3132 nmdc:mga08y16_8584_c1
3133 nmdc:mga0n895_193849_c1
3134 Ga0495619_0234385
3135 Ga0500578_0000155
3136 Ga0500578_0031314
3137 Ga0500644_0000267
3138 Ga0500646_0001240
3139 Ga0500646_0008454
3140 Ga0500646_0029674
3141 Ga0500647_0106336
3142 Ga0500583_0000043
3143 Ga0500583_0002749
3144 Ga0500583_0017441
3145 Ga0500583_0094654
3146 Ga0500651_0001157
3147 Ga0500566_0037856
3148 Ga0500640_001728
3149 Ga0500641_0000027
3150 Ga0500641_0000083
3151 Ga0500641_0000415
3152 Ga0500641_0051164
3153 Ga0500554_000172
3154 Ga0500556_0066938
3155 Ga0500569_000319
3156 Ga0500595_000017
3157 Ga0500608_000329
3158 Ga0500614_000174
3159 Ga0500614_010475
3160 Ga0500618_000004
3161 Ga0500618_005734
3162 Ga0500652_004080
3163 Ga0500658_0000550
3164 Ga0500559_0006396
3165 Ga0500559_0015345
3166 Ga0500559_0025420
3167 Ga0500559_0036704
3168 Ga0500568_0004600
3169 Ga0500568_0100822
3170 Ga0500577_0006687
3171 Ga0500589_047465
3172 Ga0500590_079001
3173 Ga0500604_0001214
3174 Ga0500616_0000007
3175 Ga0500616_0004544
3176 Ga0500616_0014667
3177 Ga0500619_034142
3178 Ga0500622_0000003
3179 Ga0500622_0000841
3180 Ga0500622_0000864
3181 Ga0500622_0001251
3182 Ga0500622_0001894
3183 Ga0500622_0009447
3184 Ga0500633_0076677
3185 Ga0500636_0040285
3186 Ga0500584_042747
3187 Ga0500611_000077
3188 Ga0501084_0111865
3189 Ga0501084_0186693
3190 Ga0501082_0145745
3191 Ga0501082_0407727
3192 2511234315
3193 2513235376
3194 2520878810
3195 2524006061
3196 2585143354
3197 2585159642
3198 2585163895
3199 2585425082
3200 2586209490
3201 2587677701
3202 2587746850
3203 2587750912
3204 2587867936
3205 2587943368
3206 2588209617
3207 2588213908
3208 2588218471
3209 2588225838
3210 2588231654
3211 2588444917
3212 2590601215
3213 2590612499
3214 2599478512
3215 2644011480
3216 2644369881
3217 2644642276
3218 2644685273
3219 2729199225
3220 2738700650
3221 2738726304
3222 2738731932
3223 2738756548
3224 2738760872
3225 2738764497
3226 2738853633
3227 2739213512
3228 2739254399
3229 2739303987
3230 2739588866
3231 2739645252
3232 2740000777
3233 2740005593
3234 2740032952
3235 2740058414
3236 2753671161
3237 2765573323
3238 2772604137
3239 2775672471
3240 2776613057
3241 2802654188
3242 2816873727
3243 2817415787
3244 2817482047
3245 2817620853
3246 2819548026
3247 2819572546
3248 2819588583
3249 2819680683
3250 2821140061
3251 2833644144
3252 2839992780
3253 2842085015
3254 2842726316
3255 2842906804
3256 2842910567
3257 2849282178
3258 2852623436
3259 2852627318
3260 2852674229
3261 2857460809
3262 2857614526
3263 2857619091
3264 2857628992
3265 2871720718
3266 2881248478
3267 2881360433
3268 2881955939
3269 2884635304
3270 2884795426
3271 2884937686
3272 2888579942
3273 2889291005
3274 2896087952
3275 2896112334
3276 2898907899
3277 2902048831
3278 2903898576
3279 2904419812
3280 2904445515
3281 2904472182
3282 2904556601
3283 2905999660
3284 2910247597
3285 2915610539
3286 2919098902
3287 2919187353
3288 2919194073
3289 2919400459
3290 2919441655
3291 2919509873
3292 2919687159
3293 2919693203
3294 2928080436
3295 2928149392
3296 2928510871
3297 2929153032
3298 2929179002
3299 2929189385
3300 2929244898
3301 2929927142
3302 2932083223
3303 2939665379
3304 2945927748
3305 2945981405
3306 2946000883
3307 2946019196
3308 2954017790
3309 2958463360
3310 2958515315
3311 2965323455
3312 2977245670
3313 2977269696
3314 2984575319
3315 2984608773
3316 2993373042
3317 2993483726
3318 3006862476
3319 8036738090
3320 8054308239
3321 8055421464
3322 8055594064
3323 8056443925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

204

300

1

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

23

202

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

23

160

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 1.001 29 57
3if9-assembly1.cif.gz_B-2 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.999 30 57
4ysh-assembly1.cif.gz_A crystal structure of glycine oxidase from geobacillus kaustophilus 0.9983 30 57
4c3y-assembly2.cif.gz_E crystal structure of 3-ketosteroid delta1-dehydrogenase from rhodococcus erythropolis sq1 in complex with 1,4-androstadiene-3,17- dione 0.9936 30 57
2zxi-assembly2.cif.gz_D structure of aquifex aeolicus gida in the form ii crystal 0.9893 30 59
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9997 30 57 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9982 30 57 3.50.50.60
4kueA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9968 219 303 1.10.1040.10
4kueB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9968 219 303 1.10.1040.10
4kuhF02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9968 219 303 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A0C9T8E5-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase C-terminal domain-containing protein 0.999 220 308 GO:0006631
GO:0016616
AF-A0A7V4A1C2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9974 27 122 GO:0006631
GO:0008691
GO:0070403
AF-X1REX1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein 0.9956 27 103 GO:0006631
GO:0016491
GO:0070403
AF-A0A061S868-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9948 216 307 GO:0006631
GO:0016616
AF-A0A645GXP1-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.35) 0.9946 201 308 GO:0003857
GO:0006635
GO:0008691

Map