F495249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1661 | 751 | 3322 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300041511|Ga0451855_0948618|Ga0451855_0948618_301_960 |
| Length | 219 |
| Sequence | MDLVFATQFAGGLAVAMLIAVLLQGRLFWRDQIARLSSDGGSFEALTSVWVGNGRSVSFAPHETSAWTARPKSGTADVDPYSRASIARSGELPIGTGDGIAFSATSDDKRKPLDGRCDVVVSGVTPAARFWTLTLFDRKGHLVANSLKRYGFTSQEIIRGSDGTFEIRVASRSRAGNWLPTGGIERYALMLRLYDTPVGVATRTQRDAPMPSISTVNCP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 99 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 100 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 101 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 139 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 140 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 141 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 142 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 251 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 265 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 296 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 297 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 298 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 299 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 300 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 305 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 306 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 307 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 308 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 309 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 310 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 311 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 314 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 315 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 411 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 414 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 415 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 416 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 417 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 418 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 419 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 420 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 461 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 473 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 479 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 480 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 481 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 482 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 483 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 484 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 486 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 487 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 488 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 490 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 493 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 494 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 495 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 496 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 497 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 498 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 500 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 501 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 502 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 503 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 505 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 506 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 507 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 508 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 509 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 510 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 511 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 513 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 515 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 517 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 518 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 520 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 521 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 523 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 525 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 526 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 527 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 528 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 529 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 530 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 531 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 532 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 533 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 534 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 535 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 536 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 537 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 538 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 539 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 540 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 541 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 542 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 543 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 544 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 545 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 546 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 547 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 548 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 549 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 550 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 551 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 552 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 553 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 554 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 555 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 556 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 557 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 558 | 2791355199 | |||
| 559 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 560 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 561 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 562 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 563 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 564 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 565 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 566 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 567 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 568 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 569 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 570 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 571 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 572 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 573 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 574 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 575 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 576 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 577 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 578 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 579 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 580 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 581 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 582 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 583 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 584 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 585 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 586 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 587 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 588 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 589 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 590 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 591 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 592 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 593 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 594 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 595 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 596 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 597 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 598 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 599 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 600 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 601 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 602 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 603 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 604 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 605 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 606 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 607 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 608 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 609 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 610 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 611 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 612 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 613 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 614 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 615 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 616 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 617 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 618 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 619 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 620 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 621 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 622 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 623 | 2904699407 | |||
| 624 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 625 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 626 | 2906610324 | |||
| 627 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 628 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 629 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 630 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 631 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 632 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 633 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 634 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 635 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 636 | 2922368715 | |||
| 637 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 638 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 639 | 2922425934 | |||
| 640 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 641 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 642 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 643 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 644 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 645 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 646 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 647 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 648 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 649 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 650 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 651 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 652 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 653 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 654 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 655 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 656 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 657 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 658 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 659 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 660 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 661 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 662 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 663 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 664 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 665 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 666 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 667 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 668 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 669 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 670 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 671 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 672 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 673 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 674 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 675 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 676 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 677 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 678 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 679 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 680 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 681 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 682 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 683 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 684 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 685 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 686 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 687 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 688 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 689 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 690 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 691 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 692 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 693 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 694 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 695 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 696 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 697 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 698 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 699 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 700 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 701 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 702 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 703 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 704 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 705 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 706 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 707 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 708 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 709 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 710 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 711 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 712 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 713 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 714 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 715 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 716 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 717 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 718 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 719 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 720 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 721 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 722 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 723 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 724 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 725 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 726 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 727 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 728 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 729 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 730 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 731 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 732 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 733 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 734 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 735 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 736 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 737 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 738 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 739 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 740 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 741 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 742 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 743 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 744 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 745 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 746 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 747 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 748 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 749 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 750 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 751 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.35 |
| Metatranscriptomes | 0.24 |
| Isolates | 13.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.61 |
| Nodule | 10.96 |
| Rhizoplane | 6.62 |
| Rhizosphere | 65.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451855_0948618 | 3300041511 | Bacteria | 978 |
| 2 | JGI24735J21928_10029983 | 3300002067 | Bacteria | 1617 |
| 3 | JGI25406J46586_10000035 | 3300003203 | Bacteria | 61904 |
| 4 | JGI25153J46596_10007563 | 3300003215 | Bacteria | 5320 |
| 5 | JGI25153J46596_10024636 | 3300003215 | Bacteria | 2166 |
| 6 | JGI25160J50197_1001173 | 3300003354 | Bacteria | 13353 |
| 7 | JGI25160J50197_1001457 | 3300003354 | Bacteria | 11795 |
| 8 | JGI25160J50197_1014137 | 3300003354 | Bacteria | 2685 |
| 9 | JGI25404J52841_10008532 | 3300003659 | Bacteria | 2184 |
| 10 | JGI25404J52841_10014135 | 3300003659 | Bacteria | 1731 |
| 11 | JGI25404J52841_10016468 | 3300003659 | Bacteria | 1603 |
| 12 | Ga0055539_1008932 | 3300003752 | Bacteria | 1248 |
| 13 | Ga0055531_10006944 | 3300003794 | Bacteria | 6304 |
| 14 | Ga0055543_1025968 | 3300004625 | Bacteria | 1044 |
| 15 | Ga0065165_1001742 | 3300005262 | Bacteria | 21704 |
| 16 | Ga0070658_10293516 | 3300005327 | Bacteria | 1386 |
| 17 | Ga0070658_10462448 | 3300005327 | Bacteria | 1094 |
| 18 | Ga0070676_10228449 | 3300005328 | Bacteria | 1232 |
| 19 | Ga0070683_100034308 | 3300005329 | Bacteria | 4634 |
| 20 | Ga0070683_100340228 | 3300005329 | Bacteria | 1429 |
| 21 | Ga0070690_100036445 | 3300005330 | Bacteria | 3091 |
| 22 | Ga0070690_100670836 | 3300005330 | Bacteria | 794 |
| 23 | Ga0070670_100172802 | 3300005331 | Bacteria | 1874 |
| 24 | Ga0070677_10031918 | 3300005333 | Bacteria | 2017 |
| 25 | Ga0068869_100131178 | 3300005334 | Bacteria | 1926 |
| 26 | Ga0068869_100456569 | 3300005334 | Bacteria | 1060 |
| 27 | Ga0070666_10264592 | 3300005335 | Bacteria | 1220 |
| 28 | Ga0070666_10320567 | 3300005335 | Bacteria | 1105 |
| 29 | Ga0070666_10556194 | 3300005335 | Bacteria | 835 |
| 30 | Ga0070680_100005549 | 3300005336 | Bacteria | 9548 |
| 31 | Ga0070680_100034563 | 3300005336 | Bacteria | 4075 |
| 32 | Ga0070682_100011716 | 3300005337 | Bacteria | 5013 |
| 33 | Ga0070682_100233255 | 3300005337 | Bacteria | 1317 |
| 34 | Ga0070682_100329693 | 3300005337 | Bacteria | 1131 |
| 35 | Ga0070682_100695343 | 3300005337 | Bacteria | 815 |
| 36 | Ga0068868_100077925 | 3300005338 | Bacteria | 2652 |
| 37 | Ga0068868_100464899 | 3300005338 | Bacteria | 1103 |
| 38 | Ga0070660_100056116 | 3300005339 | Bacteria | 3046 |
| 39 | Ga0070660_100314333 | 3300005339 | Bacteria | 1286 |
| 40 | Ga0070689_100188427 | 3300005340 | Bacteria | 1679 |
| 41 | Ga0070689_100409463 | 3300005340 | Bacteria | 1147 |
| 42 | Ga0070691_10033220 | 3300005341 | Bacteria | 2427 |
| 43 | Ga0070661_100114171 | 3300005344 | Bacteria | 2019 |
| 44 | Ga0070661_100289824 | 3300005344 | Bacteria | 1272 |
| 45 | Ga0070661_100467894 | 3300005344 | Bacteria | 1005 |
| 46 | Ga0070692_10212208 | 3300005345 | Bacteria | 1140 |
| 47 | Ga0070668_100184790 | 3300005347 | Bacteria | 1704 |
| 48 | Ga0070668_100236941 | 3300005347 | Bacteria | 1510 |
| 49 | Ga0070669_100196404 | 3300005353 | Bacteria | 1585 |
| 50 | Ga0070671_100484613 | 3300005355 | Bacteria | 1063 |
| 51 | Ga0070671_100747776 | 3300005355 | Bacteria | 850 |
| 52 | Ga0070674_100032222 | 3300005356 | Bacteria | 3479 |
| 53 | Ga0070674_100676521 | 3300005356 | Bacteria | 880 |
| 54 | Ga0070674_101000433 | 3300005356 | Bacteria | 734 |
| 55 | Ga0070659_100426697 | 3300005366 | Bacteria | 1122 |
| 56 | Ga0070667_100331712 | 3300005367 | Bacteria | 1374 |
| 57 | Ga0070667_100357278 | 3300005367 | Bacteria | 1323 |
| 58 | Ga0070667_100425799 | 3300005367 | Bacteria | 1211 |
| 59 | Ga0070709_10000810 | 3300005434 | Bacteria | 17427 |
| 60 | Ga0070709_10008385 | 3300005434 | Bacteria | 5676 |
| 61 | Ga0070709_10157668 | 3300005434 | Bacteria | 1575 |
| 62 | Ga0070709_10177685 | 3300005434 | Bacteria | 1492 |
| 63 | Ga0070714_100005006 | 3300005435 | Bacteria | 10073 |
| 64 | Ga0070714_100171897 | 3300005435 | Bacteria | 1967 |
| 65 | Ga0070713_100046224 | 3300005436 | Bacteria | 3571 |
| 66 | Ga0070713_100084119 | 3300005436 | Bacteria | 2722 |
| 67 | Ga0070713_100084528 | 3300005436 | Bacteria | 2715 |
| 68 | Ga0070713_100094107 | 3300005436 | Bacteria | 2582 |
| 69 | Ga0070713_100872544 | 3300005436 | Bacteria | 865 |
| 70 | Ga0070710_10002889 | 3300005437 | Bacteria | 8186 |
| 71 | Ga0070710_10007376 | 3300005437 | Bacteria | 5323 |
| 72 | Ga0070710_10007545 | 3300005437 | Bacteria | 5268 |
| 73 | Ga0070710_10449983 | 3300005437 | Bacteria | 873 |
| 74 | Ga0070711_100002918 | 3300005439 | Bacteria | 9851 |
| 75 | Ga0070711_100002976 | 3300005439 | Bacteria | 9779 |
| 76 | Ga0070711_100004710 | 3300005439 | Bacteria | 8076 |
| 77 | Ga0070711_100008785 | 3300005439 | Bacteria | 6198 |
| 78 | Ga0070711_100028567 | 3300005439 | Bacteria | 3671 |
| 79 | Ga0070711_100143512 | 3300005439 | Bacteria | 1793 |
| 80 | Ga0070708_100149973 | 3300005445 | Bacteria | 2168 |
| 81 | Ga0070663_100031884 | 3300005455 | Bacteria | 3626 |
| 82 | Ga0070663_100061548 | 3300005455 | Bacteria | 2703 |
| 83 | Ga0070663_100113407 | 3300005455 | Bacteria | 2040 |
| 84 | Ga0070663_100199614 | 3300005455 | Bacteria | 1560 |
| 85 | Ga0070663_100699182 | 3300005455 | Bacteria | 861 |
| 86 | Ga0070678_100063626 | 3300005456 | Bacteria | 2730 |
| 87 | Ga0070678_100168236 | 3300005456 | Bacteria | 1782 |
| 88 | Ga0070678_100187400 | 3300005456 | Bacteria | 1698 |
| 89 | Ga0070678_100765087 | 3300005456 | Bacteria | 874 |
| 90 | Ga0070678_100988926 | 3300005456 | Bacteria | 773 |
| 91 | Ga0070662_100256122 | 3300005457 | Bacteria | 1409 |
| 92 | Ga0070662_100360018 | 3300005457 | Bacteria | 1193 |
| 93 | Ga0070662_100671075 | 3300005457 | Bacteria | 875 |
| 94 | Ga0070681_10002285 | 3300005458 | Bacteria | 17518 |
| 95 | Ga0070681_10027350 | 3300005458 | Bacteria | 5734 |
| 96 | Ga0070681_10178858 | 3300005458 | Bacteria | 2043 |
| 97 | Ga0070681_10220323 | 3300005458 | Bacteria | 1812 |
| 98 | Ga0070681_10235277 | 3300005458 | Bacteria | 1746 |
| 99 | Ga0070681_10308639 | 3300005458 | Bacteria | 1491 |
| 100 | Ga0068867_100139372 | 3300005459 | Bacteria | 1894 |
| 101 | Ga0070685_10442634 | 3300005466 | Bacteria | 909 |
| 102 | Ga0070706_100069425 | 3300005467 | Bacteria | 3258 |
| 103 | Ga0070706_100122952 | 3300005467 | Bacteria | 2420 |
| 104 | Ga0070707_100071401 | 3300005468 | Bacteria | 3345 |
| 105 | Ga0070707_100106166 | 3300005468 | Bacteria | 2724 |
| 106 | Ga0070698_100174586 | 3300005471 | Bacteria | 2089 |
| 107 | Ga0070698_100297164 | 3300005471 | Bacteria | 1546 |
| 108 | Ga0070679_100034939 | 3300005530 | Bacteria | 4985 |
| 109 | Ga0070679_100056755 | 3300005530 | Bacteria | 3902 |
| 110 | Ga0070679_100058880 | 3300005530 | Bacteria | 3828 |
| 111 | Ga0070679_100121327 | 3300005530 | Bacteria | 2598 |
| 112 | Ga0070679_100191388 | 3300005530 | Bacteria | 2014 |
| 113 | Ga0070679_100405665 | 3300005530 | Bacteria | 1309 |
| 114 | Ga0070684_100011247 | 3300005535 | Bacteria | 7125 |
| 115 | Ga0070684_100011751 | 3300005535 | Bacteria | 6984 |
| 116 | Ga0070684_100027605 | 3300005535 | Bacteria | 4793 |
| 117 | Ga0070684_100128956 | 3300005535 | Bacteria | 2280 |
| 118 | Ga0070684_101284920 | 3300005535 | Bacteria | 689 |
| 119 | Ga0070697_100024320 | 3300005536 | Bacteria | 4821 |
| 120 | Ga0070697_100089871 | 3300005536 | Bacteria | 2538 |
| 121 | Ga0070697_101120311 | 3300005536 | Bacteria | 701 |
| 122 | Ga0068853_100009591 | 3300005539 | Bacteria | 7801 |
| 123 | Ga0068853_100017708 | 3300005539 | Bacteria | 5879 |
| 124 | Ga0068853_100034597 | 3300005539 | Bacteria | 4289 |
| 125 | Ga0068853_100186788 | 3300005539 | Bacteria | 1881 |
| 126 | Ga0068853_100245522 | 3300005539 | Bacteria | 1642 |
| 127 | Ga0068853_100350793 | 3300005539 | Bacteria | 1372 |
| 128 | Ga0068853_100524138 | 3300005539 | Bacteria | 1120 |
| 129 | Ga0070672_100487069 | 3300005543 | Bacteria | 1065 |
| 130 | Ga0070686_100086954 | 3300005544 | Bacteria | 2083 |
| 131 | Ga0070696_100700415 | 3300005546 | Bacteria | 826 |
| 132 | Ga0070696_100756230 | 3300005546 | Bacteria | 797 |
| 133 | Ga0070693_100128317 | 3300005547 | Bacteria | 1582 |
| 134 | Ga0070693_100325869 | 3300005547 | Bacteria | 1044 |
| 135 | Ga0070693_100402171 | 3300005547 | Bacteria | 950 |
| 136 | Ga0070665_100031003 | 3300005548 | Bacteria | 5381 |
| 137 | Ga0070665_100083014 | 3300005548 | Bacteria | 3209 |
| 138 | Ga0070665_100102413 | 3300005548 | Bacteria | 2866 |
| 139 | Ga0070665_100216025 | 3300005548 | Bacteria | 1918 |
| 140 | Ga0070665_100224348 | 3300005548 | Bacteria | 1879 |
| 141 | Ga0070665_100335111 | 3300005548 | Bacteria | 1517 |
| 142 | Ga0070665_100388898 | 3300005548 | Bacteria | 1402 |
| 143 | Ga0070665_100460283 | 3300005548 | Bacteria | 1282 |
| 144 | Ga0070665_100485338 | 3300005548 | Bacteria | 1246 |
| 145 | Ga0070665_100753893 | 3300005548 | Bacteria | 986 |
| 146 | Ga0070704_100293424 | 3300005549 | Bacteria | 1352 |
| 147 | Ga0068855_100023046 | 3300005563 | Bacteria | 7462 |
| 148 | Ga0068855_100027258 | 3300005563 | Bacteria | 6836 |
| 149 | Ga0068855_100044620 | 3300005563 | Bacteria | 5246 |
| 150 | Ga0068855_100141266 | 3300005563 | Bacteria | 2745 |
| 151 | Ga0068855_100180688 | 3300005563 | Bacteria | 2385 |
| 152 | Ga0068855_100233511 | 3300005563 | Bacteria | 2058 |
| 153 | Ga0068855_100256727 | 3300005563 | Bacteria | 1948 |
| 154 | Ga0068855_100427734 | 3300005563 | Bacteria | 1447 |
| 155 | Ga0068855_100493357 | 3300005563 | Bacteria | 1332 |
| 156 | Ga0068855_100841552 | 3300005563 | Bacteria | 973 |
| 157 | Ga0070664_100128043 | 3300005564 | Bacteria | 2228 |
| 158 | Ga0070664_100387738 | 3300005564 | Bacteria | 1276 |
| 159 | Ga0068857_100012550 | 3300005577 | Bacteria | 7378 |
| 160 | Ga0068857_100033366 | 3300005577 | Bacteria | 4552 |
| 161 | Ga0068857_100153449 | 3300005577 | Bacteria | 2087 |
| 162 | Ga0068857_100742601 | 3300005577 | Bacteria | 934 |
| 163 | Ga0068854_100021565 | 3300005578 | Bacteria | 4373 |
| 164 | Ga0068854_100058673 | 3300005578 | Bacteria | 2779 |
| 165 | Ga0068854_100211001 | 3300005578 | Bacteria | 1531 |
| 166 | Ga0068856_100000061 | 3300005614 | Bacteria | 100823 |
| 167 | Ga0068856_100245950 | 3300005614 | Bacteria | 1804 |
| 168 | Ga0068856_100284390 | 3300005614 | Bacteria | 1671 |
| 169 | Ga0068856_100648445 | 3300005614 | Bacteria | 1076 |
| 170 | Ga0070702_100525273 | 3300005615 | Bacteria | 874 |
| 171 | Ga0070702_100642090 | 3300005615 | Bacteria | 802 |
| 172 | Ga0068852_100013998 | 3300005616 | Bacteria | 6155 |
| 173 | Ga0068852_100451996 | 3300005616 | Bacteria | 1272 |
| 174 | Ga0068859_100418873 | 3300005617 | Bacteria | 1435 |
| 175 | Ga0068866_10046590 | 3300005718 | Bacteria | 2181 |
| 176 | Ga0068866_10163656 | 3300005718 | Bacteria | 1300 |
| 177 | Ga0068861_100081648 | 3300005719 | Bacteria | 2531 |
| 178 | Ga0068861_100265523 | 3300005719 | Bacteria | 1471 |
| 179 | Ga0068861_100309414 | 3300005719 | Bacteria | 1372 |
| 180 | Ga0068851_10003737 | 3300005834 | Bacteria | 6801 |
| 181 | Ga0068851_10139663 | 3300005834 | Bacteria | 1317 |
| 182 | Ga0068870_10169831 | 3300005840 | Bacteria | 1301 |
| 183 | Ga0068863_100162223 | 3300005841 | Bacteria | 2142 |
| 184 | Ga0068863_100460714 | 3300005841 | Bacteria | 1248 |
| 185 | Ga0068858_100182400 | 3300005842 | Bacteria | 1982 |
| 186 | Ga0068858_100293328 | 3300005842 | Bacteria | 1551 |
| 187 | Ga0068858_100994562 | 3300005842 | Bacteria | 822 |
| 188 | Ga0068860_100032363 | 3300005843 | Bacteria | 5024 |
| 189 | Ga0068860_100089618 | 3300005843 | Bacteria | 2928 |
| 190 | Ga0068860_100286915 | 3300005843 | Bacteria | 1609 |
| 191 | Ga0068860_100689934 | 3300005843 | Bacteria | 1030 |
| 192 | Ga0068862_100137405 | 3300005844 | Bacteria | 2167 |
| 193 | Ga0081455_10011984 | 3300005937 | Bacteria | 8678 |
| 194 | Ga0081455_10019455 | 3300005937 | Bacteria | 6424 |
| 195 | Ga0081538_10090004 | 3300005981 | Bacteria | 1590 |
| 196 | Ga0081540_1005688 | 3300005983 | Bacteria | 9251 |
| 197 | Ga0081540_1012357 | 3300005983 | Bacteria | 5633 |
| 198 | Ga0081540_1020550 | 3300005983 | Bacteria | 3966 |
| 199 | Ga0081540_1038398 | 3300005983 | Bacteria | 2524 |
| 200 | Ga0081540_1041540 | 3300005983 | Bacteria | 2383 |
| 201 | Ga0081540_1236812 | 3300005983 | Bacteria | 642 |
| 202 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 203 | Ga0081539_10011797 | 3300005985 | Bacteria | 6841 |
| 204 | Ga0081539_10059698 | 3300005985 | Bacteria | 2098 |
| 205 | Ga0081539_10086233 | 3300005985 | Bacteria | 1635 |
| 206 | Ga0081539_10114384 | 3300005985 | Bacteria | 1352 |
| 207 | Ga0070717_10005909 | 3300006028 | Bacteria | 8961 |
| 208 | Ga0070717_10008342 | 3300006028 | Bacteria | 7735 |
| 209 | Ga0070717_10730537 | 3300006028 | Bacteria | 900 |
| 210 | Ga0075365_10015440 | 3300006038 | Bacteria | 4621 |
| 211 | Ga0075365_10260439 | 3300006038 | Bacteria | 1219 |
| 212 | Ga0075368_10048445 | 3300006042 | Bacteria | 1684 |
| 213 | Ga0075368_10212988 | 3300006042 | Bacteria | 819 |
| 214 | Ga0075363_100150679 | 3300006048 | Bacteria | 1313 |
| 215 | Ga0075364_10048183 | 3300006051 | Bacteria | 2776 |
| 216 | Ga0075364_10106118 | 3300006051 | Bacteria | 1872 |
| 217 | Ga0075364_10828374 | 3300006051 | Bacteria | 630 |
| 218 | Ga0070715_10000568 | 3300006163 | Bacteria | 9736 |
| 219 | Ga0070715_10197947 | 3300006163 | Bacteria | 1019 |
| 220 | Ga0070715_10236402 | 3300006163 | Bacteria | 948 |
| 221 | Ga0070716_100141523 | 3300006173 | Bacteria | 1535 |
| 222 | Ga0070716_100315252 | 3300006173 | Bacteria | 1094 |
| 223 | Ga0070712_100026768 | 3300006175 | Bacteria | 3846 |
| 224 | Ga0070712_100032532 | 3300006175 | Bacteria | 3523 |
| 225 | Ga0070712_100071104 | 3300006175 | Bacteria | 2489 |
| 226 | Ga0075367_10058993 | 3300006178 | Bacteria | 2284 |
| 227 | Ga0075367_10126363 | 3300006178 | Bacteria | 1578 |
| 228 | Ga0075367_10145551 | 3300006178 | Bacteria | 1469 |
| 229 | Ga0075369_10035186 | 3300006186 | Bacteria | 2128 |
| 230 | Ga0075369_10106822 | 3300006186 | Bacteria | 1259 |
| 231 | Ga0075366_10041918 | 3300006195 | Bacteria | 2710 |
| 232 | Ga0097621_100169434 | 3300006237 | Bacteria | 1881 |
| 233 | Ga0097621_100465146 | 3300006237 | Bacteria | 1141 |
| 234 | Ga0075370_10003171 | 3300006353 | Bacteria | 7779 |
| 235 | Ga0075370_10035923 | 3300006353 | Bacteria | 2782 |
| 236 | Ga0068871_100345538 | 3300006358 | Bacteria | 1315 |
| 237 | Ga0068871_101057844 | 3300006358 | Bacteria | 758 |
| 238 | Ga0075428_100575561 | 3300006844 | Bacteria | 1203 |
| 239 | Ga0075434_100393908 | 3300006871 | Bacteria | 1406 |
| 240 | Ga0075434_100489727 | 3300006871 | Bacteria | 1250 |
| 241 | Ga0075429_100247855 | 3300006880 | Bacteria | 1560 |
| 242 | Ga0068865_100082807 | 3300006881 | Bacteria | 2307 |
| 243 | Ga0075436_100157313 | 3300006914 | Bacteria | 1601 |
| 244 | Ga0097620_100418892 | 3300006931 | Bacteria | 1435 |
| 245 | Ga0099825_1021210 | 3300006941 | Bacteria | 4450 |
| 246 | Ga0099824_1016548 | 3300006942 | Bacteria | 6652 |
| 247 | Ga0099822_1000695 | 3300006943 | Bacteria | 34127 |
| 248 | Ga0099823_1098755 | 3300006944 | Bacteria | 911 |
| 249 | Ga0075435_100203894 | 3300007076 | Bacteria | 1676 |
| 250 | Ga0075435_100310875 | 3300007076 | Bacteria | 1348 |
| 251 | Ga0099794_10039678 | 3300007265 | Bacteria | 2236 |
| 252 | Ga0099795_10021632 | 3300007788 | Bacteria | 2112 |
| 253 | Ga0099795_10065331 | 3300007788 | Bacteria | 1360 |
| 254 | Ga0099795_10272534 | 3300007788 | Bacteria | 736 |
| 255 | Ga0105251_10124113 | 3300009011 | Bacteria | 1172 |
| 256 | Ga0105250_10025743 | 3300009092 | Bacteria | 2370 |
| 257 | Ga0105250_10081081 | 3300009092 | Bacteria | 1315 |
| 258 | Ga0105240_10004423 | 3300009093 | Bacteria | 21429 |
| 259 | Ga0105240_10011106 | 3300009093 | Bacteria | 12589 |
| 260 | Ga0105240_10017597 | 3300009093 | Bacteria | 9629 |
| 261 | Ga0105240_10086262 | 3300009093 | Bacteria | 3844 |
| 262 | Ga0105240_10219029 | 3300009093 | Bacteria | 2219 |
| 263 | Ga0105240_10235260 | 3300009093 | Bacteria | 2126 |
| 264 | Ga0105240_10508108 | 3300009093 | Bacteria | 1339 |
| 265 | Ga0105240_11519385 | 3300009093 | Bacteria | 702 |
| 266 | Ga0105240_11631574 | 3300009093 | Bacteria | 674 |
| 267 | Ga0111539_10080797 | 3300009094 | Bacteria | 3824 |
| 268 | Ga0105245_10045862 | 3300009098 | Bacteria | 3905 |
| 269 | Ga0105245_10399721 | 3300009098 | Bacteria | 1373 |
| 270 | Ga0105245_10741223 | 3300009098 | Bacteria | 1018 |
| 271 | Ga0105245_11459206 | 3300009098 | Bacteria | 735 |
| 272 | Ga0105247_10159523 | 3300009101 | Bacteria | 1492 |
| 273 | Ga0114129_11018744 | 3300009147 | Bacteria | 1042 |
| 274 | Ga0105243_10386222 | 3300009148 | Bacteria | 1296 |
| 275 | Ga0105243_10622347 | 3300009148 | Bacteria | 1042 |
| 276 | Ga0105241_10008232 | 3300009174 | Bacteria | 7678 |
| 277 | Ga0105241_10334582 | 3300009174 | Bacteria | 1310 |
| 278 | Ga0105241_10455595 | 3300009174 | Bacteria | 1132 |
| 279 | Ga0105242_10466984 | 3300009176 | Bacteria | 1193 |
| 280 | Ga0105248_10232607 | 3300009177 | Bacteria | 2075 |
| 281 | Ga0105248_10812101 | 3300009177 | Bacteria | 1056 |
| 282 | Ga0105237_10019836 | 3300009545 | Bacteria | 6941 |
| 283 | Ga0105237_10020040 | 3300009545 | Bacteria | 6903 |
| 284 | Ga0105237_10030505 | 3300009545 | Bacteria | 5474 |
| 285 | Ga0105237_10110248 | 3300009545 | Bacteria | 2744 |
| 286 | Ga0105237_10141995 | 3300009545 | Bacteria | 2395 |
| 287 | Ga0105237_10254343 | 3300009545 | Bacteria | 1759 |
| 288 | Ga0105237_10392316 | 3300009545 | Bacteria | 1393 |
| 289 | Ga0105237_10431998 | 3300009545 | Bacteria | 1323 |
| 290 | Ga0105238_10006212 | 3300009551 | Bacteria | 11866 |
| 291 | Ga0105238_10007238 | 3300009551 | Bacteria | 11108 |
| 292 | Ga0105238_10012675 | 3300009551 | Bacteria | 8509 |
| 293 | Ga0105238_10029408 | 3300009551 | Bacteria | 5597 |
| 294 | Ga0105238_10203515 | 3300009551 | Bacteria | 1956 |
| 295 | Ga0105238_10370407 | 3300009551 | Bacteria | 1423 |
| 296 | Ga0105238_10678044 | 3300009551 | Bacteria | 1042 |
| 297 | Ga0105238_10757503 | 3300009551 | Bacteria | 985 |
| 298 | Ga0105238_10804079 | 3300009551 | Bacteria | 956 |
| 299 | Ga0105238_11188024 | 3300009551 | Bacteria | 787 |
| 300 | Ga0099796_10103763 | 3300010159 | Bacteria | 1073 |
| 301 | Ga0105239_10032630 | 3300010375 | Bacteria | 5722 |
| 302 | Ga0105239_10051708 | 3300010375 | Bacteria | 4504 |
| 303 | Ga0105239_10151068 | 3300010375 | Bacteria | 2592 |
| 304 | Ga0105239_10153794 | 3300010375 | Bacteria | 2568 |
| 305 | Ga0105239_10206757 | 3300010375 | Bacteria | 2200 |
| 306 | Ga0105239_10265765 | 3300010375 | Bacteria | 1929 |
| 307 | Ga0105239_10825894 | 3300010375 | Bacteria | 1062 |
| 308 | Ga0105239_11362207 | 3300010375 | Bacteria | 819 |
| 309 | Ga0105246_10031447 | 3300011119 | Bacteria | 3513 |
| 310 | Ga0105246_10122187 | 3300011119 | Bacteria | 1931 |
| 311 | Ga0157373_10024137 | 3300013100 | Bacteria | 4407 |
| 312 | Ga0157370_10322105 | 3300013104 | Bacteria | 1426 |
| 313 | Ga0157369_10007836 | 3300013105 | Bacteria | 12285 |
| 314 | Ga0157369_10039809 | 3300013105 | Bacteria | 5136 |
| 315 | Ga0157369_10043556 | 3300013105 | Bacteria | 4891 |
| 316 | Ga0157369_10055070 | 3300013105 | Bacteria | 4294 |
| 317 | Ga0157374_10475791 | 3300013296 | Bacteria | 1252 |
| 318 | Ga0157378_10013138 | 3300013297 | Bacteria | 7245 |
| 319 | Ga0157378_10122248 | 3300013297 | Bacteria | 2401 |
| 320 | Ga0163162_10022099 | 3300013306 | Bacteria | 6268 |
| 321 | Ga0163162_10209857 | 3300013306 | Bacteria | 2077 |
| 322 | Ga0163162_10667111 | 3300013306 | Bacteria | 1163 |
| 323 | Ga0163162_10750687 | 3300013306 | Bacteria | 1095 |
| 324 | Ga0163162_11178574 | 3300013306 | Bacteria | 869 |
| 325 | Ga0163162_11567554 | 3300013306 | Bacteria | 751 |
| 326 | Ga0157372_10784165 | 3300013307 | Bacteria | 1108 |
| 327 | Ga0157375_10042178 | 3300013308 | Bacteria | 4414 |
| 328 | Ga0157375_10386696 | 3300013308 | Bacteria | 1566 |
| 329 | Ga0163163_10010549 | 3300014325 | Bacteria | 8315 |
| 330 | Ga0163163_10349047 | 3300014325 | Bacteria | 1535 |
| 331 | Ga0163163_10739064 | 3300014325 | Bacteria | 1047 |
| 332 | Ga0157377_10094238 | 3300014745 | Bacteria | 1773 |
| 333 | Ga0157379_10568341 | 3300014968 | Bacteria | 1056 |
| 334 | Ga0157379_11005979 | 3300014968 | Bacteria | 795 |
| 335 | Ga0157376_10046230 | 3300014969 | Bacteria | 3589 |
| 336 | Ga0182007_10090010 | 3300015262 | Bacteria | 1010 |
| 337 | Ga0163161_10022935 | 3300017792 | Bacteria | 4398 |
| 338 | Ga0206356_11553430 | 3300020070 | Bacteria | 960 |
| 339 | Ga0206354_10339519 | 3300020081 | Bacteria | 1001 |
| 340 | Ga0206354_10702824 | 3300020081 | Bacteria | 1202 |
| 341 | Ga0206353_11288135 | 3300020082 | Bacteria | 1228 |
| 342 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 343 | Ga0214542_1000442 | 3300021321 | Bacteria | 74244 |
| 344 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 345 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 346 | Ga0213873_10010838 | 3300021358 | Bacteria | 1933 |
| 347 | Ga0213873_10017755 | 3300021358 | Bacteria | 1627 |
| 348 | Ga0213872_10030742 | 3300021361 | Bacteria | 2461 |
| 349 | Ga0213876_10000775 | 3300021384 | Bacteria | 21906 |
| 350 | Ga0213876_10143696 | 3300021384 | Bacteria | 1269 |
| 351 | Ga0213875_10010732 | 3300021388 | Bacteria | 4582 |
| 352 | Ga0213871_10061395 | 3300021441 | Bacteria | 1047 |
| 353 | Ga0209563_100564 | 3300025230 | Bacteria | 12366 |
| 354 | Ga0207425_1005910 | 3300025245 | Bacteria | 3420 |
| 355 | Ga0209677_101733 | 3300025253 | Bacteria | 9087 |
| 356 | Ga0209148_1000634 | 3300025254 | Bacteria | 30929 |
| 357 | Ga0209148_1009582 | 3300025254 | Bacteria | 1877 |
| 358 | Ga0209233_1001540 | 3300025261 | Bacteria | 9034 |
| 359 | Ga0209233_1001832 | 3300025261 | Bacteria | 8163 |
| 360 | Ga0209233_1003049 | 3300025261 | Bacteria | 5958 |
| 361 | Ga0209233_1035287 | 3300025261 | Bacteria | 1131 |
| 362 | Ga0209455_1001165 | 3300025272 | Bacteria | 12657 |
| 363 | Ga0209455_1004508 | 3300025272 | Bacteria | 4530 |
| 364 | Ga0209455_1007057 | 3300025272 | Bacteria | 3225 |
| 365 | Ga0209564_1030527 | 3300025295 | Bacteria | 1668 |
| 366 | Ga0209564_1031500 | 3300025295 | Bacteria | 1618 |
| 367 | Ga0209564_1047122 | 3300025295 | Bacteria | 1090 |
| 368 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 369 | Ga0209758_1000359 | 3300025297 | Bacteria | 81559 |
| 370 | Ga0209758_1000365 | 3300025297 | Bacteria | 80645 |
| 371 | Ga0209758_1001403 | 3300025297 | Bacteria | 28564 |
| 372 | Ga0209758_1003658 | 3300025297 | Bacteria | 13702 |
| 373 | Ga0209758_1006509 | 3300025297 | Bacteria | 8344 |
| 374 | Ga0209758_1033786 | 3300025297 | Bacteria | 2047 |
| 375 | Ga0209256_1003144 | 3300025299 | Bacteria | 12021 |
| 376 | Ga0207426_1000325 | 3300025302 | Bacteria | 91634 |
| 377 | Ga0207426_1002810 | 3300025302 | Bacteria | 10425 |
| 378 | Ga0209257_1001035 | 3300025304 | Bacteria | 37155 |
| 379 | Ga0207697_10218823 | 3300025315 | Bacteria | 840 |
| 380 | Ga0207656_10025714 | 3300025321 | Bacteria | 2393 |
| 381 | Ga0207656_10028607 | 3300025321 | Bacteria | 2289 |
| 382 | Ga0207656_10043420 | 3300025321 | Bacteria | 1917 |
| 383 | Ga0207656_10045878 | 3300025321 | Bacteria | 1872 |
| 384 | Ga0207656_10186065 | 3300025321 | Bacteria | 999 |
| 385 | Ga0207696_1060228 | 3300025711 | Bacteria | 1069 |
| 386 | Ga0207653_10027681 | 3300025885 | Bacteria | 1819 |
| 387 | Ga0207682_10068394 | 3300025893 | Bacteria | 1501 |
| 388 | Ga0207692_10000486 | 3300025898 | Bacteria | 14016 |
| 389 | Ga0207692_10005589 | 3300025898 | Bacteria | 5046 |
| 390 | Ga0207692_10018110 | 3300025898 | Bacteria | 3155 |
| 391 | Ga0207692_10090520 | 3300025898 | Bacteria | 1658 |
| 392 | Ga0207642_10055780 | 3300025899 | Bacteria | 1809 |
| 393 | Ga0207710_10234281 | 3300025900 | Bacteria | 914 |
| 394 | Ga0207710_10288022 | 3300025900 | Bacteria | 828 |
| 395 | Ga0207710_10310381 | 3300025900 | Bacteria | 798 |
| 396 | Ga0207688_10024611 | 3300025901 | Bacteria | 3303 |
| 397 | Ga0207688_10045627 | 3300025901 | Bacteria | 2445 |
| 398 | Ga0207688_10170859 | 3300025901 | Bacteria | 1292 |
| 399 | Ga0207688_10794165 | 3300025901 | Bacteria | 600 |
| 400 | Ga0207647_10000275 | 3300025904 | Bacteria | 41765 |
| 401 | Ga0207647_10007934 | 3300025904 | Bacteria | 7633 |
| 402 | Ga0207647_10041382 | 3300025904 | Bacteria | 2897 |
| 403 | Ga0207685_10019520 | 3300025905 | Bacteria | 2235 |
| 404 | Ga0207699_10000499 | 3300025906 | Bacteria | 19629 |
| 405 | Ga0207699_10001305 | 3300025906 | Bacteria | 11850 |
| 406 | Ga0207699_10007131 | 3300025906 | Bacteria | 5450 |
| 407 | Ga0207699_10040172 | 3300025906 | Bacteria | 2694 |
| 408 | Ga0207699_10076192 | 3300025906 | Bacteria | 2065 |
| 409 | Ga0207699_10265824 | 3300025906 | Bacteria | 1187 |
| 410 | Ga0207645_10234358 | 3300025907 | Bacteria | 1212 |
| 411 | Ga0207645_10244686 | 3300025907 | Bacteria | 1185 |
| 412 | Ga0207645_10418000 | 3300025907 | Bacteria | 903 |
| 413 | Ga0207705_10053050 | 3300025909 | Bacteria | 2920 |
| 414 | Ga0207705_10070090 | 3300025909 | Bacteria | 2540 |
| 415 | Ga0207705_10339336 | 3300025909 | Bacteria | 1156 |
| 416 | Ga0207705_10396451 | 3300025909 | Bacteria | 1067 |
| 417 | Ga0207684_10125074 | 3300025910 | Bacteria | 2206 |
| 418 | Ga0207684_10744917 | 3300025910 | Bacteria | 831 |
| 419 | Ga0207654_10000663 | 3300025911 | Bacteria | 19478 |
| 420 | Ga0207707_10000404 | 3300025912 | Bacteria | 45123 |
| 421 | Ga0207707_10007729 | 3300025912 | Bacteria | 9359 |
| 422 | Ga0207707_10055228 | 3300025912 | Bacteria | 3455 |
| 423 | Ga0207707_10069843 | 3300025912 | Bacteria | 3061 |
| 424 | Ga0207707_10164068 | 3300025912 | Bacteria | 1942 |
| 425 | Ga0207707_10211901 | 3300025912 | Bacteria | 1687 |
| 426 | Ga0207707_10235212 | 3300025912 | Bacteria | 1594 |
| 427 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 428 | Ga0207695_10004288 | 3300025913 | Bacteria | 19554 |
| 429 | Ga0207695_10048296 | 3300025913 | Bacteria | 4496 |
| 430 | Ga0207695_10471020 | 3300025913 | Bacteria | 1139 |
| 431 | Ga0207695_10513561 | 3300025913 | Bacteria | 1080 |
| 432 | Ga0207695_10665733 | 3300025913 | Bacteria | 922 |
| 433 | Ga0207695_11024758 | 3300025913 | Bacteria | 705 |
| 434 | Ga0207671_10014923 | 3300025914 | Bacteria | 6109 |
| 435 | Ga0207671_10066737 | 3300025914 | Bacteria | 2678 |
| 436 | Ga0207671_10128834 | 3300025914 | Bacteria | 1941 |
| 437 | Ga0207671_10128984 | 3300025914 | Bacteria | 1940 |
| 438 | Ga0207671_10203188 | 3300025914 | Bacteria | 1548 |
| 439 | Ga0207671_10269985 | 3300025914 | Bacteria | 1340 |
| 440 | Ga0207671_10477548 | 3300025914 | Bacteria | 994 |
| 441 | Ga0207693_10000910 | 3300025915 | Bacteria | 26538 |
| 442 | Ga0207693_10002290 | 3300025915 | Bacteria | 16654 |
| 443 | Ga0207693_10024119 | 3300025915 | Bacteria | 4829 |
| 444 | Ga0207693_10060338 | 3300025915 | Bacteria | 2971 |
| 445 | Ga0207663_10001370 | 3300025916 | Bacteria | 11307 |
| 446 | Ga0207663_10009928 | 3300025916 | Bacteria | 5040 |
| 447 | Ga0207663_10020578 | 3300025916 | Bacteria | 3739 |
| 448 | Ga0207663_10025476 | 3300025916 | Bacteria | 3420 |
| 449 | Ga0207663_10037072 | 3300025916 | Bacteria | 2937 |
| 450 | Ga0207660_10002854 | 3300025917 | Bacteria | 11294 |
| 451 | Ga0207660_10132699 | 3300025917 | Bacteria | 1897 |
| 452 | Ga0207660_10326034 | 3300025917 | Bacteria | 1227 |
| 453 | Ga0207662_10260798 | 3300025918 | Bacteria | 1141 |
| 454 | Ga0207657_10004122 | 3300025919 | Bacteria | 15431 |
| 455 | Ga0207657_10011792 | 3300025919 | Bacteria | 8654 |
| 456 | Ga0207657_10181406 | 3300025919 | Bacteria | 1702 |
| 457 | Ga0207657_10571574 | 3300025919 | Bacteria | 883 |
| 458 | Ga0207649_10387663 | 3300025920 | Bacteria | 1043 |
| 459 | Ga0207649_10664844 | 3300025920 | Bacteria | 806 |
| 460 | Ga0207652_10002796 | 3300025921 | Bacteria | 14640 |
| 461 | Ga0207652_10124913 | 3300025921 | Bacteria | 2291 |
| 462 | Ga0207652_10149158 | 3300025921 | Bacteria | 2093 |
| 463 | Ga0207652_10222844 | 3300025921 | Bacteria | 1699 |
| 464 | Ga0207652_10330675 | 3300025921 | Bacteria | 1376 |
| 465 | Ga0207652_10609912 | 3300025921 | Bacteria | 978 |
| 466 | Ga0207646_10045245 | 3300025922 | Bacteria | 3951 |
| 467 | Ga0207646_10096344 | 3300025922 | Bacteria | 2651 |
| 468 | Ga0207681_10093496 | 3300025923 | Bacteria | 2152 |
| 469 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 470 | Ga0207694_10017719 | 3300025924 | Bacteria | 5382 |
| 471 | Ga0207694_10065611 | 3300025924 | Bacteria | 2830 |
| 472 | Ga0207694_10109370 | 3300025924 | Bacteria | 2198 |
| 473 | Ga0207694_10119443 | 3300025924 | Bacteria | 2104 |
| 474 | Ga0207694_10285474 | 3300025924 | Bacteria | 1356 |
| 475 | Ga0207694_10459403 | 3300025924 | Bacteria | 1064 |
| 476 | Ga0207650_10172373 | 3300025925 | Bacteria | 1720 |
| 477 | Ga0207650_10392577 | 3300025925 | Bacteria | 1147 |
| 478 | Ga0207659_10718091 | 3300025926 | Bacteria | 856 |
| 479 | Ga0207659_11199850 | 3300025926 | Bacteria | 652 |
| 480 | Ga0207687_10024493 | 3300025927 | Bacteria | 4033 |
| 481 | Ga0207687_10077219 | 3300025927 | Bacteria | 2395 |
| 482 | Ga0207687_10496028 | 3300025927 | Bacteria | 1019 |
| 483 | Ga0207687_10854247 | 3300025927 | Bacteria | 778 |
| 484 | Ga0207700_10006007 | 3300025928 | Bacteria | 7306 |
| 485 | Ga0207700_10023644 | 3300025928 | Bacteria | 4243 |
| 486 | Ga0207700_10086417 | 3300025928 | Bacteria | 2464 |
| 487 | Ga0207700_10149910 | 3300025928 | Bacteria | 1926 |
| 488 | Ga0207700_10378349 | 3300025928 | Bacteria | 1238 |
| 489 | Ga0207700_10393825 | 3300025928 | Bacteria | 1213 |
| 490 | Ga0207664_10005310 | 3300025929 | Bacteria | 8799 |
| 491 | Ga0207664_10007756 | 3300025929 | Bacteria | 7449 |
| 492 | Ga0207664_10169433 | 3300025929 | Bacteria | 1868 |
| 493 | Ga0207664_10471417 | 3300025929 | Bacteria | 1122 |
| 494 | Ga0207644_10168650 | 3300025931 | Bacteria | 1707 |
| 495 | Ga0207644_10266123 | 3300025931 | Bacteria | 1372 |
| 496 | Ga0207644_10338670 | 3300025931 | Bacteria | 1219 |
| 497 | Ga0207644_10392419 | 3300025931 | Bacteria | 1133 |
| 498 | Ga0207690_10096337 | 3300025932 | Bacteria | 2104 |
| 499 | Ga0207690_10324240 | 3300025932 | Bacteria | 1211 |
| 500 | Ga0207690_10461304 | 3300025932 | Bacteria | 1022 |
| 501 | Ga0207690_10552483 | 3300025932 | Bacteria | 936 |
| 502 | Ga0207706_10067622 | 3300025933 | Bacteria | 3144 |
| 503 | Ga0207706_10088708 | 3300025933 | Bacteria | 2719 |
| 504 | Ga0207706_10224350 | 3300025933 | Bacteria | 1645 |
| 505 | Ga0207709_10039609 | 3300025935 | Bacteria | 2816 |
| 506 | Ga0207709_10281481 | 3300025935 | Bacteria | 1228 |
| 507 | Ga0207709_10286525 | 3300025935 | Bacteria | 1219 |
| 508 | Ga0207670_10333469 | 3300025936 | Bacteria | 1197 |
| 509 | Ga0207669_10135195 | 3300025937 | Bacteria | 1701 |
| 510 | Ga0207704_10740118 | 3300025938 | Bacteria | 817 |
| 511 | Ga0207665_10000537 | 3300025939 | Bacteria | 25552 |
| 512 | Ga0207665_10145621 | 3300025939 | Bacteria | 1693 |
| 513 | Ga0207665_10188231 | 3300025939 | Bacteria | 1498 |
| 514 | Ga0207691_10042590 | 3300025940 | Bacteria | 4185 |
| 515 | Ga0207691_10263628 | 3300025940 | Bacteria | 1485 |
| 516 | Ga0207691_10331060 | 3300025940 | Bacteria | 1305 |
| 517 | Ga0207711_10152478 | 3300025941 | Bacteria | 2086 |
| 518 | Ga0207689_10146169 | 3300025942 | Bacteria | 1948 |
| 519 | Ga0207689_10348705 | 3300025942 | Bacteria | 1230 |
| 520 | Ga0207661_10001004 | 3300025944 | Bacteria | 18641 |
| 521 | Ga0207661_10004383 | 3300025944 | Bacteria | 9894 |
| 522 | Ga0207661_10077568 | 3300025944 | Bacteria | 2732 |
| 523 | Ga0207661_10318299 | 3300025944 | Bacteria | 1398 |
| 524 | Ga0207661_10490430 | 3300025944 | Bacteria | 1122 |
| 525 | Ga0207679_10173346 | 3300025945 | Bacteria | 1778 |
| 526 | Ga0207679_10194164 | 3300025945 | Bacteria | 1690 |
| 527 | Ga0207667_10006495 | 3300025949 | Bacteria | 14146 |
| 528 | Ga0207667_10034099 | 3300025949 | Bacteria | 5469 |
| 529 | Ga0207667_10149610 | 3300025949 | Bacteria | 2403 |
| 530 | Ga0207667_10233551 | 3300025949 | Bacteria | 1883 |
| 531 | Ga0207667_10248165 | 3300025949 | Bacteria | 1821 |
| 532 | Ga0207667_10260496 | 3300025949 | Bacteria | 1773 |
| 533 | Ga0207667_10554443 | 3300025949 | Bacteria | 1162 |
| 534 | Ga0207667_10611798 | 3300025949 | Bacteria | 1098 |
| 535 | Ga0207667_10719815 | 3300025949 | Bacteria | 999 |
| 536 | Ga0207667_10896992 | 3300025949 | Bacteria | 878 |
| 537 | Ga0207651_10233566 | 3300025960 | Bacteria | 1495 |
| 538 | Ga0207712_10005172 | 3300025961 | Bacteria | 8256 |
| 539 | Ga0207712_10555027 | 3300025961 | Bacteria | 988 |
| 540 | Ga0207668_10003910 | 3300025972 | Bacteria | 8783 |
| 541 | Ga0207668_10196775 | 3300025972 | Bacteria | 1602 |
| 542 | Ga0207668_10371253 | 3300025972 | Bacteria | 1201 |
| 543 | Ga0207640_10042961 | 3300025981 | Bacteria | 2885 |
| 544 | Ga0207640_10057584 | 3300025981 | Bacteria | 2557 |
| 545 | Ga0207640_10102749 | 3300025981 | Bacteria | 2008 |
| 546 | Ga0207658_10570988 | 3300025986 | Bacteria | 1014 |
| 547 | Ga0207677_10088394 | 3300026023 | Bacteria | 2246 |
| 548 | Ga0207677_10412545 | 3300026023 | Bacteria | 1148 |
| 549 | Ga0207703_11409709 | 3300026035 | Bacteria | 670 |
| 550 | Ga0207639_10033198 | 3300026041 | Bacteria | 3805 |
| 551 | Ga0207639_10040580 | 3300026041 | Bacteria | 3475 |
| 552 | Ga0207639_10058323 | 3300026041 | Bacteria | 2969 |
| 553 | Ga0207639_10090237 | 3300026041 | Bacteria | 2451 |
| 554 | Ga0207639_10187279 | 3300026041 | Bacteria | 1765 |
| 555 | Ga0207639_10194833 | 3300026041 | Bacteria | 1733 |
| 556 | Ga0207639_10221978 | 3300026041 | Bacteria | 1633 |
| 557 | Ga0207639_10274406 | 3300026041 | Bacteria | 1480 |
| 558 | Ga0207639_10447803 | 3300026041 | Bacteria | 1172 |
| 559 | Ga0207639_10582269 | 3300026041 | Bacteria | 1030 |
| 560 | Ga0207678_10023667 | 3300026067 | Bacteria | 5371 |
| 561 | Ga0207678_10036614 | 3300026067 | Bacteria | 4272 |
| 562 | Ga0207678_10098432 | 3300026067 | Bacteria | 2499 |
| 563 | Ga0207678_10353911 | 3300026067 | Bacteria | 1266 |
| 564 | Ga0207708_10037515 | 3300026075 | Bacteria | 3692 |
| 565 | Ga0207708_10337010 | 3300026075 | Bacteria | 1234 |
| 566 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 567 | Ga0207702_10000243 | 3300026078 | Bacteria | 63718 |
| 568 | Ga0207702_10030183 | 3300026078 | Bacteria | 4517 |
| 569 | Ga0207641_10156631 | 3300026088 | Bacteria | 2067 |
| 570 | Ga0207648_10091537 | 3300026089 | Bacteria | 2658 |
| 571 | Ga0207648_11267658 | 3300026089 | Bacteria | 692 |
| 572 | Ga0207676_10171257 | 3300026095 | Bacteria | 1892 |
| 573 | Ga0207676_10442007 | 3300026095 | Bacteria | 1224 |
| 574 | Ga0207676_10810633 | 3300026095 | Bacteria | 914 |
| 575 | Ga0207674_10005330 | 3300026116 | Bacteria | 15297 |
| 576 | Ga0207674_10011961 | 3300026116 | Bacteria | 9726 |
| 577 | Ga0207674_10020302 | 3300026116 | Bacteria | 7181 |
| 578 | Ga0207674_10117084 | 3300026116 | Bacteria | 2635 |
| 579 | Ga0207674_10248958 | 3300026116 | Bacteria | 1724 |
| 580 | Ga0207675_100043556 | 3300026118 | Bacteria | 4191 |
| 581 | Ga0207675_100046342 | 3300026118 | Bacteria | 4061 |
| 582 | Ga0207683_10012010 | 3300026121 | Bacteria | 7394 |
| 583 | Ga0207683_10080862 | 3300026121 | Bacteria | 2883 |
| 584 | Ga0207683_10437489 | 3300026121 | Bacteria | 1205 |
| 585 | Ga0207683_10462637 | 3300026121 | Bacteria | 1170 |
| 586 | Ga0207683_10471942 | 3300026121 | Bacteria | 1158 |
| 587 | Ga0207698_10156633 | 3300026142 | Bacteria | 1986 |
| 588 | Ga0207698_10190493 | 3300026142 | Bacteria | 1826 |
| 589 | Ga0207698_11103392 | 3300026142 | Bacteria | 806 |
| 590 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 591 | Ga0209389_1000412 | 3300027296 | Bacteria | 25422 |
| 592 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 593 | Ga0209589_1004063 | 3300027357 | Bacteria | 25422 |
| 594 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 595 | Ga0209489_100090 | 3300027361 | Bacteria | 123931 |
| 596 | Ga0209489_119775 | 3300027361 | Bacteria | 2131 |
| 597 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 598 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 599 | Ga0209588_1016793 | 3300027671 | Bacteria | 2264 |
| 600 | Ga0207428_10244784 | 3300027907 | Bacteria | 1339 |
| 601 | Ga0207428_10292826 | 3300027907 | Bacteria | 1206 |
| 602 | Ga0268266_10044745 | 3300028379 | Bacteria | 3784 |
| 603 | Ga0268266_10050744 | 3300028379 | Bacteria | 3559 |
| 604 | Ga0268266_10243604 | 3300028379 | Bacteria | 1660 |
| 605 | Ga0268266_10253152 | 3300028379 | Bacteria | 1629 |
| 606 | Ga0268266_10320016 | 3300028379 | Bacteria | 1451 |
| 607 | Ga0268266_10330611 | 3300028379 | Bacteria | 1428 |
| 608 | Ga0268266_10351395 | 3300028379 | Bacteria | 1385 |
| 609 | Ga0268266_10385470 | 3300028379 | Bacteria | 1323 |
| 610 | Ga0268266_10904473 | 3300028379 | Bacteria | 853 |
| 611 | Ga0268264_10106915 | 3300028381 | Bacteria | 2443 |
| 612 | Ga0268264_10278126 | 3300028381 | Bacteria | 1566 |
| 613 | Ga0268264_10341982 | 3300028381 | Bacteria | 1422 |
| 614 | Ga0265337_1017079 | 3300028556 | Bacteria | 2334 |
| 615 | Ga0265334_10032099 | 3300028573 | Bacteria | 2096 |
| 616 | Ga0265323_10011044 | 3300028653 | Bacteria | 3651 |
| 617 | Ga0265322_10031734 | 3300028654 | Bacteria | 1508 |
| 618 | Ga0265336_10000588 | 3300028666 | Bacteria | 20447 |
| 619 | Ga0307517_10003796 | 3300028786 | Bacteria | 23466 |
| 620 | Ga0307517_10160945 | 3300028786 | Bacteria | 1507 |
| 621 | Ga0307515_10058433 | 3300028794 | Bacteria | 5554 |
| 622 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 623 | Ga0265330_10019276 | 3300031235 | Bacteria | 3128 |
| 624 | Ga0265332_10031873 | 3300031238 | Bacteria | 2298 |
| 625 | Ga0265332_10074016 | 3300031238 | Bacteria | 1449 |
| 626 | Ga0265328_10118669 | 3300031239 | Bacteria | 985 |
| 627 | Ga0265325_10013731 | 3300031241 | Bacteria | 4599 |
| 628 | Ga0265339_10128371 | 3300031249 | Bacteria | 1298 |
| 629 | Ga0265331_10118693 | 3300031250 | Bacteria | 1210 |
| 630 | Ga0265331_10135429 | 3300031250 | Bacteria | 1122 |
| 631 | Ga0265316_10319702 | 3300031344 | Bacteria | 1128 |
| 632 | Ga0307513_10111708 | 3300031456 | Bacteria | 2725 |
| 633 | Ga0307509_10421645 | 3300031507 | Bacteria | 1035 |
| 634 | Ga0307408_100285562 | 3300031548 | Bacteria | 1376 |
| 635 | Ga0307408_100561213 | 3300031548 | Bacteria | 1009 |
| 636 | Ga0307508_10230354 | 3300031616 | Bacteria | 1451 |
| 637 | Ga0307508_10567355 | 3300031616 | Bacteria | 734 |
| 638 | Ga0265342_10007820 | 3300031712 | Bacteria | 7768 |
| 639 | Ga0265342_10242887 | 3300031712 | Bacteria | 963 |
| 640 | Ga0307516_10257684 | 3300031730 | Bacteria | 1436 |
| 641 | Ga0307516_10477010 | 3300031730 | Bacteria | 902 |
| 642 | Ga0307405_10263065 | 3300031731 | Bacteria | 1290 |
| 643 | Ga0307413_10028764 | 3300031824 | Bacteria | 3101 |
| 644 | Ga0307406_10253636 | 3300031901 | Bacteria | 1327 |
| 645 | Ga0307407_10367260 | 3300031903 | Bacteria | 1024 |
| 646 | Ga0307412_10983757 | 3300031911 | Bacteria | 744 |
| 647 | Ga0307409_100157459 | 3300031995 | Bacteria | 1981 |
| 648 | Ga0307409_101519026 | 3300031995 | Bacteria | 697 |
| 649 | Ga0307416_100226312 | 3300032002 | Bacteria | 1799 |
| 650 | Ga0307416_100420186 | 3300032002 | Bacteria | 1381 |
| 651 | Ga0307416_101440719 | 3300032002 | Bacteria | 795 |
| 652 | Ga0307414_10598804 | 3300032004 | Bacteria | 988 |
| 653 | Ga0307414_10987920 | 3300032004 | Bacteria | 774 |
| 654 | Ga0307411_10486095 | 3300032005 | Bacteria | 1041 |
| 655 | Ga0307415_100177603 | 3300032126 | Bacteria | 1667 |
| 656 | Ga0307415_100259957 | 3300032126 | Bacteria | 1416 |
| 657 | Ga0307415_100286298 | 3300032126 | Bacteria | 1358 |
| 658 | Ga0307510_10052013 | 3300033180 | Bacteria | 4325 |
| 659 | Ga0307510_10068711 | 3300033180 | Bacteria | 3553 |
| 660 | Ga0307510_10114422 | 3300033180 | Bacteria | 2427 |
| 661 | Ga0307510_10192143 | 3300033180 | Bacteria | 1588 |
| 662 | Ga0307510_10467721 | 3300033180 | Bacteria | 702 |
| 663 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 664 | Ga0316214_1017221 | 3300033545 | Bacteria | 1001 |
| 665 | Ga0373926_0017720 | 3300035083 | Bacteria | 2446 |
| 666 | Ga0373926_0084438 | 3300035083 | Bacteria | 1177 |
| 667 | Ga0373928_0035706 | 3300035084 | Bacteria | 1121 |
| 668 | Ga0373929_0053446 | 3300035085 | Bacteria | 929 |
| 669 | Ga0373934_0018056 | 3300035086 | Bacteria | 2698 |
| 670 | Ga0373934_0064143 | 3300035086 | Bacteria | 1466 |
| 671 | Ga0373944_0070313 | 3300035089 | Bacteria | 1139 |
| 672 | Ga0373923_0037190 | 3300035111 | Bacteria | 1990 |
| 673 | Ga0373923_0265666 | 3300035111 | Bacteria | 806 |
| 674 | Ga0373936_0007741 | 3300035113 | Bacteria | 4034 |
| 675 | Ga0373936_0105156 | 3300035113 | Bacteria | 1194 |
| 676 | Ga0373936_0106712 | 3300035113 | Bacteria | 1186 |
| 677 | Ga0373936_0180382 | 3300035113 | Bacteria | 926 |
| 678 | Ga0373941_0204678 | 3300035115 | Bacteria | 752 |
| 679 | Ga0373945_0002360 | 3300035116 | Bacteria | 5926 |
| 680 | Ga0373945_0012335 | 3300035116 | Bacteria | 2837 |
| 681 | Ga0373954_0008972 | 3300035118 | Bacteria | 4401 |
| 682 | Ga0373954_0039614 | 3300035118 | Bacteria | 2194 |
| 683 | Ga0373954_0073713 | 3300035118 | Bacteria | 1624 |
| 684 | Ga0373956_0004542 | 3300035119 | Bacteria | 5541 |
| 685 | Ga0373957_0040002 | 3300035120 | Bacteria | 1761 |
| 686 | Ga0373957_0072525 | 3300035120 | Bacteria | 1349 |
| 687 | Ga0373943_0009393 | 3300035170 | Bacteria | 4382 |
| 688 | Ga0373943_0235169 | 3300035170 | Bacteria | 1025 |
| 689 | Ga0373946_0004971 | 3300035171 | Bacteria | 4788 |
| 690 | Ga0373946_0008733 | 3300035171 | Bacteria | 3719 |
| 691 | Ga0373946_0034447 | 3300035171 | Bacteria | 2045 |
| 692 | Ga0373946_0430168 | 3300035171 | Bacteria | 670 |
| 693 | Ga0373955_0046774 | 3300035172 | Bacteria | 2340 |
| 694 | Ga0373955_0209330 | 3300035172 | Bacteria | 1162 |
| 695 | Ga0373955_0387254 | 3300035172 | Bacteria | 849 |
| 696 | Ga0373931_0004151 | 3300035691 | Bacteria | 6579 |
| 697 | Ga0373931_0414842 | 3300035691 | Bacteria | 855 |
| 698 | Ga0373931_0486722 | 3300035691 | Bacteria | 794 |
| 699 | Ga0373935_0004402 | 3300035692 | Bacteria | 8271 |
| 700 | Ga0373927_0001631 | 3300035695 | Bacteria | 16813 |
| 701 | Ga0373927_0001997 | 3300035695 | Bacteria | 15042 |
| 702 | Ga0373927_0028844 | 3300035695 | Bacteria | 3619 |
| 703 | Ga0373927_0042183 | 3300035695 | Bacteria | 2957 |
| 704 | Ga0373927_0068557 | 3300035695 | Bacteria | 2295 |
| 705 | Ga0373927_0114326 | 3300035695 | Bacteria | 1759 |
| 706 | Ga0373927_0630595 | 3300035695 | Bacteria | 708 |
| 707 | Ga0373933_0000062 | 3300035724 | Bacteria | 64991 |
| 708 | Ga0373933_0011368 | 3300035724 | Bacteria | 4903 |
| 709 | Ga0373933_0061784 | 3300035724 | Bacteria | 2261 |
| 710 | Ga0373933_0371836 | 3300035724 | Bacteria | 930 |
| 711 | Ga0373947_0021736 | 3300035725 | Bacteria | 3716 |
| 712 | Ga0373947_0035316 | 3300035725 | Bacteria | 2959 |
| 713 | Ga0373947_0038420 | 3300035725 | Bacteria | 2844 |
| 714 | Ga0373937_0006410 | 3300036401 | Bacteria | 10154 |
| 715 | Ga0373937_0043209 | 3300036401 | Bacteria | 4112 |
| 716 | Ga0373937_0083596 | 3300036401 | Bacteria | 2953 |
| 717 | Ga0373937_0114593 | 3300036401 | Bacteria | 2509 |
| 718 | Ga0373937_0121290 | 3300036401 | Bacteria | 2436 |
| 719 | Ga0373937_0133228 | 3300036401 | Bacteria | 2322 |
| 720 | Ga0373937_0770753 | 3300036401 | Bacteria | 909 |
| 721 | Ga0373925_0009647 | 3300037068 | Bacteria | 7032 |
| 722 | Ga0373925_0030941 | 3300037068 | Bacteria | 3931 |
| 723 | Ga0373925_0039820 | 3300037068 | Bacteria | 3478 |
| 724 | Ga0373925_0063389 | 3300037068 | Bacteria | 2781 |
| 725 | Ga0373925_0310363 | 3300037068 | Bacteria | 1275 |
| 726 | Ga0395899_0062545 | 3300037312 | Bacteria | 2741 |
| 727 | Ga0395900_0001786 | 3300037418 | Bacteria | 24649 |
| 728 | Ga0395900_0213132 | 3300037418 | Bacteria | 1950 |
| 729 | Ga0395900_0256586 | 3300037418 | Bacteria | 1747 |
| 730 | Ga0395900_0610524 | 3300037418 | Bacteria | 1030 |
| 731 | Ga0395900_1380931 | 3300037418 | Bacteria | 618 |
| 732 | Ga0395898_0042027 | 3300037466 | Bacteria | 4512 |
| 733 | Ga0395898_0042817 | 3300037466 | Bacteria | 4465 |
| 734 | Ga0395898_0167294 | 3300037466 | Bacteria | 2102 |
| 735 | Ga0395898_0200953 | 3300037466 | Bacteria | 1903 |
| 736 | Ga0395898_0246436 | 3300037466 | Bacteria | 1704 |
| 737 | Ga0395898_0467759 | 3300037466 | Bacteria | 1200 |
| 738 | Ga0395905_0057784 | 3300037471 | Bacteria | 3628 |
| 739 | Ga0395905_0817315 | 3300037471 | Bacteria | 835 |
| 740 | Ga0395905_0951001 | 3300037471 | Bacteria | 762 |
| 741 | Ga0436364_0209550 | 3300037853 | Bacteria | 7718 |
| 742 | Ga0436364_0509683 | 3300037853 | Bacteria | 659 |
| 743 | Ga0436364_0527791 | 3300037853 | Bacteria | 1189 |
| 744 | Ga0395901_0102502 | 3300038443 | Bacteria | 3004 |
| 745 | Ga0395901_0118999 | 3300038443 | Bacteria | 2775 |
| 746 | Ga0395901_0165792 | 3300038443 | Bacteria | 2320 |
| 747 | Ga0395901_0964608 | 3300038443 | Bacteria | 830 |
| 748 | Ga0436365_0034335 | 3300039437 | Bacteria | 4704 |
| 749 | Ga0436365_0100384 | 3300039437 | Bacteria | 14382 |
| 750 | Ga0436365_0547824 | 3300039437 | Bacteria | 821 |
| 751 | Ga0436365_0993729 | 3300039437 | Bacteria | 2830 |
| 752 | Ga0436365_1427844 | 3300039437 | Bacteria | 953 |
| 753 | Ga0436365_1635710 | 3300039437 | Bacteria | 9235 |
| 754 | Ga0436365_1797109 | 3300039437 | Bacteria | 1295 |
| 755 | Ga0436360_0065834 | 3300039438 | Bacteria | 2362 |
| 756 | Ga0436360_0204027 | 3300039438 | Bacteria | 1177 |
| 757 | Ga0436360_1203390 | 3300039438 | Bacteria | 1220 |
| 758 | Ga0436361_0157270 | 3300039447 | Bacteria | 1105 |
| 759 | Ga0436361_0547832 | 3300039447 | Bacteria | 2104 |
| 760 | Ga0436363_0087654 | 3300039450 | Bacteria | 1365 |
| 761 | Ga0436363_0180460 | 3300039450 | Bacteria | 1057 |
| 762 | Ga0436363_0702233 | 3300039450 | Bacteria | 896 |
| 763 | Ga0436363_0821156 | 3300039450 | Bacteria | 1329 |
| 764 | Ga0436363_1084799 | 3300039450 | Bacteria | 770 |
| 765 | Ga0436362_0127225 | 3300039453 | Bacteria | 2100 |
| 766 | Ga0439465_0053981 | 3300041413 | Bacteria | 1321 |
| 767 | Ga0451797_1414737 | 3300041453 | Bacteria | 1348 |
| 768 | Ga0451800_1468852 | 3300041459 | Bacteria | 957 |
| 769 | Ga0451802_1696236 | 3300041460 | Bacteria | 844 |
| 770 | Ga0451853_2132757 | 3300041512 | Bacteria | 1300 |
| 771 | Ga0439455_0122989 | 3300042012 | Bacteria | 728 |
| 772 | Ga0439434_0068670 | 3300042435 | Bacteria | 1114 |
| 773 | Ga0439464_0035714 | 3300042439 | Bacteria | 1405 |
| 774 | Ga0466969_0014467 | 3300044656 | Bacteria | 4149 |
| 775 | Ga0466972_0000200 | 3300044658 | Bacteria | 43953 |
| 776 | Ga0466972_0020843 | 3300044658 | Bacteria | 3272 |
| 777 | Ga0466965_0133336 | 3300044683 | Bacteria | 1289 |
| 778 | Ga0466965_0175398 | 3300044683 | Bacteria | 1129 |
| 779 | Ga0466966_0021082 | 3300044684 | Bacteria | 4280 |
| 780 | Ga0466966_0163185 | 3300044684 | Bacteria | 1356 |
| 781 | Ga0466966_0170242 | 3300044684 | Bacteria | 1324 |
| 782 | Ga0466961_0000102 | 3300044693 | Bacteria | 55644 |
| 783 | Ga0466961_0105547 | 3300044693 | Bacteria | 1774 |
| 784 | Ga0466963_0020583 | 3300044694 | Bacteria | 4149 |
| 785 | Ga0466963_0039622 | 3300044694 | Bacteria | 3086 |
| 786 | Ga0466963_0045767 | 3300044694 | Bacteria | 2883 |
| 787 | Ga0466964_0035767 | 3300044706 | Bacteria | 1988 |
| 788 | Ga0466964_0059951 | 3300044706 | Bacteria | 1582 |
| 789 | Ga0466968_0240442 | 3300044735 | Bacteria | 857 |
| 790 | Ga0466970_0038748 | 3300044765 | Bacteria | 2529 |
| 791 | Ga0466970_0066345 | 3300044765 | Bacteria | 1937 |
| 792 | Ga0466970_0281871 | 3300044765 | Bacteria | 935 |
| 793 | Ga0466957_0019778 | 3300044842 | Bacteria | 3963 |
| 794 | Ga0466957_0113952 | 3300044842 | Bacteria | 1717 |
| 795 | Ga0466957_0132237 | 3300044842 | Bacteria | 1600 |
| 796 | Ga0466960_0028887 | 3300044901 | Bacteria | 2540 |
| 797 | Ga0466959_0018133 | 3300045049 | Bacteria | 5165 |
| 798 | Ga0466959_0039738 | 3300045049 | Bacteria | 3477 |
| 799 | Ga0466959_0081703 | 3300045049 | Bacteria | 2329 |
| 800 | Ga0466967_0273467 | 3300045976 | Bacteria | 1619 |
| 801 | Ga0466967_0437576 | 3300045976 | Bacteria | 1277 |
| 802 | Ga0466967_0607532 | 3300045976 | Bacteria | 1080 |
| 803 | Ga0495617_172680 | 3300046452 | Bacteria | 682 |
| 804 | Ga0495627_040068 | 3300046453 | Bacteria | 1444 |
| 805 | Ga0495592_0055751 | 3300046454 | Bacteria | 2922 |
| 806 | Ga0495592_0089446 | 3300046454 | Bacteria | 2211 |
| 807 | Ga0495592_0100554 | 3300046454 | Bacteria | 2061 |
| 808 | Ga0495592_0101010 | 3300046454 | Bacteria | 2056 |
| 809 | Ga0495592_0162625 | 3300046454 | Bacteria | 1534 |
| 810 | Ga0495592_0395241 | 3300046454 | Bacteria | 877 |
| 811 | Ga0495603_0013972 | 3300046455 | Bacteria | 4856 |
| 812 | Ga0495603_0019223 | 3300046455 | Bacteria | 4136 |
| 813 | Ga0495603_0074038 | 3300046455 | Bacteria | 2000 |
| 814 | Ga0495603_0085847 | 3300046455 | Bacteria | 1842 |
| 815 | Ga0495603_0090905 | 3300046455 | Bacteria | 1785 |
| 816 | Ga0495603_0102791 | 3300046455 | Bacteria | 1668 |
| 817 | Ga0495603_0119401 | 3300046455 | Bacteria | 1537 |
| 818 | Ga0495603_0136023 | 3300046455 | Bacteria | 1430 |
| 819 | Ga0495590_0142451 | 3300046457 | Bacteria | 866 |
| 820 | Ga0495591_046075 | 3300046458 | Bacteria | 1213 |
| 821 | Ga0495629_0002784 | 3300046459 | Bacteria | 13349 |
| 822 | Ga0495629_0005268 | 3300046459 | Bacteria | 9666 |
| 823 | Ga0495629_0027516 | 3300046459 | Bacteria | 4037 |
| 824 | Ga0495629_0198786 | 3300046459 | Bacteria | 1386 |
| 825 | Ga0495629_0258872 | 3300046459 | Bacteria | 1196 |
| 826 | Ga0495629_0671710 | 3300046459 | Bacteria | 689 |
| 827 | Ga0495638_0078309 | 3300046460 | Bacteria | 2011 |
| 828 | Ga0495638_0233614 | 3300046460 | Bacteria | 1021 |
| 829 | Ga0495638_0273366 | 3300046460 | Bacteria | 921 |
| 830 | Ga0495641_0015327 | 3300046461 | Bacteria | 4098 |
| 831 | Ga0495641_0272156 | 3300046461 | Bacteria | 762 |
| 832 | Ga0495651_0013038 | 3300046462 | Bacteria | 6421 |
| 833 | Ga0495651_0148477 | 3300046462 | Bacteria | 1692 |
| 834 | Ga0495653_0138447 | 3300046463 | Bacteria | 1715 |
| 835 | Ga0495653_0301727 | 3300046463 | Bacteria | 1044 |
| 836 | Ga0495653_0329901 | 3300046463 | Bacteria | 986 |
| 837 | Ga0495650_0148050 | 3300046471 | Bacteria | 845 |
| 838 | Ga0495580_0005616 | 3300046472 | Bacteria | 10331 |
| 839 | Ga0495580_0008118 | 3300046472 | Bacteria | 8372 |
| 840 | Ga0495580_0341078 | 3300046472 | Bacteria | 1016 |
| 841 | Ga0495582_0000228 | 3300046473 | Bacteria | 31086 |
| 842 | Ga0495582_0008256 | 3300046473 | Bacteria | 5747 |
| 843 | Ga0495582_0042985 | 3300046473 | Bacteria | 2488 |
| 844 | Ga0495582_0116869 | 3300046473 | Bacteria | 1501 |
| 845 | Ga0495605_0098350 | 3300046474 | Bacteria | 1348 |
| 846 | Ga0495639_0000261 | 3300046475 | Bacteria | 26039 |
| 847 | Ga0495639_0001957 | 3300046475 | Bacteria | 9135 |
| 848 | Ga0495639_0069279 | 3300046475 | Bacteria | 1627 |
| 849 | Ga0495662_0001403 | 3300046476 | Bacteria | 11950 |
| 850 | Ga0495664_0009409 | 3300046477 | Bacteria | 5467 |
| 851 | Ga0495664_0009558 | 3300046477 | Bacteria | 5426 |
| 852 | Ga0495664_0035329 | 3300046477 | Bacteria | 2942 |
| 853 | Ga0495664_0056486 | 3300046477 | Bacteria | 2335 |
| 854 | Ga0495664_0068578 | 3300046477 | Bacteria | 2116 |
| 855 | Ga0495664_0191208 | 3300046477 | Bacteria | 1241 |
| 856 | Ga0495664_0632531 | 3300046477 | Bacteria | 635 |
| 857 | Ga0495584_0385235 | 3300046491 | Bacteria | 712 |
| 858 | Ga0495585_0091102 | 3300046492 | Bacteria | 1642 |
| 859 | Ga0495585_0138573 | 3300046492 | Bacteria | 1275 |
| 860 | Ga0495585_0164326 | 3300046492 | Bacteria | 1150 |
| 861 | Ga0495585_0393394 | 3300046492 | Bacteria | 668 |
| 862 | Ga0495594_0010814 | 3300046499 | Bacteria | 4741 |
| 863 | Ga0495594_0110971 | 3300046499 | Bacteria | 1547 |
| 864 | Ga0495594_0281843 | 3300046499 | Bacteria | 947 |
| 865 | Ga0495594_0563621 | 3300046499 | Bacteria | 646 |
| 866 | Ga0495583_0129293 | 3300046506 | Bacteria | 1058 |
| 867 | Ga0495606_0006063 | 3300046507 | Bacteria | 11295 |
| 868 | Ga0495606_0069689 | 3300046507 | Bacteria | 2220 |
| 869 | Ga0495606_0120178 | 3300046507 | Bacteria | 1573 |
| 870 | Ga0495606_0206132 | 3300046507 | Bacteria | 1117 |
| 871 | Ga0495606_0230739 | 3300046507 | Bacteria | 1037 |
| 872 | Ga0495606_0308169 | 3300046507 | Bacteria | 855 |
| 873 | Ga0495608_0005477 | 3300046511 | Bacteria | 9073 |
| 874 | Ga0495608_0097536 | 3300046511 | Bacteria | 1897 |
| 875 | Ga0495608_0113242 | 3300046511 | Bacteria | 1743 |
| 876 | Ga0495610_0124266 | 3300046512 | Bacteria | 1127 |
| 877 | Ga0495610_0149908 | 3300046512 | Bacteria | 996 |
| 878 | Ga0495618_0234893 | 3300046514 | Bacteria | 1154 |
| 879 | Ga0495620_0090521 | 3300046515 | Bacteria | 1228 |
| 880 | Ga0495620_0208687 | 3300046515 | Bacteria | 750 |
| 881 | Ga0495628_0011105 | 3300046516 | Bacteria | 7623 |
| 882 | Ga0495628_0018283 | 3300046516 | Bacteria | 5811 |
| 883 | Ga0495628_0033468 | 3300046516 | Bacteria | 4142 |
| 884 | Ga0495628_0149640 | 3300046516 | Bacteria | 1779 |
| 885 | Ga0495628_0664461 | 3300046516 | Bacteria | 739 |
| 886 | Ga0495630_0001773 | 3300046517 | Bacteria | 15102 |
| 887 | Ga0495630_0095136 | 3300046517 | Bacteria | 2252 |
| 888 | Ga0495630_0154542 | 3300046517 | Bacteria | 1746 |
| 889 | Ga0495631_0070805 | 3300046518 | Bacteria | 1507 |
| 890 | Ga0495632_0078062 | 3300046519 | Bacteria | 1582 |
| 891 | Ga0495632_0190862 | 3300046519 | Bacteria | 936 |
| 892 | Ga0495643_0010662 | 3300046522 | Bacteria | 5646 |
| 893 | Ga0495644_0057469 | 3300046523 | Bacteria | 1462 |
| 894 | Ga0495644_0065945 | 3300046523 | Bacteria | 1360 |
| 895 | Ga0495648_0003345 | 3300046524 | Bacteria | 14142 |
| 896 | Ga0495648_0094787 | 3300046524 | Bacteria | 1662 |
| 897 | Ga0495666_0016454 | 3300046526 | Bacteria | 3683 |
| 898 | Ga0495666_0265347 | 3300046526 | Bacteria | 780 |
| 899 | Ga0495666_0347335 | 3300046526 | Bacteria | 669 |
| 900 | Ga0495652_0019969 | 3300046529 | Bacteria | 5958 |
| 901 | Ga0495652_0023429 | 3300046529 | Bacteria | 5471 |
| 902 | Ga0495652_0038900 | 3300046529 | Bacteria | 4116 |
| 903 | Ga0495652_0072785 | 3300046529 | Bacteria | 2863 |
| 904 | Ga0495652_0174916 | 3300046529 | Bacteria | 1653 |
| 905 | Ga0495652_0241049 | 3300046529 | Bacteria | 1345 |
| 906 | Ga0495665_0023590 | 3300046531 | Bacteria | 3304 |
| 907 | Ga0495665_0034460 | 3300046531 | Bacteria | 2707 |
| 908 | Ga0495665_0107188 | 3300046531 | Bacteria | 1466 |
| 909 | Ga0495665_0432133 | 3300046531 | Bacteria | 666 |
| 910 | Ga0495640_0007929 | 3300046533 | Bacteria | 8351 |
| 911 | Ga0495640_0041460 | 3300046533 | Bacteria | 3217 |
| 912 | Ga0495640_0092347 | 3300046533 | Bacteria | 1996 |
| 913 | Ga0495586_0615133 | 3300046535 | Bacteria | 628 |
| 914 | Ga0495587_0089452 | 3300046536 | Bacteria | 1779 |
| 915 | Ga0495587_0127645 | 3300046536 | Bacteria | 1454 |
| 916 | Ga0495587_0177033 | 3300046536 | Bacteria | 1210 |
| 917 | Ga0495587_0199967 | 3300046536 | Bacteria | 1130 |
| 918 | Ga0495587_0214108 | 3300046536 | Bacteria | 1087 |
| 919 | Ga0495587_0401774 | 3300046536 | Bacteria | 761 |
| 920 | Ga0495598_0066844 | 3300046537 | Bacteria | 1122 |
| 921 | Ga0495609_0206913 | 3300046538 | Bacteria | 818 |
| 922 | Ga0495609_0265847 | 3300046538 | Bacteria | 704 |
| 923 | Ga0495645_0090596 | 3300046543 | Bacteria | 2185 |
| 924 | Ga0495645_0285680 | 3300046543 | Bacteria | 1083 |
| 925 | Ga0495622_0006509 | 3300046557 | Bacteria | 5418 |
| 926 | Ga0495622_0096796 | 3300046557 | Bacteria | 1354 |
| 927 | Ga0495622_0097866 | 3300046557 | Bacteria | 1346 |
| 928 | Ga0495622_0222236 | 3300046557 | Bacteria | 836 |
| 929 | Ga0495622_0293355 | 3300046557 | Bacteria | 709 |
| 930 | Ga0495667_0005052 | 3300046559 | Bacteria | 8922 |
| 931 | Ga0495667_0019161 | 3300046559 | Bacteria | 4618 |
| 932 | Ga0495667_0093728 | 3300046559 | Bacteria | 1944 |
| 933 | Ga0495667_0195344 | 3300046559 | Bacteria | 1296 |
| 934 | Ga0495656_0020894 | 3300046615 | Bacteria | 2543 |
| 935 | Ga0495656_0071487 | 3300046615 | Bacteria | 1542 |
| 936 | Ga0495668_0021645 | 3300046616 | Bacteria | 3684 |
| 937 | Ga0495668_0099916 | 3300046616 | Bacteria | 1587 |
| 938 | Ga0495668_0232952 | 3300046616 | Bacteria | 1008 |
| 939 | Ga0495668_0277403 | 3300046616 | Bacteria | 918 |
| 940 | Ga0495634_0003006 | 3300046642 | Bacteria | 13727 |
| 941 | Ga0495634_0181976 | 3300046642 | Bacteria | 1315 |
| 942 | Ga0495634_0279121 | 3300046642 | Bacteria | 1015 |
| 943 | Ga0495634_0439895 | 3300046642 | Bacteria | 770 |
| 944 | Ga0495625_0114346 | 3300046660 | Bacteria | 1842 |
| 945 | Ga0495635_0002773 | 3300046663 | Bacteria | 12015 |
| 946 | Ga0495635_0062187 | 3300046663 | Bacteria | 2563 |
| 947 | Ga0495635_0109045 | 3300046663 | Bacteria | 1891 |
| 948 | Ga0495635_0142774 | 3300046663 | Bacteria | 1630 |
| 949 | Ga0495635_0282736 | 3300046663 | Bacteria | 1114 |
| 950 | Ga0495635_0344870 | 3300046663 | Bacteria | 994 |
| 951 | Ga0495661_0114807 | 3300046665 | Bacteria | 1496 |
| 952 | Ga0495661_0165886 | 3300046665 | Bacteria | 1182 |
| 953 | Ga0495588_0007973 | 3300046674 | Bacteria | 4841 |
| 954 | Ga0495588_0062517 | 3300046674 | Bacteria | 1930 |
| 955 | Ga0495588_0138678 | 3300046674 | Bacteria | 1284 |
| 956 | Ga0495588_0192079 | 3300046674 | Bacteria | 1078 |
| 957 | Ga0495588_0396481 | 3300046674 | Bacteria | 724 |
| 958 | Ga0495657_0004948 | 3300046675 | Bacteria | 10591 |
| 959 | Ga0495657_0050289 | 3300046675 | Bacteria | 2802 |
| 960 | Ga0495657_0270942 | 3300046675 | Bacteria | 1018 |
| 961 | Ga0495657_0455890 | 3300046675 | Bacteria | 748 |
| 962 | Ga0495599_0015121 | 3300046678 | Bacteria | 4784 |
| 963 | Ga0495599_0062978 | 3300046678 | Bacteria | 2317 |
| 964 | Ga0495599_0149633 | 3300046678 | Bacteria | 1446 |
| 965 | Ga0495599_0214701 | 3300046678 | Bacteria | 1178 |
| 966 | Ga0495599_0538361 | 3300046678 | Bacteria | 685 |
| 967 | Ga0495623_0001850 | 3300046679 | Bacteria | 14179 |
| 968 | Ga0495623_0009506 | 3300046679 | Bacteria | 6313 |
| 969 | Ga0495623_0073594 | 3300046679 | Bacteria | 2124 |
| 970 | Ga0495623_0139747 | 3300046679 | Bacteria | 1442 |
| 971 | Ga0495646_0031462 | 3300046680 | Bacteria | 3306 |
| 972 | Ga0495646_0065534 | 3300046680 | Bacteria | 2151 |
| 973 | Ga0495646_0134112 | 3300046680 | Bacteria | 1391 |
| 974 | Ga0495647_0362006 | 3300046681 | Bacteria | 662 |
| 975 | Ga0495658_0000941 | 3300046683 | Bacteria | 15502 |
| 976 | Ga0495658_0121326 | 3300046683 | Bacteria | 1581 |
| 977 | Ga0495658_0220495 | 3300046683 | Bacteria | 1187 |
| 978 | Ga0495669_0133638 | 3300046684 | Bacteria | 1169 |
| 979 | Ga0495669_0198135 | 3300046684 | Bacteria | 959 |
| 980 | Ga0495669_0377313 | 3300046684 | Bacteria | 686 |
| 981 | Ga0495613_0019620 | 3300046689 | Bacteria | 5040 |
| 982 | Ga0495613_0023147 | 3300046689 | Bacteria | 4629 |
| 983 | Ga0495613_0023549 | 3300046689 | Bacteria | 4588 |
| 984 | Ga0495613_0466653 | 3300046689 | Bacteria | 854 |
| 985 | Ga0495624_0001434 | 3300046690 | Bacteria | 18540 |
| 986 | Ga0495624_0025490 | 3300046690 | Bacteria | 3881 |
| 987 | Ga0495670_0053226 | 3300046691 | Bacteria | 2027 |
| 988 | Ga0495671_0207474 | 3300046692 | Bacteria | 950 |
| 989 | Ga0495589_0148538 | 3300046794 | Bacteria | 1120 |
| 990 | Ga0495600_0000403 | 3300046809 | Bacteria | 22314 |
| 991 | Ga0495600_0035078 | 3300046809 | Bacteria | 3257 |
| 992 | Ga0495600_0083126 | 3300046809 | Bacteria | 2090 |
| 993 | Ga0495600_0267614 | 3300046809 | Bacteria | 1084 |
| 994 | Ga0495600_0356871 | 3300046809 | Bacteria | 915 |
| 995 | Ga0495600_0430627 | 3300046809 | Bacteria | 818 |
| 996 | Ga0495581_0001142 | 3300047315 | Bacteria | 14513 |
| 997 | Ga0495581_0023132 | 3300047315 | Bacteria | 3601 |
| 998 | Ga0495604_0008342 | 3300047317 | Bacteria | 8194 |
| 999 | Ga0495604_0046930 | 3300047317 | Bacteria | 3366 |
| 1000 | Ga0495604_0108519 | 3300047317 | Bacteria | 2027 |
| 1001 | Ga0495604_0271175 | 3300047317 | Bacteria | 1150 |
| 1002 | Ga0495604_0343934 | 3300047317 | Bacteria | 992 |
| 1003 | Ga0495604_0541541 | 3300047317 | Bacteria | 751 |
| 1004 | Ga0495674_0001977 | 3300047319 | Bacteria | 20157 |
| 1005 | Ga0495674_0005615 | 3300047319 | Bacteria | 12027 |
| 1006 | Ga0495674_0068279 | 3300047319 | Bacteria | 3077 |
| 1007 | Ga0495674_0076517 | 3300047319 | Bacteria | 2878 |
| 1008 | Ga0495674_0122252 | 3300047319 | Bacteria | 2198 |
| 1009 | Ga0495672_0103080 | 3300047320 | Bacteria | 1544 |
| 1010 | Ga0495672_0274691 | 3300047320 | Bacteria | 808 |
| 1011 | Ga0495676_0054558 | 3300047321 | Bacteria | 3176 |
| 1012 | Ga0495676_0087817 | 3300047321 | Bacteria | 2335 |
| 1013 | Ga0495676_0129745 | 3300047321 | Bacteria | 1822 |
| 1014 | Ga0495676_0185185 | 3300047321 | Bacteria | 1456 |
| 1015 | Ga0495676_0353094 | 3300047321 | Bacteria | 982 |
| 1016 | Ga0495680_0088283 | 3300047322 | Bacteria | 2330 |
| 1017 | Ga0495680_0133516 | 3300047322 | Bacteria | 1821 |
| 1018 | Ga0495680_0276179 | 3300047322 | Bacteria | 1185 |
| 1019 | Ga0495687_045232 | 3300047443 | Bacteria | 1907 |
| 1020 | Ga0495675_0009532 | 3300047444 | Bacteria | 6049 |
| 1021 | Ga0495675_0059657 | 3300047444 | Bacteria | 2419 |
| 1022 | Ga0495675_0124324 | 3300047444 | Bacteria | 1605 |
| 1023 | Ga0495675_0159215 | 3300047444 | Bacteria | 1391 |
| 1024 | Ga0495675_0230386 | 3300047444 | Bacteria | 1118 |
| 1025 | Ga0495675_0326294 | 3300047444 | Bacteria | 907 |
| 1026 | Ga0495675_0449968 | 3300047444 | Bacteria | 745 |
| 1027 | Ga0495677_0172982 | 3300047445 | Bacteria | 836 |
| 1028 | Ga0495679_026015 | 3300047446 | Bacteria | 1949 |
| 1029 | Ga0495673_0055161 | 3300047469 | Bacteria | 1725 |
| 1030 | Ga0495673_0076703 | 3300047469 | Bacteria | 1393 |
| 1031 | Ga0495673_0207860 | 3300047469 | Bacteria | 729 |
| 1032 | Ga0495681_0282418 | 3300047470 | Bacteria | 647 |
| 1033 | Ga0495684_0008846 | 3300047471 | Bacteria | 7781 |
| 1034 | Ga0495684_0028651 | 3300047471 | Bacteria | 4275 |
| 1035 | Ga0495684_0030022 | 3300047471 | Bacteria | 4174 |
| 1036 | Ga0495684_0392709 | 3300047471 | Bacteria | 976 |
| 1037 | Ga0495686_0021356 | 3300047472 | Bacteria | 4301 |
| 1038 | Ga0495593_0002128 | 3300047673 | Bacteria | 11830 |
| 1039 | Ga0495593_0023793 | 3300047673 | Bacteria | 3400 |
| 1040 | Ga0495593_0100701 | 3300047673 | Bacteria | 1481 |
| 1041 | Ga0495593_0123546 | 3300047673 | Bacteria | 1316 |
| 1042 | Ga0495593_0232773 | 3300047673 | Bacteria | 924 |
| 1043 | Ga0495602_0010811 | 3300048088 | Bacteria | 9458 |
| 1044 | Ga0495602_0043422 | 3300048088 | Bacteria | 4087 |
| 1045 | Ga0495602_0311354 | 3300048088 | Bacteria | 1149 |
| 1046 | Ga0495602_0432035 | 3300048088 | Bacteria | 933 |
| 1047 | Ga0495614_0069220 | 3300048089 | Bacteria | 1520 |
| 1048 | Ga0495614_0313806 | 3300048089 | Bacteria | 726 |
| 1049 | Ga0495615_0044726 | 3300048090 | Bacteria | 1119 |
| 1050 | Ga0495615_0149566 | 3300048090 | Bacteria | 694 |
| 1051 | Ga0496100_0002855 | 3300048903 | Bacteria | 8848 |
| 1052 | Ga0496100_0042265 | 3300048903 | Bacteria | 2911 |
| 1053 | Ga0496100_0047384 | 3300048903 | Bacteria | 2769 |
| 1054 | Ga0496100_0490661 | 3300048903 | Bacteria | 945 |
| 1055 | Ga0496100_0663951 | 3300048903 | Bacteria | 812 |
| 1056 | Ga0496101_0015791 | 3300048904 | Bacteria | 5095 |
| 1057 | Ga0496101_0096186 | 3300048904 | Bacteria | 2210 |
| 1058 | Ga0496101_0289790 | 3300048904 | Bacteria | 1281 |
| 1059 | Ga0496101_0425035 | 3300048904 | Bacteria | 1047 |
| 1060 | Ga0496101_0453714 | 3300048904 | Bacteria | 1011 |
| 1061 | Ga0496101_0917624 | 3300048904 | Bacteria | 689 |
| 1062 | Ga0496102_0005213 | 3300048905 | Bacteria | 11035 |
| 1063 | Ga0496102_0007639 | 3300048905 | Bacteria | 9235 |
| 1064 | Ga0496102_0069908 | 3300048905 | Bacteria | 3223 |
| 1065 | Ga0496102_0200857 | 3300048905 | Bacteria | 1879 |
| 1066 | Ga0496102_0241013 | 3300048905 | Bacteria | 1705 |
| 1067 | Ga0496102_0476522 | 3300048905 | Bacteria | 1169 |
| 1068 | Ga0496102_0525328 | 3300048905 | Bacteria | 1106 |
| 1069 | Ga0496102_0858996 | 3300048905 | Bacteria | 829 |
| 1070 | Ga0496103_0085102 | 3300048906 | Bacteria | 1992 |
| 1071 | Ga0496103_0180736 | 3300048906 | Bacteria | 1356 |
| 1072 | Ga0496103_0182102 | 3300048906 | Bacteria | 1350 |
| 1073 | Ga0496103_0337615 | 3300048906 | Bacteria | 969 |
| 1074 | Ga0496104_0000430 | 3300048907 | Bacteria | 36402 |
| 1075 | Ga0496104_0007365 | 3300048907 | Bacteria | 9722 |
| 1076 | Ga0496104_0053657 | 3300048907 | Bacteria | 3809 |
| 1077 | Ga0496104_0093136 | 3300048907 | Bacteria | 2881 |
| 1078 | Ga0496104_0314308 | 3300048907 | Bacteria | 1479 |
| 1079 | Ga0496104_0355902 | 3300048907 | Bacteria | 1376 |
| 1080 | Ga0496104_0397372 | 3300048907 | Bacteria | 1291 |
| 1081 | Ga0496104_0675097 | 3300048907 | Bacteria | 941 |
| 1082 | Ga0496105_0006356 | 3300048908 | Bacteria | 9075 |
| 1083 | Ga0496105_0008068 | 3300048908 | Bacteria | 8184 |
| 1084 | Ga0496105_0210849 | 3300048908 | Bacteria | 1583 |
| 1085 | Ga0496105_0362012 | 3300048908 | Bacteria | 1157 |
| 1086 | Ga0496105_0510909 | 3300048908 | Bacteria | 942 |
| 1087 | Ga0496106_0005044 | 3300048909 | Bacteria | 9768 |
| 1088 | Ga0496106_0010296 | 3300048909 | Bacteria | 6914 |
| 1089 | Ga0496106_0039463 | 3300048909 | Bacteria | 3536 |
| 1090 | Ga0496106_0082059 | 3300048909 | Bacteria | 2477 |
| 1091 | Ga0496106_0164852 | 3300048909 | Bacteria | 1754 |
| 1092 | Ga0496106_0203985 | 3300048909 | Bacteria | 1574 |
| 1093 | Ga0496106_0301645 | 3300048909 | Bacteria | 1285 |
| 1094 | Ga0496106_0555811 | 3300048909 | Bacteria | 921 |
| 1095 | Ga0496107_0007983 | 3300048910 | Bacteria | 7305 |
| 1096 | Ga0496107_0078980 | 3300048910 | Bacteria | 2398 |
| 1097 | Ga0496107_0185280 | 3300048910 | Bacteria | 1546 |
| 1098 | Ga0496107_0195536 | 3300048910 | Bacteria | 1503 |
| 1099 | Ga0496107_0235672 | 3300048910 | Bacteria | 1362 |
| 1100 | Ga0496107_0345446 | 3300048910 | Bacteria | 1107 |
| 1101 | Ga0496107_0397923 | 3300048910 | Bacteria | 1024 |
| 1102 | Ga0496108_0000415 | 3300048911 | Bacteria | 34866 |
| 1103 | Ga0496108_0013533 | 3300048911 | Bacteria | 6659 |
| 1104 | Ga0496108_0016710 | 3300048911 | Bacteria | 5994 |
| 1105 | Ga0496108_0020318 | 3300048911 | Bacteria | 5458 |
| 1106 | Ga0496108_0229718 | 3300048911 | Bacteria | 1613 |
| 1107 | Ga0496108_0505210 | 3300048911 | Bacteria | 1056 |
| 1108 | Ga0496109_0000759 | 3300048912 | Bacteria | 26784 |
| 1109 | Ga0496109_0083699 | 3300048912 | Bacteria | 2942 |
| 1110 | Ga0496109_0151320 | 3300048912 | Bacteria | 2172 |
| 1111 | Ga0496109_0182669 | 3300048912 | Bacteria | 1970 |
| 1112 | Ga0496109_0518079 | 3300048912 | Bacteria | 1125 |
| 1113 | Ga0496109_0701566 | 3300048912 | Bacteria | 949 |
| 1114 | Ga0496109_0716436 | 3300048912 | Bacteria | 938 |
| 1115 | Ga0496109_0918292 | 3300048912 | Bacteria | 813 |
| 1116 | Ga0496110_0011522 | 3300048913 | Bacteria | 7242 |
| 1117 | Ga0496110_0104597 | 3300048913 | Bacteria | 2540 |
| 1118 | Ga0496110_0116790 | 3300048913 | Bacteria | 2402 |
| 1119 | Ga0496110_0132410 | 3300048913 | Bacteria | 2252 |
| 1120 | Ga0496110_0743667 | 3300048913 | Bacteria | 883 |
| 1121 | Ga0496111_0021000 | 3300048914 | Bacteria | 4553 |
| 1122 | Ga0496111_0040423 | 3300048914 | Bacteria | 3345 |
| 1123 | Ga0496111_0123868 | 3300048914 | Bacteria | 1910 |
| 1124 | Ga0496111_0146765 | 3300048914 | Bacteria | 1749 |
| 1125 | Ga0496111_0397653 | 3300048914 | Bacteria | 1018 |
| 1126 | Ga0496111_0774996 | 3300048914 | Bacteria | 695 |
| 1127 | Ga0496112_0000395 | 3300048915 | Bacteria | 28497 |
| 1128 | Ga0496112_0007176 | 3300048915 | Bacteria | 9869 |
| 1129 | Ga0496112_0007941 | 3300048915 | Bacteria | 9461 |
| 1130 | Ga0496112_0026148 | 3300048915 | Bacteria | 5612 |
| 1131 | Ga0496112_0034003 | 3300048915 | Bacteria | 4959 |
| 1132 | Ga0496112_0156929 | 3300048915 | Bacteria | 2242 |
| 1133 | Ga0496113_0014492 | 3300048916 | Bacteria | 5380 |
| 1134 | Ga0496113_0014638 | 3300048916 | Bacteria | 5360 |
| 1135 | Ga0496113_0071846 | 3300048916 | Bacteria | 2632 |
| 1136 | Ga0496113_0133548 | 3300048916 | Bacteria | 1949 |
| 1137 | Ga0496113_0193833 | 3300048916 | Bacteria | 1613 |
| 1138 | Ga0496113_0315234 | 3300048916 | Bacteria | 1253 |
| 1139 | Ga0496113_0677811 | 3300048916 | Bacteria | 824 |
| 1140 | Ga0496113_0821187 | 3300048916 | Bacteria | 738 |
| 1141 | Ga0496114_0024690 | 3300048917 | Bacteria | 4907 |
| 1142 | Ga0496114_0030586 | 3300048917 | Bacteria | 4431 |
| 1143 | Ga0496114_0057160 | 3300048917 | Bacteria | 3256 |
| 1144 | Ga0496114_0327023 | 3300048917 | Bacteria | 1355 |
| 1145 | Ga0496114_0509487 | 3300048917 | Bacteria | 1064 |
| 1146 | Ga0496114_0522648 | 3300048917 | Bacteria | 1049 |
| 1147 | Ga0496115_0018252 | 3300048918 | Bacteria | 5382 |
| 1148 | Ga0496115_0046676 | 3300048918 | Bacteria | 3463 |
| 1149 | Ga0496115_0088598 | 3300048918 | Bacteria | 2527 |
| 1150 | Ga0496115_0101117 | 3300048918 | Bacteria | 2363 |
| 1151 | Ga0496115_0115409 | 3300048918 | Bacteria | 2208 |
| 1152 | Ga0496115_0137874 | 3300048918 | Bacteria | 2012 |
| 1153 | Ga0496115_0142334 | 3300048918 | Bacteria | 1979 |
| 1154 | Ga0496115_0389916 | 3300048918 | Bacteria | 1131 |
| 1155 | Ga0496115_0460957 | 3300048918 | Bacteria | 1025 |
| 1156 | Ga0496117_0121610 | 3300048920 | Bacteria | 1602 |
| 1157 | Ga0496117_0153162 | 3300048920 | Bacteria | 1361 |
| 1158 | Ga0496118_0017746 | 3300048921 | Bacteria | 6460 |
| 1159 | Ga0496118_0059322 | 3300048921 | Bacteria | 2850 |
| 1160 | Ga0496118_0109246 | 3300048921 | Bacteria | 1841 |
| 1161 | Ga0496118_0164266 | 3300048921 | Bacteria | 1367 |
| 1162 | Ga0496118_0373694 | 3300048921 | Bacteria | 751 |
| 1163 | Ga0496119_0014065 | 3300048922 | Bacteria | 6298 |
| 1164 | Ga0496119_0065340 | 3300048922 | Bacteria | 2155 |
| 1165 | Ga0496120_0005770 | 3300048923 | Bacteria | 9725 |
| 1166 | Ga0496120_0028452 | 3300048923 | Bacteria | 3425 |
| 1167 | Ga0496121_0000885 | 3300048924 | Bacteria | 54051 |
| 1168 | Ga0496121_0004207 | 3300048924 | Bacteria | 19640 |
| 1169 | Ga0496121_0015422 | 3300048924 | Bacteria | 8009 |
| 1170 | Ga0496121_0079646 | 3300048924 | Bacteria | 2600 |
| 1171 | Ga0496121_0082803 | 3300048924 | Bacteria | 2535 |
| 1172 | Ga0496121_0114112 | 3300048924 | Bacteria | 2054 |
| 1173 | Ga0496121_0120484 | 3300048924 | Bacteria | 1982 |
| 1174 | Ga0496121_0168711 | 3300048924 | Bacteria | 1592 |
| 1175 | Ga0496121_0176872 | 3300048924 | Bacteria | 1544 |
| 1176 | Ga0496121_0198829 | 3300048924 | Bacteria | 1430 |
| 1177 | Ga0496121_0292310 | 3300048924 | Bacteria | 1109 |
| 1178 | Ga0496122_0219560 | 3300048925 | Bacteria | 1092 |
| 1179 | Ga0496124_0120907 | 3300048927 | Bacteria | 2093 |
| 1180 | Ga0496124_0135858 | 3300048927 | Bacteria | 1947 |
| 1181 | Ga0496124_0153877 | 3300048927 | Bacteria | 1801 |
| 1182 | Ga0496124_0190856 | 3300048927 | Bacteria | 1568 |
| 1183 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 1184 | Ga0496125_0001136 | 3300048928 | Bacteria | 40509 |
| 1185 | Ga0496125_0042098 | 3300048928 | Bacteria | 3896 |
| 1186 | Ga0496125_0078875 | 3300048928 | Bacteria | 2528 |
| 1187 | Ga0496125_0110848 | 3300048928 | Bacteria | 1988 |
| 1188 | Ga0496125_0145890 | 3300048928 | Bacteria | 1636 |
| 1189 | Ga0496126_0003396 | 3300048929 | Bacteria | 20150 |
| 1190 | Ga0496126_0016014 | 3300048929 | Bacteria | 7518 |
| 1191 | Ga0496126_0022608 | 3300048929 | Bacteria | 6111 |
| 1192 | Ga0496126_0025615 | 3300048929 | Bacteria | 5671 |
| 1193 | Ga0496126_0036244 | 3300048929 | Bacteria | 4613 |
| 1194 | Ga0496126_0037427 | 3300048929 | Bacteria | 4528 |
| 1195 | Ga0496126_0037738 | 3300048929 | Bacteria | 4504 |
| 1196 | Ga0496126_0038017 | 3300048929 | Bacteria | 4481 |
| 1197 | Ga0496126_0045586 | 3300048929 | Bacteria | 4028 |
| 1198 | Ga0496126_0059106 | 3300048929 | Bacteria | 3454 |
| 1199 | Ga0496126_0268528 | 3300048929 | Bacteria | 1416 |
| 1200 | Ga0496126_0282343 | 3300048929 | Bacteria | 1375 |
| 1201 | Ga0496126_0295050 | 3300048929 | Bacteria | 1339 |
| 1202 | Ga0496126_0410197 | 3300048929 | Bacteria | 1097 |
| 1203 | Ga0496126_0482588 | 3300048929 | Bacteria | 993 |
| 1204 | Ga0496126_0705476 | 3300048929 | Bacteria | 783 |
| 1205 | Ga0501031_0008325 | 3300049568 | Bacteria | 6746 |
| 1206 | Ga0501031_0234793 | 3300049568 | Bacteria | 1193 |
| 1207 | Ga0501031_0333238 | 3300049568 | Bacteria | 982 |
| 1208 | Ga0501031_0335740 | 3300049568 | Bacteria | 978 |
| 1209 | Ga0501031_0530970 | 3300049568 | Bacteria | 758 |
| 1210 | Ga0501032_0000038 | 3300049569 | Bacteria | 115810 |
| 1211 | Ga0501032_0058768 | 3300049569 | Bacteria | 2581 |
| 1212 | Ga0501032_0082953 | 3300049569 | Bacteria | 2132 |
| 1213 | Ga0501032_0435466 | 3300049569 | Bacteria | 841 |
| 1214 | Ga0501033_0000089 | 3300049570 | Bacteria | 86782 |
| 1215 | Ga0501033_0021064 | 3300049570 | Bacteria | 4921 |
| 1216 | Ga0501033_0172126 | 3300049570 | Bacteria | 1555 |
| 1217 | Ga0501034_0000228 | 3300049571 | Bacteria | 106111 |
| 1218 | Ga0501034_0095311 | 3300049571 | Bacteria | 2972 |
| 1219 | Ga0501034_0111412 | 3300049571 | Bacteria | 2727 |
| 1220 | Ga0501034_1273233 | 3300049571 | Bacteria | 613 |
| 1221 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 1222 | Ga0501036_0163132 | 3300049572 | Bacteria | 1879 |
| 1223 | Ga0501036_0195905 | 3300049572 | Bacteria | 1700 |
| 1224 | Ga0501036_0308082 | 3300049572 | Bacteria | 1324 |
| 1225 | Ga0501036_0317741 | 3300049572 | Bacteria | 1301 |
| 1226 | Ga0501036_0445764 | 3300049572 | Bacteria | 1078 |
| 1227 | Ga0501037_0000291 | 3300049573 | Bacteria | 42514 |
| 1228 | Ga0501037_0016257 | 3300049573 | Bacteria | 5476 |
| 1229 | Ga0501037_0127938 | 3300049573 | Bacteria | 1822 |
| 1230 | Ga0501037_0226343 | 3300049573 | Bacteria | 1314 |
| 1231 | Ga0501037_0234471 | 3300049573 | Bacteria | 1288 |
| 1232 | Ga0501038_0000079 | 3300049574 | Bacteria | 81639 |
| 1233 | Ga0501038_0004207 | 3300049574 | Bacteria | 13372 |
| 1234 | Ga0501038_0029528 | 3300049574 | Bacteria | 4856 |
| 1235 | Ga0501038_0118858 | 3300049574 | Bacteria | 2182 |
| 1236 | Ga0501038_0164126 | 3300049574 | Bacteria | 1803 |
| 1237 | Ga0501038_0429972 | 3300049574 | Bacteria | 1017 |
| 1238 | Ga0501038_0445062 | 3300049574 | Bacteria | 997 |
| 1239 | Ga0501039_0000616 | 3300049575 | Bacteria | 25733 |
| 1240 | Ga0501039_0032299 | 3300049575 | Bacteria | 4034 |
| 1241 | Ga0501039_0096203 | 3300049575 | Bacteria | 2309 |
| 1242 | Ga0501039_0101672 | 3300049575 | Bacteria | 2243 |
| 1243 | Ga0501039_0124252 | 3300049575 | Bacteria | 2023 |
| 1244 | Ga0501040_0040512 | 3300049576 | Bacteria | 3170 |
| 1245 | Ga0501040_0364192 | 3300049576 | Bacteria | 1036 |
| 1246 | Ga0501042_0011053 | 3300049578 | Bacteria | 6078 |
| 1247 | Ga0501043_0000021 | 3300049579 | Bacteria | 155025 |
| 1248 | Ga0501043_0006770 | 3300049579 | Bacteria | 9148 |
| 1249 | Ga0501043_0020635 | 3300049579 | Bacteria | 5169 |
| 1250 | Ga0501043_0027533 | 3300049579 | Bacteria | 4461 |
| 1251 | Ga0501043_0189099 | 3300049579 | Bacteria | 1602 |
| 1252 | Ga0501043_0209037 | 3300049579 | Bacteria | 1513 |
| 1253 | Ga0501046_0007870 | 3300049580 | Bacteria | 9345 |
| 1254 | Ga0501046_0044634 | 3300049580 | Bacteria | 3524 |
| 1255 | Ga0501046_0049136 | 3300049580 | Bacteria | 3338 |
| 1256 | Ga0501047_0000041 | 3300049581 | Bacteria | 184355 |
| 1257 | Ga0501047_0003510 | 3300049581 | Bacteria | 14816 |
| 1258 | Ga0501047_0009705 | 3300049581 | Bacteria | 9101 |
| 1259 | Ga0501047_0014189 | 3300049581 | Bacteria | 7572 |
| 1260 | Ga0501047_0017439 | 3300049581 | Bacteria | 6877 |
| 1261 | Ga0501047_0125899 | 3300049581 | Bacteria | 2442 |
| 1262 | Ga0501047_0192433 | 3300049581 | Bacteria | 1903 |
| 1263 | Ga0501048_0000954 | 3300049582 | Bacteria | 21351 |
| 1264 | Ga0501048_0786463 | 3300049582 | Bacteria | 683 |
| 1265 | Ga0501067_0002822 | 3300049583 | Bacteria | 9560 |
| 1266 | Ga0501067_0006812 | 3300049583 | Bacteria | 6337 |
| 1267 | Ga0501068_0000285 | 3300049584 | Bacteria | 25201 |
| 1268 | Ga0501068_0044949 | 3300049584 | Bacteria | 2660 |
| 1269 | Ga0501069_0001245 | 3300049585 | Bacteria | 12471 |
| 1270 | Ga0501069_0004522 | 3300049585 | Bacteria | 7184 |
| 1271 | Ga0501070_0000986 | 3300049586 | Bacteria | 25571 |
| 1272 | Ga0501070_0021595 | 3300049586 | Bacteria | 5399 |
| 1273 | Ga0501070_0046634 | 3300049586 | Bacteria | 3603 |
| 1274 | Ga0501070_0096975 | 3300049586 | Bacteria | 2439 |
| 1275 | Ga0501070_0288187 | 3300049586 | Bacteria | 1339 |
| 1276 | Ga0501070_0413858 | 3300049586 | Bacteria | 1089 |
| 1277 | Ga0501071_0045361 | 3300049587 | Bacteria | 3156 |
| 1278 | Ga0501071_0048337 | 3300049587 | Bacteria | 3059 |
| 1279 | Ga0501071_0343702 | 3300049587 | Bacteria | 1135 |
| 1280 | Ga0501072_0005779 | 3300049588 | Bacteria | 9419 |
| 1281 | Ga0501072_0026701 | 3300049588 | Bacteria | 4503 |
| 1282 | Ga0501073_0000056 | 3300049589 | Bacteria | 70854 |
| 1283 | Ga0501073_0019072 | 3300049589 | Bacteria | 4956 |
| 1284 | Ga0501073_0110358 | 3300049589 | Bacteria | 1908 |
| 1285 | Ga0501073_0517289 | 3300049589 | Bacteria | 825 |
| 1286 | Ga0501074_0012527 | 3300049590 | Bacteria | 6166 |
| 1287 | Ga0501074_0157621 | 3300049590 | Bacteria | 1621 |
| 1288 | Ga0501074_0478203 | 3300049590 | Bacteria | 883 |
| 1289 | Ga0501076_0036855 | 3300049592 | Bacteria | 3834 |
| 1290 | Ga0501076_0123182 | 3300049592 | Bacteria | 2100 |
| 1291 | Ga0501079_0001576 | 3300049741 | Bacteria | 16193 |
| 1292 | Ga0501079_0209244 | 3300049741 | Bacteria | 1523 |
| 1293 | Ga0501079_0461240 | 3300049741 | Bacteria | 998 |
| 1294 | Ga0501080_0000138 | 3300049742 | Bacteria | 50982 |
| 1295 | Ga0501080_0002680 | 3300049742 | Bacteria | 15586 |
| 1296 | Ga0501080_0005281 | 3300049742 | Bacteria | 11504 |
| 1297 | Ga0501080_0098917 | 3300049742 | Bacteria | 2707 |
| 1298 | Ga0501081_0677475 | 3300049743 | Bacteria | 774 |
| 1299 | Ga0501083_0004205 | 3300049744 | Bacteria | 10137 |
| 1300 | Ga0501083_0041698 | 3300049744 | Bacteria | 3112 |
| 1301 | Ga0501035_0000090 | 3300049822 | Bacteria | 112445 |
| 1302 | Ga0501035_0004898 | 3300049822 | Bacteria | 12704 |
| 1303 | Ga0501035_0144468 | 3300049822 | Bacteria | 2067 |
| 1304 | Ga0501035_0158324 | 3300049822 | Bacteria | 1961 |
| 1305 | Ga0501035_0543370 | 3300049822 | Bacteria | 952 |
| 1306 | Ga0501035_0586975 | 3300049822 | Bacteria | 909 |
| 1307 | Ga0501044_0000054 | 3300049823 | Bacteria | 141399 |
| 1308 | Ga0501044_0008668 | 3300049823 | Bacteria | 11137 |
| 1309 | Ga0501044_0012007 | 3300049823 | Bacteria | 9384 |
| 1310 | Ga0501044_0034079 | 3300049823 | Bacteria | 5344 |
| 1311 | Ga0501044_0047391 | 3300049823 | Bacteria | 4445 |
| 1312 | Ga0501044_0066366 | 3300049823 | Bacteria | 3679 |
| 1313 | Ga0501044_0176294 | 3300049823 | Bacteria | 2107 |
| 1314 | Ga0501044_0378461 | 3300049823 | Bacteria | 1331 |
| 1315 | Ga0501044_0553213 | 3300049823 | Bacteria | 1047 |
| 1316 | Ga0501044_0590767 | 3300049823 | Bacteria | 1004 |
| 1317 | Ga0501044_0695218 | 3300049823 | Bacteria | 903 |
| 1318 | Ga0501045_0009955 | 3300049824 | Bacteria | 6651 |
| 1319 | nmdc:mga03n38_185037_c1 | 3300050490 | Bacteria | 1070 |
| 1320 | nmdc:mga03n38_209046_c1 | 3300050490 | Bacteria | 1013 |
| 1321 | nmdc:mga0yw44_22683_c1 | 3300050492 | Bacteria | 3524 |
| 1322 | nmdc:mga0yw44_57354_c1 | 3300050492 | Bacteria | 2376 |
| 1323 | nmdc:mga0k408_138705_c1 | 3300050493 | Bacteria | 1446 |
| 1324 | nmdc:mga0k408_36679_c1 | 3300050493 | Bacteria | 2814 |
| 1325 | nmdc:mga06z11_155886_c1 | 3300050494 | Bacteria | 1302 |
| 1326 | nmdc:mga06z11_344240_c1 | 3300050494 | Bacteria | 892 |
| 1327 | nmdc:mga06z11_436833_c1 | 3300050494 | Bacteria | 790 |
| 1328 | nmdc:mga07m45_91212_c1 | 3300050496 | Bacteria | 1746 |
| 1329 | nmdc:mga07m45_96862_c1 | 3300050496 | Bacteria | 1693 |
| 1330 | nmdc:mga09592_770843_c1 | 3300050508 | Bacteria | 815 |
| 1331 | nmdc:mga08y16_895554_c1 | 3300050511 | Bacteria | 874 |
| 1332 | nmdc:mga0n895_421678_c1 | 3300050512 | Bacteria | 1349 |
| 1333 | nmdc:mga0rr50_60914_c1 | 3300050513 | Bacteria | 2841 |
| 1334 | nmdc:mga0a205_522343_c1 | 3300050515 | Bacteria | 1043 |
| 1335 | nmdc:mga0sz30_12372_c1 | 3300050516 | Bacteria | 3320 |
| 1336 | nmdc:mga0sz30_53076_c1 | 3300050516 | Bacteria | 1722 |
| 1337 | Ga0495601_0021028 | 3300053077 | Bacteria | 3991 |
| 1338 | Ga0495601_0028181 | 3300053077 | Bacteria | 3477 |
| 1339 | Ga0495601_0066479 | 3300053077 | Bacteria | 2295 |
| 1340 | Ga0495601_0135398 | 3300053077 | Bacteria | 1606 |
| 1341 | Ga0495601_0531443 | 3300053077 | Bacteria | 757 |
| 1342 | Ga0495612_0017545 | 3300053078 | Bacteria | 2865 |
| 1343 | Ga0500610_0177009 | 3300053079 | Bacteria | 1048 |
| 1344 | Ga0500635_0000944 | 3300053080 | Bacteria | 7020 |
| 1345 | Ga0495655_0005420 | 3300053083 | Bacteria | 2251 |
| 1346 | Ga0495595_0033631 | 3300053084 | Bacteria | 2314 |
| 1347 | Ga0495619_0016517 | 3300053085 | Bacteria | 4674 |
| 1348 | Ga0495619_0034063 | 3300053085 | Bacteria | 3310 |
| 1349 | Ga0495619_0060466 | 3300053085 | Bacteria | 2518 |
| 1350 | Ga0495619_0119026 | 3300053085 | Bacteria | 1810 |
| 1351 | Ga0495619_0122981 | 3300053085 | Bacteria | 1780 |
| 1352 | Ga0495619_0515717 | 3300053085 | Bacteria | 821 |
| 1353 | Ga0500578_0136663 | 3300053086 | Bacteria | 1534 |
| 1354 | Ga0500643_000046 | 3300053087 | Bacteria | 150388 |
| 1355 | Ga0500643_039916 | 3300053087 | Bacteria | 1384 |
| 1356 | Ga0500583_0150434 | 3300053092 | Bacteria | 1158 |
| 1357 | Ga0500566_0000048 | 3300053094 | Bacteria | 58542 |
| 1358 | Ga0500566_0000301 | 3300053094 | Bacteria | 26447 |
| 1359 | Ga0500566_0013839 | 3300053094 | Bacteria | 4747 |
| 1360 | Ga0500640_000691 | 3300053095 | Bacteria | 8969 |
| 1361 | Ga0500641_0065898 | 3300053096 | Bacteria | 1516 |
| 1362 | Ga0500554_006294 | 3300053102 | Bacteria | 2651 |
| 1363 | Ga0500555_007051 | 3300053103 | Bacteria | 3195 |
| 1364 | Ga0500556_0013241 | 3300053104 | Bacteria | 2489 |
| 1365 | Ga0500557_000020 | 3300053105 | Bacteria | 91933 |
| 1366 | Ga0500558_201039 | 3300053106 | Bacteria | 694 |
| 1367 | Ga0500562_025281 | 3300053108 | Bacteria | 1553 |
| 1368 | Ga0500572_000045 | 3300053111 | Bacteria | 38005 |
| 1369 | Ga0500572_000352 | 3300053111 | Bacteria | 16420 |
| 1370 | Ga0500572_002884 | 3300053111 | Bacteria | 4037 |
| 1371 | Ga0500591_003235 | 3300053115 | Bacteria | 6896 |
| 1372 | Ga0500594_0007961 | 3300053118 | Bacteria | 2408 |
| 1373 | Ga0500595_000494 | 3300053119 | Bacteria | 24038 |
| 1374 | Ga0500595_010569 | 3300053119 | Bacteria | 3661 |
| 1375 | Ga0500595_031885 | 3300053119 | Bacteria | 1764 |
| 1376 | Ga0500595_054767 | 3300053119 | Bacteria | 1223 |
| 1377 | Ga0500595_095321 | 3300053119 | Bacteria | 857 |
| 1378 | Ga0500607_007093 | 3300053121 | Bacteria | 6979 |
| 1379 | Ga0500608_023055 | 3300053122 | Bacteria | 2893 |
| 1380 | Ga0500608_069772 | 3300053122 | Bacteria | 1671 |
| 1381 | Ga0500614_021046 | 3300053123 | Bacteria | 1510 |
| 1382 | Ga0500614_131085 | 3300053123 | Bacteria | 744 |
| 1383 | Ga0500617_142212 | 3300053124 | Bacteria | 961 |
| 1384 | Ga0500655_010901 | 3300053133 | Bacteria | 1644 |
| 1385 | Ga0500655_020904 | 3300053133 | Bacteria | 1225 |
| 1386 | Ga0500559_0000099 | 3300053136 | Bacteria | 67311 |
| 1387 | Ga0500559_0002781 | 3300053136 | Bacteria | 8854 |
| 1388 | Ga0500559_0017178 | 3300053136 | Bacteria | 3054 |
| 1389 | Ga0500559_0133710 | 3300053136 | Bacteria | 1159 |
| 1390 | Ga0500559_0347311 | 3300053136 | Bacteria | 694 |
| 1391 | Ga0500568_0037159 | 3300053139 | Bacteria | 1977 |
| 1392 | Ga0500568_0091119 | 3300053139 | Bacteria | 1150 |
| 1393 | Ga0500577_0000025 | 3300053142 | Bacteria | 38251 |
| 1394 | Ga0500588_0231680 | 3300053146 | Bacteria | 690 |
| 1395 | Ga0500589_127632 | 3300053147 | Bacteria | 1067 |
| 1396 | Ga0500590_149485 | 3300053148 | Bacteria | 1055 |
| 1397 | Ga0500603_000041 | 3300053150 | Bacteria | 30524 |
| 1398 | Ga0500603_000138 | 3300053150 | Bacteria | 17480 |
| 1399 | Ga0500603_043687 | 3300053150 | Bacteria | 1204 |
| 1400 | Ga0500606_179728 | 3300053152 | Bacteria | 666 |
| 1401 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1402 | Ga0500616_0043757 | 3300053153 | Bacteria | 2392 |
| 1403 | Ga0500620_016427 | 3300053155 | Bacteria | 2115 |
| 1404 | Ga0500622_0004044 | 3300053156 | Bacteria | 9436 |
| 1405 | Ga0500627_0068451 | 3300053158 | Bacteria | 1569 |
| 1406 | Ga0500630_001433 | 3300053159 | Bacteria | 11319 |
| 1407 | Ga0500634_0041301 | 3300053161 | Bacteria | 2505 |
| 1408 | Ga0500634_0118884 | 3300053161 | Bacteria | 1290 |
| 1409 | Ga0500638_030569 | 3300053162 | Bacteria | 2593 |
| 1410 | Ga0500638_037572 | 3300053162 | Bacteria | 2350 |
| 1411 | Ga0500638_084347 | 3300053162 | Bacteria | 1505 |
| 1412 | Ga0500638_156214 | 3300053162 | Bacteria | 1008 |
| 1413 | Ga0500639_000228 | 3300053163 | Bacteria | 27840 |
| 1414 | Ga0500639_083116 | 3300053163 | Bacteria | 1610 |
| 1415 | Ga0500636_0000173 | 3300053177 | Bacteria | 34092 |
| 1416 | Ga0500636_0009981 | 3300053177 | Bacteria | 5527 |
| 1417 | Ga0500636_0021705 | 3300053177 | Bacteria | 3801 |
| 1418 | Ga0500636_0228874 | 3300053177 | Bacteria | 963 |
| 1419 | Ga0500637_0000162 | 3300053178 | Bacteria | 24729 |
| 1420 | Ga0500637_0000555 | 3300053178 | Bacteria | 14632 |
| 1421 | Ga0500637_0028427 | 3300053178 | Bacteria | 3093 |
| 1422 | Ga0500576_053151 | 3300053725 | Bacteria | 1791 |
| 1423 | Ga0500609_002640 | 3300053731 | Bacteria | 2551 |
| 1424 | Ga0500656_040104 | 3300053732 | Bacteria | 653 |
| 1425 | Ga0500596_002664 | 3300053735 | Bacteria | 3501 |
| 1426 | Ga0500599_012403 | 3300053736 | Bacteria | 1144 |
| 1427 | Ga0500601_000334 | 3300053737 | Bacteria | 8622 |
| 1428 | Ga0501084_0001679 | 3300054114 | Bacteria | 17584 |
| 1429 | Ga0501084_0020524 | 3300054114 | Bacteria | 5511 |
| 1430 | Ga0500661_000236 | 3300055283 | Bacteria | 9863 |
| 1431 | Ga0500661_057368 | 3300055283 | Bacteria | 700 |
| 1432 | Ga0501082_0006099 | 3300060353 | Bacteria | 10462 |
| 1433 | Ga0501082_0116934 | 3300060353 | Bacteria | 2309 |
| 1434 | Ga0530510_0328515 | 3300061734 | Bacteria | 1147 |
| 1435 | 2507507825 | 2507262055 | Bacteria | 8048963 |
| 1436 | 2508541936 | 2508501009 | Bacteria | 7784016 |
| 1437 | 2508692515 | 2508501042 | Bacteria | 8719808 |
| 1438 | 2511397361 | 2511231028 | Bacteria | 8046582 |
| 1439 | 2513622894 | 2513237092 | Bacteria | 8341956 |
| 1440 | 2513639272 | 2513237094 | Bacteria | 8789602 |
| 1441 | 2513647363 | 2513237095 | Bacteria | 8976980 |
| 1442 | 2513653951 | 2513237096 | Bacteria | 8722461 |
| 1443 | 2513676223 | 2513237098 | Bacteria | 9902361 |
| 1444 | 2513695766 | 2513237101 | Bacteria | 7952346 |
| 1445 | 2513700876 | 2513237102 | Bacteria | 7703324 |
| 1446 | 2513715373 | 2513237104 | Bacteria | 10034502 |
| 1447 | 2513856385 | 2513237137 | Bacteria | 9558895 |
| 1448 | 2513878215 | 2513237139 | Bacteria | 8737671 |
| 1449 | 2513891416 | 2513237141 | Bacteria | 8496279 |
| 1450 | 2513918291 | 2513237145 | Bacteria | 8979722 |
| 1451 | 2514009596 | 2513237161 | Bacteria | 8871253 |
| 1452 | 2515626733 | 2515154112 | Bacteria | 8294334 |
| 1453 | 2517103986 | 2517093001 | Bacteria | 9002274 |
| 1454 | 2517891479 | 2517572143 | Bacteria | 9484767 |
| 1455 | 2524470319 | 2524023210 | Bacteria | 9029266 |
| 1456 | 2524538340 | 2524023228 | Bacteria | 10118060 |
| 1457 | 2528852614 | 2528768022 | Bacteria | 10457665 |
| 1458 | 2603861476 | 2602042107 | Bacteria | 6226103 |
| 1459 | 2617346631 | 2617270735 | Bacteria | 9163226 |
| 1460 | 2617372566 | 2617270741 | Bacteria | 8201522 |
| 1461 | 2644291429 | 2643221651 | Bacteria | 4798932 |
| 1462 | 2671118755 | 2667528175 | Bacteria | 7532676 |
| 1463 | 2723847216 | 2721755755 | Bacteria | 8322773 |
| 1464 | 2728754858 | 2728368998 | Bacteria | 8720350 |
| 1465 | 2745080632 | 2744054633 | Bacteria | 8678936 |
| 1466 | 2793064510 | 2791355196 | Bacteria | 7323613 |
| 1467 | 2793066847 | 2791355197 | Bacteria | 8420563 |
| 1468 | 2793084176 | |||
| 1469 | 2805919220 | 2802429603 | Bacteria | 8777136 |
| 1470 | 2818236400 | 2816332527 | Bacteria | 8933356 |
| 1471 | 2824605401 | 2824600985 | Bacteria | 8488197 |
| 1472 | 2824613571 | 2824609381 | Bacteria | 8672835 |
| 1473 | 2824621434 | 2824617872 | Bacteria | 8814715 |
| 1474 | 2824630505 | 2824626560 | Bacteria | 8813858 |
| 1475 | 2824638794 | 2824635225 | Bacteria | 8785348 |
| 1476 | 2824657621 | 2824653114 | Bacteria | 8493680 |
| 1477 | 2824668094 | 2824661429 | Bacteria | 9877870 |
| 1478 | 2824675940 | 2824671348 | Bacteria | 8369588 |
| 1479 | 2824683050 | 2824679649 | Bacteria | 8248951 |
| 1480 | 2824692135 | 2824687955 | Bacteria | 8360029 |
| 1481 | 2824726235 | 2824723954 | Bacteria | 8758240 |
| 1482 | 2824735795 | 2824732956 | Bacteria | 7810675 |
| 1483 | 2824747004 | 2824746037 | Bacteria | 7911610 |
| 1484 | 2824755621 | 2824753945 | Bacteria | 9787441 |
| 1485 | 2824766284 | 2824763712 | Bacteria | 9792355 |
| 1486 | 2824777382 | 2824773399 | Bacteria | 8360218 |
| 1487 | 2838128956 | 2838122688 | Bacteria | 8803140 |
| 1488 | 2841944888 | 2841941048 | Bacteria | 8688029 |
| 1489 | 2841953314 | 2841949485 | Bacteria | 8680857 |
| 1490 | 2841959840 | 2841957949 | Bacteria | 8652217 |
| 1491 | 2841972206 | 2841966195 | Bacteria | 8673214 |
| 1492 | 2841978039 | 2841974524 | Bacteria | 8931498 |
| 1493 | 2841986331 | 2841983080 | Bacteria | 8395090 |
| 1494 | 2842040488 | 2842038055 | Bacteria | 8002051 |
| 1495 | 2842046567 | 2842045827 | Bacteria | 8006841 |
| 1496 | 2844319872 | 2844315083 | Bacteria | 8138177 |
| 1497 | 2847937190 | 2847930680 | Bacteria | 9342022 |
| 1498 | 2847947575 | 2847939898 | Bacteria | 8606328 |
| 1499 | 2849078549 | 2849076700 | Bacteria | 7039503 |
| 1500 | 2857512910 | 2857509624 | Bacteria | 7472071 |
| 1501 | 2857528414 | 2857524615 | Bacteria | 6615449 |
| 1502 | 2874598934 | 2874590934 | Bacteria | 8299676 |
| 1503 | 2874611021 | 2874604998 | Bacteria | 7834745 |
| 1504 | 2874614743 | 2874612657 | Bacteria | 8252029 |
| 1505 | 2874622256 | 2874620515 | Bacteria | 8290088 |
| 1506 | 2874635179 | 2874628541 | Bacteria | 8630250 |
| 1507 | 2874650617 | 2874645413 | Bacteria | 8214782 |
| 1508 | 2876764173 | 2876761206 | Bacteria | 10111113 |
| 1509 | 2876778973 | 2876771140 | Bacteria | 8287509 |
| 1510 | 2876814487 | 2876808645 | Bacteria | 8824342 |
| 1511 | 2876824132 | 2876818435 | Bacteria | 8274608 |
| 1512 | 2879082766 | 2879074833 | Bacteria | 8279565 |
| 1513 | 2879089145 | 2879083081 | Bacteria | 8587928 |
| 1514 | 2879105618 | 2879099564 | Bacteria | 10442239 |
| 1515 | 2879114586 | 2879110137 | Bacteria | 8907982 |
| 1516 | 2879132072 | 2879127579 | Bacteria | 8294491 |
| 1517 | 2879148401 | 2879142872 | Bacteria | 8267021 |
| 1518 | 2881364790 | 2881364244 | Bacteria | 7710352 |
| 1519 | 2881671905 | 2881665667 | Bacteria | 8175609 |
| 1520 | 2885369807 | 2885366525 | Bacteria | 8326213 |
| 1521 | 2885377816 | 2885374607 | Bacteria | 8927485 |
| 1522 | 2885390304 | 2885383462 | Bacteria | 9473874 |
| 1523 | 2888385298 | 2888378607 | Bacteria | 9652610 |
| 1524 | 2888392949 | 2888388044 | Bacteria | 7304136 |
| 1525 | 2888425448 | 2888419890 | Bacteria | 7857137 |
| 1526 | 2889038156 | 2889033259 | Bacteria | 9099371 |
| 1527 | 2893068821 | 2893066018 | Bacteria | 6158120 |
| 1528 | 2903730457 | 2903727486 | Bacteria | 8281579 |
| 1529 | 2903758739 | 2903748898 | Bacteria | 9972761 |
| 1530 | 2903772997 | 2903768456 | Bacteria | 9749579 |
| 1531 | 2904667867 | 2904666416 | Bacteria | 8226587 |
| 1532 | 2904691331 | 2904690495 | Bacteria | 9412302 |
| 1533 | 2904704822 | |||
| 1534 | 2904712135 | 2904711408 | Bacteria | 9771557 |
| 1535 | 2906609744 | 2906602504 | Bacteria | 8295279 |
| 1536 | 2906616655 | |||
| 1537 | 2906632374 | 2906626472 | Bacteria | 8826946 |
| 1538 | 2906643711 | 2906635258 | Bacteria | 8601019 |
| 1539 | 2906646970 | 2906643746 | Bacteria | 8722424 |
| 1540 | 2906666982 | 2906660503 | Bacteria | 8595048 |
| 1541 | 2908741821 | 2908739725 | Bacteria | 8628932 |
| 1542 | 2908759025 | 2908756301 | Bacteria | 8864324 |
| 1543 | 2908781015 | 2908775508 | Bacteria | 8092255 |
| 1544 | 2919075871 | 2919073203 | Bacteria | 6531949 |
| 1545 | 2922368547 | 2922361189 | Bacteria | 7436256 |
| 1546 | 2922372598 | |||
| 1547 | 2922387477 | 2922386360 | Bacteria | 7017218 |
| 1548 | 2922397225 | 2922393267 | Bacteria | 8285685 |
| 1549 | 2922431322 | |||
| 1550 | 2929620409 | 2929615660 | Bacteria | 9193770 |
| 1551 | 2929626302 | 2929624759 | Bacteria | 9339455 |
| 1552 | 2932784822 | 2932784394 | Bacteria | 9704911 |
| 1553 | 2932795300 | 2932794094 | Bacteria | 7915132 |
| 1554 | 2932805832 | 2932801729 | Bacteria | 7987968 |
| 1555 | 2932809855 | 2932809354 | Bacteria | 9135765 |
| 1556 | 2932818401 | 2932818245 | Bacteria | 9955613 |
| 1557 | 2932828658 | 2932828146 | Bacteria | 9745859 |
| 1558 | 2933582327 | 2933577622 | Bacteria | 9116884 |
| 1559 | 2935609682 | 2935608549 | Bacteria | 8203142 |
| 1560 | 2935619920 | 2935616580 | Bacteria | 9032984 |
| 1561 | 2935633914 | 2935630451 | Bacteria | 8169952 |
| 1562 | 2935638903 | 2935638405 | Bacteria | 10015038 |
| 1563 | 2935652173 | 2935648319 | Bacteria | 8801166 |
| 1564 | 2935660755 | 2935656913 | Bacteria | 8965014 |
| 1565 | 2935666246 | 2935665750 | Bacteria | 9571747 |
| 1566 | 2935676708 | 2935675223 | Bacteria | 9928132 |
| 1567 | 2935685097 | 2935684952 | Bacteria | 9590419 |
| 1568 | 2935694786 | 2935694250 | Bacteria | 9291695 |
| 1569 | 2935703909 | 2935703347 | Bacteria | 10242284 |
| 1570 | 2935713650 | 2935713505 | Bacteria | 9608509 |
| 1571 | 2935724270 | 2935722832 | Bacteria | 9608746 |
| 1572 | 2935733372 | 2935732158 | Bacteria | 9706831 |
| 1573 | 2935742751 | 2935741537 | Bacteria | 9707219 |
| 1574 | 2935751062 | 2935750917 | Bacteria | 9590372 |
| 1575 | 2935760415 | 2935760218 | Bacteria | 9817913 |
| 1576 | 2935772083 | 2935769743 | Bacteria | 7878163 |
| 1577 | 2935784260 | 2935777560 | Bacteria | 8077691 |
| 1578 | 2935787530 | 2935785616 | Bacteria | 7962367 |
| 1579 | 2935796161 | 2935793552 | Bacteria | 8012592 |
| 1580 | 2935802045 | 2935801545 | Bacteria | 9301974 |
| 1581 | 2935810814 | 2935810662 | Bacteria | 9401221 |
| 1582 | 2935822844 | 2935819856 | Bacteria | 8261050 |
| 1583 | 2935828397 | 2935827899 | Bacteria | 10038562 |
| 1584 | 2935839812 | 2935837841 | Bacteria | 9454360 |
| 1585 | 2935848426 | 2935847175 | Bacteria | 8228321 |
| 1586 | 2935857765 | 2935855204 | Bacteria | 9035059 |
| 1587 | 2935868894 | 2935864058 | Bacteria | 9784707 |
| 1588 | 2935874309 | 2935873716 | Bacteria | 9632195 |
| 1589 | 2935883803 | 2935883170 | Bacteria | 7964738 |
| 1590 | 2935909769 | 2935908558 | Bacteria | 8568796 |
| 1591 | 2935917494 | 2935916978 | Bacteria | 9113783 |
| 1592 | 2935927250 | 2935926038 | Bacteria | 8601059 |
| 1593 | 2935936906 | 2935934488 | Bacteria | 8602579 |
| 1594 | 2935944791 | 2935942939 | Bacteria | 8599779 |
| 1595 | 2935953228 | 2935951376 | Bacteria | 8602333 |
| 1596 | 2935961269 | 2935959822 | Bacteria | 7869783 |
| 1597 | 2935970068 | 2935967501 | Bacteria | 8603075 |
| 1598 | 2935980376 | 2935975950 | Bacteria | 8347125 |
| 1599 | 2935986639 | 2935984226 | Bacteria | 8302647 |
| 1600 | 2935992765 | 2935992306 | Bacteria | 9802711 |
| 1601 | 2936002678 | 2936002035 | Bacteria | 9362176 |
| 1602 | 2936014811 | 2936011229 | Bacteria | 8801034 |
| 1603 | 2936022208 | 2936019824 | Bacteria | 8804134 |
| 1604 | 2936032896 | 2936028420 | Bacteria | 8965941 |
| 1605 | 2936037766 | 2936037263 | Bacteria | 9446081 |
| 1606 | 2936050552 | 2936046547 | Bacteria | 8903709 |
| 1607 | 2936059672 | 2936055302 | Bacteria | 8785755 |
| 1608 | 2940558135 | 2940556831 | Bacteria | 9590747 |
| 1609 | 2941510783 | 2941507105 | Bacteria | 8166816 |
| 1610 | 2941518167 | 2941515067 | Bacteria | 8166720 |
| 1611 | 2941526962 | 2941523033 | Bacteria | 8169134 |
| 1612 | 2941531059 | 2941531003 | Bacteria | 7653939 |
| 1613 | 2941540847 | 2941538514 | Bacteria | 9402094 |
| 1614 | 3005481116 | 3005474847 | Bacteria | 9259049 |
| 1615 | 3005484949 | 3005483717 | Bacteria | 7877331 |
| 1616 | 3005508575 | 3005506211 | Bacteria | 6943378 |
| 1617 | 3005587224 | 3005587118 | Bacteria | 7794411 |
| 1618 | 3005600143 | 3005594810 | Bacteria | 8716512 |
| 1619 | 3005715667 | 3005710791 | Bacteria | 7622528 |
| 1620 | 3005723001 | 3005718088 | Bacteria | 8283608 |
| 1621 | 8006927857 | 8006926726 | Bacteria | 6749210 |
| 1622 | 8006939593 | 8006933436 | Bacteria | 10410654 |
| 1623 | 8006968414 | 8006964411 | Bacteria | 8966052 |
| 1624 | 8006979344 | 8006973647 | Bacteria | 10679141 |
| 1625 | 8006989239 | 8006984368 | Bacteria | 9651211 |
| 1626 | 8006994850 | 8006994254 | Bacteria | 8309700 |
| 1627 | 8016520827 | 8016511872 | Bacteria | 9921665 |
| 1628 | 8016528840 | 8016522445 | Bacteria | 8156687 |
| 1629 | 8016534027 | 8016530956 | Bacteria | 8155261 |
| 1630 | 8016547251 | 8016539877 | Bacteria | 8155419 |
| 1631 | 8016554880 | 8016548790 | Bacteria | 8155074 |
| 1632 | 8016563245 | 8016557553 | Bacteria | 8154380 |
| 1633 | 8016576545 | 8016575299 | Bacteria | 8154085 |
| 1634 | 8016594118 | 8016583857 | Bacteria | 10421953 |
| 1635 | 8016609459 | 8016603502 | Bacteria | 8731218 |
| 1636 | 8016615448 | 8016613128 | Bacteria | 8794220 |
| 1637 | 8016625767 | 8016622563 | Bacteria | 7999408 |
| 1638 | 8016639343 | 8016630954 | Bacteria | 9217207 |
| 1639 | 8017064763 | 8017057580 | Bacteria | 10023680 |
| 1640 | 8019533794 | 8019530166 | Bacteria | 8155624 |
| 1641 | 8019545871 | 8019538911 | Bacteria | 7872763 |
| 1642 | 8019552854 | 8019547302 | Bacteria | 7996444 |
| 1643 | 8019565486 | 8019555841 | Bacteria | 9642137 |
| 1644 | 8019575581 | 8019565922 | Bacteria | 9639779 |
| 1645 | 8019584136 | 8019576017 | Bacteria | 10049540 |
| 1646 | 8019591893 | 8019586578 | Bacteria | 10212056 |
| 1647 | 8019599390 | 8019597564 | Bacteria | 10041141 |
| 1648 | 8019608967 | 8019608314 | Bacteria | 10042931 |
| 1649 | 8019619635 | 8019619141 | Bacteria | 9218857 |
| 1650 | 8019633478 | 8019629233 | Bacteria | 8687553 |
| 1651 | 8019646419 | 8019638758 | Bacteria | 9062356 |
| 1652 | 8019649180 | 8019648815 | Bacteria | 10014479 |
| 1653 | 8019661363 | 8019659431 | Bacteria | 8577854 |
| 1654 | 8019670904 | 8019668869 | Bacteria | 8791617 |
| 1655 | 8019685291 | 8019678201 | Bacteria | 8863603 |
| 1656 | 8019690914 | 8019687851 | Bacteria | 8712826 |
| 1657 | 8055745271 | 8055742211 | Bacteria | 9226248 |
| 1658 | 8056679422 | 8056673599 | Bacteria | 7871253 |
| 1659 | 8056684935 | 8056681323 | Bacteria | 8472857 |
| 1660 | 8056693440 | 8056689827 | Bacteria | 6712655 |
| 1661 | 8056968892 | 8056967851 | Bacteria | 9038162 |
| 1662 | Ga0451855_0948618 | |||
| 1663 | JGI24735J21928_10029983 | |||
| 1664 | JGI25406J46586_10000035 | |||
| 1665 | JGI25153J46596_10007563 | |||
| 1666 | JGI25153J46596_10024636 | |||
| 1667 | JGI25160J50197_1001173 | |||
| 1668 | JGI25160J50197_1001457 | |||
| 1669 | JGI25160J50197_1014137 | |||
| 1670 | JGI25404J52841_10008532 | |||
| 1671 | JGI25404J52841_10014135 | |||
| 1672 | JGI25404J52841_10016468 | |||
| 1673 | Ga0055539_1008932 | |||
| 1674 | Ga0055531_10006944 | |||
| 1675 | Ga0055543_1025968 | |||
| 1676 | Ga0065165_1001742 | |||
| 1677 | Ga0070658_10293516 | |||
| 1678 | Ga0070658_10462448 | |||
| 1679 | Ga0070676_10228449 | |||
| 1680 | Ga0070683_100034308 | |||
| 1681 | Ga0070683_100340228 | |||
| 1682 | Ga0070690_100036445 | |||
| 1683 | Ga0070690_100670836 | |||
| 1684 | Ga0070670_100172802 | |||
| 1685 | Ga0070677_10031918 | |||
| 1686 | Ga0068869_100131178 | |||
| 1687 | Ga0068869_100456569 | |||
| 1688 | Ga0070666_10264592 | |||
| 1689 | Ga0070666_10320567 | |||
| 1690 | Ga0070666_10556194 | |||
| 1691 | Ga0070680_100005549 | |||
| 1692 | Ga0070680_100034563 | |||
| 1693 | Ga0070682_100011716 | |||
| 1694 | Ga0070682_100233255 | |||
| 1695 | Ga0070682_100329693 | |||
| 1696 | Ga0070682_100695343 | |||
| 1697 | Ga0068868_100077925 | |||
| 1698 | Ga0068868_100464899 | |||
| 1699 | Ga0070660_100056116 | |||
| 1700 | Ga0070660_100314333 | |||
| 1701 | Ga0070689_100188427 | |||
| 1702 | Ga0070689_100409463 | |||
| 1703 | Ga0070691_10033220 | |||
| 1704 | Ga0070661_100114171 | |||
| 1705 | Ga0070661_100289824 | |||
| 1706 | Ga0070661_100467894 | |||
| 1707 | Ga0070692_10212208 | |||
| 1708 | Ga0070668_100184790 | |||
| 1709 | Ga0070668_100236941 | |||
| 1710 | Ga0070669_100196404 | |||
| 1711 | Ga0070671_100484613 | |||
| 1712 | Ga0070671_100747776 | |||
| 1713 | Ga0070674_100032222 | |||
| 1714 | Ga0070674_100676521 | |||
| 1715 | Ga0070674_101000433 | |||
| 1716 | Ga0070659_100426697 | |||
| 1717 | Ga0070667_100331712 | |||
| 1718 | Ga0070667_100357278 | |||
| 1719 | Ga0070667_100425799 | |||
| 1720 | Ga0070709_10000810 | |||
| 1721 | Ga0070709_10008385 | |||
| 1722 | Ga0070709_10157668 | |||
| 1723 | Ga0070709_10177685 | |||
| 1724 | Ga0070714_100005006 | |||
| 1725 | Ga0070714_100171897 | |||
| 1726 | Ga0070713_100046224 | |||
| 1727 | Ga0070713_100084119 | |||
| 1728 | Ga0070713_100084528 | |||
| 1729 | Ga0070713_100094107 | |||
| 1730 | Ga0070713_100872544 | |||
| 1731 | Ga0070710_10002889 | |||
| 1732 | Ga0070710_10007376 | |||
| 1733 | Ga0070710_10007545 | |||
| 1734 | Ga0070710_10449983 | |||
| 1735 | Ga0070711_100002918 | |||
| 1736 | Ga0070711_100002976 | |||
| 1737 | Ga0070711_100004710 | |||
| 1738 | Ga0070711_100008785 | |||
| 1739 | Ga0070711_100028567 | |||
| 1740 | Ga0070711_100143512 | |||
| 1741 | Ga0070708_100149973 | |||
| 1742 | Ga0070663_100031884 | |||
| 1743 | Ga0070663_100061548 | |||
| 1744 | Ga0070663_100113407 | |||
| 1745 | Ga0070663_100199614 | |||
| 1746 | Ga0070663_100699182 | |||
| 1747 | Ga0070678_100063626 | |||
| 1748 | Ga0070678_100168236 | |||
| 1749 | Ga0070678_100187400 | |||
| 1750 | Ga0070678_100765087 | |||
| 1751 | Ga0070678_100988926 | |||
| 1752 | Ga0070662_100256122 | |||
| 1753 | Ga0070662_100360018 | |||
| 1754 | Ga0070662_100671075 | |||
| 1755 | Ga0070681_10002285 | |||
| 1756 | Ga0070681_10027350 | |||
| 1757 | Ga0070681_10178858 | |||
| 1758 | Ga0070681_10220323 | |||
| 1759 | Ga0070681_10235277 | |||
| 1760 | Ga0070681_10308639 | |||
| 1761 | Ga0068867_100139372 | |||
| 1762 | Ga0070685_10442634 | |||
| 1763 | Ga0070706_100069425 | |||
| 1764 | Ga0070706_100122952 | |||
| 1765 | Ga0070707_100071401 | |||
| 1766 | Ga0070707_100106166 | |||
| 1767 | Ga0070698_100174586 | |||
| 1768 | Ga0070698_100297164 | |||
| 1769 | Ga0070679_100034939 | |||
| 1770 | Ga0070679_100056755 | |||
| 1771 | Ga0070679_100058880 | |||
| 1772 | Ga0070679_100121327 | |||
| 1773 | Ga0070679_100191388 | |||
| 1774 | Ga0070679_100405665 | |||
| 1775 | Ga0070684_100011247 | |||
| 1776 | Ga0070684_100011751 | |||
| 1777 | Ga0070684_100027605 | |||
| 1778 | Ga0070684_100128956 | |||
| 1779 | Ga0070684_101284920 | |||
| 1780 | Ga0070697_100024320 | |||
| 1781 | Ga0070697_100089871 | |||
| 1782 | Ga0070697_101120311 | |||
| 1783 | Ga0068853_100009591 | |||
| 1784 | Ga0068853_100017708 | |||
| 1785 | Ga0068853_100034597 | |||
| 1786 | Ga0068853_100186788 | |||
| 1787 | Ga0068853_100245522 | |||
| 1788 | Ga0068853_100350793 | |||
| 1789 | Ga0068853_100524138 | |||
| 1790 | Ga0070672_100487069 | |||
| 1791 | Ga0070686_100086954 | |||
| 1792 | Ga0070696_100700415 | |||
| 1793 | Ga0070696_100756230 | |||
| 1794 | Ga0070693_100128317 | |||
| 1795 | Ga0070693_100325869 | |||
| 1796 | Ga0070693_100402171 | |||
| 1797 | Ga0070665_100031003 | |||
| 1798 | Ga0070665_100083014 | |||
| 1799 | Ga0070665_100102413 | |||
| 1800 | Ga0070665_100216025 | |||
| 1801 | Ga0070665_100224348 | |||
| 1802 | Ga0070665_100335111 | |||
| 1803 | Ga0070665_100388898 | |||
| 1804 | Ga0070665_100460283 | |||
| 1805 | Ga0070665_100485338 | |||
| 1806 | Ga0070665_100753893 | |||
| 1807 | Ga0070704_100293424 | |||
| 1808 | Ga0068855_100023046 | |||
| 1809 | Ga0068855_100027258 | |||
| 1810 | Ga0068855_100044620 | |||
| 1811 | Ga0068855_100141266 | |||
| 1812 | Ga0068855_100180688 | |||
| 1813 | Ga0068855_100233511 | |||
| 1814 | Ga0068855_100256727 | |||
| 1815 | Ga0068855_100427734 | |||
| 1816 | Ga0068855_100493357 | |||
| 1817 | Ga0068855_100841552 | |||
| 1818 | Ga0070664_100128043 | |||
| 1819 | Ga0070664_100387738 | |||
| 1820 | Ga0068857_100012550 | |||
| 1821 | Ga0068857_100033366 | |||
| 1822 | Ga0068857_100153449 | |||
| 1823 | Ga0068857_100742601 | |||
| 1824 | Ga0068854_100021565 | |||
| 1825 | Ga0068854_100058673 | |||
| 1826 | Ga0068854_100211001 | |||
| 1827 | Ga0068856_100000061 | |||
| 1828 | Ga0068856_100245950 | |||
| 1829 | Ga0068856_100284390 | |||
| 1830 | Ga0068856_100648445 | |||
| 1831 | Ga0070702_100525273 | |||
| 1832 | Ga0070702_100642090 | |||
| 1833 | Ga0068852_100013998 | |||
| 1834 | Ga0068852_100451996 | |||
| 1835 | Ga0068859_100418873 | |||
| 1836 | Ga0068866_10046590 | |||
| 1837 | Ga0068866_10163656 | |||
| 1838 | Ga0068861_100081648 | |||
| 1839 | Ga0068861_100265523 | |||
| 1840 | Ga0068861_100309414 | |||
| 1841 | Ga0068851_10003737 | |||
| 1842 | Ga0068851_10139663 | |||
| 1843 | Ga0068870_10169831 | |||
| 1844 | Ga0068863_100162223 | |||
| 1845 | Ga0068863_100460714 | |||
| 1846 | Ga0068858_100182400 | |||
| 1847 | Ga0068858_100293328 | |||
| 1848 | Ga0068858_100994562 | |||
| 1849 | Ga0068860_100032363 | |||
| 1850 | Ga0068860_100089618 | |||
| 1851 | Ga0068860_100286915 | |||
| 1852 | Ga0068860_100689934 | |||
| 1853 | Ga0068862_100137405 | |||
| 1854 | Ga0081455_10011984 | |||
| 1855 | Ga0081455_10019455 | |||
| 1856 | Ga0081538_10090004 | |||
| 1857 | Ga0081540_1005688 | |||
| 1858 | Ga0081540_1012357 | |||
| 1859 | Ga0081540_1020550 | |||
| 1860 | Ga0081540_1038398 | |||
| 1861 | Ga0081540_1041540 | |||
| 1862 | Ga0081540_1236812 | |||
| 1863 | Ga0081539_10000113 | |||
| 1864 | Ga0081539_10011797 | |||
| 1865 | Ga0081539_10059698 | |||
| 1866 | Ga0081539_10086233 | |||
| 1867 | Ga0081539_10114384 | |||
| 1868 | Ga0070717_10005909 | |||
| 1869 | Ga0070717_10008342 | |||
| 1870 | Ga0070717_10730537 | |||
| 1871 | Ga0075365_10015440 | |||
| 1872 | Ga0075365_10260439 | |||
| 1873 | Ga0075368_10048445 | |||
| 1874 | Ga0075368_10212988 | |||
| 1875 | Ga0075363_100150679 | |||
| 1876 | Ga0075364_10048183 | |||
| 1877 | Ga0075364_10106118 | |||
| 1878 | Ga0075364_10828374 | |||
| 1879 | Ga0070715_10000568 | |||
| 1880 | Ga0070715_10197947 | |||
| 1881 | Ga0070715_10236402 | |||
| 1882 | Ga0070716_100141523 | |||
| 1883 | Ga0070716_100315252 | |||
| 1884 | Ga0070712_100026768 | |||
| 1885 | Ga0070712_100032532 | |||
| 1886 | Ga0070712_100071104 | |||
| 1887 | Ga0075367_10058993 | |||
| 1888 | Ga0075367_10126363 | |||
| 1889 | Ga0075367_10145551 | |||
| 1890 | Ga0075369_10035186 | |||
| 1891 | Ga0075369_10106822 | |||
| 1892 | Ga0075366_10041918 | |||
| 1893 | Ga0097621_100169434 | |||
| 1894 | Ga0097621_100465146 | |||
| 1895 | Ga0075370_10003171 | |||
| 1896 | Ga0075370_10035923 | |||
| 1897 | Ga0068871_100345538 | |||
| 1898 | Ga0068871_101057844 | |||
| 1899 | Ga0075428_100575561 | |||
| 1900 | Ga0075434_100393908 | |||
| 1901 | Ga0075434_100489727 | |||
| 1902 | Ga0075429_100247855 | |||
| 1903 | Ga0068865_100082807 | |||
| 1904 | Ga0075436_100157313 | |||
| 1905 | Ga0097620_100418892 | |||
| 1906 | Ga0099825_1021210 | |||
| 1907 | Ga0099824_1016548 | |||
| 1908 | Ga0099822_1000695 | |||
| 1909 | Ga0099823_1098755 | |||
| 1910 | Ga0075435_100203894 | |||
| 1911 | Ga0075435_100310875 | |||
| 1912 | Ga0099794_10039678 | |||
| 1913 | Ga0099795_10021632 | |||
| 1914 | Ga0099795_10065331 | |||
| 1915 | Ga0099795_10272534 | |||
| 1916 | Ga0105251_10124113 | |||
| 1917 | Ga0105250_10025743 | |||
| 1918 | Ga0105250_10081081 | |||
| 1919 | Ga0105240_10004423 | |||
| 1920 | Ga0105240_10011106 | |||
| 1921 | Ga0105240_10017597 | |||
| 1922 | Ga0105240_10086262 | |||
| 1923 | Ga0105240_10219029 | |||
| 1924 | Ga0105240_10235260 | |||
| 1925 | Ga0105240_10508108 | |||
| 1926 | Ga0105240_11519385 | |||
| 1927 | Ga0105240_11631574 | |||
| 1928 | Ga0111539_10080797 | |||
| 1929 | Ga0105245_10045862 | |||
| 1930 | Ga0105245_10399721 | |||
| 1931 | Ga0105245_10741223 | |||
| 1932 | Ga0105245_11459206 | |||
| 1933 | Ga0105247_10159523 | |||
| 1934 | Ga0114129_11018744 | |||
| 1935 | Ga0105243_10386222 | |||
| 1936 | Ga0105243_10622347 | |||
| 1937 | Ga0105241_10008232 | |||
| 1938 | Ga0105241_10334582 | |||
| 1939 | Ga0105241_10455595 | |||
| 1940 | Ga0105242_10466984 | |||
| 1941 | Ga0105248_10232607 | |||
| 1942 | Ga0105248_10812101 | |||
| 1943 | Ga0105237_10019836 | |||
| 1944 | Ga0105237_10020040 | |||
| 1945 | Ga0105237_10030505 | |||
| 1946 | Ga0105237_10110248 | |||
| 1947 | Ga0105237_10141995 | |||
| 1948 | Ga0105237_10254343 | |||
| 1949 | Ga0105237_10392316 | |||
| 1950 | Ga0105237_10431998 | |||
| 1951 | Ga0105238_10006212 | |||
| 1952 | Ga0105238_10007238 | |||
| 1953 | Ga0105238_10012675 | |||
| 1954 | Ga0105238_10029408 | |||
| 1955 | Ga0105238_10203515 | |||
| 1956 | Ga0105238_10370407 | |||
| 1957 | Ga0105238_10678044 | |||
| 1958 | Ga0105238_10757503 | |||
| 1959 | Ga0105238_10804079 | |||
| 1960 | Ga0105238_11188024 | |||
| 1961 | Ga0099796_10103763 | |||
| 1962 | Ga0105239_10032630 | |||
| 1963 | Ga0105239_10051708 | |||
| 1964 | Ga0105239_10151068 | |||
| 1965 | Ga0105239_10153794 | |||
| 1966 | Ga0105239_10206757 | |||
| 1967 | Ga0105239_10265765 | |||
| 1968 | Ga0105239_10825894 | |||
| 1969 | Ga0105239_11362207 | |||
| 1970 | Ga0105246_10031447 | |||
| 1971 | Ga0105246_10122187 | |||
| 1972 | Ga0157373_10024137 | |||
| 1973 | Ga0157370_10322105 | |||
| 1974 | Ga0157369_10007836 | |||
| 1975 | Ga0157369_10039809 | |||
| 1976 | Ga0157369_10043556 | |||
| 1977 | Ga0157369_10055070 | |||
| 1978 | Ga0157374_10475791 | |||
| 1979 | Ga0157378_10013138 | |||
| 1980 | Ga0157378_10122248 | |||
| 1981 | Ga0163162_10022099 | |||
| 1982 | Ga0163162_10209857 | |||
| 1983 | Ga0163162_10667111 | |||
| 1984 | Ga0163162_10750687 | |||
| 1985 | Ga0163162_11178574 | |||
| 1986 | Ga0163162_11567554 | |||
| 1987 | Ga0157372_10784165 | |||
| 1988 | Ga0157375_10042178 | |||
| 1989 | Ga0157375_10386696 | |||
| 1990 | Ga0163163_10010549 | |||
| 1991 | Ga0163163_10349047 | |||
| 1992 | Ga0163163_10739064 | |||
| 1993 | Ga0157377_10094238 | |||
| 1994 | Ga0157379_10568341 | |||
| 1995 | Ga0157379_11005979 | |||
| 1996 | Ga0157376_10046230 | |||
| 1997 | Ga0182007_10090010 | |||
| 1998 | Ga0163161_10022935 | |||
| 1999 | Ga0206356_11553430 | |||
| 2000 | Ga0206354_10339519 | |||
| 2001 | Ga0206354_10702824 | |||
| 2002 | Ga0206353_11288135 | |||
| 2003 | Ga0214544_1000004 | |||
| 2004 | Ga0214542_1000442 | |||
| 2005 | Ga0214545_1000001 | |||
| 2006 | Ga0214543_1000006 | |||
| 2007 | Ga0213873_10010838 | |||
| 2008 | Ga0213873_10017755 | |||
| 2009 | Ga0213872_10030742 | |||
| 2010 | Ga0213876_10000775 | |||
| 2011 | Ga0213876_10143696 | |||
| 2012 | Ga0213875_10010732 | |||
| 2013 | Ga0213871_10061395 | |||
| 2014 | Ga0209563_100564 | |||
| 2015 | Ga0207425_1005910 | |||
| 2016 | Ga0209677_101733 | |||
| 2017 | Ga0209148_1000634 | |||
| 2018 | Ga0209148_1009582 | |||
| 2019 | Ga0209233_1001540 | |||
| 2020 | Ga0209233_1001832 | |||
| 2021 | Ga0209233_1003049 | |||
| 2022 | Ga0209233_1035287 | |||
| 2023 | Ga0209455_1001165 | |||
| 2024 | Ga0209455_1004508 | |||
| 2025 | Ga0209455_1007057 | |||
| 2026 | Ga0209564_1030527 | |||
| 2027 | Ga0209564_1031500 | |||
| 2028 | Ga0209564_1047122 | |||
| 2029 | Ga0209758_1000011 | |||
| 2030 | Ga0209758_1000359 | |||
| 2031 | Ga0209758_1000365 | |||
| 2032 | Ga0209758_1001403 | |||
| 2033 | Ga0209758_1003658 | |||
| 2034 | Ga0209758_1006509 | |||
| 2035 | Ga0209758_1033786 | |||
| 2036 | Ga0209256_1003144 | |||
| 2037 | Ga0207426_1000325 | |||
| 2038 | Ga0207426_1002810 | |||
| 2039 | Ga0209257_1001035 | |||
| 2040 | Ga0207697_10218823 | |||
| 2041 | Ga0207656_10025714 | |||
| 2042 | Ga0207656_10028607 | |||
| 2043 | Ga0207656_10043420 | |||
| 2044 | Ga0207656_10045878 | |||
| 2045 | Ga0207656_10186065 | |||
| 2046 | Ga0207696_1060228 | |||
| 2047 | Ga0207653_10027681 | |||
| 2048 | Ga0207682_10068394 | |||
| 2049 | Ga0207692_10000486 | |||
| 2050 | Ga0207692_10005589 | |||
| 2051 | Ga0207692_10018110 | |||
| 2052 | Ga0207692_10090520 | |||
| 2053 | Ga0207642_10055780 | |||
| 2054 | Ga0207710_10234281 | |||
| 2055 | Ga0207710_10288022 | |||
| 2056 | Ga0207710_10310381 | |||
| 2057 | Ga0207688_10024611 | |||
| 2058 | Ga0207688_10045627 | |||
| 2059 | Ga0207688_10170859 | |||
| 2060 | Ga0207688_10794165 | |||
| 2061 | Ga0207647_10000275 | |||
| 2062 | Ga0207647_10007934 | |||
| 2063 | Ga0207647_10041382 | |||
| 2064 | Ga0207685_10019520 | |||
| 2065 | Ga0207699_10000499 | |||
| 2066 | Ga0207699_10001305 | |||
| 2067 | Ga0207699_10007131 | |||
| 2068 | Ga0207699_10040172 | |||
| 2069 | Ga0207699_10076192 | |||
| 2070 | Ga0207699_10265824 | |||
| 2071 | Ga0207645_10234358 | |||
| 2072 | Ga0207645_10244686 | |||
| 2073 | Ga0207645_10418000 | |||
| 2074 | Ga0207705_10053050 | |||
| 2075 | Ga0207705_10070090 | |||
| 2076 | Ga0207705_10339336 | |||
| 2077 | Ga0207705_10396451 | |||
| 2078 | Ga0207684_10125074 | |||
| 2079 | Ga0207684_10744917 | |||
| 2080 | Ga0207654_10000663 | |||
| 2081 | Ga0207707_10000404 | |||
| 2082 | Ga0207707_10007729 | |||
| 2083 | Ga0207707_10055228 | |||
| 2084 | Ga0207707_10069843 | |||
| 2085 | Ga0207707_10164068 | |||
| 2086 | Ga0207707_10211901 | |||
| 2087 | Ga0207707_10235212 | |||
| 2088 | Ga0207695_10000008 | |||
| 2089 | Ga0207695_10004288 | |||
| 2090 | Ga0207695_10048296 | |||
| 2091 | Ga0207695_10471020 | |||
| 2092 | Ga0207695_10513561 | |||
| 2093 | Ga0207695_10665733 | |||
| 2094 | Ga0207695_11024758 | |||
| 2095 | Ga0207671_10014923 | |||
| 2096 | Ga0207671_10066737 | |||
| 2097 | Ga0207671_10128834 | |||
| 2098 | Ga0207671_10128984 | |||
| 2099 | Ga0207671_10203188 | |||
| 2100 | Ga0207671_10269985 | |||
| 2101 | Ga0207671_10477548 | |||
| 2102 | Ga0207693_10000910 | |||
| 2103 | Ga0207693_10002290 | |||
| 2104 | Ga0207693_10024119 | |||
| 2105 | Ga0207693_10060338 | |||
| 2106 | Ga0207663_10001370 | |||
| 2107 | Ga0207663_10009928 | |||
| 2108 | Ga0207663_10020578 | |||
| 2109 | Ga0207663_10025476 | |||
| 2110 | Ga0207663_10037072 | |||
| 2111 | Ga0207660_10002854 | |||
| 2112 | Ga0207660_10132699 | |||
| 2113 | Ga0207660_10326034 | |||
| 2114 | Ga0207662_10260798 | |||
| 2115 | Ga0207657_10004122 | |||
| 2116 | Ga0207657_10011792 | |||
| 2117 | Ga0207657_10181406 | |||
| 2118 | Ga0207657_10571574 | |||
| 2119 | Ga0207649_10387663 | |||
| 2120 | Ga0207649_10664844 | |||
| 2121 | Ga0207652_10002796 | |||
| 2122 | Ga0207652_10124913 | |||
| 2123 | Ga0207652_10149158 | |||
| 2124 | Ga0207652_10222844 | |||
| 2125 | Ga0207652_10330675 | |||
| 2126 | Ga0207652_10609912 | |||
| 2127 | Ga0207646_10045245 | |||
| 2128 | Ga0207646_10096344 | |||
| 2129 | Ga0207681_10093496 | |||
| 2130 | Ga0207694_10000050 | |||
| 2131 | Ga0207694_10017719 | |||
| 2132 | Ga0207694_10065611 | |||
| 2133 | Ga0207694_10109370 | |||
| 2134 | Ga0207694_10119443 | |||
| 2135 | Ga0207694_10285474 | |||
| 2136 | Ga0207694_10459403 | |||
| 2137 | Ga0207650_10172373 | |||
| 2138 | Ga0207650_10392577 | |||
| 2139 | Ga0207659_10718091 | |||
| 2140 | Ga0207659_11199850 | |||
| 2141 | Ga0207687_10024493 | |||
| 2142 | Ga0207687_10077219 | |||
| 2143 | Ga0207687_10496028 | |||
| 2144 | Ga0207687_10854247 | |||
| 2145 | Ga0207700_10006007 | |||
| 2146 | Ga0207700_10023644 | |||
| 2147 | Ga0207700_10086417 | |||
| 2148 | Ga0207700_10149910 | |||
| 2149 | Ga0207700_10378349 | |||
| 2150 | Ga0207700_10393825 | |||
| 2151 | Ga0207664_10005310 | |||
| 2152 | Ga0207664_10007756 | |||
| 2153 | Ga0207664_10169433 | |||
| 2154 | Ga0207664_10471417 | |||
| 2155 | Ga0207644_10168650 | |||
| 2156 | Ga0207644_10266123 | |||
| 2157 | Ga0207644_10338670 | |||
| 2158 | Ga0207644_10392419 | |||
| 2159 | Ga0207690_10096337 | |||
| 2160 | Ga0207690_10324240 | |||
| 2161 | Ga0207690_10461304 | |||
| 2162 | Ga0207690_10552483 | |||
| 2163 | Ga0207706_10067622 | |||
| 2164 | Ga0207706_10088708 | |||
| 2165 | Ga0207706_10224350 | |||
| 2166 | Ga0207709_10039609 | |||
| 2167 | Ga0207709_10281481 | |||
| 2168 | Ga0207709_10286525 | |||
| 2169 | Ga0207670_10333469 | |||
| 2170 | Ga0207669_10135195 | |||
| 2171 | Ga0207704_10740118 | |||
| 2172 | Ga0207665_10000537 | |||
| 2173 | Ga0207665_10145621 | |||
| 2174 | Ga0207665_10188231 | |||
| 2175 | Ga0207691_10042590 | |||
| 2176 | Ga0207691_10263628 | |||
| 2177 | Ga0207691_10331060 | |||
| 2178 | Ga0207711_10152478 | |||
| 2179 | Ga0207689_10146169 | |||
| 2180 | Ga0207689_10348705 | |||
| 2181 | Ga0207661_10001004 | |||
| 2182 | Ga0207661_10004383 | |||
| 2183 | Ga0207661_10077568 | |||
| 2184 | Ga0207661_10318299 | |||
| 2185 | Ga0207661_10490430 | |||
| 2186 | Ga0207679_10173346 | |||
| 2187 | Ga0207679_10194164 | |||
| 2188 | Ga0207667_10006495 | |||
| 2189 | Ga0207667_10034099 | |||
| 2190 | Ga0207667_10149610 | |||
| 2191 | Ga0207667_10233551 | |||
| 2192 | Ga0207667_10248165 | |||
| 2193 | Ga0207667_10260496 | |||
| 2194 | Ga0207667_10554443 | |||
| 2195 | Ga0207667_10611798 | |||
| 2196 | Ga0207667_10719815 | |||
| 2197 | Ga0207667_10896992 | |||
| 2198 | Ga0207651_10233566 | |||
| 2199 | Ga0207712_10005172 | |||
| 2200 | Ga0207712_10555027 | |||
| 2201 | Ga0207668_10003910 | |||
| 2202 | Ga0207668_10196775 | |||
| 2203 | Ga0207668_10371253 | |||
| 2204 | Ga0207640_10042961 | |||
| 2205 | Ga0207640_10057584 | |||
| 2206 | Ga0207640_10102749 | |||
| 2207 | Ga0207658_10570988 | |||
| 2208 | Ga0207677_10088394 | |||
| 2209 | Ga0207677_10412545 | |||
| 2210 | Ga0207703_11409709 | |||
| 2211 | Ga0207639_10033198 | |||
| 2212 | Ga0207639_10040580 | |||
| 2213 | Ga0207639_10058323 | |||
| 2214 | Ga0207639_10090237 | |||
| 2215 | Ga0207639_10187279 | |||
| 2216 | Ga0207639_10194833 | |||
| 2217 | Ga0207639_10221978 | |||
| 2218 | Ga0207639_10274406 | |||
| 2219 | Ga0207639_10447803 | |||
| 2220 | Ga0207639_10582269 | |||
| 2221 | Ga0207678_10023667 | |||
| 2222 | Ga0207678_10036614 | |||
| 2223 | Ga0207678_10098432 | |||
| 2224 | Ga0207678_10353911 | |||
| 2225 | Ga0207708_10037515 | |||
| 2226 | Ga0207708_10337010 | |||
| 2227 | Ga0207702_10000002 | |||
| 2228 | Ga0207702_10000243 | |||
| 2229 | Ga0207702_10030183 | |||
| 2230 | Ga0207641_10156631 | |||
| 2231 | Ga0207648_10091537 | |||
| 2232 | Ga0207648_11267658 | |||
| 2233 | Ga0207676_10171257 | |||
| 2234 | Ga0207676_10442007 | |||
| 2235 | Ga0207676_10810633 | |||
| 2236 | Ga0207674_10005330 | |||
| 2237 | Ga0207674_10011961 | |||
| 2238 | Ga0207674_10020302 | |||
| 2239 | Ga0207674_10117084 | |||
| 2240 | Ga0207674_10248958 | |||
| 2241 | Ga0207675_100043556 | |||
| 2242 | Ga0207675_100046342 | |||
| 2243 | Ga0207683_10012010 | |||
| 2244 | Ga0207683_10080862 | |||
| 2245 | Ga0207683_10437489 | |||
| 2246 | Ga0207683_10462637 | |||
| 2247 | Ga0207683_10471942 | |||
| 2248 | Ga0207698_10156633 | |||
| 2249 | Ga0207698_10190493 | |||
| 2250 | Ga0207698_11103392 | |||
| 2251 | Ga0209389_1000001 | |||
| 2252 | Ga0209389_1000412 | |||
| 2253 | Ga0209589_1000014 | |||
| 2254 | Ga0209589_1004063 | |||
| 2255 | Ga0209489_100014 | |||
| 2256 | Ga0209489_100090 | |||
| 2257 | Ga0209489_119775 | |||
| 2258 | Ga0209700_100007 | |||
| 2259 | Ga0209700_100024 | |||
| 2260 | Ga0209588_1016793 | |||
| 2261 | Ga0207428_10244784 | |||
| 2262 | Ga0207428_10292826 | |||
| 2263 | Ga0268266_10044745 | |||
| 2264 | Ga0268266_10050744 | |||
| 2265 | Ga0268266_10243604 | |||
| 2266 | Ga0268266_10253152 | |||
| 2267 | Ga0268266_10320016 | |||
| 2268 | Ga0268266_10330611 | |||
| 2269 | Ga0268266_10351395 | |||
| 2270 | Ga0268266_10385470 | |||
| 2271 | Ga0268266_10904473 | |||
| 2272 | Ga0268264_10106915 | |||
| 2273 | Ga0268264_10278126 | |||
| 2274 | Ga0268264_10341982 | |||
| 2275 | Ga0265337_1017079 | |||
| 2276 | Ga0265334_10032099 | |||
| 2277 | Ga0265323_10011044 | |||
| 2278 | Ga0265322_10031734 | |||
| 2279 | Ga0265336_10000588 | |||
| 2280 | Ga0307517_10003796 | |||
| 2281 | Ga0307517_10160945 | |||
| 2282 | Ga0307515_10058433 | |||
| 2283 | Ga0265338_10000034 | |||
| 2284 | Ga0265330_10019276 | |||
| 2285 | Ga0265332_10031873 | |||
| 2286 | Ga0265332_10074016 | |||
| 2287 | Ga0265328_10118669 | |||
| 2288 | Ga0265325_10013731 | |||
| 2289 | Ga0265339_10128371 | |||
| 2290 | Ga0265331_10118693 | |||
| 2291 | Ga0265331_10135429 | |||
| 2292 | Ga0265316_10319702 | |||
| 2293 | Ga0307513_10111708 | |||
| 2294 | Ga0307509_10421645 | |||
| 2295 | Ga0307408_100285562 | |||
| 2296 | Ga0307408_100561213 | |||
| 2297 | Ga0307508_10230354 | |||
| 2298 | Ga0307508_10567355 | |||
| 2299 | Ga0265342_10007820 | |||
| 2300 | Ga0265342_10242887 | |||
| 2301 | Ga0307516_10257684 | |||
| 2302 | Ga0307516_10477010 | |||
| 2303 | Ga0307405_10263065 | |||
| 2304 | Ga0307413_10028764 | |||
| 2305 | Ga0307406_10253636 | |||
| 2306 | Ga0307407_10367260 | |||
| 2307 | Ga0307412_10983757 | |||
| 2308 | Ga0307409_100157459 | |||
| 2309 | Ga0307409_101519026 | |||
| 2310 | Ga0307416_100226312 | |||
| 2311 | Ga0307416_100420186 | |||
| 2312 | Ga0307416_101440719 | |||
| 2313 | Ga0307414_10598804 | |||
| 2314 | Ga0307414_10987920 | |||
| 2315 | Ga0307411_10486095 | |||
| 2316 | Ga0307415_100177603 | |||
| 2317 | Ga0307415_100259957 | |||
| 2318 | Ga0307415_100286298 | |||
| 2319 | Ga0307510_10052013 | |||
| 2320 | Ga0307510_10068711 | |||
| 2321 | Ga0307510_10114422 | |||
| 2322 | Ga0307510_10192143 | |||
| 2323 | Ga0307510_10467721 | |||
| 2324 | Ga0315911_1000002 | |||
| 2325 | Ga0316214_1017221 | |||
| 2326 | Ga0373926_0017720 | |||
| 2327 | Ga0373926_0084438 | |||
| 2328 | Ga0373928_0035706 | |||
| 2329 | Ga0373929_0053446 | |||
| 2330 | Ga0373934_0018056 | |||
| 2331 | Ga0373934_0064143 | |||
| 2332 | Ga0373944_0070313 | |||
| 2333 | Ga0373923_0037190 | |||
| 2334 | Ga0373923_0265666 | |||
| 2335 | Ga0373936_0007741 | |||
| 2336 | Ga0373936_0105156 | |||
| 2337 | Ga0373936_0106712 | |||
| 2338 | Ga0373936_0180382 | |||
| 2339 | Ga0373941_0204678 | |||
| 2340 | Ga0373945_0002360 | |||
| 2341 | Ga0373945_0012335 | |||
| 2342 | Ga0373954_0008972 | |||
| 2343 | Ga0373954_0039614 | |||
| 2344 | Ga0373954_0073713 | |||
| 2345 | Ga0373956_0004542 | |||
| 2346 | Ga0373957_0040002 | |||
| 2347 | Ga0373957_0072525 | |||
| 2348 | Ga0373943_0009393 | |||
| 2349 | Ga0373943_0235169 | |||
| 2350 | Ga0373946_0004971 | |||
| 2351 | Ga0373946_0008733 | |||
| 2352 | Ga0373946_0034447 | |||
| 2353 | Ga0373946_0430168 | |||
| 2354 | Ga0373955_0046774 | |||
| 2355 | Ga0373955_0209330 | |||
| 2356 | Ga0373955_0387254 | |||
| 2357 | Ga0373931_0004151 | |||
| 2358 | Ga0373931_0414842 | |||
| 2359 | Ga0373931_0486722 | |||
| 2360 | Ga0373935_0004402 | |||
| 2361 | Ga0373927_0001631 | |||
| 2362 | Ga0373927_0001997 | |||
| 2363 | Ga0373927_0028844 | |||
| 2364 | Ga0373927_0042183 | |||
| 2365 | Ga0373927_0068557 | |||
| 2366 | Ga0373927_0114326 | |||
| 2367 | Ga0373927_0630595 | |||
| 2368 | Ga0373933_0000062 | |||
| 2369 | Ga0373933_0011368 | |||
| 2370 | Ga0373933_0061784 | |||
| 2371 | Ga0373933_0371836 | |||
| 2372 | Ga0373947_0021736 | |||
| 2373 | Ga0373947_0035316 | |||
| 2374 | Ga0373947_0038420 | |||
| 2375 | Ga0373937_0006410 | |||
| 2376 | Ga0373937_0043209 | |||
| 2377 | Ga0373937_0083596 | |||
| 2378 | Ga0373937_0114593 | |||
| 2379 | Ga0373937_0121290 | |||
| 2380 | Ga0373937_0133228 | |||
| 2381 | Ga0373937_0770753 | |||
| 2382 | Ga0373925_0009647 | |||
| 2383 | Ga0373925_0030941 | |||
| 2384 | Ga0373925_0039820 | |||
| 2385 | Ga0373925_0063389 | |||
| 2386 | Ga0373925_0310363 | |||
| 2387 | Ga0395899_0062545 | |||
| 2388 | Ga0395900_0001786 | |||
| 2389 | Ga0395900_0213132 | |||
| 2390 | Ga0395900_0256586 | |||
| 2391 | Ga0395900_0610524 | |||
| 2392 | Ga0395900_1380931 | |||
| 2393 | Ga0395898_0042027 | |||
| 2394 | Ga0395898_0042817 | |||
| 2395 | Ga0395898_0167294 | |||
| 2396 | Ga0395898_0200953 | |||
| 2397 | Ga0395898_0246436 | |||
| 2398 | Ga0395898_0467759 | |||
| 2399 | Ga0395905_0057784 | |||
| 2400 | Ga0395905_0817315 | |||
| 2401 | Ga0395905_0951001 | |||
| 2402 | Ga0436364_0209550 | |||
| 2403 | Ga0436364_0509683 | |||
| 2404 | Ga0436364_0527791 | |||
| 2405 | Ga0395901_0102502 | |||
| 2406 | Ga0395901_0118999 | |||
| 2407 | Ga0395901_0165792 | |||
| 2408 | Ga0395901_0964608 | |||
| 2409 | Ga0436365_0034335 | |||
| 2410 | Ga0436365_0100384 | |||
| 2411 | Ga0436365_0547824 | |||
| 2412 | Ga0436365_0993729 | |||
| 2413 | Ga0436365_1427844 | |||
| 2414 | Ga0436365_1635710 | |||
| 2415 | Ga0436365_1797109 | |||
| 2416 | Ga0436360_0065834 | |||
| 2417 | Ga0436360_0204027 | |||
| 2418 | Ga0436360_1203390 | |||
| 2419 | Ga0436361_0157270 | |||
| 2420 | Ga0436361_0547832 | |||
| 2421 | Ga0436363_0087654 | |||
| 2422 | Ga0436363_0180460 | |||
| 2423 | Ga0436363_0702233 | |||
| 2424 | Ga0436363_0821156 | |||
| 2425 | Ga0436363_1084799 | |||
| 2426 | Ga0436362_0127225 | |||
| 2427 | Ga0439465_0053981 | |||
| 2428 | Ga0451797_1414737 | |||
| 2429 | Ga0451800_1468852 | |||
| 2430 | Ga0451802_1696236 | |||
| 2431 | Ga0451853_2132757 | |||
| 2432 | Ga0439455_0122989 | |||
| 2433 | Ga0439434_0068670 | |||
| 2434 | Ga0439464_0035714 | |||
| 2435 | Ga0466969_0014467 | |||
| 2436 | Ga0466972_0000200 | |||
| 2437 | Ga0466972_0020843 | |||
| 2438 | Ga0466965_0133336 | |||
| 2439 | Ga0466965_0175398 | |||
| 2440 | Ga0466966_0021082 | |||
| 2441 | Ga0466966_0163185 | |||
| 2442 | Ga0466966_0170242 | |||
| 2443 | Ga0466961_0000102 | |||
| 2444 | Ga0466961_0105547 | |||
| 2445 | Ga0466963_0020583 | |||
| 2446 | Ga0466963_0039622 | |||
| 2447 | Ga0466963_0045767 | |||
| 2448 | Ga0466964_0035767 | |||
| 2449 | Ga0466964_0059951 | |||
| 2450 | Ga0466968_0240442 | |||
| 2451 | Ga0466970_0038748 | |||
| 2452 | Ga0466970_0066345 | |||
| 2453 | Ga0466970_0281871 | |||
| 2454 | Ga0466957_0019778 | |||
| 2455 | Ga0466957_0113952 | |||
| 2456 | Ga0466957_0132237 | |||
| 2457 | Ga0466960_0028887 | |||
| 2458 | Ga0466959_0018133 | |||
| 2459 | Ga0466959_0039738 | |||
| 2460 | Ga0466959_0081703 | |||
| 2461 | Ga0466967_0273467 | |||
| 2462 | Ga0466967_0437576 | |||
| 2463 | Ga0466967_0607532 | |||
| 2464 | Ga0495617_172680 | |||
| 2465 | Ga0495627_040068 | |||
| 2466 | Ga0495592_0055751 | |||
| 2467 | Ga0495592_0089446 | |||
| 2468 | Ga0495592_0100554 | |||
| 2469 | Ga0495592_0101010 | |||
| 2470 | Ga0495592_0162625 | |||
| 2471 | Ga0495592_0395241 | |||
| 2472 | Ga0495603_0013972 | |||
| 2473 | Ga0495603_0019223 | |||
| 2474 | Ga0495603_0074038 | |||
| 2475 | Ga0495603_0085847 | |||
| 2476 | Ga0495603_0090905 | |||
| 2477 | Ga0495603_0102791 | |||
| 2478 | Ga0495603_0119401 | |||
| 2479 | Ga0495603_0136023 | |||
| 2480 | Ga0495590_0142451 | |||
| 2481 | Ga0495591_046075 | |||
| 2482 | Ga0495629_0002784 | |||
| 2483 | Ga0495629_0005268 | |||
| 2484 | Ga0495629_0027516 | |||
| 2485 | Ga0495629_0198786 | |||
| 2486 | Ga0495629_0258872 | |||
| 2487 | Ga0495629_0671710 | |||
| 2488 | Ga0495638_0078309 | |||
| 2489 | Ga0495638_0233614 | |||
| 2490 | Ga0495638_0273366 | |||
| 2491 | Ga0495641_0015327 | |||
| 2492 | Ga0495641_0272156 | |||
| 2493 | Ga0495651_0013038 | |||
| 2494 | Ga0495651_0148477 | |||
| 2495 | Ga0495653_0138447 | |||
| 2496 | Ga0495653_0301727 | |||
| 2497 | Ga0495653_0329901 | |||
| 2498 | Ga0495650_0148050 | |||
| 2499 | Ga0495580_0005616 | |||
| 2500 | Ga0495580_0008118 | |||
| 2501 | Ga0495580_0341078 | |||
| 2502 | Ga0495582_0000228 | |||
| 2503 | Ga0495582_0008256 | |||
| 2504 | Ga0495582_0042985 | |||
| 2505 | Ga0495582_0116869 | |||
| 2506 | Ga0495605_0098350 | |||
| 2507 | Ga0495639_0000261 | |||
| 2508 | Ga0495639_0001957 | |||
| 2509 | Ga0495639_0069279 | |||
| 2510 | Ga0495662_0001403 | |||
| 2511 | Ga0495664_0009409 | |||
| 2512 | Ga0495664_0009558 | |||
| 2513 | Ga0495664_0035329 | |||
| 2514 | Ga0495664_0056486 | |||
| 2515 | Ga0495664_0068578 | |||
| 2516 | Ga0495664_0191208 | |||
| 2517 | Ga0495664_0632531 | |||
| 2518 | Ga0495584_0385235 | |||
| 2519 | Ga0495585_0091102 | |||
| 2520 | Ga0495585_0138573 | |||
| 2521 | Ga0495585_0164326 | |||
| 2522 | Ga0495585_0393394 | |||
| 2523 | Ga0495594_0010814 | |||
| 2524 | Ga0495594_0110971 | |||
| 2525 | Ga0495594_0281843 | |||
| 2526 | Ga0495594_0563621 | |||
| 2527 | Ga0495583_0129293 | |||
| 2528 | Ga0495606_0006063 | |||
| 2529 | Ga0495606_0069689 | |||
| 2530 | Ga0495606_0120178 | |||
| 2531 | Ga0495606_0206132 | |||
| 2532 | Ga0495606_0230739 | |||
| 2533 | Ga0495606_0308169 | |||
| 2534 | Ga0495608_0005477 | |||
| 2535 | Ga0495608_0097536 | |||
| 2536 | Ga0495608_0113242 | |||
| 2537 | Ga0495610_0124266 | |||
| 2538 | Ga0495610_0149908 | |||
| 2539 | Ga0495618_0234893 | |||
| 2540 | Ga0495620_0090521 | |||
| 2541 | Ga0495620_0208687 | |||
| 2542 | Ga0495628_0011105 | |||
| 2543 | Ga0495628_0018283 | |||
| 2544 | Ga0495628_0033468 | |||
| 2545 | Ga0495628_0149640 | |||
| 2546 | Ga0495628_0664461 | |||
| 2547 | Ga0495630_0001773 | |||
| 2548 | Ga0495630_0095136 | |||
| 2549 | Ga0495630_0154542 | |||
| 2550 | Ga0495631_0070805 | |||
| 2551 | Ga0495632_0078062 | |||
| 2552 | Ga0495632_0190862 | |||
| 2553 | Ga0495643_0010662 | |||
| 2554 | Ga0495644_0057469 | |||
| 2555 | Ga0495644_0065945 | |||
| 2556 | Ga0495648_0003345 | |||
| 2557 | Ga0495648_0094787 | |||
| 2558 | Ga0495666_0016454 | |||
| 2559 | Ga0495666_0265347 | |||
| 2560 | Ga0495666_0347335 | |||
| 2561 | Ga0495652_0019969 | |||
| 2562 | Ga0495652_0023429 | |||
| 2563 | Ga0495652_0038900 | |||
| 2564 | Ga0495652_0072785 | |||
| 2565 | Ga0495652_0174916 | |||
| 2566 | Ga0495652_0241049 | |||
| 2567 | Ga0495665_0023590 | |||
| 2568 | Ga0495665_0034460 | |||
| 2569 | Ga0495665_0107188 | |||
| 2570 | Ga0495665_0432133 | |||
| 2571 | Ga0495640_0007929 | |||
| 2572 | Ga0495640_0041460 | |||
| 2573 | Ga0495640_0092347 | |||
| 2574 | Ga0495586_0615133 | |||
| 2575 | Ga0495587_0089452 | |||
| 2576 | Ga0495587_0127645 | |||
| 2577 | Ga0495587_0177033 | |||
| 2578 | Ga0495587_0199967 | |||
| 2579 | Ga0495587_0214108 | |||
| 2580 | Ga0495587_0401774 | |||
| 2581 | Ga0495598_0066844 | |||
| 2582 | Ga0495609_0206913 | |||
| 2583 | Ga0495609_0265847 | |||
| 2584 | Ga0495645_0090596 | |||
| 2585 | Ga0495645_0285680 | |||
| 2586 | Ga0495622_0006509 | |||
| 2587 | Ga0495622_0096796 | |||
| 2588 | Ga0495622_0097866 | |||
| 2589 | Ga0495622_0222236 | |||
| 2590 | Ga0495622_0293355 | |||
| 2591 | Ga0495667_0005052 | |||
| 2592 | Ga0495667_0019161 | |||
| 2593 | Ga0495667_0093728 | |||
| 2594 | Ga0495667_0195344 | |||
| 2595 | Ga0495656_0020894 | |||
| 2596 | Ga0495656_0071487 | |||
| 2597 | Ga0495668_0021645 | |||
| 2598 | Ga0495668_0099916 | |||
| 2599 | Ga0495668_0232952 | |||
| 2600 | Ga0495668_0277403 | |||
| 2601 | Ga0495634_0003006 | |||
| 2602 | Ga0495634_0181976 | |||
| 2603 | Ga0495634_0279121 | |||
| 2604 | Ga0495634_0439895 | |||
| 2605 | Ga0495625_0114346 | |||
| 2606 | Ga0495635_0002773 | |||
| 2607 | Ga0495635_0062187 | |||
| 2608 | Ga0495635_0109045 | |||
| 2609 | Ga0495635_0142774 | |||
| 2610 | Ga0495635_0282736 | |||
| 2611 | Ga0495635_0344870 | |||
| 2612 | Ga0495661_0114807 | |||
| 2613 | Ga0495661_0165886 | |||
| 2614 | Ga0495588_0007973 | |||
| 2615 | Ga0495588_0062517 | |||
| 2616 | Ga0495588_0138678 | |||
| 2617 | Ga0495588_0192079 | |||
| 2618 | Ga0495588_0396481 | |||
| 2619 | Ga0495657_0004948 | |||
| 2620 | Ga0495657_0050289 | |||
| 2621 | Ga0495657_0270942 | |||
| 2622 | Ga0495657_0455890 | |||
| 2623 | Ga0495599_0015121 | |||
| 2624 | Ga0495599_0062978 | |||
| 2625 | Ga0495599_0149633 | |||
| 2626 | Ga0495599_0214701 | |||
| 2627 | Ga0495599_0538361 | |||
| 2628 | Ga0495623_0001850 | |||
| 2629 | Ga0495623_0009506 | |||
| 2630 | Ga0495623_0073594 | |||
| 2631 | Ga0495623_0139747 | |||
| 2632 | Ga0495646_0031462 | |||
| 2633 | Ga0495646_0065534 | |||
| 2634 | Ga0495646_0134112 | |||
| 2635 | Ga0495647_0362006 | |||
| 2636 | Ga0495658_0000941 | |||
| 2637 | Ga0495658_0121326 | |||
| 2638 | Ga0495658_0220495 | |||
| 2639 | Ga0495669_0133638 | |||
| 2640 | Ga0495669_0198135 | |||
| 2641 | Ga0495669_0377313 | |||
| 2642 | Ga0495613_0019620 | |||
| 2643 | Ga0495613_0023147 | |||
| 2644 | Ga0495613_0023549 | |||
| 2645 | Ga0495613_0466653 | |||
| 2646 | Ga0495624_0001434 | |||
| 2647 | Ga0495624_0025490 | |||
| 2648 | Ga0495670_0053226 | |||
| 2649 | Ga0495671_0207474 | |||
| 2650 | Ga0495589_0148538 | |||
| 2651 | Ga0495600_0000403 | |||
| 2652 | Ga0495600_0035078 | |||
| 2653 | Ga0495600_0083126 | |||
| 2654 | Ga0495600_0267614 | |||
| 2655 | Ga0495600_0356871 | |||
| 2656 | Ga0495600_0430627 | |||
| 2657 | Ga0495581_0001142 | |||
| 2658 | Ga0495581_0023132 | |||
| 2659 | Ga0495604_0008342 | |||
| 2660 | Ga0495604_0046930 | |||
| 2661 | Ga0495604_0108519 | |||
| 2662 | Ga0495604_0271175 | |||
| 2663 | Ga0495604_0343934 | |||
| 2664 | Ga0495604_0541541 | |||
| 2665 | Ga0495674_0001977 | |||
| 2666 | Ga0495674_0005615 | |||
| 2667 | Ga0495674_0068279 | |||
| 2668 | Ga0495674_0076517 | |||
| 2669 | Ga0495674_0122252 | |||
| 2670 | Ga0495672_0103080 | |||
| 2671 | Ga0495672_0274691 | |||
| 2672 | Ga0495676_0054558 | |||
| 2673 | Ga0495676_0087817 | |||
| 2674 | Ga0495676_0129745 | |||
| 2675 | Ga0495676_0185185 | |||
| 2676 | Ga0495676_0353094 | |||
| 2677 | Ga0495680_0088283 | |||
| 2678 | Ga0495680_0133516 | |||
| 2679 | Ga0495680_0276179 | |||
| 2680 | Ga0495687_045232 | |||
| 2681 | Ga0495675_0009532 | |||
| 2682 | Ga0495675_0059657 | |||
| 2683 | Ga0495675_0124324 | |||
| 2684 | Ga0495675_0159215 | |||
| 2685 | Ga0495675_0230386 | |||
| 2686 | Ga0495675_0326294 | |||
| 2687 | Ga0495675_0449968 | |||
| 2688 | Ga0495677_0172982 | |||
| 2689 | Ga0495679_026015 | |||
| 2690 | Ga0495673_0055161 | |||
| 2691 | Ga0495673_0076703 | |||
| 2692 | Ga0495673_0207860 | |||
| 2693 | Ga0495681_0282418 | |||
| 2694 | Ga0495684_0008846 | |||
| 2695 | Ga0495684_0028651 | |||
| 2696 | Ga0495684_0030022 | |||
| 2697 | Ga0495684_0392709 | |||
| 2698 | Ga0495686_0021356 | |||
| 2699 | Ga0495593_0002128 | |||
| 2700 | Ga0495593_0023793 | |||
| 2701 | Ga0495593_0100701 | |||
| 2702 | Ga0495593_0123546 | |||
| 2703 | Ga0495593_0232773 | |||
| 2704 | Ga0495602_0010811 | |||
| 2705 | Ga0495602_0043422 | |||
| 2706 | Ga0495602_0311354 | |||
| 2707 | Ga0495602_0432035 | |||
| 2708 | Ga0495614_0069220 | |||
| 2709 | Ga0495614_0313806 | |||
| 2710 | Ga0495615_0044726 | |||
| 2711 | Ga0495615_0149566 | |||
| 2712 | Ga0496100_0002855 | |||
| 2713 | Ga0496100_0042265 | |||
| 2714 | Ga0496100_0047384 | |||
| 2715 | Ga0496100_0490661 | |||
| 2716 | Ga0496100_0663951 | |||
| 2717 | Ga0496101_0015791 | |||
| 2718 | Ga0496101_0096186 | |||
| 2719 | Ga0496101_0289790 | |||
| 2720 | Ga0496101_0425035 | |||
| 2721 | Ga0496101_0453714 | |||
| 2722 | Ga0496101_0917624 | |||
| 2723 | Ga0496102_0005213 | |||
| 2724 | Ga0496102_0007639 | |||
| 2725 | Ga0496102_0069908 | |||
| 2726 | Ga0496102_0200857 | |||
| 2727 | Ga0496102_0241013 | |||
| 2728 | Ga0496102_0476522 | |||
| 2729 | Ga0496102_0525328 | |||
| 2730 | Ga0496102_0858996 | |||
| 2731 | Ga0496103_0085102 | |||
| 2732 | Ga0496103_0180736 | |||
| 2733 | Ga0496103_0182102 | |||
| 2734 | Ga0496103_0337615 | |||
| 2735 | Ga0496104_0000430 | |||
| 2736 | Ga0496104_0007365 | |||
| 2737 | Ga0496104_0053657 | |||
| 2738 | Ga0496104_0093136 | |||
| 2739 | Ga0496104_0314308 | |||
| 2740 | Ga0496104_0355902 | |||
| 2741 | Ga0496104_0397372 | |||
| 2742 | Ga0496104_0675097 | |||
| 2743 | Ga0496105_0006356 | |||
| 2744 | Ga0496105_0008068 | |||
| 2745 | Ga0496105_0210849 | |||
| 2746 | Ga0496105_0362012 | |||
| 2747 | Ga0496105_0510909 | |||
| 2748 | Ga0496106_0005044 | |||
| 2749 | Ga0496106_0010296 | |||
| 2750 | Ga0496106_0039463 | |||
| 2751 | Ga0496106_0082059 | |||
| 2752 | Ga0496106_0164852 | |||
| 2753 | Ga0496106_0203985 | |||
| 2754 | Ga0496106_0301645 | |||
| 2755 | Ga0496106_0555811 | |||
| 2756 | Ga0496107_0007983 | |||
| 2757 | Ga0496107_0078980 | |||
| 2758 | Ga0496107_0185280 | |||
| 2759 | Ga0496107_0195536 | |||
| 2760 | Ga0496107_0235672 | |||
| 2761 | Ga0496107_0345446 | |||
| 2762 | Ga0496107_0397923 | |||
| 2763 | Ga0496108_0000415 | |||
| 2764 | Ga0496108_0013533 | |||
| 2765 | Ga0496108_0016710 | |||
| 2766 | Ga0496108_0020318 | |||
| 2767 | Ga0496108_0229718 | |||
| 2768 | Ga0496108_0505210 | |||
| 2769 | Ga0496109_0000759 | |||
| 2770 | Ga0496109_0083699 | |||
| 2771 | Ga0496109_0151320 | |||
| 2772 | Ga0496109_0182669 | |||
| 2773 | Ga0496109_0518079 | |||
| 2774 | Ga0496109_0701566 | |||
| 2775 | Ga0496109_0716436 | |||
| 2776 | Ga0496109_0918292 | |||
| 2777 | Ga0496110_0011522 | |||
| 2778 | Ga0496110_0104597 | |||
| 2779 | Ga0496110_0116790 | |||
| 2780 | Ga0496110_0132410 | |||
| 2781 | Ga0496110_0743667 | |||
| 2782 | Ga0496111_0021000 | |||
| 2783 | Ga0496111_0040423 | |||
| 2784 | Ga0496111_0123868 | |||
| 2785 | Ga0496111_0146765 | |||
| 2786 | Ga0496111_0397653 | |||
| 2787 | Ga0496111_0774996 | |||
| 2788 | Ga0496112_0000395 | |||
| 2789 | Ga0496112_0007176 | |||
| 2790 | Ga0496112_0007941 | |||
| 2791 | Ga0496112_0026148 | |||
| 2792 | Ga0496112_0034003 | |||
| 2793 | Ga0496112_0156929 | |||
| 2794 | Ga0496113_0014492 | |||
| 2795 | Ga0496113_0014638 | |||
| 2796 | Ga0496113_0071846 | |||
| 2797 | Ga0496113_0133548 | |||
| 2798 | Ga0496113_0193833 | |||
| 2799 | Ga0496113_0315234 | |||
| 2800 | Ga0496113_0677811 | |||
| 2801 | Ga0496113_0821187 | |||
| 2802 | Ga0496114_0024690 | |||
| 2803 | Ga0496114_0030586 | |||
| 2804 | Ga0496114_0057160 | |||
| 2805 | Ga0496114_0327023 | |||
| 2806 | Ga0496114_0509487 | |||
| 2807 | Ga0496114_0522648 | |||
| 2808 | Ga0496115_0018252 | |||
| 2809 | Ga0496115_0046676 | |||
| 2810 | Ga0496115_0088598 | |||
| 2811 | Ga0496115_0101117 | |||
| 2812 | Ga0496115_0115409 | |||
| 2813 | Ga0496115_0137874 | |||
| 2814 | Ga0496115_0142334 | |||
| 2815 | Ga0496115_0389916 | |||
| 2816 | Ga0496115_0460957 | |||
| 2817 | Ga0496117_0121610 | |||
| 2818 | Ga0496117_0153162 | |||
| 2819 | Ga0496118_0017746 | |||
| 2820 | Ga0496118_0059322 | |||
| 2821 | Ga0496118_0109246 | |||
| 2822 | Ga0496118_0164266 | |||
| 2823 | Ga0496118_0373694 | |||
| 2824 | Ga0496119_0014065 | |||
| 2825 | Ga0496119_0065340 | |||
| 2826 | Ga0496120_0005770 | |||
| 2827 | Ga0496120_0028452 | |||
| 2828 | Ga0496121_0000885 | |||
| 2829 | Ga0496121_0004207 | |||
| 2830 | Ga0496121_0015422 | |||
| 2831 | Ga0496121_0079646 | |||
| 2832 | Ga0496121_0082803 | |||
| 2833 | Ga0496121_0114112 | |||
| 2834 | Ga0496121_0120484 | |||
| 2835 | Ga0496121_0168711 | |||
| 2836 | Ga0496121_0176872 | |||
| 2837 | Ga0496121_0198829 | |||
| 2838 | Ga0496121_0292310 | |||
| 2839 | Ga0496122_0219560 | |||
| 2840 | Ga0496124_0120907 | |||
| 2841 | Ga0496124_0135858 | |||
| 2842 | Ga0496124_0153877 | |||
| 2843 | Ga0496124_0190856 | |||
| 2844 | Ga0496125_0000040 | |||
| 2845 | Ga0496125_0001136 | |||
| 2846 | Ga0496125_0042098 | |||
| 2847 | Ga0496125_0078875 | |||
| 2848 | Ga0496125_0110848 | |||
| 2849 | Ga0496125_0145890 | |||
| 2850 | Ga0496126_0003396 | |||
| 2851 | Ga0496126_0016014 | |||
| 2852 | Ga0496126_0022608 | |||
| 2853 | Ga0496126_0025615 | |||
| 2854 | Ga0496126_0036244 | |||
| 2855 | Ga0496126_0037427 | |||
| 2856 | Ga0496126_0037738 | |||
| 2857 | Ga0496126_0038017 | |||
| 2858 | Ga0496126_0045586 | |||
| 2859 | Ga0496126_0059106 | |||
| 2860 | Ga0496126_0268528 | |||
| 2861 | Ga0496126_0282343 | |||
| 2862 | Ga0496126_0295050 | |||
| 2863 | Ga0496126_0410197 | |||
| 2864 | Ga0496126_0482588 | |||
| 2865 | Ga0496126_0705476 | |||
| 2866 | Ga0501031_0008325 | |||
| 2867 | Ga0501031_0234793 | |||
| 2868 | Ga0501031_0333238 | |||
| 2869 | Ga0501031_0335740 | |||
| 2870 | Ga0501031_0530970 | |||
| 2871 | Ga0501032_0000038 | |||
| 2872 | Ga0501032_0058768 | |||
| 2873 | Ga0501032_0082953 | |||
| 2874 | Ga0501032_0435466 | |||
| 2875 | Ga0501033_0000089 | |||
| 2876 | Ga0501033_0021064 | |||
| 2877 | Ga0501033_0172126 | |||
| 2878 | Ga0501034_0000228 | |||
| 2879 | Ga0501034_0095311 | |||
| 2880 | Ga0501034_0111412 | |||
| 2881 | Ga0501034_1273233 | |||
| 2882 | Ga0501036_0000010 | |||
| 2883 | Ga0501036_0163132 | |||
| 2884 | Ga0501036_0195905 | |||
| 2885 | Ga0501036_0308082 | |||
| 2886 | Ga0501036_0317741 | |||
| 2887 | Ga0501036_0445764 | |||
| 2888 | Ga0501037_0000291 | |||
| 2889 | Ga0501037_0016257 | |||
| 2890 | Ga0501037_0127938 | |||
| 2891 | Ga0501037_0226343 | |||
| 2892 | Ga0501037_0234471 | |||
| 2893 | Ga0501038_0000079 | |||
| 2894 | Ga0501038_0004207 | |||
| 2895 | Ga0501038_0029528 | |||
| 2896 | Ga0501038_0118858 | |||
| 2897 | Ga0501038_0164126 | |||
| 2898 | Ga0501038_0429972 | |||
| 2899 | Ga0501038_0445062 | |||
| 2900 | Ga0501039_0000616 | |||
| 2901 | Ga0501039_0032299 | |||
| 2902 | Ga0501039_0096203 | |||
| 2903 | Ga0501039_0101672 | |||
| 2904 | Ga0501039_0124252 | |||
| 2905 | Ga0501040_0040512 | |||
| 2906 | Ga0501040_0364192 | |||
| 2907 | Ga0501042_0011053 | |||
| 2908 | Ga0501043_0000021 | |||
| 2909 | Ga0501043_0006770 | |||
| 2910 | Ga0501043_0020635 | |||
| 2911 | Ga0501043_0027533 | |||
| 2912 | Ga0501043_0189099 | |||
| 2913 | Ga0501043_0209037 | |||
| 2914 | Ga0501046_0007870 | |||
| 2915 | Ga0501046_0044634 | |||
| 2916 | Ga0501046_0049136 | |||
| 2917 | Ga0501047_0000041 | |||
| 2918 | Ga0501047_0003510 | |||
| 2919 | Ga0501047_0009705 | |||
| 2920 | Ga0501047_0014189 | |||
| 2921 | Ga0501047_0017439 | |||
| 2922 | Ga0501047_0125899 | |||
| 2923 | Ga0501047_0192433 | |||
| 2924 | Ga0501048_0000954 | |||
| 2925 | Ga0501048_0786463 | |||
| 2926 | Ga0501067_0002822 | |||
| 2927 | Ga0501067_0006812 | |||
| 2928 | Ga0501068_0000285 | |||
| 2929 | Ga0501068_0044949 | |||
| 2930 | Ga0501069_0001245 | |||
| 2931 | Ga0501069_0004522 | |||
| 2932 | Ga0501070_0000986 | |||
| 2933 | Ga0501070_0021595 | |||
| 2934 | Ga0501070_0046634 | |||
| 2935 | Ga0501070_0096975 | |||
| 2936 | Ga0501070_0288187 | |||
| 2937 | Ga0501070_0413858 | |||
| 2938 | Ga0501071_0045361 | |||
| 2939 | Ga0501071_0048337 | |||
| 2940 | Ga0501071_0343702 | |||
| 2941 | Ga0501072_0005779 | |||
| 2942 | Ga0501072_0026701 | |||
| 2943 | Ga0501073_0000056 | |||
| 2944 | Ga0501073_0019072 | |||
| 2945 | Ga0501073_0110358 | |||
| 2946 | Ga0501073_0517289 | |||
| 2947 | Ga0501074_0012527 | |||
| 2948 | Ga0501074_0157621 | |||
| 2949 | Ga0501074_0478203 | |||
| 2950 | Ga0501076_0036855 | |||
| 2951 | Ga0501076_0123182 | |||
| 2952 | Ga0501079_0001576 | |||
| 2953 | Ga0501079_0209244 | |||
| 2954 | Ga0501079_0461240 | |||
| 2955 | Ga0501080_0000138 | |||
| 2956 | Ga0501080_0002680 | |||
| 2957 | Ga0501080_0005281 | |||
| 2958 | Ga0501080_0098917 | |||
| 2959 | Ga0501081_0677475 | |||
| 2960 | Ga0501083_0004205 | |||
| 2961 | Ga0501083_0041698 | |||
| 2962 | Ga0501035_0000090 | |||
| 2963 | Ga0501035_0004898 | |||
| 2964 | Ga0501035_0144468 | |||
| 2965 | Ga0501035_0158324 | |||
| 2966 | Ga0501035_0543370 | |||
| 2967 | Ga0501035_0586975 | |||
| 2968 | Ga0501044_0000054 | |||
| 2969 | Ga0501044_0008668 | |||
| 2970 | Ga0501044_0012007 | |||
| 2971 | Ga0501044_0034079 | |||
| 2972 | Ga0501044_0047391 | |||
| 2973 | Ga0501044_0066366 | |||
| 2974 | Ga0501044_0176294 | |||
| 2975 | Ga0501044_0378461 | |||
| 2976 | Ga0501044_0553213 | |||
| 2977 | Ga0501044_0590767 | |||
| 2978 | Ga0501044_0695218 | |||
| 2979 | Ga0501045_0009955 | |||
| 2980 | nmdc:mga03n38_185037_c1 | |||
| 2981 | nmdc:mga03n38_209046_c1 | |||
| 2982 | nmdc:mga0yw44_22683_c1 | |||
| 2983 | nmdc:mga0yw44_57354_c1 | |||
| 2984 | nmdc:mga0k408_138705_c1 | |||
| 2985 | nmdc:mga0k408_36679_c1 | |||
| 2986 | nmdc:mga06z11_155886_c1 | |||
| 2987 | nmdc:mga06z11_344240_c1 | |||
| 2988 | nmdc:mga06z11_436833_c1 | |||
| 2989 | nmdc:mga07m45_91212_c1 | |||
| 2990 | nmdc:mga07m45_96862_c1 | |||
| 2991 | nmdc:mga09592_770843_c1 | |||
| 2992 | nmdc:mga08y16_895554_c1 | |||
| 2993 | nmdc:mga0n895_421678_c1 | |||
| 2994 | nmdc:mga0rr50_60914_c1 | |||
| 2995 | nmdc:mga0a205_522343_c1 | |||
| 2996 | nmdc:mga0sz30_12372_c1 | |||
| 2997 | nmdc:mga0sz30_53076_c1 | |||
| 2998 | Ga0495601_0021028 | |||
| 2999 | Ga0495601_0028181 | |||
| 3000 | Ga0495601_0066479 | |||
| 3001 | Ga0495601_0135398 | |||
| 3002 | Ga0495601_0531443 | |||
| 3003 | Ga0495612_0017545 | |||
| 3004 | Ga0500610_0177009 | |||
| 3005 | Ga0500635_0000944 | |||
| 3006 | Ga0495655_0005420 | |||
| 3007 | Ga0495595_0033631 | |||
| 3008 | Ga0495619_0016517 | |||
| 3009 | Ga0495619_0034063 | |||
| 3010 | Ga0495619_0060466 | |||
| 3011 | Ga0495619_0119026 | |||
| 3012 | Ga0495619_0122981 | |||
| 3013 | Ga0495619_0515717 | |||
| 3014 | Ga0500578_0136663 | |||
| 3015 | Ga0500643_000046 | |||
| 3016 | Ga0500643_039916 | |||
| 3017 | Ga0500583_0150434 | |||
| 3018 | Ga0500566_0000048 | |||
| 3019 | Ga0500566_0000301 | |||
| 3020 | Ga0500566_0013839 | |||
| 3021 | Ga0500640_000691 | |||
| 3022 | Ga0500641_0065898 | |||
| 3023 | Ga0500554_006294 | |||
| 3024 | Ga0500555_007051 | |||
| 3025 | Ga0500556_0013241 | |||
| 3026 | Ga0500557_000020 | |||
| 3027 | Ga0500558_201039 | |||
| 3028 | Ga0500562_025281 | |||
| 3029 | Ga0500572_000045 | |||
| 3030 | Ga0500572_000352 | |||
| 3031 | Ga0500572_002884 | |||
| 3032 | Ga0500591_003235 | |||
| 3033 | Ga0500594_0007961 | |||
| 3034 | Ga0500595_000494 | |||
| 3035 | Ga0500595_010569 | |||
| 3036 | Ga0500595_031885 | |||
| 3037 | Ga0500595_054767 | |||
| 3038 | Ga0500595_095321 | |||
| 3039 | Ga0500607_007093 | |||
| 3040 | Ga0500608_023055 | |||
| 3041 | Ga0500608_069772 | |||
| 3042 | Ga0500614_021046 | |||
| 3043 | Ga0500614_131085 | |||
| 3044 | Ga0500617_142212 | |||
| 3045 | Ga0500655_010901 | |||
| 3046 | Ga0500655_020904 | |||
| 3047 | Ga0500559_0000099 | |||
| 3048 | Ga0500559_0002781 | |||
| 3049 | Ga0500559_0017178 | |||
| 3050 | Ga0500559_0133710 | |||
| 3051 | Ga0500559_0347311 | |||
| 3052 | Ga0500568_0037159 | |||
| 3053 | Ga0500568_0091119 | |||
| 3054 | Ga0500577_0000025 | |||
| 3055 | Ga0500588_0231680 | |||
| 3056 | Ga0500589_127632 | |||
| 3057 | Ga0500590_149485 | |||
| 3058 | Ga0500603_000041 | |||
| 3059 | Ga0500603_000138 | |||
| 3060 | Ga0500603_043687 | |||
| 3061 | Ga0500606_179728 | |||
| 3062 | Ga0500616_0000002 | |||
| 3063 | Ga0500616_0043757 | |||
| 3064 | Ga0500620_016427 | |||
| 3065 | Ga0500622_0004044 | |||
| 3066 | Ga0500627_0068451 | |||
| 3067 | Ga0500630_001433 | |||
| 3068 | Ga0500634_0041301 | |||
| 3069 | Ga0500634_0118884 | |||
| 3070 | Ga0500638_030569 | |||
| 3071 | Ga0500638_037572 | |||
| 3072 | Ga0500638_084347 | |||
| 3073 | Ga0500638_156214 | |||
| 3074 | Ga0500639_000228 | |||
| 3075 | Ga0500639_083116 | |||
| 3076 | Ga0500636_0000173 | |||
| 3077 | Ga0500636_0009981 | |||
| 3078 | Ga0500636_0021705 | |||
| 3079 | Ga0500636_0228874 | |||
| 3080 | Ga0500637_0000162 | |||
| 3081 | Ga0500637_0000555 | |||
| 3082 | Ga0500637_0028427 | |||
| 3083 | Ga0500576_053151 | |||
| 3084 | Ga0500609_002640 | |||
| 3085 | Ga0500656_040104 | |||
| 3086 | Ga0500596_002664 | |||
| 3087 | Ga0500599_012403 | |||
| 3088 | Ga0500601_000334 | |||
| 3089 | Ga0501084_0001679 | |||
| 3090 | Ga0501084_0020524 | |||
| 3091 | Ga0500661_000236 | |||
| 3092 | Ga0500661_057368 | |||
| 3093 | Ga0501082_0006099 | |||
| 3094 | Ga0501082_0116934 | |||
| 3095 | Ga0530510_0328515 | |||
| 3096 | 2507507825 | |||
| 3097 | 2508541936 | |||
| 3098 | 2508692515 | |||
| 3099 | 2511397361 | |||
| 3100 | 2513622894 | |||
| 3101 | 2513639272 | |||
| 3102 | 2513647363 | |||
| 3103 | 2513653951 | |||
| 3104 | 2513676223 | |||
| 3105 | 2513695766 | |||
| 3106 | 2513700876 | |||
| 3107 | 2513715373 | |||
| 3108 | 2513856385 | |||
| 3109 | 2513878215 | |||
| 3110 | 2513891416 | |||
| 3111 | 2513918291 | |||
| 3112 | 2514009596 | |||
| 3113 | 2515626733 | |||
| 3114 | 2517103986 | |||
| 3115 | 2517891479 | |||
| 3116 | 2524470319 | |||
| 3117 | 2524538340 | |||
| 3118 | 2528852614 | |||
| 3119 | 2603861476 | |||
| 3120 | 2617346631 | |||
| 3121 | 2617372566 | |||
| 3122 | 2644291429 | |||
| 3123 | 2671118755 | |||
| 3124 | 2723847216 | |||
| 3125 | 2728754858 | |||
| 3126 | 2745080632 | |||
| 3127 | 2793064510 | |||
| 3128 | 2793066847 | |||
| 3129 | 2793084176 | |||
| 3130 | 2805919220 | |||
| 3131 | 2818236400 | |||
| 3132 | 2824605401 | |||
| 3133 | 2824613571 | |||
| 3134 | 2824621434 | |||
| 3135 | 2824630505 | |||
| 3136 | 2824638794 | |||
| 3137 | 2824657621 | |||
| 3138 | 2824668094 | |||
| 3139 | 2824675940 | |||
| 3140 | 2824683050 | |||
| 3141 | 2824692135 | |||
| 3142 | 2824726235 | |||
| 3143 | 2824735795 | |||
| 3144 | 2824747004 | |||
| 3145 | 2824755621 | |||
| 3146 | 2824766284 | |||
| 3147 | 2824777382 | |||
| 3148 | 2838128956 | |||
| 3149 | 2841944888 | |||
| 3150 | 2841953314 | |||
| 3151 | 2841959840 | |||
| 3152 | 2841972206 | |||
| 3153 | 2841978039 | |||
| 3154 | 2841986331 | |||
| 3155 | 2842040488 | |||
| 3156 | 2842046567 | |||
| 3157 | 2844319872 | |||
| 3158 | 2847937190 | |||
| 3159 | 2847947575 | |||
| 3160 | 2849078549 | |||
| 3161 | 2857512910 | |||
| 3162 | 2857528414 | |||
| 3163 | 2874598934 | |||
| 3164 | 2874611021 | |||
| 3165 | 2874614743 | |||
| 3166 | 2874622256 | |||
| 3167 | 2874635179 | |||
| 3168 | 2874650617 | |||
| 3169 | 2876764173 | |||
| 3170 | 2876778973 | |||
| 3171 | 2876814487 | |||
| 3172 | 2876824132 | |||
| 3173 | 2879082766 | |||
| 3174 | 2879089145 | |||
| 3175 | 2879105618 | |||
| 3176 | 2879114586 | |||
| 3177 | 2879132072 | |||
| 3178 | 2879148401 | |||
| 3179 | 2881364790 | |||
| 3180 | 2881671905 | |||
| 3181 | 2885369807 | |||
| 3182 | 2885377816 | |||
| 3183 | 2885390304 | |||
| 3184 | 2888385298 | |||
| 3185 | 2888392949 | |||
| 3186 | 2888425448 | |||
| 3187 | 2889038156 | |||
| 3188 | 2893068821 | |||
| 3189 | 2903730457 | |||
| 3190 | 2903758739 | |||
| 3191 | 2903772997 | |||
| 3192 | 2904667867 | |||
| 3193 | 2904691331 | |||
| 3194 | 2904704822 | |||
| 3195 | 2904712135 | |||
| 3196 | 2906609744 | |||
| 3197 | 2906616655 | |||
| 3198 | 2906632374 | |||
| 3199 | 2906643711 | |||
| 3200 | 2906646970 | |||
| 3201 | 2906666982 | |||
| 3202 | 2908741821 | |||
| 3203 | 2908759025 | |||
| 3204 | 2908781015 | |||
| 3205 | 2919075871 | |||
| 3206 | 2922368547 | |||
| 3207 | 2922372598 | |||
| 3208 | 2922387477 | |||
| 3209 | 2922397225 | |||
| 3210 | 2922431322 | |||
| 3211 | 2929620409 | |||
| 3212 | 2929626302 | |||
| 3213 | 2932784822 | |||
| 3214 | 2932795300 | |||
| 3215 | 2932805832 | |||
| 3216 | 2932809855 | |||
| 3217 | 2932818401 | |||
| 3218 | 2932828658 | |||
| 3219 | 2933582327 | |||
| 3220 | 2935609682 | |||
| 3221 | 2935619920 | |||
| 3222 | 2935633914 | |||
| 3223 | 2935638903 | |||
| 3224 | 2935652173 | |||
| 3225 | 2935660755 | |||
| 3226 | 2935666246 | |||
| 3227 | 2935676708 | |||
| 3228 | 2935685097 | |||
| 3229 | 2935694786 | |||
| 3230 | 2935703909 | |||
| 3231 | 2935713650 | |||
| 3232 | 2935724270 | |||
| 3233 | 2935733372 | |||
| 3234 | 2935742751 | |||
| 3235 | 2935751062 | |||
| 3236 | 2935760415 | |||
| 3237 | 2935772083 | |||
| 3238 | 2935784260 | |||
| 3239 | 2935787530 | |||
| 3240 | 2935796161 | |||
| 3241 | 2935802045 | |||
| 3242 | 2935810814 | |||
| 3243 | 2935822844 | |||
| 3244 | 2935828397 | |||
| 3245 | 2935839812 | |||
| 3246 | 2935848426 | |||
| 3247 | 2935857765 | |||
| 3248 | 2935868894 | |||
| 3249 | 2935874309 | |||
| 3250 | 2935883803 | |||
| 3251 | 2935909769 | |||
| 3252 | 2935917494 | |||
| 3253 | 2935927250 | |||
| 3254 | 2935936906 | |||
| 3255 | 2935944791 | |||
| 3256 | 2935953228 | |||
| 3257 | 2935961269 | |||
| 3258 | 2935970068 | |||
| 3259 | 2935980376 | |||
| 3260 | 2935986639 | |||
| 3261 | 2935992765 | |||
| 3262 | 2936002678 | |||
| 3263 | 2936014811 | |||
| 3264 | 2936022208 | |||
| 3265 | 2936032896 | |||
| 3266 | 2936037766 | |||
| 3267 | 2936050552 | |||
| 3268 | 2936059672 | |||
| 3269 | 2940558135 | |||
| 3270 | 2941510783 | |||
| 3271 | 2941518167 | |||
| 3272 | 2941526962 | |||
| 3273 | 2941531059 | |||
| 3274 | 2941540847 | |||
| 3275 | 3005481116 | |||
| 3276 | 3005484949 | |||
| 3277 | 3005508575 | |||
| 3278 | 3005587224 | |||
| 3279 | 3005600143 | |||
| 3280 | 3005715667 | |||
| 3281 | 3005723001 | |||
| 3282 | 8006927857 | |||
| 3283 | 8006939593 | |||
| 3284 | 8006968414 | |||
| 3285 | 8006979344 | |||
| 3286 | 8006989239 | |||
| 3287 | 8006994850 | |||
| 3288 | 8016520827 | |||
| 3289 | 8016528840 | |||
| 3290 | 8016534027 | |||
| 3291 | 8016547251 | |||
| 3292 | 8016554880 | |||
| 3293 | 8016563245 | |||
| 3294 | 8016576545 | |||
| 3295 | 8016594118 | |||
| 3296 | 8016609459 | |||
| 3297 | 8016615448 | |||
| 3298 | 8016625767 | |||
| 3299 | 8016639343 | |||
| 3300 | 8017064763 | |||
| 3301 | 8019533794 | |||
| 3302 | 8019545871 | |||
| 3303 | 8019552854 | |||
| 3304 | 8019565486 | |||
| 3305 | 8019575581 | |||
| 3306 | 8019584136 | |||
| 3307 | 8019591893 | |||
| 3308 | 8019599390 | |||
| 3309 | 8019608967 | |||
| 3310 | 8019619635 | |||
| 3311 | 8019633478 | |||
| 3312 | 8019646419 | |||
| 3313 | 8019649180 | |||
| 3314 | 8019661363 | |||
| 3315 | 8019670904 | |||
| 3316 | 8019685291 | |||
| 3317 | 8019690914 | |||
| 3318 | 8055745271 | |||
| 3319 | 8056679422 | |||
| 3320 | 8056684935 | |||
| 3321 | 8056693440 | |||
| 3322 | 8056968892 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u07-assembly2.cif.gz_B | crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. | 0.854 | 71 | 190 |
| 3u07-assembly3.cif.gz_C | crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. | 0.8432 | 71 | 190 |
| 3vb9-assembly2.cif.gz_D | crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 | 0.8417 | 72 | 189 |
| 6ans-assembly2.cif.gz_B | crystal structure of a putative uncharacterized protein from burkholderia cenocepacia | 0.7152 | 69 | 192 |
| 2xbz-assembly1.cif.gz_A-2 | multiple oligomeric forms of the pseudomonas aeruginosa rets sensor domain modulate accessibility to the ligand-binding site | 0.6284 | 72 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u07C02 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7847 | 74 | 190 | 2.60.120.1600 |
| 3u07C02 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7726 | 74 | 190 | 2.60.120.1600 |
| 3vb9A04 | Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain | 0.7209 | 54 | 189 | 2.60.120.600 |
| af_G5EFZ0_141_266_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6468 | 70 | 172 | 2.60.120.200 |
| af_I6XHH2_45_177_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.6388 | 61 | 189 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533IYI2-F1-model_v4 | deleted | 0.9158 | 93 | 192 |
|
| AF-A0A533IYI2-F1-model_v4 | deleted | 0.8988 | 93 | 192 |
|
| AF-A0A2N3EKV0-F1-model_v4 | DUF1214 domain-containing protein | 0.8914 | 71 | 192 |
|
| AF-A0A3M1YUY4-F1-model_v4 | DUF1214 domain-containing protein | 0.8833 | 75 | 191 |
|
| AF-A0A529KC85-F1-model_v4 | DUF1214 domain-containing protein | 0.8806 | 69 | 192 |
|