F495255

General Info

Members Datasets Scaffolds Average Seq Length
1663 975 3326 823

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10001813|Ga0207697_100018132
Length 879
Sequence MTQPVPDAPMTADGDGFTSPSAAAATALPGASXPAGDSKGHATMPVAPVWQAGLTDAAAQAGALAESQAKPDEAVAAFRAAVLHKLTYMVGKDSGHAQEHDWFVATALAVRDHLVDRWIDATRKTYRDGRKRVYYFSLEFLIGRLLFDALSNLGITQVAREALRDLGVDLERLRKVEPDAALGNGGLGRLAACFMESMASLGIPAHGYGIRYDHGIFRQAIKDGWQMELPEEWLSAGNPWEFERPEVTYPVGFGGAVDTRENADGTVRSVWEPAESVNAVAFDTPLAGWRGRHVNTLRLWSARASDPLRLDDFNRGDHVGALADRVRLEAISRVLYPSDETEAGHELRLRQEYFFASASLQDLLRRHKAQHGDLASLADHVSIQLNDTHPAIAVPELMRLLIDVHELPWELAWDITTSVFNYTNHTLLPEALETWPVALMERLLPRHMQIAYLINGLHLDAQRTEGHDDRFLSSISLIEENHVRRLRMGHLAFLASRRVNGVSALHTDLMRKTVFHDLAAIHPGRIVNVTNGITLRRWLYQANPGLTELIVDAVGPEVLDKAALLEALTPLADDAAFRERFMAVRRANKVALARLIAERLGIGVDPEAMFDVQIKRIHEYKRQLLNLLETIAFYNAVRAQPTRAWVPRVKIFSGKAAAGYRQAKLVIKLAHDVARIVNRDPVLRGRLKVVFLPNYNVSLAESIIPAADVSEQISTAGMEASGTGNMKLALNGALTIGTLDGANIEIRERVGAENMVIFGLDAEGVAQRRATGLDATATIAASPTLADVLRALESGTFSPDDRGRYRELVDGLRHHDYFMVCADFDAYWMAQRSINTLWQDRESWYGKAILNTARMGWFSADRAVLEYAREIWGADPGAQ

Samples

Sample ID Description Type Environment
1 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
102 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
103 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
104 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
138 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
139 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
140 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
235 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
236 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
237 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
238 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
241 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
242 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
248 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
249 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
262 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
263 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
289 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
290 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
291 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
295 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
296 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
297 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
298 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
299 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
300 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
301 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
302 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
303 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
315 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
316 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
317 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
318 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
319 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
320 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
321 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
322 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
323 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
324 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
331 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
332 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
333 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
334 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
335 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
339 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
340 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
341 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
342 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
343 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
344 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
345 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
346 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
347 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
363 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
364 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
370 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
371 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
374 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
375 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
376 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
377 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
378 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
379 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
380 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
381 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
382 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
383 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
384 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
385 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
388 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
389 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
399 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
409 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
415 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
416 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
417 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
418 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
419 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
420 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
421 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
433 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
436 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
437 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
438 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
439 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
440 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
444 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
445 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
446 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
447 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
451 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
455 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
456 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
457 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
458 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
459 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
460 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
461 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
462 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
463 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
464 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
465 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
466 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
467 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
468 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
469 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
470 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
471 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
472 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
473 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
476 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
477 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
478 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
479 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
483 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
484 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
485 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
486 2511231004 Pseudomonas sp. GM102 Isolate Nodule
487 2511231006 Pseudomonas sp. GM17 Isolate Nodule
488 2511231007 Pseudomonas sp. GM18 Isolate Nodule
489 2511231008 Pseudomonas sp. GM21 Isolate Nodule
490 2511231010 Pseudomonas sp. GM25 Isolate Nodule
491 2511231011 Pseudomonas sp. GM30 Isolate Nodule
492 2511231012 Pseudomonas sp. GM33 Isolate Nodule
493 2511231014 Pseudomonas sp. GM48 Isolate Nodule
494 2511231015 Pseudomonas sp. GM49 Isolate Nodule
495 2511231016 Pseudomonas sp. GM50 Isolate Nodule
496 2511231017 Pseudomonas sp. GM55 Isolate Nodule
497 2511231018 Pseudomonas sp. GM60 Isolate Nodule
498 2511231019 Pseudomonas sp. GM67 Isolate Nodule
499 2511231020 Pseudomonas sp. GM74 Isolate Nodule
500 2511231021 Pseudomonas sp. GM78 Isolate Nodule
501 2511231022 Pseudomonas sp. GM79 Isolate Nodule
502 2511231023 Pseudomonas sp. GM80 Isolate Nodule
503 2511231024 Pseudomonas sp. GM84 Isolate Nodule
504 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
505 2511231031 Pseudomonas sp. GM16 Isolate Nodule
506 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
507 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
508 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
509 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
510 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
511 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
512 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
513 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
514 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
515 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
516 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
517 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
518 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
519 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
520 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
521 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
522 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
523 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
524 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
525 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
526 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
527 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
528 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
529 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
530 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
531 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
532 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
533 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
534 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
535 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
536 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
537 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
538 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
539 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
540 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
541 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
542 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
543 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
544 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
545 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
546 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
547 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
548 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
549 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
550 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
551 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
552 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
553 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
554 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
555 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
556 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
557 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
558 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
559 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
560 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
561 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
562 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
563 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
564 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
565 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
566 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
567 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
568 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
569 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
570 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
571 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
572 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
573 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
574 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
575 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
576 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
577 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
578 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
579 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
580 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
581 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
582 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
583 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
584 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
585 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
586 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
587 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
588 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
589 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
590 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
591 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
592 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
593 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
594 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
595 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
596 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
597 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
598 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
599 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
600 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
601 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
602 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
603 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
604 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
605 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
606 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
607 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
608 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
609 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
610 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
611 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
612 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
613 2643221733 Bosea sp. Root381 Isolate Unclassified
614 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
615 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
616 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
617 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
618 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
619 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
620 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
621 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
622 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
623 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
624 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
625 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
626 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
627 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
628 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
629 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
630 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
631 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
632 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
633 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
634 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
635 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
636 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
637 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
638 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
639 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
640 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
641 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
642 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
643 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
644 2765235841 Pseudomonas putida AA7 Isolate Unclassified
645 2773857670 Pseudomonas sp. 478 Isolate Unclassified
646 2773857673 Pseudomonas sp. 443 Isolate Unclassified
647 2784132063 Pseudomonas sp. 424 Isolate Unclassified
648 2784132072 Pseudomonas sp. 460 Isolate Unclassified
649 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
650 2791355199
651 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
652 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
653 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
654 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
655 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
656 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
657 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
658 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
659 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
660 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
661 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
662 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
663 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
664 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
665 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
666 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
667 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
668 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
669 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
670 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
671 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
672 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
673 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
674 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
675 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
676 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
677 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
678 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
679 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
680 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
681 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
682 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
683 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
684 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
685 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
686 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
687 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
688 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
689 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
690 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
691 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
692 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
693 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
694 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
695 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
696 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
697 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
698 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
699 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
700 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
701 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
702 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
703 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
704 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
705 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
706 2842694124 Methylopila sp. R-72369 Isolate Unclassified
707 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
708 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
709 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
710 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
711 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
712 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
713 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
714 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
715 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
716 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
717 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
718 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
719 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
720 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
721 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
722 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
723 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
724 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
725 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
726 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
727 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
728 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
729 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
730 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
731 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
732 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
733 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
734 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
735 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
736 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
737 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
738 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
739 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
740 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
741 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
742 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
743 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
744 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
745 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
746 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
747 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
748 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
749 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
750 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
751 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
752 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
753 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
754 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
755 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
756 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
757 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
758 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
759 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
760 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
761 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
762 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
763 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
764 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
765 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
766 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
767 2904699407
768 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
769 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
770 2906610324
771 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
772 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
773 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
774 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
775 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
776 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
777 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
778 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
779 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
780 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
781 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
782 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
783 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
784 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
785 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
786 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
787 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
788 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
789 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
790 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
791 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
792 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
793 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
794 2922368715
795 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
796 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
797 2922425934
798 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
799 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
800 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
801 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
802 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
803 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
804 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
805 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
806 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
807 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
808 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
809 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
810 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
811 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
812 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
813 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
814 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
815 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
816 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
817 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
818 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
819 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
820 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
821 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
822 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
823 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
824 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
825 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
826 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
827 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
828 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
829 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
830 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
831 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
832 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
833 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
834 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
835 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
836 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
837 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
838 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
839 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
840 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
841 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
842 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
843 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
844 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
845 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
846 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
847 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
848 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
849 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
850 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
851 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
852 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
853 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
854 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
855 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
856 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
857 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
858 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
859 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
860 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
861 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
862 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
863 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
864 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
865 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
866 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
867 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
868 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
869 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
870 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
871 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
872 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
873 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
874 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
875 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
876 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
877 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
878 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
879 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
880 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
881 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
882 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
883 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
884 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
885 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
886 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
887 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
888 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
889 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
890 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
891 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
892 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
893 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
894 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
895 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
896 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
897 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
898 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
899 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
900 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
901 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
902 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
903 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
904 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
905 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
906 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
907 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
908 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
909 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
910 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
911 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
912 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
913 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
914 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
915 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
916 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
917 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
918 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
919 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
920 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
921 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
922 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
923 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
924 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
925 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
926 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
927 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
928 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
929 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
930 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
931 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
932 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
933 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
934 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
935 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
936 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
937 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
938 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
939 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
940 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
941 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
942 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
943 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
944 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
945 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
946 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
947 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
948 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
949 8052494512 Pseudomonas putida LD6 Isolate Unclassified
950 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
951 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
952 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
953 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
954 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
955 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
956 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
957 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
958 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
959 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
960 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
961 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
962 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
963 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
964 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
965 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
966 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
967 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
968 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
969 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
970 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
971 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
972 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
973 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
974 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
975 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.51
Metatranscriptomes 0
Isolates 29.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 12.27
Rhizoplane 6.49
Rhizosphere 60.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207697_10001813 3300025315 Bacteria 11452
2 MRS2a_Contig_52 2124908027 Bacteria 34043
3 SwRhRL2b_contig_613450 2162886007 Bacteria 3260
4 JGI24741J21665_1001182 3300001915 Bacteria 7722
5 JGI24740J21852_10007761 3300001979 Bacteria 4336
6 JGI24737J22298_10003323 3300001990 Bacteria 5693
7 JGI25162J39368_1000098 3300002737 Bacteria 95821
8 JGI25162J39368_1000129 3300002737 Bacteria 83712
9 JGI25154J39366_1004169 3300002738 Bacteria 2681
10 JGI25163J39215_1000689 3300002771 Bacteria 8956
11 JGI25163J39215_1001594 3300002771 Bacteria 3435
12 JGI25164J39214_1000076 3300002772 Bacteria 95821
13 JGI25164J39214_1000101 3300002772 Bacteria 83715
14 JGI25406J46586_10000308 3300003203 Bacteria 21987
15 JGI25406J46586_10003834 3300003203 Bacteria 7026
16 JGI25165J46597_1000150 3300003214 Bacteria 115430
17 JGI25165J46597_1000180 3300003214 Bacteria 95821
18 JGI25153J46596_10003462 3300003215 Bacteria 8838
19 JGI25160J50197_1007754 3300003354 Bacteria 4164
20 Ga0055538_1000115 3300003751 Bacteria 61470
21 Ga0055539_1000162 3300003752 Bacteria 61470
22 Ga0055533_1000164 3300003756 Bacteria 61470
23 Ga0055532_1000153 3300003758 Bacteria 61470
24 Ga0055525_1000224 3300003759 Bacteria 61470
25 Ga0055536_1000232 3300003781 Bacteria 44724
26 Ga0055536_1000312 3300003781 Bacteria 36538
27 Ga0055536_1003049 3300003781 Bacteria 9150
28 Ga0055530_10000404 3300003791 Bacteria 38699
29 Ga0055530_10002858 3300003791 Bacteria 10545
30 Ga0055530_10006098 3300003791 Bacteria 5492
31 Ga0055540_1000339 3300003792 Bacteria 40092
32 Ga0055540_1000753 3300003792 Bacteria 21955
33 Ga0055540_1002153 3300003792 Bacteria 10730
34 Ga0055531_10000455 3300003794 Bacteria 38042
35 Ga0055541_1000107 3300003841 Bacteria 61470
36 Ga0065165_1001384 3300005262 Bacteria 26615
37 Ga0065165_1001704 3300005262 Bacteria 22070
38 Ga0065714_10000618 3300005288 Bacteria 4004
39 Ga0065714_10003400 3300005288 Bacteria 7913
40 Ga0065714_10009637 3300005288 Bacteria 3727
41 Ga0065714_10068828 3300005288 Bacteria 4520
42 Ga0065714_10069561 3300005288 Bacteria 4174
43 Ga0065714_10074770 3300005288 Bacteria 2962
44 Ga0065714_10078921 3300005288 Bacteria 2558
45 Ga0065704_10005342 3300005289 Bacteria 3054
46 Ga0065704_10084010 3300005289 Bacteria 3388
47 Ga0065712_10003999 3300005290 Bacteria 4202
48 Ga0065712_10067807 3300005290 Bacteria 30871
49 Ga0065715_10013732 3300005293 Bacteria 3306
50 Ga0070658_10015788 3300005327 Bacteria 6036
51 Ga0070676_10000872 3300005328 Bacteria 14892
52 Ga0070676_10024434 3300005328 Bacteria 3404
53 Ga0070683_100007899 3300005329 Bacteria 9019
54 Ga0070670_100000066 3300005331 Bacteria 107260
55 Ga0070670_100007196 3300005331 Bacteria 9424
56 Ga0070670_100007723 3300005331 Bacteria 9145
57 Ga0070670_100009172 3300005331 Bacteria 8457
58 Ga0070670_100013630 3300005331 Bacteria 6966
59 Ga0068869_100001188 3300005334 Bacteria 15282
60 Ga0068869_100007725 3300005334 Bacteria 6894
61 Ga0070666_10000801 3300005335 Bacteria 19095
62 Ga0070666_10004064 3300005335 Bacteria 8880
63 Ga0070680_100032610 3300005336 Bacteria 4194
64 Ga0070680_100033131 3300005336 Bacteria 4162
65 Ga0070680_100055358 3300005336 Bacteria 3241
66 Ga0070680_100061857 3300005336 Bacteria 3065
67 Ga0068868_100022586 3300005338 Bacteria 4750
68 Ga0070661_100001439 3300005344 Bacteria 16550
69 Ga0070661_100032588 3300005344 Bacteria 3772
70 Ga0070668_100000032 3300005347 Bacteria 85248
71 Ga0070668_100001127 3300005347 Bacteria 18772
72 Ga0070668_100001958 3300005347 Bacteria 15019
73 Ga0070668_100004263 3300005347 Bacteria 10609
74 Ga0070668_100006735 3300005347 Bacteria 8515
75 Ga0070668_100027740 3300005347 Bacteria 4298
76 Ga0070669_100000233 3300005353 Bacteria 46639
77 Ga0070669_100004590 3300005353 Bacteria 9970
78 Ga0070669_100004761 3300005353 Bacteria 9786
79 Ga0070669_100008033 3300005353 Bacteria 7532
80 Ga0070669_100009909 3300005353 Bacteria 6785
81 Ga0070675_100004013 3300005354 Bacteria 11174
82 Ga0070675_100006340 3300005354 Bacteria 9081
83 Ga0070675_100024299 3300005354 Bacteria 4853
84 Ga0070675_100034848 3300005354 Bacteria 4087
85 Ga0070675_100044927 3300005354 Bacteria 3613
86 Ga0070671_100012016 3300005355 Bacteria 6965
87 Ga0070673_100001777 3300005364 Bacteria 12849
88 Ga0070673_100019119 3300005364 Bacteria 4915
89 Ga0070673_100023738 3300005364 Bacteria 4485
90 Ga0070688_100003732 3300005365 Bacteria 7883
91 Ga0070659_100009972 3300005366 Bacteria 6987
92 Ga0070667_100000526 3300005367 Bacteria 38431
93 Ga0070667_100000619 3300005367 Bacteria 34660
94 Ga0070667_100002498 3300005367 Bacteria 16055
95 Ga0070667_100011068 3300005367 Bacteria 7462
96 Ga0070667_100016674 3300005367 Bacteria 6081
97 Ga0070709_10008708 3300005434 Bacteria 5581
98 Ga0070714_100030984 3300005435 Bacteria 4457
99 Ga0070714_100061393 3300005435 Bacteria 3228
100 Ga0070714_100066765 3300005435 Bacteria 3100
101 Ga0070713_100000894 3300005436 Bacteria 19127
102 Ga0070710_10004687 3300005437 Bacteria 6466
103 Ga0070710_10009230 3300005437 Bacteria 4820
104 Ga0070711_100002080 3300005439 Bacteria 11302
105 Ga0070711_100008621 3300005439 Bacteria 6254
106 Ga0070700_100007179 3300005441 Bacteria 5999
107 Ga0070708_100000012 3300005445 Bacteria 133550
108 Ga0070663_100008924 3300005455 Bacteria 6193
109 Ga0070663_100020283 3300005455 Bacteria 4399
110 Ga0070678_100000361 3300005456 Bacteria 21160
111 Ga0070678_100010959 3300005456 Bacteria 5565
112 Ga0070662_100001331 3300005457 Bacteria 15188
113 Ga0070681_10008326 3300005458 Bacteria 10160
114 Ga0068867_100001440 3300005459 Bacteria 16478
115 Ga0068867_100001447 3300005459 Bacteria 16452
116 Ga0070698_100022285 3300005471 Bacteria 6627
117 Ga0070699_100017152 3300005518 Bacteria 6218
118 Ga0070699_100021712 3300005518 Bacteria 5534
119 Ga0070679_100006990 3300005530 Bacteria 10534
120 Ga0070679_100019021 3300005530 Bacteria 6672
121 Ga0070679_100034216 3300005530 Bacteria 5035
122 Ga0070679_100059192 3300005530 Bacteria 3818
123 Ga0070684_100003445 3300005535 Bacteria 11873
124 Ga0070684_100017952 3300005535 Bacteria 5816
125 Ga0070684_100051145 3300005535 Bacteria 3589
126 Ga0068853_100000029 3300005539 Bacteria 121775
127 Ga0068853_100004618 3300005539 Bacteria 10687
128 Ga0068853_100008416 3300005539 Bacteria 8289
129 Ga0070672_100014409 3300005543 Bacteria 5603
130 Ga0070672_100036731 3300005543 Bacteria 3734
131 Ga0070665_100000751 3300005548 Bacteria 43044
132 Ga0070665_100000824 3300005548 Bacteria 40499
133 Ga0070665_100003493 3300005548 Bacteria 16732
134 Ga0070665_100006084 3300005548 Bacteria 12336
135 Ga0070665_100012520 3300005548 Bacteria 8547
136 Ga0070665_100036175 3300005548 Bacteria 4967
137 Ga0070665_100036817 3300005548 Bacteria 4920
138 Ga0068855_100016264 3300005563 Bacteria 8947
139 Ga0068855_100042590 3300005563 Bacteria 5379
140 Ga0070664_100000531 3300005564 Bacteria 29123
141 Ga0070664_100010616 3300005564 Bacteria 7464
142 Ga0068857_100005533 3300005577 Bacteria 10778
143 Ga0068857_100027111 3300005577 Bacteria 5054
144 Ga0068856_100000432 3300005614 Bacteria 45968
145 Ga0068856_100034833 3300005614 Bacteria 4933
146 Ga0068856_100057227 3300005614 Bacteria 3849
147 Ga0068856_100062862 3300005614 Bacteria 3667
148 Ga0070702_100025638 3300005615 Bacteria 3161
149 Ga0068852_100025278 3300005616 Bacteria 4809
150 Ga0068852_100036675 3300005616 Bacteria 4105
151 Ga0068859_100002359 3300005617 Bacteria 19224
152 Ga0068859_100003198 3300005617 Bacteria 16678
153 Ga0068859_100012416 3300005617 Bacteria 8571
154 Ga0068859_100083408 3300005617 Bacteria 3239
155 Ga0068864_100000132 3300005618 Bacteria 72063
156 Ga0068864_100000273 3300005618 Bacteria 45943
157 Ga0068864_100001673 3300005618 Bacteria 18247
158 Ga0068864_100016393 3300005618 Bacteria 6168
159 Ga0068864_100022148 3300005618 Bacteria 5327
160 Ga0068861_100002284 3300005719 Bacteria 12436
161 Ga0068861_100031773 3300005719 Bacteria 3881
162 Ga0068851_10000035 3300005834 Bacteria 106588
163 Ga0068851_10006945 3300005834 Bacteria 5189
164 Ga0068870_10004164 3300005840 Bacteria 6203
165 Ga0068863_100000142 3300005841 Bacteria 75317
166 Ga0068863_100002817 3300005841 Bacteria 17214
167 Ga0068863_100003818 3300005841 Bacteria 14893
168 Ga0068863_100004135 3300005841 Bacteria 14347
169 Ga0068863_100011071 3300005841 Bacteria 8747
170 Ga0068863_100017414 3300005841 Bacteria 6889
171 Ga0068858_100001039 3300005842 Bacteria 28680
172 Ga0068858_100002619 3300005842 Bacteria 18122
173 Ga0068858_100007621 3300005842 Bacteria 10455
174 Ga0068858_100029555 3300005842 Bacteria 5089
175 Ga0068860_100000295 3300005843 Bacteria 69402
176 Ga0068860_100004046 3300005843 Bacteria 15059
177 Ga0068860_100004537 3300005843 Bacteria 14174
178 Ga0068860_100018230 3300005843 Bacteria 6832
179 Ga0068860_100026653 3300005843 Bacteria 5572
180 Ga0068862_100000238 3300005844 Bacteria 61105
181 Ga0068862_100011179 3300005844 Bacteria 7414
182 Ga0068862_100011348 3300005844 Bacteria 7357
183 Ga0068862_100058205 3300005844 Bacteria 3315
184 Ga0081455_10000633 3300005937 Bacteria 45582
185 Ga0081455_10002844 3300005937 Bacteria 20375
186 Ga0081455_10008295 3300005937 Bacteria 10823
187 Ga0081455_10012886 3300005937 Bacteria 8296
188 Ga0081455_10020150 3300005937 Bacteria 6291
189 Ga0081455_10023112 3300005937 Bacteria 5791
190 Ga0081538_10005211 3300005981 Bacteria 11746
191 Ga0081538_10034611 3300005981 Bacteria 3335
192 Ga0081540_1003693 3300005983 Bacteria 11998
193 Ga0081540_1005997 3300005983 Bacteria 8952
194 Ga0081540_1014711 3300005983 Bacteria 4996
195 Ga0081540_1020374 3300005983 Bacteria 3992
196 Ga0081539_10000040 3300005985 Bacteria 292753
197 Ga0081539_10002152 3300005985 Bacteria 29064
198 Ga0070717_10003674 3300006028 Bacteria 11014
199 Ga0070717_10018962 3300006028 Bacteria 5386
200 Ga0070717_10027490 3300006028 Bacteria 4547
201 Ga0070717_10035736 3300006028 Bacteria 4026
202 Ga0075365_10010751 3300006038 Bacteria 5347
203 Ga0075368_10011691 3300006042 Bacteria 3198
204 Ga0075363_100032087 3300006048 Bacteria 2726
205 Ga0075432_10005107 3300006058 Bacteria 4472
206 Ga0070715_10001868 3300006163 Bacteria 6309
207 Ga0070716_100012041 3300006173 Bacteria 4371
208 Ga0070712_100004848 3300006175 Bacteria 8318
209 Ga0070712_100010245 3300006175 Bacteria 5911
210 Ga0070712_100012801 3300006175 Bacteria 5339
211 Ga0075369_10005528 3300006186 Bacteria 4729
212 Ga0097621_100019504 3300006237 Bacteria 5205
213 Ga0097621_100023896 3300006237 Bacteria 4764
214 Ga0068871_100025300 3300006358 Bacteria 4616
215 Ga0075428_100020463 3300006844 Bacteria 7325
216 Ga0075430_100000066 3300006846 Bacteria 56729
217 Ga0075430_100002359 3300006846 Bacteria 15692
218 Ga0075431_100102583 3300006847 Bacteria 2952
219 Ga0068865_100049130 3300006881 Bacteria 2906
220 Ga0097620_100002358 3300006931 Bacteria 19224
221 Ga0097620_100003197 3300006931 Bacteria 16678
222 Ga0097620_100012415 3300006931 Bacteria 8571
223 Ga0097620_100083406 3300006931 Bacteria 3239
224 Ga0099825_1016067 3300006941 Bacteria 6541
225 Ga0099824_1014113 3300006942 Bacteria 8051
226 Ga0099822_1006926 3300006943 Bacteria 14714
227 Ga0099823_1007118 3300006944 Bacteria 11327
228 Ga0079104_1000423 3300006946 Bacteria 48297
229 Ga0079104_1001202 3300006946 Bacteria 18420
230 Ga0105251_10000118 3300009011 Bacteria 79165
231 Ga0105251_10000191 3300009011 Bacteria 62283
232 Ga0105251_10001252 3300009011 Bacteria 21984
233 Ga0105251_10005196 3300009011 Bacteria 8589
234 Ga0105251_10005418 3300009011 Bacteria 8343
235 Ga0105251_10014131 3300009011 Bacteria 4431
236 Ga0105244_10000593 3300009036 Bacteria 32509
237 Ga0105244_10000969 3300009036 Bacteria 24124
238 Ga0105244_10001341 3300009036 Bacteria 20090
239 Ga0105244_10019846 3300009036 Bacteria 3741
240 Ga0105244_10020929 3300009036 Bacteria 3624
241 Ga0105244_10025551 3300009036 Bacteria 3210
242 Ga0105244_10027558 3300009036 Bacteria 3059
243 Ga0105250_10000251 3300009092 Bacteria 44435
244 Ga0105250_10002362 3300009092 Bacteria 9534
245 Ga0105250_10002665 3300009092 Bacteria 8849
246 Ga0105250_10003074 3300009092 Bacteria 8045
247 Ga0105240_10002394 3300009093 Bacteria 30190
248 Ga0105240_10047754 3300009093 Bacteria 5416
249 Ga0105240_10056069 3300009093 Bacteria 4932
250 Ga0105240_10092314 3300009093 Bacteria 3697
251 Ga0111539_10000323 3300009094 Bacteria 58458
252 Ga0111539_10050591 3300009094 Bacteria 4950
253 Ga0114129_10009029 3300009147 Bacteria 14212
254 Ga0114129_10044968 3300009147 Bacteria 6209
255 Ga0105243_10000299 3300009148 Bacteria 54796
256 Ga0105243_10001887 3300009148 Bacteria 17864
257 Ga0105243_10003109 3300009148 Bacteria 13648
258 Ga0105243_10020011 3300009148 Bacteria 5074
259 Ga0105243_10042863 3300009148 Bacteria 3545
260 Ga0105242_10000465 3300009176 Bacteria 32243
261 Ga0105242_10040171 3300009176 Bacteria 3769
262 Ga0105248_10000648 3300009177 Bacteria 39487
263 Ga0105248_10001325 3300009177 Bacteria 27561
264 Ga0105248_10009379 3300009177 Bacteria 10773
265 Ga0105248_10009617 3300009177 Bacteria 10644
266 Ga0105237_10002856 3300009545 Bacteria 21007
267 Ga0105237_10023860 3300009545 Bacteria 6260
268 Ga0105237_10025304 3300009545 Bacteria 6071
269 Ga0105237_10027605 3300009545 Bacteria 5792
270 Ga0105238_10014059 3300009551 Bacteria 8093
271 Ga0105238_10014372 3300009551 Bacteria 8000
272 Ga0105238_10015143 3300009551 Bacteria 7810
273 Ga0105249_10000237 3300009553 Bacteria 62456
274 Ga0105249_10045838 3300009553 Bacteria 3978
275 Ga0105249_10076393 3300009553 Bacteria 3104
276 Ga0105239_10013419 3300010375 Bacteria 9104
277 Ga0105239_10036008 3300010375 Bacteria 5434
278 Ga0105246_10000445 3300011119 Bacteria 22189
279 Ga0105246_10005000 3300011119 Bacteria 8066
280 Ga0105246_10016063 3300011119 Bacteria 4737
281 Ga0157345_1000228 3300012498 Bacteria 8239
282 Ga0157373_10004675 3300013100 Bacteria 10293
283 Ga0157373_10006022 3300013100 Bacteria 9067
284 Ga0157371_10000238 3300013102 Bacteria 78535
285 Ga0157371_10006967 3300013102 Bacteria 9206
286 Ga0157370_10026265 3300013104 Bacteria 5752
287 Ga0157370_10037678 3300013104 Bacteria 4686
288 Ga0157369_10014104 3300013105 Bacteria 9034
289 Ga0157369_10014525 3300013105 Bacteria 8885
290 Ga0157369_10055180 3300013105 Bacteria 4289
291 Ga0157369_10066221 3300013105 Bacteria 3887
292 Ga0157378_10004733 3300013297 Bacteria 11931
293 Ga0163162_10020131 3300013306 Bacteria 6551
294 Ga0163162_10022074 3300013306 Bacteria 6272
295 Ga0163162_10042652 3300013306 Bacteria 4542
296 Ga0163162_10047143 3300013306 Bacteria 4319
297 Ga0163162_10073208 3300013306 Bacteria 3482
298 Ga0163162_10134325 3300013306 Bacteria 2585
299 Ga0157372_10000711 3300013307 Bacteria 36578
300 Ga0157372_10020723 3300013307 Bacteria 7096
301 Ga0157375_10009131 3300013308 Bacteria 8687
302 Ga0157375_10018608 3300013308 Bacteria 6302
303 Ga0157375_10021792 3300013308 Bacteria 5885
304 Ga0157375_10044280 3300013308 Bacteria 4322
305 Ga0163163_10003123 3300014325 Bacteria 14036
306 Ga0163163_10004279 3300014325 Bacteria 12164
307 Ga0163163_10019108 3300014325 Bacteria 6430
308 Ga0163163_10075518 3300014325 Bacteria 3363
309 Ga0157380_10016019 3300014326 Bacteria 5520
310 Ga0157380_10020785 3300014326 Bacteria 4913
311 Ga0182008_10004318 3300014497 Bacteria 8322
312 Ga0182008_10004478 3300014497 Bacteria 8166
313 Ga0182008_10008335 3300014497 Bacteria 5662
314 Ga0182008_10012516 3300014497 Bacteria 4477
315 Ga0182008_10019813 3300014497 Bacteria 3468
316 Ga0157379_10000560 3300014968 Bacteria 29968
317 Ga0157379_10002826 3300014968 Bacteria 14630
318 Ga0157379_10002876 3300014968 Bacteria 14511
319 Ga0157379_10010463 3300014968 Bacteria 8086
320 Ga0157379_10018619 3300014968 Bacteria 6123
321 Ga0157376_10028999 3300014969 Bacteria 4406
322 Ga0182006_1000753 3300015261 Bacteria 22122
323 Ga0182006_1002918 3300015261 Bacteria 9070
324 Ga0182006_1003105 3300015261 Bacteria 8708
325 Ga0182005_1002245 3300015265 Bacteria 7087
326 Ga0182005_1005438 3300015265 Bacteria 3980
327 Ga0163161_10010542 3300017792 Bacteria 6401
328 Ga0163161_10012152 3300017792 Bacteria 5971
329 Ga0214544_1000007 3300021320 Bacteria 379989
330 Ga0214542_1000007 3300021321 Bacteria 291816
331 Ga0214545_1000006 3300021324 Bacteria 291693
332 Ga0214543_1000009 3300021327 Bacteria 384302
333 Ga0213876_10002289 3300021384 Bacteria 11300
334 Ga0213876_10009146 3300021384 Bacteria 5335
335 Ga0213876_10013063 3300021384 Bacteria 4414
336 Ga0213875_10000860 3300021388 Bacteria 22443
337 Ga0213875_10002209 3300021388 Bacteria 11845
338 Ga0209760_100080 3300025207 Bacteria 77279
339 Ga0209760_100159 3300025207 Bacteria 40609
340 Ga0209784_100087 3300025224 Bacteria 122062
341 Ga0209566_100106 3300025225 Bacteria 122062
342 Ga0209674_100128 3300025226 Bacteria 122062
343 Ga0209147_100129 3300025229 Bacteria 122062
344 Ga0209563_100122 3300025230 Bacteria 122062
345 Ga0209563_100636 3300025230 Bacteria 11311
346 Ga0207427_100014 3300025231 Bacteria 561361
347 Ga0207427_100016 3300025231 Bacteria 538697
348 Ga0209437_100011 3300025233 Bacteria 818520
349 Ga0209437_100016 3300025233 Bacteria 710118
350 Ga0209437_100499 3300025233 Bacteria 28332
351 Ga0209258_100352 3300025242 Bacteria 64206
352 Ga0209646_1000310 3300025246 Bacteria 38640
353 Ga0209677_100078 3300025253 Bacteria 122062
354 Ga0209677_100296 3300025253 Bacteria 32613
355 Ga0209677_101858 3300025253 Bacteria 8575
356 Ga0209148_1000526 3300025254 Bacteria 37777
357 Ga0209233_1000019 3300025261 Bacteria 818520
358 Ga0209233_1000036 3300025261 Bacteria 561361
359 Ga0209233_1003377 3300025261 Bacteria 5635
360 Ga0209455_1001742 3300025272 Bacteria 9248
361 Ga0209676_1000025 3300025292 Bacteria 577569
362 Ga0209676_1000032 3300025292 Bacteria 469558
363 Ga0209676_1000208 3300025292 Bacteria 130879
364 Ga0209676_1000519 3300025292 Bacteria 60439
365 Ga0209676_1003834 3300025292 Bacteria 8847
366 Ga0209564_1002226 3300025295 Bacteria 16043
367 Ga0209564_1002401 3300025295 Bacteria 14944
368 Ga0209564_1005204 3300025295 Bacteria 7531
369 Ga0209758_1000030 3300025297 Bacteria 509217
370 Ga0209758_1001439 3300025297 Bacteria 28039
371 Ga0209758_1004188 3300025297 Bacteria 12254
372 Ga0209758_1010096 3300025297 Bacteria 5718
373 Ga0209050_1000025 3300025298 Bacteria 528225
374 Ga0209050_1000028 3300025298 Bacteria 477133
375 Ga0209050_1000381 3300025298 Bacteria 83623
376 Ga0209050_1004562 3300025298 Bacteria 9294
377 Ga0207426_1000380 3300025302 Bacteria 76046
378 Ga0207426_1001158 3300025302 Bacteria 23695
379 Ga0209051_1000026 3300025303 Bacteria 413311
380 Ga0209051_1000039 3300025303 Bacteria 319632
381 Ga0209051_1000047 3300025303 Bacteria 293227
382 Ga0209051_1000080 3300025303 Bacteria 199694
383 Ga0209257_1000034 3300025304 Bacteria 662719
384 Ga0209257_1001899 3300025304 Bacteria 22595
385 Ga0207656_10000008 3300025321 Bacteria 275365
386 Ga0207656_10008944 3300025321 Bacteria 3710
387 Ga0207696_1000020 3300025711 Bacteria 434998
388 Ga0207696_1000057 3300025711 Bacteria 249404
389 Ga0207696_1000074 3300025711 Bacteria 215333
390 Ga0207696_1000084 3300025711 Bacteria 196086
391 Ga0207696_1002815 3300025711 Bacteria 8249
392 Ga0207696_1005271 3300025711 Bacteria 5389
393 Ga0207696_1006465 3300025711 Bacteria 4720
394 Ga0207696_1010017 3300025711 Bacteria 3498
395 Ga0207655_1000014 3300025728 Bacteria 607124
396 Ga0207655_1000556 3300025728 Bacteria 46531
397 Ga0207655_1000904 3300025728 Bacteria 30971
398 Ga0207655_1001007 3300025728 Bacteria 28675
399 Ga0207655_1001055 3300025728 Bacteria 27513
400 Ga0207655_1001190 3300025728 Bacteria 25175
401 Ga0207655_1001386 3300025728 Bacteria 22646
402 Ga0207655_1002635 3300025728 Bacteria 14206
403 Ga0207655_1004166 3300025728 Bacteria 10378
404 Ga0207655_1004754 3300025728 Bacteria 9474
405 Ga0207655_1006994 3300025728 Bacteria 7389
406 Ga0207655_1015505 3300025728 Bacteria 4227
407 Ga0207655_1020640 3300025728 Bacteria 3376
408 Ga0207713_1000031 3300025735 Bacteria 283971
409 Ga0207713_1000114 3300025735 Bacteria 132170
410 Ga0207713_1000814 3300025735 Bacteria 28848
411 Ga0207713_1000823 3300025735 Bacteria 28708
412 Ga0207713_1002649 3300025735 Bacteria 12860
413 Ga0207713_1005023 3300025735 Bacteria 8422
414 Ga0207713_1007272 3300025735 Bacteria 6568
415 Ga0207713_1017048 3300025735 Bacteria 3661
416 Ga0207713_1020419 3300025735 Bacteria 3210
417 Ga0207713_1022163 3300025735 Bacteria 3023
418 Ga0207682_10003038 3300025893 Bacteria 7367
419 Ga0207692_10000619 3300025898 Bacteria 12488
420 Ga0207688_10000740 3300025901 Bacteria 16209
421 Ga0207688_10006116 3300025901 Bacteria 6549
422 Ga0207688_10013242 3300025901 Bacteria 4482
423 Ga0207680_10005696 3300025903 Bacteria 5967
424 Ga0207647_10009114 3300025904 Bacteria 7065
425 Ga0207685_10001110 3300025905 Bacteria 5345
426 Ga0207645_10000381 3300025907 Bacteria 36628
427 Ga0207645_10006829 3300025907 Bacteria 8141
428 Ga0207645_10014705 3300025907 Bacteria 5225
429 Ga0207643_10002073 3300025908 Bacteria 11044
430 Ga0207643_10004363 3300025908 Bacteria 7598
431 Ga0207643_10015612 3300025908 Bacteria 4134
432 Ga0207684_10045086 3300025910 Bacteria 3740
433 Ga0207654_10000611 3300025911 Bacteria 20145
434 Ga0207707_10000749 3300025912 Bacteria 31978
435 Ga0207707_10009487 3300025912 Bacteria 8440
436 Ga0207707_10017756 3300025912 Bacteria 6206
437 Ga0207695_10000006 3300025913 Bacteria 1135309
438 Ga0207695_10002336 3300025913 Bacteria 28213
439 Ga0207695_10010723 3300025913 Bacteria 11186
440 Ga0207695_10066281 3300025913 Bacteria 3709
441 Ga0207671_10000015 3300025914 Bacteria 439607
442 Ga0207671_10033720 3300025914 Bacteria 3808
443 Ga0207671_10037354 3300025914 Bacteria 3602
444 Ga0207693_10000701 3300025915 Bacteria 30084
445 Ga0207693_10003425 3300025915 Bacteria 13537
446 Ga0207693_10010113 3300025915 Bacteria 7663
447 Ga0207693_10025339 3300025915 Bacteria 4704
448 Ga0207663_10001487 3300025916 Bacteria 10928
449 Ga0207663_10011188 3300025916 Bacteria 4808
450 Ga0207663_10013624 3300025916 Bacteria 4424
451 Ga0207660_10013218 3300025917 Bacteria 5406
452 Ga0207660_10022948 3300025917 Bacteria 4209
453 Ga0207660_10030875 3300025917 Bacteria 3685
454 Ga0207657_10017514 3300025919 Bacteria 6865
455 Ga0207657_10047722 3300025919 Bacteria 3742
456 Ga0207649_10000001 3300025920 Bacteria 537851
457 Ga0207652_10021894 3300025921 Bacteria 5281
458 Ga0207646_10062663 3300025922 Bacteria 3320
459 Ga0207681_10000683 3300025923 Bacteria 22278
460 Ga0207681_10003174 3300025923 Bacteria 10320
461 Ga0207681_10004247 3300025923 Bacteria 8846
462 Ga0207694_10004635 3300025924 Bacteria 10703
463 Ga0207694_10016745 3300025924 Bacteria 5541
464 Ga0207694_10033461 3300025924 Bacteria 3938
465 Ga0207650_10000110 3300025925 Bacteria 108519
466 Ga0207650_10000239 3300025925 Bacteria 60879
467 Ga0207650_10001925 3300025925 Bacteria 14614
468 Ga0207700_10011969 3300025928 Bacteria 5565
469 Ga0207700_10017997 3300025928 Bacteria 4734
470 Ga0207664_10003529 3300025929 Bacteria 10445
471 Ga0207644_10004280 3300025931 Bacteria 9261
472 Ga0207706_10000885 3300025933 Bacteria 30776
473 Ga0207706_10004496 3300025933 Bacteria 13092
474 Ga0207706_10009929 3300025933 Bacteria 8727
475 Ga0207706_10037403 3300025933 Bacteria 4310
476 Ga0207706_10066218 3300025933 Bacteria 3180
477 Ga0207709_10000451 3300025935 Bacteria 38328
478 Ga0207709_10001143 3300025935 Bacteria 19344
479 Ga0207709_10002422 3300025935 Bacteria 11739
480 Ga0207709_10013497 3300025935 Bacteria 4506
481 Ga0207669_10001538 3300025937 Bacteria 9831
482 Ga0207704_10000667 3300025938 Bacteria 15204
483 Ga0207665_10003410 3300025939 Bacteria 10639
484 Ga0207665_10003934 3300025939 Bacteria 9947
485 Ga0207691_10001601 3300025940 Bacteria 22500
486 Ga0207691_10001942 3300025940 Bacteria 20182
487 Ga0207691_10019038 3300025940 Bacteria 6501
488 Ga0207691_10035493 3300025940 Bacteria 4627
489 Ga0207711_10012404 3300025941 Bacteria 7085
490 Ga0207711_10057207 3300025941 Bacteria 3353
491 Ga0207689_10000548 3300025942 Bacteria 35796
492 Ga0207689_10013134 3300025942 Bacteria 7068
493 Ga0207689_10016085 3300025942 Bacteria 6332
494 Ga0207661_10000379 3300025944 Bacteria 28634
495 Ga0207679_10000009 3300025945 Bacteria 357262
496 Ga0207667_10018585 3300025949 Bacteria 7790
497 Ga0207667_10024759 3300025949 Bacteria 6582
498 Ga0207667_10065460 3300025949 Bacteria 3790
499 Ga0207651_10008314 3300025960 Bacteria 5598
500 Ga0207651_10014919 3300025960 Bacteria 4500
501 Ga0207651_10027417 3300025960 Bacteria 3577
502 Ga0207712_10000185 3300025961 Bacteria 64444
503 Ga0207712_10010895 3300025961 Bacteria 5787
504 Ga0207668_10000003 3300025972 Bacteria 206959
505 Ga0207668_10000658 3300025972 Bacteria 21211
506 Ga0207668_10005943 3300025972 Bacteria 7191
507 Ga0207668_10011392 3300025972 Bacteria 5401
508 Ga0207640_10034871 3300025981 Bacteria 3144
509 Ga0207658_10000158 3300025986 Bacteria 71472
510 Ga0207658_10004094 3300025986 Bacteria 10170
511 Ga0207658_10004956 3300025986 Bacteria 9182
512 Ga0207658_10023472 3300025986 Bacteria 4305
513 Ga0207703_10000746 3300026035 Bacteria 32065
514 Ga0207703_10002726 3300026035 Bacteria 15138
515 Ga0207703_10013036 3300026035 Bacteria 6479
516 Ga0207703_10020233 3300026035 Bacteria 5204
517 Ga0207639_10000090 3300026041 Bacteria 76134
518 Ga0207639_10030720 3300026041 Bacteria 3942
519 Ga0207678_10005581 3300026067 Bacteria 11246
520 Ga0207678_10006762 3300026067 Bacteria 10170
521 Ga0207678_10024159 3300026067 Bacteria 5310
522 Ga0207708_10001830 3300026075 Bacteria 15686
523 Ga0207708_10026202 3300026075 Bacteria 4410
524 Ga0207702_10000122 3300026078 Bacteria 91685
525 Ga0207702_10000598 3300026078 Bacteria 39935
526 Ga0207702_10063134 3300026078 Bacteria 3167
527 Ga0207641_10003431 3300026088 Bacteria 14035
528 Ga0207641_10005395 3300026088 Bacteria 10923
529 Ga0207641_10006693 3300026088 Bacteria 9660
530 Ga0207641_10009156 3300026088 Bacteria 8175
531 Ga0207641_10035165 3300026088 Bacteria 4172
532 Ga0207648_10000330 3300026089 Bacteria 51825
533 Ga0207648_10006413 3300026089 Bacteria 11693
534 Ga0207648_10010744 3300026089 Bacteria 8651
535 Ga0207648_10011827 3300026089 Bacteria 8201
536 Ga0207648_10015832 3300026089 Bacteria 6912
537 Ga0207676_10000522 3300026095 Bacteria 32307
538 Ga0207676_10001311 3300026095 Bacteria 18516
539 Ga0207676_10003518 3300026095 Bacteria 11086
540 Ga0207676_10005910 3300026095 Bacteria 8646
541 Ga0207674_10005808 3300026116 Bacteria 14643
542 Ga0207674_10016864 3300026116 Bacteria 7981
543 Ga0207674_10041147 3300026116 Bacteria 4781
544 Ga0207675_100001548 3300026118 Bacteria 23038
545 Ga0207675_100002647 3300026118 Bacteria 17671
546 Ga0207675_100020818 3300026118 Bacteria 6115
547 Ga0207675_100041472 3300026118 Bacteria 4299
548 Ga0207683_10000528 3300026121 Bacteria 35475
549 Ga0207683_10005690 3300026121 Bacteria 10693
550 Ga0207683_10007332 3300026121 Bacteria 9451
551 Ga0207698_10013528 3300026142 Bacteria 5388
552 Ga0209281_1000026 3300027111 Bacteria 465877
553 Ga0209281_1000033 3300027111 Bacteria 383539
554 Ga0209281_1002039 3300027111 Bacteria 9127
555 Ga0209389_1000015 3300027296 Bacteria 188311
556 Ga0209389_1000165 3300027296 Bacteria 54591
557 Ga0209389_1000190 3300027296 Bacteria 46313
558 Ga0209371_1000630 3300027312 Bacteria 31210
559 Ga0209589_1001841 3300027357 Bacteria 35751
560 Ga0209589_1006092 3300027357 Bacteria 20135
561 Ga0209489_100072 3300027361 Bacteria 138111
562 Ga0209489_102693 3300027361 Bacteria 35754
563 Ga0209489_105989 3300027361 Bacteria 20135
564 Ga0209700_100034 3300027363 Bacteria 197276
565 Ga0209700_105810 3300027363 Bacteria 20135
566 Ga0209995_1001318 3300027471 Bacteria 3820
567 Ga0209983_1001251 3300027665 Bacteria 5645
568 Ga0207428_10000129 3300027907 Bacteria 104467
569 Ga0207428_10039490 3300027907 Bacteria 3833
570 Ga0207428_10061338 3300027907 Bacteria 2978
571 Ga0268266_10001049 3300028379 Bacteria 34622
572 Ga0268266_10001217 3300028379 Bacteria 31646
573 Ga0268266_10003843 3300028379 Bacteria 14661
574 Ga0268266_10006228 3300028379 Bacteria 10954
575 Ga0268266_10007906 3300028379 Bacteria 9521
576 Ga0268266_10026479 3300028379 Bacteria 4934
577 Ga0268265_10000246 3300028380 Bacteria 61853
578 Ga0268265_10037023 3300028380 Bacteria 3577
579 Ga0268264_10000187 3300028381 Bacteria 129270
580 Ga0268264_10000232 3300028381 Bacteria 107399
581 Ga0268264_10003098 3300028381 Bacteria 14393
582 Ga0268264_10031183 3300028381 Bacteria 4370
583 Ga0265337_1000506 3300028556 Bacteria 20742
584 Ga0265334_10002104 3300028573 Bacteria 9404
585 Ga0265334_10007245 3300028573 Bacteria 4758
586 Ga0265323_10005048 3300028653 Bacteria 5636
587 Ga0265336_10004816 3300028666 Bacteria 5055
588 Ga0307517_10000066 3300028786 Bacteria 141370
589 Ga0265338_10000973 3300028800 Bacteria 48208
590 Ga0268256_1000273 3300030500 Bacteria 53445
591 Ga0268256_1000278 3300030500 Bacteria 53027
592 Ga0316178_1102168 3300030735 Bacteria 42019
593 Ga0316181_1018381 3300030744 Bacteria 4565
594 Ga0265330_10009710 3300031235 Bacteria 4559
595 Ga0265330_10024206 3300031235 Bacteria 2754
596 Ga0265332_10000730 3300031238 Bacteria 20533
597 Ga0265332_10003203 3300031238 Bacteria 7967
598 Ga0265332_10010155 3300031238 Bacteria 4192
599 Ga0265328_10000008 3300031239 Bacteria 208282
600 Ga0265328_10003910 3300031239 Bacteria 6552
601 Ga0265325_10002761 3300031241 Bacteria 11731
602 Ga0265340_10002240 3300031247 Bacteria 11048
603 Ga0265339_10002540 3300031249 Bacteria 13011
604 Ga0265331_10000038 3300031250 Bacteria 196951
605 Ga0265331_10001798 3300031250 Bacteria 15260
606 Ga0265327_10007946 3300031251 Bacteria 8028
607 Ga0265316_10000387 3300031344 Bacteria 50269
608 Ga0307513_10005099 3300031456 Bacteria 17386
609 Ga0307408_100000004 3300031548 Bacteria 572889
610 Ga0307408_100028865 3300031548 Bacteria 3837
611 Ga0265313_10000223 3300031595 Bacteria 61143
612 Ga0307508_10000613 3300031616 Bacteria 42773
613 Ga0265314_10008057 3300031711 Bacteria 9069
614 Ga0265314_10022262 3300031711 Bacteria 4856
615 Ga0265342_10000308 3300031712 Bacteria 55378
616 Ga0307516_10012541 3300031730 Bacteria 9124
617 Ga0307410_10027576 3300031852 Bacteria 3591
618 Ga0307411_10021448 3300032005 Bacteria 3781
619 Ga0307411_10043985 3300032005 Bacteria 2860
620 Ga0307510_10011043 3300033180 Bacteria 10735
621 Ga0307510_10014026 3300033180 Bacteria 9488
622 Ga0307510_10016531 3300033180 Bacteria 8708
623 Ga0307510_10031045 3300033180 Bacteria 6043
624 Ga0315911_1000024 3300033442 Bacteria 97712
625 Ga0373934_0003933 3300035086 Bacteria 5460
626 Ga0373936_0001548 3300035113 Bacteria 8369
627 Ga0373941_0000462 3300035115 Bacteria 8113
628 Ga0373945_0013387 3300035116 Bacteria 2736
629 Ga0373953_0008441 3300035117 Bacteria 3499
630 Ga0373954_0000471 3300035118 Bacteria 15110
631 Ga0373954_0002347 3300035118 Bacteria 7908
632 Ga0373957_0003107 3300035120 Bacteria 4846
633 Ga0373924_0011467 3300035410 Bacteria 3292
634 Ga0373935_0019326 3300035692 Bacteria 4155
635 Ga0373927_0007892 3300035695 Bacteria 7193
636 Ga0373927_0009614 3300035695 Bacteria 6485
637 Ga0373927_0021704 3300035695 Bacteria 4207
638 Ga0373933_0000915 3300035724 Bacteria 18020
639 Ga0373947_0003547 3300035725 Bacteria 9210
640 Ga0373947_0027058 3300035725 Bacteria 3355
641 Ga0373937_0023179 3300036401 Bacteria 5588
642 Ga0316584_0065528 3300036712 Bacteria 2721
643 Ga0373925_0007117 3300037068 Bacteria 8178
644 Ga0373925_0019996 3300037068 Bacteria 4871
645 Ga0395900_0014639 3300037418 Bacteria 7999
646 Ga0395898_0004776 3300037466 Bacteria 14745
647 Ga0395898_0036586 3300037466 Bacteria 4874
648 Ga0395898_0049242 3300037466 Bacteria 4129
649 Ga0395905_0011164 3300037471 Bacteria 8685
650 Ga0436364_0348338 3300037853 Bacteria 9011
651 Ga0436364_0943018 3300037853 Bacteria 6542
652 Ga0436364_1171513 3300037853 Bacteria 122046
653 Ga0436364_1345588 3300037853 Bacteria 129670
654 Ga0395901_0101157 3300038443 Bacteria 3025
655 Ga0400483_231204 3300039062 Bacteria 8864
656 Ga0436365_0957972 3300039437 Bacteria 5462
657 Ga0436365_1045032 3300039437 Bacteria 24410
658 Ga0436365_1910924 3300039437 Bacteria 11762
659 Ga0436361_0615393 3300039447 Bacteria 3183
660 Ga0436363_0711625 3300039450 Bacteria 8825
661 Ga0436363_0726746 3300039450 Bacteria 4442
662 Ga0436363_1463967 3300039450 Bacteria 16945
663 Ga0436362_0841994 3300039453 Bacteria 4099
664 Ga0439436_0000952 3300041404 Bacteria 7978
665 Ga0439438_001868 3300041405 Bacteria 9216
666 Ga0439438_001970 3300041405 Bacteria 8973
667 Ga0439438_006265 3300041405 Bacteria 4228
668 Ga0439438_011272 3300041405 Bacteria 2791
669 Ga0439447_006383 3300041407 Bacteria 3834
670 Ga0439466_0001535 3300041411 Bacteria 9020
671 Ga0439466_0003548 3300041411 Bacteria 6031
672 Ga0439466_0006413 3300041411 Bacteria 4471
673 Ga0439466_0007342 3300041411 Bacteria 4174
674 Ga0439432_000775 3300042006 Bacteria 11997
675 Ga0439432_001464 3300042006 Bacteria 8860
676 Ga0439452_000786 3300042010 Bacteria 15052
677 Ga0439452_000858 3300042010 Bacteria 14069
678 Ga0439452_000882 3300042010 Bacteria 13826
679 Ga0439456_001355 3300042013 Bacteria 4892
680 Ga0439463_000059 3300042016 Bacteria 23483
681 Ga0450911_000004 3300042115 Bacteria 234537
682 Ga0450911_000355 3300042115 Bacteria 15573
683 Ga0450902_001778 3300042137 Bacteria 2978
684 Ga0450904_000009 3300042139 Bacteria 43388
685 Ga0450905_000464 3300042142 Bacteria 4957
686 Ga0450905_000945 3300042142 Bacteria 3648
687 Ga0450907_000601 3300042146 Bacteria 9590
688 Ga0450910_000437 3300042147 Bacteria 4909
689 Ga0439464_0005557 3300042439 Bacteria 3265
690 Ga0451577_0000005 3300042876 Bacteria 712599
691 Ga0451577_0000028 3300042876 Bacteria 395361
692 Ga0466972_0000264 3300044658 Bacteria 33879
693 Ga0453683_0008346 3300044673 Bacteria 6955
694 Ga0466966_0002003 3300044684 Bacteria 13212
695 Ga0466961_0001950 3300044693 Bacteria 12859
696 Ga0466963_0018905 3300044694 Bacteria 4315
697 Ga0453684_0000190 3300044712 Bacteria 269203
698 Ga0453684_0000390 3300044712 Bacteria 180365
699 Ga0453684_0001014 3300044712 Bacteria 90517
700 Ga0453684_0002558 3300044712 Bacteria 43721
701 Ga0466957_0031560 3300044842 Bacteria 3167
702 Ga0466959_0046208 3300045049 Bacteria 3204
703 Ga0451576_0000852 3300045051 Bacteria 59207
704 Ga0466958_0011628 3300045836 Bacteria 4962
705 Ga0495617_000455 3300046452 Bacteria 22035
706 Ga0495627_000023 3300046453 Bacteria 251113
707 Ga0495627_000774 3300046453 Bacteria 23729
708 Ga0495627_002193 3300046453 Bacteria 9734
709 Ga0495627_006533 3300046453 Bacteria 4562
710 Ga0495592_0020318 3300046454 Bacteria 5052
711 Ga0495603_0003090 3300046455 Bacteria 9886
712 Ga0495603_0011291 3300046455 Bacteria 5411
713 Ga0495590_0008010 3300046457 Bacteria 4053
714 Ga0495591_000025 3300046458 Bacteria 189897
715 Ga0495591_000668 3300046458 Bacteria 25300
716 Ga0495591_001374 3300046458 Bacteria 15248
717 Ga0495591_002991 3300046458 Bacteria 9023
718 Ga0495591_003186 3300046458 Bacteria 8654
719 Ga0495591_003225 3300046458 Bacteria 8583
720 Ga0495591_006806 3300046458 Bacteria 4975
721 Ga0495591_013521 3300046458 Bacteria 2978
722 Ga0495629_0000151 3300046459 Bacteria 60632
723 Ga0495629_0003854 3300046459 Bacteria 11309
724 Ga0495638_0005305 3300046460 Bacteria 9619
725 Ga0495638_0006494 3300046460 Bacteria 8503
726 Ga0495638_0032114 3300046460 Bacteria 3368
727 Ga0495651_0005755 3300046462 Bacteria 9453
728 Ga0495651_0029501 3300046462 Bacteria 4278
729 Ga0495651_0060342 3300046462 Bacteria 2905
730 Ga0495653_0001308 3300046463 Bacteria 19293
731 Ga0495653_0024403 3300046463 Bacteria 4873
732 Ga0495653_0031130 3300046463 Bacteria 4242
733 Ga0495650_0001958 3300046471 Bacteria 18190
734 Ga0495650_0006161 3300046471 Bacteria 7539
735 Ga0495650_0011367 3300046471 Bacteria 4882
736 Ga0495582_0000218 3300046473 Bacteria 31814
737 Ga0495582_0003858 3300046473 Bacteria 8439
738 Ga0495605_0000095 3300046474 Bacteria 112622
739 Ga0495605_0000210 3300046474 Bacteria 71875
740 Ga0495605_0000677 3300046474 Bacteria 25677
741 Ga0495605_0000927 3300046474 Bacteria 20060
742 Ga0495605_0006722 3300046474 Bacteria 6577
743 Ga0495639_0001263 3300046475 Bacteria 11392
744 Ga0495639_0002288 3300046475 Bacteria 8396
745 Ga0495662_0000275 3300046476 Bacteria 22031
746 Ga0495664_0005513 3300046477 Bacteria 6951
747 Ga0495664_0005666 3300046477 Bacteria 6871
748 Ga0495664_0018049 3300046477 Bacteria 4035
749 Ga0495664_0029990 3300046477 Bacteria 3184
750 Ga0495584_0003049 3300046491 Bacteria 9300
751 Ga0495584_0003944 3300046491 Bacteria 8021
752 Ga0495584_0014091 3300046491 Bacteria 4074
753 Ga0495585_0004764 3300046492 Bacteria 8731
754 Ga0495585_0004972 3300046492 Bacteria 8500
755 Ga0495585_0008391 3300046492 Bacteria 6265
756 Ga0495585_0036910 3300046492 Bacteria 2753
757 Ga0495594_0001418 3300046499 Bacteria 12441
758 Ga0495596_0000545 3300046500 Bacteria 23624
759 Ga0495596_0002377 3300046500 Bacteria 10178
760 Ga0495607_0000069 3300046501 Bacteria 101754
761 Ga0495607_0000673 3300046501 Bacteria 33089
762 Ga0495607_0001262 3300046501 Bacteria 22625
763 Ga0495607_0001270 3300046501 Bacteria 22565
764 Ga0495607_0002719 3300046501 Bacteria 14112
765 Ga0495607_0004514 3300046501 Bacteria 10214
766 Ga0495607_0007059 3300046501 Bacteria 7811
767 Ga0495607_0018106 3300046501 Bacteria 4499
768 Ga0495607_0023960 3300046501 Bacteria 3813
769 Ga0495607_0027869 3300046501 Bacteria 3487
770 Ga0495583_0000015 3300046506 Bacteria 316392
771 Ga0495583_0000779 3300046506 Bacteria 39867
772 Ga0495583_0009541 3300046506 Bacteria 5784
773 Ga0495606_0000447 3300046507 Bacteria 67335
774 Ga0495606_0000453 3300046507 Bacteria 67136
775 Ga0495606_0003923 3300046507 Bacteria 15309
776 Ga0495606_0008979 3300046507 Bacteria 8551
777 Ga0495606_0009017 3300046507 Bacteria 8526
778 Ga0495606_0012643 3300046507 Bacteria 6742
779 Ga0495606_0013024 3300046507 Bacteria 6610
780 Ga0495606_0026931 3300046507 Bacteria 4084
781 Ga0495610_0005104 3300046512 Bacteria 9444
782 Ga0495610_0006937 3300046512 Bacteria 7667
783 Ga0495610_0007026 3300046512 Bacteria 7607
784 Ga0495610_0014582 3300046512 Bacteria 4609
785 Ga0495616_0005043 3300046513 Bacteria 8215
786 Ga0495616_0015427 3300046513 Bacteria 4249
787 Ga0495620_0000042 3300046515 Bacteria 112107
788 Ga0495620_0000146 3300046515 Bacteria 57888
789 Ga0495620_0000422 3300046515 Bacteria 28117
790 Ga0495620_0001025 3300046515 Bacteria 17183
791 Ga0495631_0001255 3300046518 Bacteria 15676
792 Ga0495631_0005285 3300046518 Bacteria 6781
793 Ga0495631_0033636 3300046518 Bacteria 2301
794 Ga0495632_0001743 3300046519 Bacteria 17635
795 Ga0495632_0004240 3300046519 Bacteria 9796
796 Ga0495632_0004428 3300046519 Bacteria 9547
797 Ga0495632_0013905 3300046519 Bacteria 4573
798 Ga0495637_0000682 3300046520 Bacteria 23481
799 Ga0495637_0002317 3300046520 Bacteria 10534
800 Ga0495637_0002721 3300046520 Bacteria 9633
801 Ga0495637_0002917 3300046520 Bacteria 9236
802 Ga0495637_0004370 3300046520 Bacteria 7333
803 Ga0495637_0011231 3300046520 Bacteria 4309
804 Ga0495637_0011386 3300046520 Bacteria 4274
805 Ga0495637_0014482 3300046520 Bacteria 3721
806 Ga0495637_0016000 3300046520 Bacteria 3512
807 Ga0495643_0000291 3300046522 Bacteria 71440
808 Ga0495643_0015422 3300046522 Bacteria 4515
809 Ga0495643_0016513 3300046522 Bacteria 4336
810 Ga0495643_0019980 3300046522 Bacteria 3869
811 Ga0495648_0000581 3300046524 Bacteria 39115
812 Ga0495648_0003184 3300046524 Bacteria 14604
813 Ga0495648_0005967 3300046524 Bacteria 10017
814 Ga0495648_0006246 3300046524 Bacteria 9747
815 Ga0495648_0008715 3300046524 Bacteria 7945
816 Ga0495648_0008856 3300046524 Bacteria 7872
817 Ga0495648_0013653 3300046524 Bacteria 5989
818 Ga0495648_0015287 3300046524 Bacteria 5581
819 Ga0495648_0033685 3300046524 Bacteria 3342
820 Ga0495642_0000662 3300046528 Bacteria 17247
821 Ga0495652_0017151 3300046529 Bacteria 6466
822 Ga0495652_0017750 3300046529 Bacteria 6351
823 Ga0495652_0025015 3300046529 Bacteria 5283
824 Ga0495654_0002507 3300046530 Bacteria 11794
825 Ga0495654_0002748 3300046530 Bacteria 11095
826 Ga0495654_0003902 3300046530 Bacteria 9009
827 Ga0495654_0005124 3300046530 Bacteria 7656
828 Ga0495654_0011853 3300046530 Bacteria 4704
829 Ga0495654_0012016 3300046530 Bacteria 4666
830 Ga0495654_0031443 3300046530 Bacteria 2694
831 Ga0495665_0000163 3300046531 Bacteria 33358
832 Ga0495640_0014322 3300046533 Bacteria 6004
833 Ga0495587_0011173 3300046536 Bacteria 5695
834 Ga0495587_0029971 3300046536 Bacteria 3301
835 Ga0495609_0000053 3300046538 Bacteria 149126
836 Ga0495609_0000133 3300046538 Bacteria 79787
837 Ga0495609_0000283 3300046538 Bacteria 46879
838 Ga0495609_0004006 3300046538 Bacteria 8224
839 Ga0495609_0019392 3300046538 Bacteria 3147
840 Ga0495597_0000229 3300046542 Bacteria 50600
841 Ga0495597_0002956 3300046542 Bacteria 10300
842 Ga0495645_0018664 3300046543 Bacteria 4985
843 Ga0495645_0019601 3300046543 Bacteria 4870
844 Ga0495645_0019829 3300046543 Bacteria 4845
845 Ga0495622_0001532 3300046557 Bacteria 11519
846 Ga0495633_0000115 3300046558 Bacteria 108676
847 Ga0495667_0010071 3300046559 Bacteria 6401
848 Ga0495668_0005524 3300046616 Bacteria 8523
849 Ga0495668_0005672 3300046616 Bacteria 8364
850 Ga0495668_0037455 3300046616 Bacteria 2713
851 Ga0495634_0000460 3300046642 Bacteria 40242
852 Ga0495634_0008719 3300046642 Bacteria 7520
853 Ga0495611_0001987 3300046648 Bacteria 9695
854 Ga0495625_0000086 3300046660 Bacteria 151735
855 Ga0495625_0008159 3300046660 Bacteria 8969
856 Ga0495625_0010636 3300046660 Bacteria 7588
857 Ga0495625_0019236 3300046660 Bacteria 5304
858 Ga0495635_0000220 3300046663 Bacteria 36107
859 Ga0495635_0004179 3300046663 Bacteria 10018
860 Ga0495635_0010274 3300046663 Bacteria 6545
861 Ga0495659_0000820 3300046664 Bacteria 11054
862 Ga0495661_0000212 3300046665 Bacteria 67078
863 Ga0495661_0000346 3300046665 Bacteria 50529
864 Ga0495661_0001033 3300046665 Bacteria 24720
865 Ga0495661_0001808 3300046665 Bacteria 17152
866 Ga0495661_0002096 3300046665 Bacteria 15649
867 Ga0495661_0004232 3300046665 Bacteria 10429
868 Ga0495661_0006792 3300046665 Bacteria 8022
869 Ga0495661_0018066 3300046665 Bacteria 4644
870 Ga0495661_0019490 3300046665 Bacteria 4444
871 Ga0495661_0033117 3300046665 Bacteria 3261
872 Ga0495588_0011868 3300046674 Bacteria 4101
873 Ga0495657_0008639 3300046675 Bacteria 7772
874 Ga0495657_0035214 3300046675 Bacteria 3471
875 Ga0495599_0001306 3300046678 Bacteria 14176
876 Ga0495623_0014332 3300046679 Bacteria 5132
877 Ga0495646_0016370 3300046680 Bacteria 4705
878 Ga0495646_0030360 3300046680 Bacteria 3375
879 Ga0495647_0000198 3300046681 Bacteria 16065
880 Ga0495658_0004750 3300046683 Bacteria 6671
881 Ga0495669_0004199 3300046684 Bacteria 5927
882 Ga0495624_0001125 3300046690 Bacteria 21160
883 Ga0495624_0017858 3300046690 Bacteria 4754
884 Ga0495671_0000835 3300046692 Bacteria 22013
885 Ga0495671_0001729 3300046692 Bacteria 14173
886 Ga0495671_0003942 3300046692 Bacteria 9001
887 Ga0495671_0004570 3300046692 Bacteria 8233
888 Ga0495671_0004646 3300046692 Bacteria 8137
889 Ga0495671_0005715 3300046692 Bacteria 7251
890 Ga0495671_0017444 3300046692 Bacteria 3822
891 Ga0495649_0001824 3300046694 Bacteria 15645
892 Ga0495649_0003218 3300046694 Bacteria 11152
893 Ga0495649_0004772 3300046694 Bacteria 8784
894 Ga0495649_0009899 3300046694 Bacteria 5639
895 Ga0495649_0014957 3300046694 Bacteria 4432
896 Ga0495649_0027064 3300046694 Bacteria 3182
897 Ga0495589_0000918 3300046794 Bacteria 18098
898 Ga0495589_0008535 3300046794 Bacteria 5342
899 Ga0495600_0001974 3300046809 Bacteria 11534
900 Ga0495600_0004746 3300046809 Bacteria 8153
901 Ga0495600_0016566 3300046809 Bacteria 4681
902 Ga0495600_0023155 3300046809 Bacteria 3994
903 Ga0495660_0003154 3300046810 Bacteria 10267
904 Ga0495660_0005301 3300046810 Bacteria 7722
905 Ga0495660_0015068 3300046810 Bacteria 4470
906 Ga0495660_0018836 3300046810 Bacteria 3963
907 Ga0495660_0031101 3300046810 Bacteria 3003
908 Ga0495581_0000291 3300047315 Bacteria 24325
909 Ga0495581_0024438 3300047315 Bacteria 3501
910 Ga0495604_0007232 3300047317 Bacteria 8790
911 Ga0495604_0014146 3300047317 Bacteria 6363
912 Ga0495604_0031685 3300047317 Bacteria 4193
913 Ga0495604_0048267 3300047317 Bacteria 3312
914 Ga0495674_0000664 3300047319 Bacteria 32284
915 Ga0495674_0001989 3300047319 Bacteria 20095
916 Ga0495674_0056283 3300047319 Bacteria 3445
917 Ga0495672_0003884 3300047320 Bacteria 12561
918 Ga0495672_0004098 3300047320 Bacteria 12155
919 Ga0495672_0007315 3300047320 Bacteria 8326
920 Ga0495672_0007556 3300047320 Bacteria 8157
921 Ga0495672_0007891 3300047320 Bacteria 7940
922 Ga0495672_0013420 3300047320 Bacteria 5654
923 Ga0495672_0024326 3300047320 Bacteria 3904
924 Ga0495676_0000022 3300047321 Bacteria 163719
925 Ga0495676_0009309 3300047321 Bacteria 8953
926 Ga0495676_0013537 3300047321 Bacteria 7331
927 Ga0495680_0002433 3300047322 Bacteria 19048
928 Ga0495680_0014855 3300047322 Bacteria 6731
929 Ga0495680_0032392 3300047322 Bacteria 4243
930 Ga0495680_0032827 3300047322 Bacteria 4209
931 Ga0495680_0052704 3300047322 Bacteria 3170
932 Ga0495683_0000030 3300047323 Bacteria 150551
933 Ga0495683_0000586 3300047323 Bacteria 27461
934 Ga0495683_0003253 3300047323 Bacteria 9496
935 Ga0495683_0003911 3300047323 Bacteria 8567
936 Ga0495683_0015622 3300047323 Bacteria 3946
937 Ga0495687_004182 3300047443 Bacteria 9913
938 Ga0495687_004249 3300047443 Bacteria 9814
939 Ga0495675_0003482 3300047444 Bacteria 9478
940 Ga0495675_0004129 3300047444 Bacteria 8797
941 Ga0495675_0016335 3300047444 Bacteria 4696
942 Ga0495679_000212 3300047446 Bacteria 49948
943 Ga0495679_000341 3300047446 Bacteria 36651
944 Ga0495679_003057 3300047446 Bacteria 8221
945 Ga0495673_0001151 3300047469 Bacteria 22526
946 Ga0495673_0001296 3300047469 Bacteria 20380
947 Ga0495673_0004054 3300047469 Bacteria 9334
948 Ga0495673_0005337 3300047469 Bacteria 7793
949 Ga0495673_0006078 3300047469 Bacteria 7169
950 Ga0495673_0006250 3300047469 Bacteria 7037
951 Ga0495673_0013803 3300047469 Bacteria 4222
952 Ga0495673_0023377 3300047469 Bacteria 3007
953 Ga0495681_0004759 3300047470 Bacteria 9198
954 Ga0495681_0006405 3300047470 Bacteria 7744
955 Ga0495681_0026787 3300047470 Bacteria 2993
956 Ga0495684_0000133 3300047471 Bacteria 54433
957 Ga0495684_0020926 3300047471 Bacteria 5040
958 Ga0495686_0058827 3300047472 Bacteria 2395
959 Ga0495593_0000323 3300047673 Bacteria 26455
960 Ga0495602_0049834 3300048088 Bacteria 3747
961 Ga0495602_0054440 3300048088 Bacteria 3532
962 Ga0495602_0058139 3300048088 Bacteria 3387
963 Ga0495626_0000039 3300048091 Bacteria 175454
964 Ga0495626_0000242 3300048091 Bacteria 63298
965 Ga0495626_0001832 3300048091 Bacteria 15978
966 Ga0495626_0003058 3300048091 Bacteria 10981
967 Ga0495626_0004652 3300048091 Bacteria 8335
968 Ga0495626_0004671 3300048091 Bacteria 8312
969 Ga0495626_0018915 3300048091 Bacteria 3448
970 Ga0496102_0002921 3300048905 Bacteria 14497
971 Ga0496102_0025012 3300048905 Bacteria 5311
972 Ga0496102_0029706 3300048905 Bacteria 4891
973 Ga0496104_0002055 3300048907 Bacteria 17481
974 Ga0496104_0002496 3300048907 Bacteria 15827
975 Ga0496104_0012404 3300048907 Bacteria 7663
976 Ga0496104_0014417 3300048907 Bacteria 7142
977 Ga0496104_0026955 3300048907 Bacteria 5313
978 Ga0496104_0028265 3300048907 Bacteria 5197
979 Ga0496105_0000745 3300048908 Bacteria 22090
980 Ga0496105_0009357 3300048908 Bacteria 7660
981 Ga0496105_0012772 3300048908 Bacteria 6653
982 Ga0496105_0041847 3300048908 Bacteria 3776
983 Ga0496106_0004350 3300048909 Bacteria 10522
984 Ga0496106_0014763 3300048909 Bacteria 5775
985 Ga0496107_0003866 3300048910 Bacteria 10066
986 Ga0496107_0007228 3300048910 Bacteria 7650
987 Ga0496107_0055542 3300048910 Bacteria 2860
988 Ga0496108_0000442 3300048911 Bacteria 33309
989 Ga0496108_0001557 3300048911 Bacteria 18155
990 Ga0496108_0010081 3300048911 Bacteria 7665
991 Ga0496109_0001341 3300048912 Bacteria 20342
992 Ga0496109_0022776 3300048912 Bacteria 5550
993 Ga0496110_0014426 3300048913 Bacteria 6561
994 Ga0496110_0019399 3300048913 Bacteria 5720
995 Ga0496110_0025213 3300048913 Bacteria 5078
996 Ga0496110_0026026 3300048913 Bacteria 5003
997 Ga0496110_0036712 3300048913 Bacteria 4257
998 Ga0496111_0028481 3300048914 Bacteria 3959
999 Ga0496112_0000051 3300048915 Bacteria 82351
1000 Ga0496112_0000655 3300048915 Bacteria 24037
1001 Ga0496112_0030907 3300048915 Bacteria 5188
1002 Ga0496113_0000982 3300048916 Bacteria 15219
1003 Ga0496114_0007693 3300048917 Bacteria 8521
1004 Ga0496114_0050155 3300048917 Bacteria 3474
1005 Ga0496114_0078294 3300048917 Bacteria 2789
1006 Ga0496115_0018715 3300048918 Bacteria 5324
1007 Ga0496116_0000881 3300048919 Bacteria 37470
1008 Ga0496116_0004615 3300048919 Bacteria 13063
1009 Ga0496116_0005174 3300048919 Bacteria 12243
1010 Ga0496116_0022410 3300048919 Bacteria 4732
1011 Ga0496116_0027452 3300048919 Bacteria 4145
1012 Ga0496117_0002861 3300048920 Bacteria 20985
1013 Ga0496117_0008441 3300048920 Bacteria 9778
1014 Ga0496117_0009463 3300048920 Bacteria 9063
1015 Ga0496117_0029062 3300048920 Bacteria 4267
1016 Ga0496117_0030174 3300048920 Bacteria 4164
1017 Ga0496117_0041829 3300048920 Bacteria 3351
1018 Ga0496118_0004108 3300048921 Bacteria 17620
1019 Ga0496118_0009635 3300048921 Bacteria 9717
1020 Ga0496118_0013389 3300048921 Bacteria 7763
1021 Ga0496118_0024544 3300048921 Bacteria 5199
1022 Ga0496118_0027349 3300048921 Bacteria 4829
1023 Ga0496118_0045810 3300048921 Bacteria 3408
1024 Ga0496119_0000060 3300048922 Bacteria 172646
1025 Ga0496119_0002304 3300048922 Bacteria 21104
1026 Ga0496119_0010712 3300048922 Bacteria 7685
1027 Ga0496119_0022739 3300048922 Bacteria 4476
1028 Ga0496119_0045531 3300048922 Bacteria 2749
1029 Ga0496120_0003825 3300048923 Bacteria 13232
1030 Ga0496121_0000144 3300048924 Bacteria 156856
1031 Ga0496121_0001650 3300048924 Bacteria 36892
1032 Ga0496121_0003740 3300048924 Bacteria 21314
1033 Ga0496121_0007337 3300048924 Bacteria 13331
1034 Ga0496121_0012757 3300048924 Bacteria 9102
1035 Ga0496121_0013250 3300048924 Bacteria 8879
1036 Ga0496121_0014564 3300048924 Bacteria 8331
1037 Ga0496121_0014671 3300048924 Bacteria 8286
1038 Ga0496121_0019695 3300048924 Bacteria 6731
1039 Ga0496122_0001366 3300048925 Bacteria 39678
1040 Ga0496122_0002897 3300048925 Bacteria 23445
1041 Ga0496122_0005797 3300048925 Bacteria 14523
1042 Ga0496122_0011268 3300048925 Bacteria 9082
1043 Ga0496122_0034155 3300048925 Bacteria 4168
1044 Ga0496122_0071400 3300048925 Bacteria 2475
1045 Ga0496123_0001033 3300048926 Bacteria 42272
1046 Ga0496123_0001703 3300048926 Bacteria 29387
1047 Ga0496123_0013950 3300048926 Bacteria 6696
1048 Ga0496124_0000120 3300048927 Bacteria 163899
1049 Ga0496124_0010997 3300048927 Bacteria 9094
1050 Ga0496124_0011914 3300048927 Bacteria 8653
1051 Ga0496124_0021692 3300048927 Bacteria 5914
1052 Ga0496124_0043648 3300048927 Bacteria 3853
1053 Ga0496124_0047212 3300048927 Bacteria 3685
1054 Ga0496124_0050045 3300048927 Bacteria 3562
1055 Ga0496124_0065564 3300048927 Bacteria 3027
1056 Ga0496125_0000099 3300048928 Bacteria 203333
1057 Ga0496125_0003667 3300048928 Bacteria 18348
1058 Ga0496125_0009550 3300048928 Bacteria 9944
1059 Ga0496125_0010381 3300048928 Bacteria 9420
1060 Ga0496125_0013483 3300048928 Bacteria 8029
1061 Ga0496125_0021610 3300048928 Bacteria 5997
1062 Ga0496125_0025971 3300048928 Bacteria 5350
1063 Ga0496125_0031206 3300048928 Bacteria 4752
1064 Ga0496126_0002484 3300048929 Bacteria 24807
1065 Ga0496126_0026919 3300048929 Bacteria 5504
1066 Ga0496126_0028855 3300048929 Bacteria 5280
1067 Ga0496126_0054275 3300048929 Bacteria 3630
1068 Ga0495678_000017 3300049459 Bacteria 282592
1069 Ga0495678_000238 3300049459 Bacteria 62224
1070 Ga0495678_001946 3300049459 Bacteria 14952
1071 Ga0495682_0001189 3300049460 Bacteria 14807
1072 Ga0495682_0002650 3300049460 Bacteria 8362
1073 Ga0501032_0000227 3300049569 Bacteria 46864
1074 Ga0501032_0019020 3300049569 Bacteria 4806
1075 Ga0501033_0004294 3300049570 Bacteria 11449
1076 Ga0501033_0006907 3300049570 Bacteria 8861
1077 Ga0501034_0000089 3300049571 Bacteria 165644
1078 Ga0501034_0000100 3300049571 Bacteria 159536
1079 Ga0501034_0000295 3300049571 Bacteria 88435
1080 Ga0501034_0001845 3300049571 Bacteria 26903
1081 Ga0501034_0047008 3300049571 Bacteria 4359
1082 Ga0501036_0000010 3300049572 Bacteria 163304
1083 Ga0501036_0000217 3300049572 Bacteria 38514
1084 Ga0501037_0000183 3300049573 Bacteria 57879
1085 Ga0501037_0016096 3300049573 Bacteria 5503
1086 Ga0501038_0000054 3300049574 Bacteria 94123
1087 Ga0501039_0000110 3300049575 Bacteria 55320
1088 Ga0501039_0011119 3300049575 Bacteria 6861
1089 Ga0501043_0000106 3300049579 Bacteria 77699
1090 Ga0501043_0023015 3300049579 Bacteria 4886
1091 Ga0501046_0004933 3300049580 Bacteria 11996
1092 Ga0501047_0000363 3300049581 Bacteria 51477
1093 Ga0501047_0000702 3300049581 Bacteria 34900
1094 Ga0501047_0036630 3300049581 Bacteria 4742
1095 Ga0501048_0000031 3300049582 Bacteria 65561
1096 Ga0501048_0000456 3300049582 Bacteria 28577
1097 Ga0501048_0052267 3300049582 Bacteria 2907
1098 Ga0501067_0003366 3300049583 Bacteria 8788
1099 Ga0501068_0005210 3300049584 Bacteria 7092
1100 Ga0501070_0001016 3300049586 Bacteria 25196
1101 Ga0501070_0033697 3300049586 Bacteria 4286
1102 Ga0501072_0001530 3300049588 Bacteria 17298
1103 Ga0501073_0000238 3300049589 Bacteria 36316
1104 Ga0501074_0000259 3300049590 Bacteria 30031
1105 Ga0501074_0031393 3300049590 Bacteria 3848
1106 Ga0501079_0004438 3300049741 Bacteria 10393
1107 Ga0501080_0000279 3300049742 Bacteria 38549
1108 Ga0501083_0000550 3300049744 Bacteria 23969
1109 Ga0501083_0001701 3300049744 Bacteria 14998
1110 Ga0501035_0000817 3300049822 Bacteria 33190
1111 Ga0501035_0008622 3300049822 Bacteria 9487
1112 Ga0501044_0002385 3300049823 Bacteria 21410
1113 Ga0501044_0009141 3300049823 Bacteria 10823
1114 Ga0501044_0037223 3300049823 Bacteria 5087
1115 Ga0501044_0039631 3300049823 Bacteria 4914
1116 Ga0501226_000003 3300049853 Bacteria 358977
1117 nmdc:mga03n38_25615_c1 3300050490 Bacteria 2425
1118 nmdc:mga00v17_23809_c1 3300050491 Bacteria 3545
1119 nmdc:mga00v17_28528_c1 3300050491 Bacteria 3269
1120 nmdc:mga0yw44_1210_c1 3300050492 Bacteria 10107
1121 nmdc:mga0yw44_7385_c1 3300050492 Bacteria 5403
1122 nmdc:mga0k408_25096_c1 3300050493 Bacteria 3373
1123 nmdc:mga07m45_2171_c1 3300050496 Bacteria 8803
1124 nmdc:mga05p37_15019_c1 3300050507 Bacteria 9295
1125 nmdc:mga05p37_4278_c1 3300050507 Bacteria 16673
1126 nmdc:mga09592_32400_c1 3300050508 Bacteria 4357
1127 nmdc:mga0qj67_235_c1 3300050509 Bacteria 37732
1128 nmdc:mga06r32_49651_c1 3300050510 Bacteria 4013
1129 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
1130 nmdc:mga0n895_11393_c1 3300050512 Bacteria 7931
1131 nmdc:mga0n895_24802_c1 3300050512 Bacteria 5657
1132 Ga0495601_0000314 3300053077 Bacteria 25703
1133 Ga0495601_0002711 3300053077 Bacteria 10052
1134 Ga0495601_0025781 3300053077 Bacteria 3627
1135 Ga0495612_0003727 3300053078 Bacteria 6333
1136 Ga0495595_0001460 3300053084 Bacteria 9233
1137 Ga0495619_0001836 3300053085 Bacteria 14121
1138 Ga0500578_0032414 3300053086 Bacteria 3359
1139 Ga0500643_000231 3300053087 Bacteria 51641
1140 Ga0500651_0001006 3300053093 Bacteria 13869
1141 Ga0500566_0000527 3300053094 Bacteria 21443
1142 Ga0500566_0000931 3300053094 Bacteria 16746
1143 Ga0500566_0001874 3300053094 Bacteria 12376
1144 Ga0500556_0000005 3300053104 Bacteria 581135
1145 Ga0500556_0000148 3300053104 Bacteria 58772
1146 Ga0500557_000180 3300053105 Bacteria 12178
1147 Ga0500562_000305 3300053108 Bacteria 12000
1148 Ga0500595_000469 3300053119 Bacteria 24960
1149 Ga0500595_002835 3300053119 Bacteria 8333
1150 Ga0500595_005065 3300053119 Bacteria 5790
1151 Ga0500595_005098 3300053119 Bacteria 5768
1152 Ga0500608_000871 3300053122 Bacteria 10890
1153 Ga0500642_0000009 3300053130 Bacteria 286829
1154 Ga0500642_0000087 3300053130 Bacteria 48287
1155 Ga0500652_001138 3300053131 Bacteria 8538
1156 Ga0500658_0010195 3300053134 Bacteria 3463
1157 Ga0500559_0000723 3300053136 Bacteria 21728
1158 Ga0500559_0001753 3300053136 Bacteria 11902
1159 Ga0500577_0001505 3300053142 Bacteria 5946
1160 Ga0500586_002742 3300053145 Bacteria 4043
1161 Ga0500616_0000035 3300053153 Bacteria 394242
1162 Ga0500634_0033053 3300053161 Bacteria 2819
1163 Ga0500636_0000344 3300053177 Bacteria 25582
1164 Ga0500636_0002110 3300053177 Bacteria 10960
1165 Ga0500637_0000471 3300053178 Bacteria 15567
1166 Ga0500625_002579 3300053729 Bacteria 6848
1167 Ga0500601_000438 3300053737 Bacteria 6849
1168 Ga0501084_0016383 3300054114 Bacteria 6155
1169 Ga0501082_0008684 3300060353 Bacteria 8761
1170 2507504681 2507262055 Bacteria 8048963
1171 2508539902 2508501009 Bacteria 7784016
1172 2508694961 2508501042 Bacteria 8719808
1173 2509149915 2508501128 Bacteria 8613869
1174 2511258458 2511231004 Bacteria 6669789
1175 2511265615 2511231006 Bacteria 6794709
1176 2511272588 2511231007 Bacteria 6306603
1177 2511280596 2511231008 Bacteria 6624100
1178 2511288868 2511231010 Bacteria 6373152
1179 2511293891 2511231011 Bacteria 6149768
1180 2511299463 2511231012 Bacteria 6738011
1181 2511315172 2511231014 Bacteria 6462302
1182 2511322573 2511231015 Bacteria 6598026
1183 2511323638 2511231016 Bacteria 6704427
1184 2511332721 2511231017 Bacteria 6503007
1185 2511337882 2511231018 Bacteria 6436256
1186 2511345099 2511231019 Bacteria 6520662
1187 2511349022 2511231020 Bacteria 6115223
1188 2511356186 2511231021 Bacteria 7302637
1189 2511361403 2511231022 Bacteria 6719296
1190 2511368546 2511231023 Bacteria 6808468
1191 2511378018 2511231024 Bacteria 5835885
1192 2511398851 2511231028 Bacteria 8046582
1193 2511411232 2511231031 Bacteria 6558529
1194 2511822351 2511231156 Bacteria 6845832
1195 2512325873 2512047018 Bacteria 6663241
1196 2513625625 2513237092 Bacteria 8341956
1197 2513640695 2513237094 Bacteria 8789602
1198 2513653439 2513237095 Bacteria 8976980
1199 2513658874 2513237096 Bacteria 8722461
1200 2513678455 2513237098 Bacteria 9902361
1201 2513698127 2513237101 Bacteria 7952346
1202 2513701756 2513237102 Bacteria 7703324
1203 2513714884 2513237104 Bacteria 10034502
1204 2513858934 2513237137 Bacteria 9558895
1205 2513874040 2513237139 Bacteria 8737671
1206 2513889652 2513237141 Bacteria 8496279
1207 2513921138 2513237145 Bacteria 8979722
1208 2514010190 2513237161 Bacteria 8871253
1209 2515627767 2515154112 Bacteria 8294334
1210 2517108692 2517093001 Bacteria 9002274
1211 2517889552 2517572143 Bacteria 9484767
1212 2524438604 2524023205 Bacteria 8918781
1213 2524466156 2524023210 Bacteria 9029266
1214 2524539572 2524023228 Bacteria 10118060
1215 2524610623 2524023250 Bacteria 5457705
1216 2528854749 2528768022 Bacteria 10457665
1217 2554815533 2554235132 Bacteria 6772433
1218 2555247801 2554235231 Bacteria 5215788
1219 2555667336 2554235341 Bacteria 6867980
1220 2583789886 2582580891 Bacteria 6800976
1221 2597855580 2597489887 Bacteria 6666321
1222 2597861582 2597489888 Bacteria 6179543
1223 2597867302 2597489889 Bacteria 6297495
1224 2599327479 2599185155 Bacteria 5827168
1225 2599356559 2599185160 Bacteria 6844013
1226 2599363411 2599185161 Bacteria 6960462
1227 2599369637 2599185162 Bacteria 6957254
1228 2599376520 2599185163 Bacteria 6995158
1229 2599381664 2599185164 Bacteria 6841688
1230 2599388192 2599185165 Bacteria 6843250
1231 2599395284 2599185166 Bacteria 6959206
1232 2599398938 2599185167 Bacteria 6353609
1233 2599407049 2599185168 Bacteria 6997636
1234 2599450993 2599185179 Bacteria 6611171
1235 2599463392 2599185181 Bacteria 6844519
1236 2599469258 2599185182 Bacteria 6883168
1237 2599485482 2599185185 Bacteria 6652270
1238 2599492409 2599185186 Bacteria 6831633
1239 2599502569 2599185188 Bacteria 6164180
1240 2599506352 2599185189 Bacteria 5862825
1241 2599514061 2599185190 Bacteria 6285678
1242 2599518662 2599185191 Bacteria 6297582
1243 2599613048 2599185212 Bacteria 6765997
1244 2599769307 2599185248 Bacteria 6696816
1245 2599806611 2599185257 Bacteria 6492581
1246 2599882574 2599185288 Bacteria 6666191
1247 2599888550 2599185289 Bacteria 6778765
1248 2599893604 2599185290 Bacteria 6289611
1249 2599900201 2599185291 Bacteria 6775623
1250 2599934153 2599185300 Bacteria 6062622
1251 2599943680 2599185302 Bacteria 5954930
1252 2599952116 2599185303 Bacteria 6512725
1253 2599955990 2599185304 Bacteria 5951361
1254 2599961784 2599185305 Bacteria 6748700
1255 2599966917 2599185306 Bacteria 6637356
1256 2599974404 2599185307 Bacteria 6194719
1257 2599978272 2599185308 Bacteria 6621546
1258 2599984684 2599185309 Bacteria 5969593
1259 2599991163 2599185310 Bacteria 6014457
1260 2599994953 2599185311 Bacteria 6354990
1261 2600002306 2599185312 Bacteria 5912071
1262 2600004760 2599185313 Bacteria 6658188
1263 2600012508 2599185314 Bacteria 6621749
1264 2600018744 2599185315 Bacteria 6771107
1265 2600026730 2599185316 Bacteria 6320029
1266 2600029881 2599185317 Bacteria 6435722
1267 2600034781 2599185318 Bacteria 6961590
1268 2600043906 2599185319 Bacteria 6637840
1269 2600047974 2599185320 Bacteria 5963263
1270 2600055622 2599185321 Bacteria 6764560
1271 2600060294 2599185322 Bacteria 6763055
1272 2600067554 2599185323 Bacteria 6688755
1273 2600071423 2599185324 Bacteria 6590677
1274 2600080405 2599185325 Bacteria 6324919
1275 2600216021 2599185356 Bacteria 6843884
1276 2600359190 2600254930 Bacteria 6431253
1277 2600364961 2600254931 Bacteria 6734225
1278 2600444595 2600254954 Bacteria 5100516
1279 2601627247 2600255283 Bacteria 6061572
1280 2601692262 2600255296 Bacteria 5784754
1281 2601776188 2600255313 Bacteria 6842543
1282 2601797748 2600255318 Bacteria 6383414
1283 2602011666 2600255389 Bacteria 5275336
1284 2603857953 2602042107 Bacteria 6226103
1285 2606076769 2603880185 Bacteria 6379190
1286 2606128817 2603880199 Bacteria 6377649
1287 2608383836 2606217733 Bacteria 6360972
1288 2617350168 2617270735 Bacteria 9163226
1289 2617377140 2617270741 Bacteria 8201522
1290 2621302257 2619619299 Bacteria 6649820
1291 2624478135 2623620443 Bacteria 6427864
1292 2624489680 2623620446 Bacteria 6500345
1293 2643740265 2643221543 Bacteria 6628015
1294 2643840900 2643221565 Bacteria 6216018
1295 2643872702 2643221571 Bacteria 6228673
1296 2643954997 2643221589 Bacteria 6250934
1297 2644024633 2643221602 Bacteria 6249926
1298 2644186038 2643221633 Bacteria 6733554
1299 2644282659 2643221650 Bacteria 7029547
1300 2644619568 2643221713 Bacteria 6554480
1301 2644732142 2643221733 Bacteria 5690728
1302 2671092677 2667528170 Bacteria 6786960
1303 2671100051 2667528171 Bacteria 6900659
1304 2671121259 2667528175 Bacteria 7532676
1305 2671127239 2667528176 Bacteria 6724917
1306 2671691934 2671180139 Bacteria 4196045
1307 2671772262 2671180172 Bacteria 6495783
1308 2677898298 2675903420 Bacteria 6247433
1309 2678260887 2675903515 Bacteria 6580491
1310 2715749124 2713897148 Bacteria 5883533
1311 2715754394 2713897149 Bacteria 6506249
1312 2718632081 2718217725 Bacteria 5758958
1313 2723246471 2721755607 Bacteria 5841722
1314 2723849177 2721755755 Bacteria 8322773
1315 2728749261 2728368998 Bacteria 8720350
1316 2729146694 2728369097 Bacteria 4333476
1317 2738674919 2738541265 Bacteria 6594665
1318 2738687637 2738541271 Bacteria 5657310
1319 2738753312 2738541282 Bacteria 6593925
1320 2738808001 2738541294 Bacteria 6925949
1321 2738862511 2738541303 Bacteria 6591772
1322 2738895361 2738541309 Bacteria 6926455
1323 2739197943 2738543004 Bacteria 6381073
1324 2739260396 2738543015 Bacteria 6750701
1325 2739263258 2738543016 Bacteria 5657564
1326 2739285344 2738543020 Bacteria 5718238
1327 2739290658 2738543021 Bacteria 5718241
1328 2739311199 2738543025 Bacteria 6600348
1329 2743734998 2740892503 Bacteria 6855563
1330 2745006200 2744054620 Bacteria 6551379
1331 2745077679 2744054633 Bacteria 8678936
1332 2765581551 2765235841 Bacteria 6137024
1333 2774119644 2773857670 Bacteria 6407454
1334 2774134657 2773857673 Bacteria 6513460
1335 2784261133 2784132063 Bacteria 6262788
1336 2784316282 2784132072 Bacteria 6596533
1337 2793073639 2791355197 Bacteria 8420563
1338 2793078465
1339 2794598752 2791355520 Bacteria 5948615
1340 2805920397 2802429603 Bacteria 8777136
1341 2807406180 2806310737 Bacteria 5751088
1342 2807454532 2806310745 Bacteria 5742165
1343 2808856559 2808606361 Bacteria 6136259
1344 2808922842 2808606376 Bacteria 6248667
1345 2808932098 2808606377 Bacteria 6646337
1346 2808936538 2808606378 Bacteria 6177535
1347 2808944529 2808606380 Bacteria 6248705
1348 2808954301 2808606381 Bacteria 6646461
1349 2808955775 2808606382 Bacteria 6841132
1350 2808964946 2808606383 Bacteria 6138645
1351 2808976748 2808606385 Bacteria 6711065
1352 2808991814 2808606388 Bacteria 6706662
1353 2808999838 2808606389 Bacteria 6138126
1354 2809217896 2808606445 Bacteria 6057339
1355 2812366386 2811994881 Bacteria 6298475
1356 2817488320 2816332298 Bacteria 6852809
1357 2818243496 2816332527 Bacteria 8933356
1358 2819657144 2818991456 Bacteria 6123676
1359 2819705133 2818991464 Bacteria 6907494
1360 2821113339 2821111986 Bacteria 6894338
1361 2823423726 2823421272 Bacteria 5372474
1362 2824605818 2824600985 Bacteria 8488197
1363 2824611968 2824609381 Bacteria 8672835
1364 2824622845 2824617872 Bacteria 8814715
1365 2824631934 2824626560 Bacteria 8813858
1366 2824642987 2824635225 Bacteria 8785348
1367 2824651069 2824644064 Bacteria 8743947
1368 2824658785 2824653114 Bacteria 8493680
1369 2824664317 2824661429 Bacteria 9877870
1370 2824676890 2824671348 Bacteria 8369588
1371 2824682000 2824679649 Bacteria 8248951
1372 2824693267 2824687955 Bacteria 8360029
1373 2824701511 2824696289 Bacteria 8335049
1374 2824710570 2824704595 Bacteria 9667483
1375 2824721082 2824714736 Bacteria 8717648
1376 2824731151 2824723954 Bacteria 8758240
1377 2824734118 2824732956 Bacteria 7810675
1378 2824749179 2824746037 Bacteria 7911610
1379 2824762237 2824753945 Bacteria 9787441
1380 2824772610 2824763712 Bacteria 9792355
1381 2824780098 2824773399 Bacteria 8360218
1382 2825654355 2825651385 Bacteria 6715909
1383 2826582507 2826581358 Bacteria 5963467
1384 2834032293 2834028612 Bacteria 6354979
1385 2838125897 2838122688 Bacteria 8803140
1386 2841942709 2841941048 Bacteria 8688029
1387 2841952940 2841949485 Bacteria 8680857
1388 2841963441 2841957949 Bacteria 8652217
1389 2841971032 2841966195 Bacteria 8673214
1390 2841977709 2841974524 Bacteria 8931498
1391 2841984729 2841983080 Bacteria 8395090
1392 2842041550 2842038055 Bacteria 8002051
1393 2842049592 2842045827 Bacteria 8006841
1394 2842695066 2842694124 Bacteria 4063419
1395 2842806977 2842805378 Bacteria 5385175
1396 2842817647 2842815866 Bacteria 5947510
1397 2842830634 2842826826 Bacteria 5974129
1398 2842834083 2842832357 Bacteria 5959113
1399 2842838538 2842837860 Bacteria 6066181
1400 2842846445 2842843487 Bacteria 6004777
1401 2842851605 2842849001 Bacteria 5924277
1402 2842859470 2842854478 Bacteria 6143501
1403 2844316008 2844315083 Bacteria 8138177
1404 2844667814 2844665904 Bacteria 6817974
1405 2847939764 2847930680 Bacteria 9342022
1406 2847943075 2847939898 Bacteria 8606328
1407 2849076819 2849076700 Bacteria 7039503
1408 2852616990 2852612431 Bacteria 6885235
1409 2852660535 2852657418 Bacteria 6472974
1410 2852672021 2852667396 Bacteria 6885555
1411 2857515780 2857509624 Bacteria 7472071
1412 2857527333 2857524615 Bacteria 6615449
1413 2860343722 2860339153 Bacteria 6846989
1414 2860868362 2860867994 Bacteria 5645326
1415 2864737258 2864733723 Bacteria 6770668
1416 2874593720 2874590934 Bacteria 8299676
1417 2874606886 2874604998 Bacteria 7834745
1418 2874617598 2874612657 Bacteria 8252029
1419 2874622008 2874620515 Bacteria 8290088
1420 2874629329 2874628541 Bacteria 8630250
1421 2874647983 2874645413 Bacteria 8214782
1422 2876763410 2876761206 Bacteria 10111113
1423 2876772811 2876771140 Bacteria 8287509
1424 2876826460 2876818435 Bacteria 8274608
1425 2878030080 2878029506 Bacteria 6418441
1426 2879077507 2879074833 Bacteria 8279565
1427 2879089976 2879083081 Bacteria 8587928
1428 2879105498 2879099564 Bacteria 10442239
1429 2879112607 2879110137 Bacteria 8907982
1430 2879134389 2879127579 Bacteria 8294491
1431 2879147348 2879142872 Bacteria 8267021
1432 2880231031 2880230671 Bacteria 6140320
1433 2881364487 2881364244 Bacteria 7710352
1434 2881666097 2881665667 Bacteria 8175609
1435 2885369073 2885366525 Bacteria 8326213
1436 2885376909 2885374607 Bacteria 8927485
1437 2885390003 2885383462 Bacteria 9473874
1438 2885411897 2885409591 Bacteria 9235467
1439 2885526610 2885526491 Bacteria 7164189
1440 2888378852 2888378607 Bacteria 9652610
1441 2888390139 2888388044 Bacteria 7304136
1442 2888427279 2888419890 Bacteria 7857137
1443 2889036128 2889033259 Bacteria 9099371
1444 2889045111 2889042446 Bacteria 7618936
1445 2893071874 2893066018 Bacteria 6158120
1446 2903729598 2903727486 Bacteria 8281579
1447 2903757085 2903748898 Bacteria 9972761
1448 2903774741 2903768456 Bacteria 9749579
1449 2904165159 2904162308 Bacteria 7086713
1450 2904492003 2904490793 Bacteria 7046938
1451 2904519490 2904518522 Bacteria 6068986
1452 2904552332 2904550169 Bacteria 6221258
1453 2904669400 2904666416 Bacteria 8226587
1454 2904692145 2904690495 Bacteria 9412302
1455 2904709371
1456 2904714488 2904711408 Bacteria 9771557
1457 2906606101 2906602504 Bacteria 8295279
1458 2906613068
1459 2906635093 2906626472 Bacteria 8826946
1460 2906641173 2906635258 Bacteria 8601019
1461 2906645618 2906643746 Bacteria 8722424
1462 2906665729 2906660503 Bacteria 8595048
1463 2908446946 2908446538 Bacteria 6829095
1464 2908748049 2908739725 Bacteria 8628932
1465 2908756676 2908756301 Bacteria 8864324
1466 2908783055 2908775508 Bacteria 8092255
1467 2912964121 2912963787 Bacteria 5646108
1468 2913037182 2913036834 Bacteria 6704877
1469 2917071087 2917070673 Bacteria 6868303
1470 2919066238 2919063839 Bacteria 6302690
1471 2919078445 2919073203 Bacteria 6531949
1472 2919157530 2919155634 Bacteria 4860545
1473 2919161240 2919160200 Bacteria 6929020
1474 2919389854 2919385768 Bacteria 5897293
1475 2919451829 2919450847 Bacteria 5631160
1476 2919459901 2919456309 Bacteria 6586567
1477 2919486481 2919481497 Bacteria 6907839
1478 2919488789 2919487758 Bacteria 5929766
1479 2919503355 2919501602 Bacteria 5286340
1480 2919699041 2919697872 Bacteria 6553725
1481 2922364507 2922361189 Bacteria 7436256
1482 2922377710
1483 2922389191 2922386360 Bacteria 7017218
1484 2922400910 2922393267 Bacteria 8285685
1485 2922433561
1486 2923153993 2923153595 Bacteria 6870622
1487 2923520410 2923519811 Bacteria 6298479
1488 2923589680 2923586266 Bacteria 6565975
1489 2926066074 2926063275 Bacteria 5285848
1490 2929144719 2929144301 Bacteria 6622272
1491 2929190222 2929189879 Bacteria 5930554
1492 2929623320 2929615660 Bacteria 9193770
1493 2929632589 2929624759 Bacteria 9339455
1494 2931371948 2931369376 Bacteria 6847892
1495 2931388547 2931384279 Bacteria 7299545
1496 2931391291 2931390751 Bacteria 6273349
1497 2931398754 2931396565 Bacteria 7251677
1498 2932788207 2932784394 Bacteria 9704911
1499 2932800064 2932794094 Bacteria 7915132
1500 2932808348 2932801729 Bacteria 7987968
1501 2932813578 2932809354 Bacteria 9135765
1502 2932820275 2932818245 Bacteria 9955613
1503 2932832658 2932828146 Bacteria 9745859
1504 2933585223 2933577622 Bacteria 9116884
1505 2935358915 2935353572 Unclassified 6955622
1506 2935615124 2935608549 Bacteria 8203142
1507 2935620148 2935616580 Bacteria 9032984
1508 2935635079 2935630451 Bacteria 8169952
1509 2935640466 2935638405 Bacteria 10015038
1510 2935651519 2935648319 Bacteria 8801166
1511 2935659713 2935656913 Bacteria 8965014
1512 2935668660 2935665750 Bacteria 9571747
1513 2935681962 2935675223 Bacteria 9928132
1514 2935686968 2935684952 Bacteria 9590419
1515 2935697062 2935694250 Bacteria 9291695
1516 2935709830 2935703347 Bacteria 10242284
1517 2935716656 2935713505 Bacteria 9608509
1518 2935723219 2935722832 Bacteria 9608746
1519 2935734776 2935732158 Bacteria 9706831
1520 2935744433 2935741537 Bacteria 9707219
1521 2935752934 2935750917 Bacteria 9590372
1522 2935766832 2935760218 Bacteria 9817913
1523 2935774808 2935769743 Bacteria 7878163
1524 2935779704 2935777560 Bacteria 8077691
1525 2935789677 2935785616 Bacteria 7962367
1526 2935797955 2935793552 Bacteria 8012592
1527 2935804580 2935801545 Bacteria 9301974
1528 2935815733 2935810662 Bacteria 9401221
1529 2935825838 2935819856 Bacteria 8261050
1530 2935831972 2935827899 Bacteria 10038562
1531 2935841196 2935837841 Bacteria 9454360
1532 2935851457 2935847175 Bacteria 8228321
1533 2935859034 2935855204 Bacteria 9035059
1534 2935864215 2935864058 Bacteria 9784707
1535 2935875433 2935873716 Bacteria 9632195
1536 2935883456 2935883170 Bacteria 7964738
1537 2935910517 2935908558 Bacteria 8568796
1538 2935918079 2935916978 Bacteria 9113783
1539 2935927572 2935926038 Bacteria 8601059
1540 2935936556 2935934488 Bacteria 8602579
1541 2935943891 2935942939 Bacteria 8599779
1542 2935952328 2935951376 Bacteria 8602333
1543 2935964385 2935959822 Bacteria 7869783
1544 2935969168 2935967501 Bacteria 8603075
1545 2935978432 2935975950 Bacteria 8347125
1546 2935984621 2935984226 Bacteria 8302647
1547 2935995588 2935992306 Bacteria 9802711
1548 2936008008 2936002035 Bacteria 9362176
1549 2936014129 2936011229 Bacteria 8801034
1550 2936022962 2936019824 Bacteria 8804134
1551 2936031098 2936028420 Bacteria 8965941
1552 2936041635 2936037263 Bacteria 9446081
1553 2936049220 2936046547 Bacteria 8903709
1554 2936055666 2936055302 Bacteria 8785755
1555 2939641017 2939636861 Bacteria 6297853
1556 2939654943 2939651529 Bacteria 5895393
1557 2939670308 2939669807 Bacteria 5028511
1558 2939682661 2939679117 Bacteria 6921672
1559 2940558847 2940556831 Bacteria 9590747
1560 2941511642 2941507105 Bacteria 8166816
1561 2941519375 2941515067 Bacteria 8166720
1562 2941527501 2941523033 Bacteria 8169134
1563 2941535872 2941531003 Bacteria 7653939
1564 2941543422 2941538514 Bacteria 9402094
1565 2945930260 2945928738 Bacteria 6053221
1566 2945967511 2945961074 Bacteria 7342064
1567 2945992863 2945991243 Bacteria 7008369
1568 2946012593 2946006987 Bacteria 6705746
1569 2946028561 2946027586 Bacteria 6049274
1570 2946055604 2946053406 Bacteria 6978655
1571 2947235093 2947233263 Bacteria 6439278
1572 2969304876 2969304461 Bacteria 6601805
1573 2974293430 2974289157 Bacteria 6080362
1574 2984292068 2984286254 Bacteria 6702062
1575 2988732113 2988728565 Bacteria 6124362
1576 2990197093 2990196909 Bacteria 4054280
1577 2998140377 2998139840 Bacteria 6073514
1578 3005483217 3005474847 Bacteria 9259049
1579 3005490543 3005483717 Bacteria 7877331
1580 3005506438 3005506211 Bacteria 6943378
1581 3005588916 3005587118 Bacteria 7794411
1582 3005595596 3005594810 Bacteria 8716512
1583 3005711588 3005710791 Bacteria 7622528
1584 3005718845 3005718088 Bacteria 8283608
1585 3007253257 3007252601 Bacteria 4559114
1586 3007317948 3007315729 Bacteria 5076637
1587 3007398006 3007395558 Bacteria 6755444
1588 3007419933 3007419365 Bacteria 7026924
1589 3007517812 3007511990 Bacteria 6481491
1590 3007616197 3007614139 Bacteria 6053559
1591 3007625369 3007619802 Bacteria 6411688
1592 3007724027 3007718800 Bacteria 5971527
1593 3007805672 3007803356 Bacteria 5931491
1594 3007857175 3007855910 Bacteria 5637581
1595 3007864417 3007861166 Bacteria 6045338
1596 3007871976 3007866637 Bacteria 5899198
1597 3007875579 3007872151 Bacteria 5268868
1598 637317733 637000220 Bacteria 7074893
1599 8001850074 8001845381 Bacteria 5804942
1600 8002061481 8002060224 Bacteria 4026565
1601 8006926997 8006926726 Bacteria 6749210
1602 8006935591 8006933436 Bacteria 10410654
1603 8006967717 8006964411 Bacteria 8966052
1604 8006975520 8006973647 Bacteria 10679141
1605 8006992625 8006984368 Bacteria 9651211
1606 8006998385 8006994254 Bacteria 8309700
1607 8015688242 8015687852 Bacteria 6613826
1608 8016517575 8016511872 Bacteria 9921665
1609 8016525655 8016522445 Bacteria 8156687
1610 8016539251 8016530956 Bacteria 8155261
1611 8016543541 8016539877 Bacteria 8155419
1612 8016549752 8016548790 Bacteria 8155074
1613 8016568940 8016566248 Bacteria 8158151
1614 8016581588 8016575299 Bacteria 8154085
1615 8016587056 8016583857 Bacteria 10421953
1616 8016596172 8016595262 Bacteria 8149947
1617 8016618968 8016613128 Bacteria 8794220
1618 8017059045 8017057580 Bacteria 10023680
1619 8019541056 8019538911 Bacteria 7872763
1620 8019549565 8019547302 Bacteria 7996444
1621 8019563217 8019555841 Bacteria 9642137
1622 8019573297 8019565922 Bacteria 9639779
1623 8019594466 8019586578 Bacteria 10212056
1624 8019607092 8019597564 Bacteria 10041141
1625 8019611415 8019608314 Bacteria 10042931
1626 8019622195 8019619141 Bacteria 9218857
1627 8019639504 8019638758 Bacteria 9062356
1628 8019653153 8019648815 Bacteria 10014479
1629 8019667923 8019659431 Bacteria 8577854
1630 8019677343 8019668869 Bacteria 8791617
1631 8019687612 8019678201 Bacteria 8863603
1632 8019696872 8019687851 Bacteria 8712826
1633 8019770231 8019769354 Bacteria 6924660
1634 8019777254 8019775933 Bacteria 6858656
1635 8030000355 8029995093 Bacteria 5990776
1636 8034964823 8034962539 Bacteria 4884839
1637 8052494990 8052494512 Bacteria 5765634
1638 8054286139 8054285046 Bacteria 6919322
1639 8054350206 8054347763 Bacteria 5901107
1640 8054503867 8054503363 Bacteria 6101651
1641 8054930646 8054929484 Bacteria 5599761
1642 8055743262 8055742211 Bacteria 9226248
1643 8055771338 8055770955 Bacteria 6827675
1644 8055818268 8055817908 Bacteria 6609162
1645 8055880034 8055878733 Bacteria 5907058
1646 8056116673 8056115690 Bacteria 5527654
1647 8056125531 8056120720 Bacteria 5758328
1648 8056126384 8056125926 Bacteria 6228218
1649 8056132252 8056131705 Bacteria 6107031
1650 8056142618 8056137416 Bacteria 6147080
1651 8056143645 8056143049 Bacteria 6307666
1652 8056152394 8056148874 Bacteria 6479865
1653 8056158433 8056155041 Bacteria 6486948
1654 8056164259 8056161164 Bacteria 6106669
1655 8056170669 8056166840 Bacteria 5820959
1656 8056176785 8056172158 Bacteria 6133900
1657 8056179710 8056177738 Bacteria 6748268
1658 8056572239 8056569372 Bacteria 5997322
1659 8056678427 8056673599 Bacteria 7871253
1660 8056687771 8056681323 Bacteria 8472857
1661 8056692794 8056689827 Bacteria 6712655
1662 8056970689 8056967851 Bacteria 9038162
1663 8057802629 8057798959 Bacteria 6713499
1664 Ga0207697_10001813
1665 MRS2a_Contig_52
1666 SwRhRL2b_contig_613450
1667 JGI24741J21665_1001182
1668 JGI24740J21852_10007761
1669 JGI24737J22298_10003323
1670 JGI25162J39368_1000098
1671 JGI25162J39368_1000129
1672 JGI25154J39366_1004169
1673 JGI25163J39215_1000689
1674 JGI25163J39215_1001594
1675 JGI25164J39214_1000076
1676 JGI25164J39214_1000101
1677 JGI25406J46586_10000308
1678 JGI25406J46586_10003834
1679 JGI25165J46597_1000150
1680 JGI25165J46597_1000180
1681 JGI25153J46596_10003462
1682 JGI25160J50197_1007754
1683 Ga0055538_1000115
1684 Ga0055539_1000162
1685 Ga0055533_1000164
1686 Ga0055532_1000153
1687 Ga0055525_1000224
1688 Ga0055536_1000232
1689 Ga0055536_1000312
1690 Ga0055536_1003049
1691 Ga0055530_10000404
1692 Ga0055530_10002858
1693 Ga0055530_10006098
1694 Ga0055540_1000339
1695 Ga0055540_1000753
1696 Ga0055540_1002153
1697 Ga0055531_10000455
1698 Ga0055541_1000107
1699 Ga0065165_1001384
1700 Ga0065165_1001704
1701 Ga0065714_10000618
1702 Ga0065714_10003400
1703 Ga0065714_10009637
1704 Ga0065714_10068828
1705 Ga0065714_10069561
1706 Ga0065714_10074770
1707 Ga0065714_10078921
1708 Ga0065704_10005342
1709 Ga0065704_10084010
1710 Ga0065712_10003999
1711 Ga0065712_10067807
1712 Ga0065715_10013732
1713 Ga0070658_10015788
1714 Ga0070676_10000872
1715 Ga0070676_10024434
1716 Ga0070683_100007899
1717 Ga0070670_100000066
1718 Ga0070670_100007196
1719 Ga0070670_100007723
1720 Ga0070670_100009172
1721 Ga0070670_100013630
1722 Ga0068869_100001188
1723 Ga0068869_100007725
1724 Ga0070666_10000801
1725 Ga0070666_10004064
1726 Ga0070680_100032610
1727 Ga0070680_100033131
1728 Ga0070680_100055358
1729 Ga0070680_100061857
1730 Ga0068868_100022586
1731 Ga0070661_100001439
1732 Ga0070661_100032588
1733 Ga0070668_100000032
1734 Ga0070668_100001127
1735 Ga0070668_100001958
1736 Ga0070668_100004263
1737 Ga0070668_100006735
1738 Ga0070668_100027740
1739 Ga0070669_100000233
1740 Ga0070669_100004590
1741 Ga0070669_100004761
1742 Ga0070669_100008033
1743 Ga0070669_100009909
1744 Ga0070675_100004013
1745 Ga0070675_100006340
1746 Ga0070675_100024299
1747 Ga0070675_100034848
1748 Ga0070675_100044927
1749 Ga0070671_100012016
1750 Ga0070673_100001777
1751 Ga0070673_100019119
1752 Ga0070673_100023738
1753 Ga0070688_100003732
1754 Ga0070659_100009972
1755 Ga0070667_100000526
1756 Ga0070667_100000619
1757 Ga0070667_100002498
1758 Ga0070667_100011068
1759 Ga0070667_100016674
1760 Ga0070709_10008708
1761 Ga0070714_100030984
1762 Ga0070714_100061393
1763 Ga0070714_100066765
1764 Ga0070713_100000894
1765 Ga0070710_10004687
1766 Ga0070710_10009230
1767 Ga0070711_100002080
1768 Ga0070711_100008621
1769 Ga0070700_100007179
1770 Ga0070708_100000012
1771 Ga0070663_100008924
1772 Ga0070663_100020283
1773 Ga0070678_100000361
1774 Ga0070678_100010959
1775 Ga0070662_100001331
1776 Ga0070681_10008326
1777 Ga0068867_100001440
1778 Ga0068867_100001447
1779 Ga0070698_100022285
1780 Ga0070699_100017152
1781 Ga0070699_100021712
1782 Ga0070679_100006990
1783 Ga0070679_100019021
1784 Ga0070679_100034216
1785 Ga0070679_100059192
1786 Ga0070684_100003445
1787 Ga0070684_100017952
1788 Ga0070684_100051145
1789 Ga0068853_100000029
1790 Ga0068853_100004618
1791 Ga0068853_100008416
1792 Ga0070672_100014409
1793 Ga0070672_100036731
1794 Ga0070665_100000751
1795 Ga0070665_100000824
1796 Ga0070665_100003493
1797 Ga0070665_100006084
1798 Ga0070665_100012520
1799 Ga0070665_100036175
1800 Ga0070665_100036817
1801 Ga0068855_100016264
1802 Ga0068855_100042590
1803 Ga0070664_100000531
1804 Ga0070664_100010616
1805 Ga0068857_100005533
1806 Ga0068857_100027111
1807 Ga0068856_100000432
1808 Ga0068856_100034833
1809 Ga0068856_100057227
1810 Ga0068856_100062862
1811 Ga0070702_100025638
1812 Ga0068852_100025278
1813 Ga0068852_100036675
1814 Ga0068859_100002359
1815 Ga0068859_100003198
1816 Ga0068859_100012416
1817 Ga0068859_100083408
1818 Ga0068864_100000132
1819 Ga0068864_100000273
1820 Ga0068864_100001673
1821 Ga0068864_100016393
1822 Ga0068864_100022148
1823 Ga0068861_100002284
1824 Ga0068861_100031773
1825 Ga0068851_10000035
1826 Ga0068851_10006945
1827 Ga0068870_10004164
1828 Ga0068863_100000142
1829 Ga0068863_100002817
1830 Ga0068863_100003818
1831 Ga0068863_100004135
1832 Ga0068863_100011071
1833 Ga0068863_100017414
1834 Ga0068858_100001039
1835 Ga0068858_100002619
1836 Ga0068858_100007621
1837 Ga0068858_100029555
1838 Ga0068860_100000295
1839 Ga0068860_100004046
1840 Ga0068860_100004537
1841 Ga0068860_100018230
1842 Ga0068860_100026653
1843 Ga0068862_100000238
1844 Ga0068862_100011179
1845 Ga0068862_100011348
1846 Ga0068862_100058205
1847 Ga0081455_10000633
1848 Ga0081455_10002844
1849 Ga0081455_10008295
1850 Ga0081455_10012886
1851 Ga0081455_10020150
1852 Ga0081455_10023112
1853 Ga0081538_10005211
1854 Ga0081538_10034611
1855 Ga0081540_1003693
1856 Ga0081540_1005997
1857 Ga0081540_1014711
1858 Ga0081540_1020374
1859 Ga0081539_10000040
1860 Ga0081539_10002152
1861 Ga0070717_10003674
1862 Ga0070717_10018962
1863 Ga0070717_10027490
1864 Ga0070717_10035736
1865 Ga0075365_10010751
1866 Ga0075368_10011691
1867 Ga0075363_100032087
1868 Ga0075432_10005107
1869 Ga0070715_10001868
1870 Ga0070716_100012041
1871 Ga0070712_100004848
1872 Ga0070712_100010245
1873 Ga0070712_100012801
1874 Ga0075369_10005528
1875 Ga0097621_100019504
1876 Ga0097621_100023896
1877 Ga0068871_100025300
1878 Ga0075428_100020463
1879 Ga0075430_100000066
1880 Ga0075430_100002359
1881 Ga0075431_100102583
1882 Ga0068865_100049130
1883 Ga0097620_100002358
1884 Ga0097620_100003197
1885 Ga0097620_100012415
1886 Ga0097620_100083406
1887 Ga0099825_1016067
1888 Ga0099824_1014113
1889 Ga0099822_1006926
1890 Ga0099823_1007118
1891 Ga0079104_1000423
1892 Ga0079104_1001202
1893 Ga0105251_10000118
1894 Ga0105251_10000191
1895 Ga0105251_10001252
1896 Ga0105251_10005196
1897 Ga0105251_10005418
1898 Ga0105251_10014131
1899 Ga0105244_10000593
1900 Ga0105244_10000969
1901 Ga0105244_10001341
1902 Ga0105244_10019846
1903 Ga0105244_10020929
1904 Ga0105244_10025551
1905 Ga0105244_10027558
1906 Ga0105250_10000251
1907 Ga0105250_10002362
1908 Ga0105250_10002665
1909 Ga0105250_10003074
1910 Ga0105240_10002394
1911 Ga0105240_10047754
1912 Ga0105240_10056069
1913 Ga0105240_10092314
1914 Ga0111539_10000323
1915 Ga0111539_10050591
1916 Ga0114129_10009029
1917 Ga0114129_10044968
1918 Ga0105243_10000299
1919 Ga0105243_10001887
1920 Ga0105243_10003109
1921 Ga0105243_10020011
1922 Ga0105243_10042863
1923 Ga0105242_10000465
1924 Ga0105242_10040171
1925 Ga0105248_10000648
1926 Ga0105248_10001325
1927 Ga0105248_10009379
1928 Ga0105248_10009617
1929 Ga0105237_10002856
1930 Ga0105237_10023860
1931 Ga0105237_10025304
1932 Ga0105237_10027605
1933 Ga0105238_10014059
1934 Ga0105238_10014372
1935 Ga0105238_10015143
1936 Ga0105249_10000237
1937 Ga0105249_10045838
1938 Ga0105249_10076393
1939 Ga0105239_10013419
1940 Ga0105239_10036008
1941 Ga0105246_10000445
1942 Ga0105246_10005000
1943 Ga0105246_10016063
1944 Ga0157345_1000228
1945 Ga0157373_10004675
1946 Ga0157373_10006022
1947 Ga0157371_10000238
1948 Ga0157371_10006967
1949 Ga0157370_10026265
1950 Ga0157370_10037678
1951 Ga0157369_10014104
1952 Ga0157369_10014525
1953 Ga0157369_10055180
1954 Ga0157369_10066221
1955 Ga0157378_10004733
1956 Ga0163162_10020131
1957 Ga0163162_10022074
1958 Ga0163162_10042652
1959 Ga0163162_10047143
1960 Ga0163162_10073208
1961 Ga0163162_10134325
1962 Ga0157372_10000711
1963 Ga0157372_10020723
1964 Ga0157375_10009131
1965 Ga0157375_10018608
1966 Ga0157375_10021792
1967 Ga0157375_10044280
1968 Ga0163163_10003123
1969 Ga0163163_10004279
1970 Ga0163163_10019108
1971 Ga0163163_10075518
1972 Ga0157380_10016019
1973 Ga0157380_10020785
1974 Ga0182008_10004318
1975 Ga0182008_10004478
1976 Ga0182008_10008335
1977 Ga0182008_10012516
1978 Ga0182008_10019813
1979 Ga0157379_10000560
1980 Ga0157379_10002826
1981 Ga0157379_10002876
1982 Ga0157379_10010463
1983 Ga0157379_10018619
1984 Ga0157376_10028999
1985 Ga0182006_1000753
1986 Ga0182006_1002918
1987 Ga0182006_1003105
1988 Ga0182005_1002245
1989 Ga0182005_1005438
1990 Ga0163161_10010542
1991 Ga0163161_10012152
1992 Ga0214544_1000007
1993 Ga0214542_1000007
1994 Ga0214545_1000006
1995 Ga0214543_1000009
1996 Ga0213876_10002289
1997 Ga0213876_10009146
1998 Ga0213876_10013063
1999 Ga0213875_10000860
2000 Ga0213875_10002209
2001 Ga0209760_100080
2002 Ga0209760_100159
2003 Ga0209784_100087
2004 Ga0209566_100106
2005 Ga0209674_100128
2006 Ga0209147_100129
2007 Ga0209563_100122
2008 Ga0209563_100636
2009 Ga0207427_100014
2010 Ga0207427_100016
2011 Ga0209437_100011
2012 Ga0209437_100016
2013 Ga0209437_100499
2014 Ga0209258_100352
2015 Ga0209646_1000310
2016 Ga0209677_100078
2017 Ga0209677_100296
2018 Ga0209677_101858
2019 Ga0209148_1000526
2020 Ga0209233_1000019
2021 Ga0209233_1000036
2022 Ga0209233_1003377
2023 Ga0209455_1001742
2024 Ga0209676_1000025
2025 Ga0209676_1000032
2026 Ga0209676_1000208
2027 Ga0209676_1000519
2028 Ga0209676_1003834
2029 Ga0209564_1002226
2030 Ga0209564_1002401
2031 Ga0209564_1005204
2032 Ga0209758_1000030
2033 Ga0209758_1001439
2034 Ga0209758_1004188
2035 Ga0209758_1010096
2036 Ga0209050_1000025
2037 Ga0209050_1000028
2038 Ga0209050_1000381
2039 Ga0209050_1004562
2040 Ga0207426_1000380
2041 Ga0207426_1001158
2042 Ga0209051_1000026
2043 Ga0209051_1000039
2044 Ga0209051_1000047
2045 Ga0209051_1000080
2046 Ga0209257_1000034
2047 Ga0209257_1001899
2048 Ga0207656_10000008
2049 Ga0207656_10008944
2050 Ga0207696_1000020
2051 Ga0207696_1000057
2052 Ga0207696_1000074
2053 Ga0207696_1000084
2054 Ga0207696_1002815
2055 Ga0207696_1005271
2056 Ga0207696_1006465
2057 Ga0207696_1010017
2058 Ga0207655_1000014
2059 Ga0207655_1000556
2060 Ga0207655_1000904
2061 Ga0207655_1001007
2062 Ga0207655_1001055
2063 Ga0207655_1001190
2064 Ga0207655_1001386
2065 Ga0207655_1002635
2066 Ga0207655_1004166
2067 Ga0207655_1004754
2068 Ga0207655_1006994
2069 Ga0207655_1015505
2070 Ga0207655_1020640
2071 Ga0207713_1000031
2072 Ga0207713_1000114
2073 Ga0207713_1000814
2074 Ga0207713_1000823
2075 Ga0207713_1002649
2076 Ga0207713_1005023
2077 Ga0207713_1007272
2078 Ga0207713_1017048
2079 Ga0207713_1020419
2080 Ga0207713_1022163
2081 Ga0207682_10003038
2082 Ga0207692_10000619
2083 Ga0207688_10000740
2084 Ga0207688_10006116
2085 Ga0207688_10013242
2086 Ga0207680_10005696
2087 Ga0207647_10009114
2088 Ga0207685_10001110
2089 Ga0207645_10000381
2090 Ga0207645_10006829
2091 Ga0207645_10014705
2092 Ga0207643_10002073
2093 Ga0207643_10004363
2094 Ga0207643_10015612
2095 Ga0207684_10045086
2096 Ga0207654_10000611
2097 Ga0207707_10000749
2098 Ga0207707_10009487
2099 Ga0207707_10017756
2100 Ga0207695_10000006
2101 Ga0207695_10002336
2102 Ga0207695_10010723
2103 Ga0207695_10066281
2104 Ga0207671_10000015
2105 Ga0207671_10033720
2106 Ga0207671_10037354
2107 Ga0207693_10000701
2108 Ga0207693_10003425
2109 Ga0207693_10010113
2110 Ga0207693_10025339
2111 Ga0207663_10001487
2112 Ga0207663_10011188
2113 Ga0207663_10013624
2114 Ga0207660_10013218
2115 Ga0207660_10022948
2116 Ga0207660_10030875
2117 Ga0207657_10017514
2118 Ga0207657_10047722
2119 Ga0207649_10000001
2120 Ga0207652_10021894
2121 Ga0207646_10062663
2122 Ga0207681_10000683
2123 Ga0207681_10003174
2124 Ga0207681_10004247
2125 Ga0207694_10004635
2126 Ga0207694_10016745
2127 Ga0207694_10033461
2128 Ga0207650_10000110
2129 Ga0207650_10000239
2130 Ga0207650_10001925
2131 Ga0207700_10011969
2132 Ga0207700_10017997
2133 Ga0207664_10003529
2134 Ga0207644_10004280
2135 Ga0207706_10000885
2136 Ga0207706_10004496
2137 Ga0207706_10009929
2138 Ga0207706_10037403
2139 Ga0207706_10066218
2140 Ga0207709_10000451
2141 Ga0207709_10001143
2142 Ga0207709_10002422
2143 Ga0207709_10013497
2144 Ga0207669_10001538
2145 Ga0207704_10000667
2146 Ga0207665_10003410
2147 Ga0207665_10003934
2148 Ga0207691_10001601
2149 Ga0207691_10001942
2150 Ga0207691_10019038
2151 Ga0207691_10035493
2152 Ga0207711_10012404
2153 Ga0207711_10057207
2154 Ga0207689_10000548
2155 Ga0207689_10013134
2156 Ga0207689_10016085
2157 Ga0207661_10000379
2158 Ga0207679_10000009
2159 Ga0207667_10018585
2160 Ga0207667_10024759
2161 Ga0207667_10065460
2162 Ga0207651_10008314
2163 Ga0207651_10014919
2164 Ga0207651_10027417
2165 Ga0207712_10000185
2166 Ga0207712_10010895
2167 Ga0207668_10000003
2168 Ga0207668_10000658
2169 Ga0207668_10005943
2170 Ga0207668_10011392
2171 Ga0207640_10034871
2172 Ga0207658_10000158
2173 Ga0207658_10004094
2174 Ga0207658_10004956
2175 Ga0207658_10023472
2176 Ga0207703_10000746
2177 Ga0207703_10002726
2178 Ga0207703_10013036
2179 Ga0207703_10020233
2180 Ga0207639_10000090
2181 Ga0207639_10030720
2182 Ga0207678_10005581
2183 Ga0207678_10006762
2184 Ga0207678_10024159
2185 Ga0207708_10001830
2186 Ga0207708_10026202
2187 Ga0207702_10000122
2188 Ga0207702_10000598
2189 Ga0207702_10063134
2190 Ga0207641_10003431
2191 Ga0207641_10005395
2192 Ga0207641_10006693
2193 Ga0207641_10009156
2194 Ga0207641_10035165
2195 Ga0207648_10000330
2196 Ga0207648_10006413
2197 Ga0207648_10010744
2198 Ga0207648_10011827
2199 Ga0207648_10015832
2200 Ga0207676_10000522
2201 Ga0207676_10001311
2202 Ga0207676_10003518
2203 Ga0207676_10005910
2204 Ga0207674_10005808
2205 Ga0207674_10016864
2206 Ga0207674_10041147
2207 Ga0207675_100001548
2208 Ga0207675_100002647
2209 Ga0207675_100020818
2210 Ga0207675_100041472
2211 Ga0207683_10000528
2212 Ga0207683_10005690
2213 Ga0207683_10007332
2214 Ga0207698_10013528
2215 Ga0209281_1000026
2216 Ga0209281_1000033
2217 Ga0209281_1002039
2218 Ga0209389_1000015
2219 Ga0209389_1000165
2220 Ga0209389_1000190
2221 Ga0209371_1000630
2222 Ga0209589_1001841
2223 Ga0209589_1006092
2224 Ga0209489_100072
2225 Ga0209489_102693
2226 Ga0209489_105989
2227 Ga0209700_100034
2228 Ga0209700_105810
2229 Ga0209995_1001318
2230 Ga0209983_1001251
2231 Ga0207428_10000129
2232 Ga0207428_10039490
2233 Ga0207428_10061338
2234 Ga0268266_10001049
2235 Ga0268266_10001217
2236 Ga0268266_10003843
2237 Ga0268266_10006228
2238 Ga0268266_10007906
2239 Ga0268266_10026479
2240 Ga0268265_10000246
2241 Ga0268265_10037023
2242 Ga0268264_10000187
2243 Ga0268264_10000232
2244 Ga0268264_10003098
2245 Ga0268264_10031183
2246 Ga0265337_1000506
2247 Ga0265334_10002104
2248 Ga0265334_10007245
2249 Ga0265323_10005048
2250 Ga0265336_10004816
2251 Ga0307517_10000066
2252 Ga0265338_10000973
2253 Ga0268256_1000273
2254 Ga0268256_1000278
2255 Ga0316178_1102168
2256 Ga0316181_1018381
2257 Ga0265330_10009710
2258 Ga0265330_10024206
2259 Ga0265332_10000730
2260 Ga0265332_10003203
2261 Ga0265332_10010155
2262 Ga0265328_10000008
2263 Ga0265328_10003910
2264 Ga0265325_10002761
2265 Ga0265340_10002240
2266 Ga0265339_10002540
2267 Ga0265331_10000038
2268 Ga0265331_10001798
2269 Ga0265327_10007946
2270 Ga0265316_10000387
2271 Ga0307513_10005099
2272 Ga0307408_100000004
2273 Ga0307408_100028865
2274 Ga0265313_10000223
2275 Ga0307508_10000613
2276 Ga0265314_10008057
2277 Ga0265314_10022262
2278 Ga0265342_10000308
2279 Ga0307516_10012541
2280 Ga0307410_10027576
2281 Ga0307411_10021448
2282 Ga0307411_10043985
2283 Ga0307510_10011043
2284 Ga0307510_10014026
2285 Ga0307510_10016531
2286 Ga0307510_10031045
2287 Ga0315911_1000024
2288 Ga0373934_0003933
2289 Ga0373936_0001548
2290 Ga0373941_0000462
2291 Ga0373945_0013387
2292 Ga0373953_0008441
2293 Ga0373954_0000471
2294 Ga0373954_0002347
2295 Ga0373957_0003107
2296 Ga0373924_0011467
2297 Ga0373935_0019326
2298 Ga0373927_0007892
2299 Ga0373927_0009614
2300 Ga0373927_0021704
2301 Ga0373933_0000915
2302 Ga0373947_0003547
2303 Ga0373947_0027058
2304 Ga0373937_0023179
2305 Ga0316584_0065528
2306 Ga0373925_0007117
2307 Ga0373925_0019996
2308 Ga0395900_0014639
2309 Ga0395898_0004776
2310 Ga0395898_0036586
2311 Ga0395898_0049242
2312 Ga0395905_0011164
2313 Ga0436364_0348338
2314 Ga0436364_0943018
2315 Ga0436364_1171513
2316 Ga0436364_1345588
2317 Ga0395901_0101157
2318 Ga0400483_231204
2319 Ga0436365_0957972
2320 Ga0436365_1045032
2321 Ga0436365_1910924
2322 Ga0436361_0615393
2323 Ga0436363_0711625
2324 Ga0436363_0726746
2325 Ga0436363_1463967
2326 Ga0436362_0841994
2327 Ga0439436_0000952
2328 Ga0439438_001868
2329 Ga0439438_001970
2330 Ga0439438_006265
2331 Ga0439438_011272
2332 Ga0439447_006383
2333 Ga0439466_0001535
2334 Ga0439466_0003548
2335 Ga0439466_0006413
2336 Ga0439466_0007342
2337 Ga0439432_000775
2338 Ga0439432_001464
2339 Ga0439452_000786
2340 Ga0439452_000858
2341 Ga0439452_000882
2342 Ga0439456_001355
2343 Ga0439463_000059
2344 Ga0450911_000004
2345 Ga0450911_000355
2346 Ga0450902_001778
2347 Ga0450904_000009
2348 Ga0450905_000464
2349 Ga0450905_000945
2350 Ga0450907_000601
2351 Ga0450910_000437
2352 Ga0439464_0005557
2353 Ga0451577_0000005
2354 Ga0451577_0000028
2355 Ga0466972_0000264
2356 Ga0453683_0008346
2357 Ga0466966_0002003
2358 Ga0466961_0001950
2359 Ga0466963_0018905
2360 Ga0453684_0000190
2361 Ga0453684_0000390
2362 Ga0453684_0001014
2363 Ga0453684_0002558
2364 Ga0466957_0031560
2365 Ga0466959_0046208
2366 Ga0451576_0000852
2367 Ga0466958_0011628
2368 Ga0495617_000455
2369 Ga0495627_000023
2370 Ga0495627_000774
2371 Ga0495627_002193
2372 Ga0495627_006533
2373 Ga0495592_0020318
2374 Ga0495603_0003090
2375 Ga0495603_0011291
2376 Ga0495590_0008010
2377 Ga0495591_000025
2378 Ga0495591_000668
2379 Ga0495591_001374
2380 Ga0495591_002991
2381 Ga0495591_003186
2382 Ga0495591_003225
2383 Ga0495591_006806
2384 Ga0495591_013521
2385 Ga0495629_0000151
2386 Ga0495629_0003854
2387 Ga0495638_0005305
2388 Ga0495638_0006494
2389 Ga0495638_0032114
2390 Ga0495651_0005755
2391 Ga0495651_0029501
2392 Ga0495651_0060342
2393 Ga0495653_0001308
2394 Ga0495653_0024403
2395 Ga0495653_0031130
2396 Ga0495650_0001958
2397 Ga0495650_0006161
2398 Ga0495650_0011367
2399 Ga0495582_0000218
2400 Ga0495582_0003858
2401 Ga0495605_0000095
2402 Ga0495605_0000210
2403 Ga0495605_0000677
2404 Ga0495605_0000927
2405 Ga0495605_0006722
2406 Ga0495639_0001263
2407 Ga0495639_0002288
2408 Ga0495662_0000275
2409 Ga0495664_0005513
2410 Ga0495664_0005666
2411 Ga0495664_0018049
2412 Ga0495664_0029990
2413 Ga0495584_0003049
2414 Ga0495584_0003944
2415 Ga0495584_0014091
2416 Ga0495585_0004764
2417 Ga0495585_0004972
2418 Ga0495585_0008391
2419 Ga0495585_0036910
2420 Ga0495594_0001418
2421 Ga0495596_0000545
2422 Ga0495596_0002377
2423 Ga0495607_0000069
2424 Ga0495607_0000673
2425 Ga0495607_0001262
2426 Ga0495607_0001270
2427 Ga0495607_0002719
2428 Ga0495607_0004514
2429 Ga0495607_0007059
2430 Ga0495607_0018106
2431 Ga0495607_0023960
2432 Ga0495607_0027869
2433 Ga0495583_0000015
2434 Ga0495583_0000779
2435 Ga0495583_0009541
2436 Ga0495606_0000447
2437 Ga0495606_0000453
2438 Ga0495606_0003923
2439 Ga0495606_0008979
2440 Ga0495606_0009017
2441 Ga0495606_0012643
2442 Ga0495606_0013024
2443 Ga0495606_0026931
2444 Ga0495610_0005104
2445 Ga0495610_0006937
2446 Ga0495610_0007026
2447 Ga0495610_0014582
2448 Ga0495616_0005043
2449 Ga0495616_0015427
2450 Ga0495620_0000042
2451 Ga0495620_0000146
2452 Ga0495620_0000422
2453 Ga0495620_0001025
2454 Ga0495631_0001255
2455 Ga0495631_0005285
2456 Ga0495631_0033636
2457 Ga0495632_0001743
2458 Ga0495632_0004240
2459 Ga0495632_0004428
2460 Ga0495632_0013905
2461 Ga0495637_0000682
2462 Ga0495637_0002317
2463 Ga0495637_0002721
2464 Ga0495637_0002917
2465 Ga0495637_0004370
2466 Ga0495637_0011231
2467 Ga0495637_0011386
2468 Ga0495637_0014482
2469 Ga0495637_0016000
2470 Ga0495643_0000291
2471 Ga0495643_0015422
2472 Ga0495643_0016513
2473 Ga0495643_0019980
2474 Ga0495648_0000581
2475 Ga0495648_0003184
2476 Ga0495648_0005967
2477 Ga0495648_0006246
2478 Ga0495648_0008715
2479 Ga0495648_0008856
2480 Ga0495648_0013653
2481 Ga0495648_0015287
2482 Ga0495648_0033685
2483 Ga0495642_0000662
2484 Ga0495652_0017151
2485 Ga0495652_0017750
2486 Ga0495652_0025015
2487 Ga0495654_0002507
2488 Ga0495654_0002748
2489 Ga0495654_0003902
2490 Ga0495654_0005124
2491 Ga0495654_0011853
2492 Ga0495654_0012016
2493 Ga0495654_0031443
2494 Ga0495665_0000163
2495 Ga0495640_0014322
2496 Ga0495587_0011173
2497 Ga0495587_0029971
2498 Ga0495609_0000053
2499 Ga0495609_0000133
2500 Ga0495609_0000283
2501 Ga0495609_0004006
2502 Ga0495609_0019392
2503 Ga0495597_0000229
2504 Ga0495597_0002956
2505 Ga0495645_0018664
2506 Ga0495645_0019601
2507 Ga0495645_0019829
2508 Ga0495622_0001532
2509 Ga0495633_0000115
2510 Ga0495667_0010071
2511 Ga0495668_0005524
2512 Ga0495668_0005672
2513 Ga0495668_0037455
2514 Ga0495634_0000460
2515 Ga0495634_0008719
2516 Ga0495611_0001987
2517 Ga0495625_0000086
2518 Ga0495625_0008159
2519 Ga0495625_0010636
2520 Ga0495625_0019236
2521 Ga0495635_0000220
2522 Ga0495635_0004179
2523 Ga0495635_0010274
2524 Ga0495659_0000820
2525 Ga0495661_0000212
2526 Ga0495661_0000346
2527 Ga0495661_0001033
2528 Ga0495661_0001808
2529 Ga0495661_0002096
2530 Ga0495661_0004232
2531 Ga0495661_0006792
2532 Ga0495661_0018066
2533 Ga0495661_0019490
2534 Ga0495661_0033117
2535 Ga0495588_0011868
2536 Ga0495657_0008639
2537 Ga0495657_0035214
2538 Ga0495599_0001306
2539 Ga0495623_0014332
2540 Ga0495646_0016370
2541 Ga0495646_0030360
2542 Ga0495647_0000198
2543 Ga0495658_0004750
2544 Ga0495669_0004199
2545 Ga0495624_0001125
2546 Ga0495624_0017858
2547 Ga0495671_0000835
2548 Ga0495671_0001729
2549 Ga0495671_0003942
2550 Ga0495671_0004570
2551 Ga0495671_0004646
2552 Ga0495671_0005715
2553 Ga0495671_0017444
2554 Ga0495649_0001824
2555 Ga0495649_0003218
2556 Ga0495649_0004772
2557 Ga0495649_0009899
2558 Ga0495649_0014957
2559 Ga0495649_0027064
2560 Ga0495589_0000918
2561 Ga0495589_0008535
2562 Ga0495600_0001974
2563 Ga0495600_0004746
2564 Ga0495600_0016566
2565 Ga0495600_0023155
2566 Ga0495660_0003154
2567 Ga0495660_0005301
2568 Ga0495660_0015068
2569 Ga0495660_0018836
2570 Ga0495660_0031101
2571 Ga0495581_0000291
2572 Ga0495581_0024438
2573 Ga0495604_0007232
2574 Ga0495604_0014146
2575 Ga0495604_0031685
2576 Ga0495604_0048267
2577 Ga0495674_0000664
2578 Ga0495674_0001989
2579 Ga0495674_0056283
2580 Ga0495672_0003884
2581 Ga0495672_0004098
2582 Ga0495672_0007315
2583 Ga0495672_0007556
2584 Ga0495672_0007891
2585 Ga0495672_0013420
2586 Ga0495672_0024326
2587 Ga0495676_0000022
2588 Ga0495676_0009309
2589 Ga0495676_0013537
2590 Ga0495680_0002433
2591 Ga0495680_0014855
2592 Ga0495680_0032392
2593 Ga0495680_0032827
2594 Ga0495680_0052704
2595 Ga0495683_0000030
2596 Ga0495683_0000586
2597 Ga0495683_0003253
2598 Ga0495683_0003911
2599 Ga0495683_0015622
2600 Ga0495687_004182
2601 Ga0495687_004249
2602 Ga0495675_0003482
2603 Ga0495675_0004129
2604 Ga0495675_0016335
2605 Ga0495679_000212
2606 Ga0495679_000341
2607 Ga0495679_003057
2608 Ga0495673_0001151
2609 Ga0495673_0001296
2610 Ga0495673_0004054
2611 Ga0495673_0005337
2612 Ga0495673_0006078
2613 Ga0495673_0006250
2614 Ga0495673_0013803
2615 Ga0495673_0023377
2616 Ga0495681_0004759
2617 Ga0495681_0006405
2618 Ga0495681_0026787
2619 Ga0495684_0000133
2620 Ga0495684_0020926
2621 Ga0495686_0058827
2622 Ga0495593_0000323
2623 Ga0495602_0049834
2624 Ga0495602_0054440
2625 Ga0495602_0058139
2626 Ga0495626_0000039
2627 Ga0495626_0000242
2628 Ga0495626_0001832
2629 Ga0495626_0003058
2630 Ga0495626_0004652
2631 Ga0495626_0004671
2632 Ga0495626_0018915
2633 Ga0496102_0002921
2634 Ga0496102_0025012
2635 Ga0496102_0029706
2636 Ga0496104_0002055
2637 Ga0496104_0002496
2638 Ga0496104_0012404
2639 Ga0496104_0014417
2640 Ga0496104_0026955
2641 Ga0496104_0028265
2642 Ga0496105_0000745
2643 Ga0496105_0009357
2644 Ga0496105_0012772
2645 Ga0496105_0041847
2646 Ga0496106_0004350
2647 Ga0496106_0014763
2648 Ga0496107_0003866
2649 Ga0496107_0007228
2650 Ga0496107_0055542
2651 Ga0496108_0000442
2652 Ga0496108_0001557
2653 Ga0496108_0010081
2654 Ga0496109_0001341
2655 Ga0496109_0022776
2656 Ga0496110_0014426
2657 Ga0496110_0019399
2658 Ga0496110_0025213
2659 Ga0496110_0026026
2660 Ga0496110_0036712
2661 Ga0496111_0028481
2662 Ga0496112_0000051
2663 Ga0496112_0000655
2664 Ga0496112_0030907
2665 Ga0496113_0000982
2666 Ga0496114_0007693
2667 Ga0496114_0050155
2668 Ga0496114_0078294
2669 Ga0496115_0018715
2670 Ga0496116_0000881
2671 Ga0496116_0004615
2672 Ga0496116_0005174
2673 Ga0496116_0022410
2674 Ga0496116_0027452
2675 Ga0496117_0002861
2676 Ga0496117_0008441
2677 Ga0496117_0009463
2678 Ga0496117_0029062
2679 Ga0496117_0030174
2680 Ga0496117_0041829
2681 Ga0496118_0004108
2682 Ga0496118_0009635
2683 Ga0496118_0013389
2684 Ga0496118_0024544
2685 Ga0496118_0027349
2686 Ga0496118_0045810
2687 Ga0496119_0000060
2688 Ga0496119_0002304
2689 Ga0496119_0010712
2690 Ga0496119_0022739
2691 Ga0496119_0045531
2692 Ga0496120_0003825
2693 Ga0496121_0000144
2694 Ga0496121_0001650
2695 Ga0496121_0003740
2696 Ga0496121_0007337
2697 Ga0496121_0012757
2698 Ga0496121_0013250
2699 Ga0496121_0014564
2700 Ga0496121_0014671
2701 Ga0496121_0019695
2702 Ga0496122_0001366
2703 Ga0496122_0002897
2704 Ga0496122_0005797
2705 Ga0496122_0011268
2706 Ga0496122_0034155
2707 Ga0496122_0071400
2708 Ga0496123_0001033
2709 Ga0496123_0001703
2710 Ga0496123_0013950
2711 Ga0496124_0000120
2712 Ga0496124_0010997
2713 Ga0496124_0011914
2714 Ga0496124_0021692
2715 Ga0496124_0043648
2716 Ga0496124_0047212
2717 Ga0496124_0050045
2718 Ga0496124_0065564
2719 Ga0496125_0000099
2720 Ga0496125_0003667
2721 Ga0496125_0009550
2722 Ga0496125_0010381
2723 Ga0496125_0013483
2724 Ga0496125_0021610
2725 Ga0496125_0025971
2726 Ga0496125_0031206
2727 Ga0496126_0002484
2728 Ga0496126_0026919
2729 Ga0496126_0028855
2730 Ga0496126_0054275
2731 Ga0495678_000017
2732 Ga0495678_000238
2733 Ga0495678_001946
2734 Ga0495682_0001189
2735 Ga0495682_0002650
2736 Ga0501032_0000227
2737 Ga0501032_0019020
2738 Ga0501033_0004294
2739 Ga0501033_0006907
2740 Ga0501034_0000089
2741 Ga0501034_0000100
2742 Ga0501034_0000295
2743 Ga0501034_0001845
2744 Ga0501034_0047008
2745 Ga0501036_0000010
2746 Ga0501036_0000217
2747 Ga0501037_0000183
2748 Ga0501037_0016096
2749 Ga0501038_0000054
2750 Ga0501039_0000110
2751 Ga0501039_0011119
2752 Ga0501043_0000106
2753 Ga0501043_0023015
2754 Ga0501046_0004933
2755 Ga0501047_0000363
2756 Ga0501047_0000702
2757 Ga0501047_0036630
2758 Ga0501048_0000031
2759 Ga0501048_0000456
2760 Ga0501048_0052267
2761 Ga0501067_0003366
2762 Ga0501068_0005210
2763 Ga0501070_0001016
2764 Ga0501070_0033697
2765 Ga0501072_0001530
2766 Ga0501073_0000238
2767 Ga0501074_0000259
2768 Ga0501074_0031393
2769 Ga0501079_0004438
2770 Ga0501080_0000279
2771 Ga0501083_0000550
2772 Ga0501083_0001701
2773 Ga0501035_0000817
2774 Ga0501035_0008622
2775 Ga0501044_0002385
2776 Ga0501044_0009141
2777 Ga0501044_0037223
2778 Ga0501044_0039631
2779 Ga0501226_000003
2780 nmdc:mga03n38_25615_c1
2781 nmdc:mga00v17_23809_c1
2782 nmdc:mga00v17_28528_c1
2783 nmdc:mga0yw44_1210_c1
2784 nmdc:mga0yw44_7385_c1
2785 nmdc:mga0k408_25096_c1
2786 nmdc:mga07m45_2171_c1
2787 nmdc:mga05p37_15019_c1
2788 nmdc:mga05p37_4278_c1
2789 nmdc:mga09592_32400_c1
2790 nmdc:mga0qj67_235_c1
2791 nmdc:mga06r32_49651_c1
2792 nmdc:mga08y16_51_c1
2793 nmdc:mga0n895_11393_c1
2794 nmdc:mga0n895_24802_c1
2795 Ga0495601_0000314
2796 Ga0495601_0002711
2797 Ga0495601_0025781
2798 Ga0495612_0003727
2799 Ga0495595_0001460
2800 Ga0495619_0001836
2801 Ga0500578_0032414
2802 Ga0500643_000231
2803 Ga0500651_0001006
2804 Ga0500566_0000527
2805 Ga0500566_0000931
2806 Ga0500566_0001874
2807 Ga0500556_0000005
2808 Ga0500556_0000148
2809 Ga0500557_000180
2810 Ga0500562_000305
2811 Ga0500595_000469
2812 Ga0500595_002835
2813 Ga0500595_005065
2814 Ga0500595_005098
2815 Ga0500608_000871
2816 Ga0500642_0000009
2817 Ga0500642_0000087
2818 Ga0500652_001138
2819 Ga0500658_0010195
2820 Ga0500559_0000723
2821 Ga0500559_0001753
2822 Ga0500577_0001505
2823 Ga0500586_002742
2824 Ga0500616_0000035
2825 Ga0500634_0033053
2826 Ga0500636_0000344
2827 Ga0500636_0002110
2828 Ga0500637_0000471
2829 Ga0500625_002579
2830 Ga0500601_000438
2831 Ga0501084_0016383
2832 Ga0501082_0008684
2833 2507504681
2834 2508539902
2835 2508694961
2836 2509149915
2837 2511258458
2838 2511265615
2839 2511272588
2840 2511280596
2841 2511288868
2842 2511293891
2843 2511299463
2844 2511315172
2845 2511322573
2846 2511323638
2847 2511332721
2848 2511337882
2849 2511345099
2850 2511349022
2851 2511356186
2852 2511361403
2853 2511368546
2854 2511378018
2855 2511398851
2856 2511411232
2857 2511822351
2858 2512325873
2859 2513625625
2860 2513640695
2861 2513653439
2862 2513658874
2863 2513678455
2864 2513698127
2865 2513701756
2866 2513714884
2867 2513858934
2868 2513874040
2869 2513889652
2870 2513921138
2871 2514010190
2872 2515627767
2873 2517108692
2874 2517889552
2875 2524438604
2876 2524466156
2877 2524539572
2878 2524610623
2879 2528854749
2880 2554815533
2881 2555247801
2882 2555667336
2883 2583789886
2884 2597855580
2885 2597861582
2886 2597867302
2887 2599327479
2888 2599356559
2889 2599363411
2890 2599369637
2891 2599376520
2892 2599381664
2893 2599388192
2894 2599395284
2895 2599398938
2896 2599407049
2897 2599450993
2898 2599463392
2899 2599469258
2900 2599485482
2901 2599492409
2902 2599502569
2903 2599506352
2904 2599514061
2905 2599518662
2906 2599613048
2907 2599769307
2908 2599806611
2909 2599882574
2910 2599888550
2911 2599893604
2912 2599900201
2913 2599934153
2914 2599943680
2915 2599952116
2916 2599955990
2917 2599961784
2918 2599966917
2919 2599974404
2920 2599978272
2921 2599984684
2922 2599991163
2923 2599994953
2924 2600002306
2925 2600004760
2926 2600012508
2927 2600018744
2928 2600026730
2929 2600029881
2930 2600034781
2931 2600043906
2932 2600047974
2933 2600055622
2934 2600060294
2935 2600067554
2936 2600071423
2937 2600080405
2938 2600216021
2939 2600359190
2940 2600364961
2941 2600444595
2942 2601627247
2943 2601692262
2944 2601776188
2945 2601797748
2946 2602011666
2947 2603857953
2948 2606076769
2949 2606128817
2950 2608383836
2951 2617350168
2952 2617377140
2953 2621302257
2954 2624478135
2955 2624489680
2956 2643740265
2957 2643840900
2958 2643872702
2959 2643954997
2960 2644024633
2961 2644186038
2962 2644282659
2963 2644619568
2964 2644732142
2965 2671092677
2966 2671100051
2967 2671121259
2968 2671127239
2969 2671691934
2970 2671772262
2971 2677898298
2972 2678260887
2973 2715749124
2974 2715754394
2975 2718632081
2976 2723246471
2977 2723849177
2978 2728749261
2979 2729146694
2980 2738674919
2981 2738687637
2982 2738753312
2983 2738808001
2984 2738862511
2985 2738895361
2986 2739197943
2987 2739260396
2988 2739263258
2989 2739285344
2990 2739290658
2991 2739311199
2992 2743734998
2993 2745006200
2994 2745077679
2995 2765581551
2996 2774119644
2997 2774134657
2998 2784261133
2999 2784316282
3000 2793073639
3001 2793078465
3002 2794598752
3003 2805920397
3004 2807406180
3005 2807454532
3006 2808856559
3007 2808922842
3008 2808932098
3009 2808936538
3010 2808944529
3011 2808954301
3012 2808955775
3013 2808964946
3014 2808976748
3015 2808991814
3016 2808999838
3017 2809217896
3018 2812366386
3019 2817488320
3020 2818243496
3021 2819657144
3022 2819705133
3023 2821113339
3024 2823423726
3025 2824605818
3026 2824611968
3027 2824622845
3028 2824631934
3029 2824642987
3030 2824651069
3031 2824658785
3032 2824664317
3033 2824676890
3034 2824682000
3035 2824693267
3036 2824701511
3037 2824710570
3038 2824721082
3039 2824731151
3040 2824734118
3041 2824749179
3042 2824762237
3043 2824772610
3044 2824780098
3045 2825654355
3046 2826582507
3047 2834032293
3048 2838125897
3049 2841942709
3050 2841952940
3051 2841963441
3052 2841971032
3053 2841977709
3054 2841984729
3055 2842041550
3056 2842049592
3057 2842695066
3058 2842806977
3059 2842817647
3060 2842830634
3061 2842834083
3062 2842838538
3063 2842846445
3064 2842851605
3065 2842859470
3066 2844316008
3067 2844667814
3068 2847939764
3069 2847943075
3070 2849076819
3071 2852616990
3072 2852660535
3073 2852672021
3074 2857515780
3075 2857527333
3076 2860343722
3077 2860868362
3078 2864737258
3079 2874593720
3080 2874606886
3081 2874617598
3082 2874622008
3083 2874629329
3084 2874647983
3085 2876763410
3086 2876772811
3087 2876826460
3088 2878030080
3089 2879077507
3090 2879089976
3091 2879105498
3092 2879112607
3093 2879134389
3094 2879147348
3095 2880231031
3096 2881364487
3097 2881666097
3098 2885369073
3099 2885376909
3100 2885390003
3101 2885411897
3102 2885526610
3103 2888378852
3104 2888390139
3105 2888427279
3106 2889036128
3107 2889045111
3108 2893071874
3109 2903729598
3110 2903757085
3111 2903774741
3112 2904165159
3113 2904492003
3114 2904519490
3115 2904552332
3116 2904669400
3117 2904692145
3118 2904709371
3119 2904714488
3120 2906606101
3121 2906613068
3122 2906635093
3123 2906641173
3124 2906645618
3125 2906665729
3126 2908446946
3127 2908748049
3128 2908756676
3129 2908783055
3130 2912964121
3131 2913037182
3132 2917071087
3133 2919066238
3134 2919078445
3135 2919157530
3136 2919161240
3137 2919389854
3138 2919451829
3139 2919459901
3140 2919486481
3141 2919488789
3142 2919503355
3143 2919699041
3144 2922364507
3145 2922377710
3146 2922389191
3147 2922400910
3148 2922433561
3149 2923153993
3150 2923520410
3151 2923589680
3152 2926066074
3153 2929144719
3154 2929190222
3155 2929623320
3156 2929632589
3157 2931371948
3158 2931388547
3159 2931391291
3160 2931398754
3161 2932788207
3162 2932800064
3163 2932808348
3164 2932813578
3165 2932820275
3166 2932832658
3167 2933585223
3168 2935358915
3169 2935615124
3170 2935620148
3171 2935635079
3172 2935640466
3173 2935651519
3174 2935659713
3175 2935668660
3176 2935681962
3177 2935686968
3178 2935697062
3179 2935709830
3180 2935716656
3181 2935723219
3182 2935734776
3183 2935744433
3184 2935752934
3185 2935766832
3186 2935774808
3187 2935779704
3188 2935789677
3189 2935797955
3190 2935804580
3191 2935815733
3192 2935825838
3193 2935831972
3194 2935841196
3195 2935851457
3196 2935859034
3197 2935864215
3198 2935875433
3199 2935883456
3200 2935910517
3201 2935918079
3202 2935927572
3203 2935936556
3204 2935943891
3205 2935952328
3206 2935964385
3207 2935969168
3208 2935978432
3209 2935984621
3210 2935995588
3211 2936008008
3212 2936014129
3213 2936022962
3214 2936031098
3215 2936041635
3216 2936049220
3217 2936055666
3218 2939641017
3219 2939654943
3220 2939670308
3221 2939682661
3222 2940558847
3223 2941511642
3224 2941519375
3225 2941527501
3226 2941535872
3227 2941543422
3228 2945930260
3229 2945967511
3230 2945992863
3231 2946012593
3232 2946028561
3233 2946055604
3234 2947235093
3235 2969304876
3236 2974293430
3237 2984292068
3238 2988732113
3239 2990197093
3240 2998140377
3241 3005483217
3242 3005490543
3243 3005506438
3244 3005588916
3245 3005595596
3246 3005711588
3247 3005718845
3248 3007253257
3249 3007317948
3250 3007398006
3251 3007419933
3252 3007517812
3253 3007616197
3254 3007625369
3255 3007724027
3256 3007805672
3257 3007857175
3258 3007864417
3259 3007871976
3260 3007875579
3261 637317733
3262 8001850074
3263 8002061481
3264 8006926997
3265 8006935591
3266 8006967717
3267 8006975520
3268 8006992625
3269 8006998385
3270 8015688242
3271 8016517575
3272 8016525655
3273 8016539251
3274 8016543541
3275 8016549752
3276 8016568940
3277 8016581588
3278 8016587056
3279 8016596172
3280 8016618968
3281 8017059045
3282 8019541056
3283 8019549565
3284 8019563217
3285 8019573297
3286 8019594466
3287 8019607092
3288 8019611415
3289 8019622195
3290 8019639504
3291 8019653153
3292 8019667923
3293 8019677343
3294 8019687612
3295 8019696872
3296 8019770231
3297 8019777254
3298 8030000355
3299 8034964823
3300 8052494990
3301 8054286139
3302 8054350206
3303 8054503867
3304 8054930646
3305 8055743262
3306 8055771338
3307 8055818268
3308 8055880034
3309 8056116673
3310 8056125531
3311 8056126384
3312 8056132252
3313 8056142618
3314 8056143645
3315 8056152394
3316 8056158433
3317 8056164259
3318 8056170669
3319 8056176785
3320 8056179710
3321 8056572239
3322 8056678427
3323 8056687771
3324 8056692794
3325 8056970689
3326 8057802629

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00343

Phosphorylase

Carbohydrate phosphorylase

163

874

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g9q-assembly1.cif.gz_A-2 the crystal structure of the glycogen phosphorylase b- 1ab complex 0.9744 10 809
2zb2-assembly1.cif.gz_B human liver glycogen phosphorylase a complexed with glcose and 5-chloro-n-[4-(1,2-dihydroxyethyl)phenyl]-1h-indole-2-carboxamide 0.9736 12 809
1kti-assembly1.cif.gz_A binding of 100 mm n-acetyl-n'-beta-d-glucopyranosyl urea to glycogen phosphorylase b: kinetic and crystallographic studies 0.9724 10 808
1z62-assembly1.cif.gz_A-2 indirubin-3'-aminooxy-acetate inhibits glycogen phosphorylase by binding at the inhibitor and the allosteric site. broad specificities of the two sites 0.9722 10 808
2ieg-assembly1.cif.gz_A crystal structure of rabbit muscle glycogen phosphorylase in complex with 3,4-dihydro-2-quinolone 0.9721 10 809
ID Description Score Start End Superfamily
1gpaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9818 467 795 3.40.50.2000
1gpaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9788 467 795 3.40.50.2000
af_A0A1D8PQQ3_42_534_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9773 12 467 3.40.50.2000
1ahpA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9727 467 795 3.40.50.2000
1ahpA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9698 467 795 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3M5YJK1-F1-model_v4 deleted 0.9977 269 812
AF-A0A5E7G0T1-F1-model_v4 deleted 0.9973 406 812
AF-A0A3M2VQ73-F1-model_v4 Alpha-1,4 glucan phosphorylase (EC 2.4.1.1) 0.9962 155 491 GO:0005737
GO:0005980
GO:0008184
GO:0030170
GO:0031220
AF-A0A024EBA6-F1-model_v4 Alpha-1,4 glucan phosphorylase (EC 2.4.1.1) 0.9953 13 812 GO:0005737
GO:0005980
GO:0008184
GO:0030170
GO:0031220
AF-A0A3D2D7N1-F1-model_v4 deleted 0.9952 307 811

Map