F495255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1663 | 975 | 3326 | 823 |
Family's Representative Sequence
| Representative Sequence | 3300025315|Ga0207697_10001813|Ga0207697_100018132 |
| Length | 879 |
| Sequence | MTQPVPDAPMTADGDGFTSPSAAAATALPGASXPAGDSKGHATMPVAPVWQAGLTDAAAQAGALAESQAKPDEAVAAFRAAVLHKLTYMVGKDSGHAQEHDWFVATALAVRDHLVDRWIDATRKTYRDGRKRVYYFSLEFLIGRLLFDALSNLGITQVAREALRDLGVDLERLRKVEPDAALGNGGLGRLAACFMESMASLGIPAHGYGIRYDHGIFRQAIKDGWQMELPEEWLSAGNPWEFERPEVTYPVGFGGAVDTRENADGTVRSVWEPAESVNAVAFDTPLAGWRGRHVNTLRLWSARASDPLRLDDFNRGDHVGALADRVRLEAISRVLYPSDETEAGHELRLRQEYFFASASLQDLLRRHKAQHGDLASLADHVSIQLNDTHPAIAVPELMRLLIDVHELPWELAWDITTSVFNYTNHTLLPEALETWPVALMERLLPRHMQIAYLINGLHLDAQRTEGHDDRFLSSISLIEENHVRRLRMGHLAFLASRRVNGVSALHTDLMRKTVFHDLAAIHPGRIVNVTNGITLRRWLYQANPGLTELIVDAVGPEVLDKAALLEALTPLADDAAFRERFMAVRRANKVALARLIAERLGIGVDPEAMFDVQIKRIHEYKRQLLNLLETIAFYNAVRAQPTRAWVPRVKIFSGKAAAGYRQAKLVIKLAHDVARIVNRDPVLRGRLKVVFLPNYNVSLAESIIPAADVSEQISTAGMEASGTGNMKLALNGALTIGTLDGANIEIRERVGAENMVIFGLDAEGVAQRRATGLDATATIAASPTLADVLRALESGTFSPDDRGRYRELVDGLRHHDYFMVCADFDAYWMAQRSINTLWQDRESWYGKAILNTARMGWFSADRAVLEYAREIWGADPGAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 102 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 103 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 104 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 105 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 138 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 139 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 140 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 237 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 242 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 247 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 256 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 259 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 263 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 288 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 289 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 290 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 291 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 292 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 293 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 294 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 295 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 296 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 297 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 298 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 299 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 300 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 301 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 302 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 303 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 409 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 410 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 411 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 412 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 413 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 414 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 415 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 416 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 417 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 418 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 419 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 444 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 447 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 460 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 461 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 462 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 463 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 465 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 466 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 467 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 470 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 472 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 473 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 474 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 476 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 478 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 479 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 480 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 483 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 484 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 485 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 486 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 487 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 488 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 489 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 490 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 491 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 492 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 493 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 494 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 495 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 496 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 497 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 498 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 499 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 500 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 501 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 502 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 503 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 504 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 505 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 506 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 507 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 508 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 509 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 510 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 511 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 512 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 513 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 514 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 515 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 516 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 517 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 518 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 519 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 520 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 521 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 522 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 523 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 524 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 525 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 526 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 527 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 528 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 529 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 530 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 531 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 532 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 533 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 534 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 535 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 536 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 537 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 538 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 539 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 540 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 541 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 542 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 543 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 544 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 545 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 546 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 547 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 548 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 549 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 550 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 551 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 552 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 553 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 554 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 555 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 556 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 557 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 558 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 559 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 560 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 561 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 562 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 563 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 564 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 565 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 566 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 567 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 568 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 569 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 570 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 571 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 572 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 573 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 574 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 575 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 576 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 577 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 578 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 579 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 580 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 581 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 582 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 583 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 584 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 585 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 586 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 587 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 588 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 589 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 590 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 591 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 592 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 593 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 594 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 595 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 596 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 597 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 598 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 599 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 600 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 601 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 602 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 603 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 604 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 605 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 606 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 607 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 608 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 609 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 610 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 611 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 612 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 613 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 614 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 615 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 616 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 617 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 618 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 619 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 620 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 621 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 622 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 623 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 624 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 625 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 626 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 627 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 628 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 629 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 630 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 631 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 632 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 633 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 634 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 635 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 636 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 637 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 638 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 639 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 640 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 641 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 642 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 643 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 644 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 645 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 646 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 647 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 648 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 649 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 650 | 2791355199 | |||
| 651 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 652 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 653 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 654 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 655 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 656 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 657 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 658 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 659 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 660 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 661 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 662 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 663 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 664 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 665 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 666 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 667 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 668 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 669 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 670 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 671 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 672 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 673 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 674 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 675 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 676 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 677 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 678 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 679 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 680 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 681 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 682 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 683 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 684 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 685 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 686 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 687 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 688 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 689 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 690 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 691 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 692 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 693 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 694 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 695 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 696 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 697 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 698 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 699 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 700 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 701 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 702 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 703 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 704 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 705 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 706 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 707 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 708 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 709 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 710 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 711 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 712 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 713 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 714 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 715 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 716 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 717 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 718 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 719 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 720 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 721 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 722 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 723 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 724 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 725 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 726 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 727 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 728 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 729 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 730 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 731 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 732 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 733 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 734 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 735 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 736 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 737 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 738 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 739 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 740 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 741 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 742 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 743 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 744 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 745 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 746 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 747 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 748 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 749 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 750 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 751 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 752 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 753 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 754 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 755 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 756 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 757 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 758 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 759 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 760 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 761 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 762 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 763 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 764 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 765 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 766 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 767 | 2904699407 | |||
| 768 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 769 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 770 | 2906610324 | |||
| 771 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 772 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 773 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 774 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 775 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 776 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 777 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 778 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 779 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 780 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 781 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 782 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 783 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 784 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 785 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 786 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 787 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 788 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 789 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 790 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 791 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 792 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 793 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 794 | 2922368715 | |||
| 795 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 796 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 797 | 2922425934 | |||
| 798 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 799 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 800 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 801 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 802 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 803 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 804 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 805 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 806 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 807 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 808 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 809 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 810 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 811 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 812 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 813 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 814 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 815 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 816 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 817 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 818 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 819 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 820 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 821 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 822 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 823 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 824 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 825 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 826 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 827 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 828 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 829 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 830 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 831 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 832 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 833 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 834 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 835 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 836 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 837 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 838 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 839 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 840 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 841 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 842 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 843 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 844 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 845 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 846 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 847 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 848 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 849 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 850 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 851 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 852 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 853 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 854 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 855 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 856 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 857 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 858 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 859 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 860 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 861 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 862 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 863 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 864 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 865 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 866 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 867 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 868 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 869 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 870 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 871 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 872 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 873 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 874 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 875 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 876 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 877 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 878 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 879 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 880 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 881 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 882 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 883 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 884 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 885 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 886 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 887 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 888 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 889 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 890 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 891 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 892 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 893 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 894 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 895 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 896 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 897 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 898 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 899 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 900 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 901 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 902 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 903 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 904 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 905 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 906 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 907 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 908 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 909 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 910 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 911 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 912 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 913 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 914 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 915 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 916 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 917 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 918 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 919 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 920 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 921 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 922 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 923 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 924 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 925 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 926 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 927 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 928 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 929 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 930 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 931 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 932 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 933 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 934 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 935 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 936 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 937 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 938 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 939 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 940 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 941 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 942 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 943 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 944 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 945 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 946 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 947 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 948 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 949 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 950 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 951 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 952 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 953 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 954 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 955 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 956 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 957 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 958 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 959 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 960 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 961 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 962 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 963 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 964 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 965 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 966 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 967 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 968 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 969 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 970 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 971 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 972 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 973 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 974 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 975 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.51 |
| Metatranscriptomes | 0 |
| Isolates | 29.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.92 |
| Nodule | 12.27 |
| Rhizoplane | 6.49 |
| Rhizosphere | 60.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207697_10001813 | 3300025315 | Bacteria | 11452 |
| 2 | MRS2a_Contig_52 | 2124908027 | Bacteria | 34043 |
| 3 | SwRhRL2b_contig_613450 | 2162886007 | Bacteria | 3260 |
| 4 | JGI24741J21665_1001182 | 3300001915 | Bacteria | 7722 |
| 5 | JGI24740J21852_10007761 | 3300001979 | Bacteria | 4336 |
| 6 | JGI24737J22298_10003323 | 3300001990 | Bacteria | 5693 |
| 7 | JGI25162J39368_1000098 | 3300002737 | Bacteria | 95821 |
| 8 | JGI25162J39368_1000129 | 3300002737 | Bacteria | 83712 |
| 9 | JGI25154J39366_1004169 | 3300002738 | Bacteria | 2681 |
| 10 | JGI25163J39215_1000689 | 3300002771 | Bacteria | 8956 |
| 11 | JGI25163J39215_1001594 | 3300002771 | Bacteria | 3435 |
| 12 | JGI25164J39214_1000076 | 3300002772 | Bacteria | 95821 |
| 13 | JGI25164J39214_1000101 | 3300002772 | Bacteria | 83715 |
| 14 | JGI25406J46586_10000308 | 3300003203 | Bacteria | 21987 |
| 15 | JGI25406J46586_10003834 | 3300003203 | Bacteria | 7026 |
| 16 | JGI25165J46597_1000150 | 3300003214 | Bacteria | 115430 |
| 17 | JGI25165J46597_1000180 | 3300003214 | Bacteria | 95821 |
| 18 | JGI25153J46596_10003462 | 3300003215 | Bacteria | 8838 |
| 19 | JGI25160J50197_1007754 | 3300003354 | Bacteria | 4164 |
| 20 | Ga0055538_1000115 | 3300003751 | Bacteria | 61470 |
| 21 | Ga0055539_1000162 | 3300003752 | Bacteria | 61470 |
| 22 | Ga0055533_1000164 | 3300003756 | Bacteria | 61470 |
| 23 | Ga0055532_1000153 | 3300003758 | Bacteria | 61470 |
| 24 | Ga0055525_1000224 | 3300003759 | Bacteria | 61470 |
| 25 | Ga0055536_1000232 | 3300003781 | Bacteria | 44724 |
| 26 | Ga0055536_1000312 | 3300003781 | Bacteria | 36538 |
| 27 | Ga0055536_1003049 | 3300003781 | Bacteria | 9150 |
| 28 | Ga0055530_10000404 | 3300003791 | Bacteria | 38699 |
| 29 | Ga0055530_10002858 | 3300003791 | Bacteria | 10545 |
| 30 | Ga0055530_10006098 | 3300003791 | Bacteria | 5492 |
| 31 | Ga0055540_1000339 | 3300003792 | Bacteria | 40092 |
| 32 | Ga0055540_1000753 | 3300003792 | Bacteria | 21955 |
| 33 | Ga0055540_1002153 | 3300003792 | Bacteria | 10730 |
| 34 | Ga0055531_10000455 | 3300003794 | Bacteria | 38042 |
| 35 | Ga0055541_1000107 | 3300003841 | Bacteria | 61470 |
| 36 | Ga0065165_1001384 | 3300005262 | Bacteria | 26615 |
| 37 | Ga0065165_1001704 | 3300005262 | Bacteria | 22070 |
| 38 | Ga0065714_10000618 | 3300005288 | Bacteria | 4004 |
| 39 | Ga0065714_10003400 | 3300005288 | Bacteria | 7913 |
| 40 | Ga0065714_10009637 | 3300005288 | Bacteria | 3727 |
| 41 | Ga0065714_10068828 | 3300005288 | Bacteria | 4520 |
| 42 | Ga0065714_10069561 | 3300005288 | Bacteria | 4174 |
| 43 | Ga0065714_10074770 | 3300005288 | Bacteria | 2962 |
| 44 | Ga0065714_10078921 | 3300005288 | Bacteria | 2558 |
| 45 | Ga0065704_10005342 | 3300005289 | Bacteria | 3054 |
| 46 | Ga0065704_10084010 | 3300005289 | Bacteria | 3388 |
| 47 | Ga0065712_10003999 | 3300005290 | Bacteria | 4202 |
| 48 | Ga0065712_10067807 | 3300005290 | Bacteria | 30871 |
| 49 | Ga0065715_10013732 | 3300005293 | Bacteria | 3306 |
| 50 | Ga0070658_10015788 | 3300005327 | Bacteria | 6036 |
| 51 | Ga0070676_10000872 | 3300005328 | Bacteria | 14892 |
| 52 | Ga0070676_10024434 | 3300005328 | Bacteria | 3404 |
| 53 | Ga0070683_100007899 | 3300005329 | Bacteria | 9019 |
| 54 | Ga0070670_100000066 | 3300005331 | Bacteria | 107260 |
| 55 | Ga0070670_100007196 | 3300005331 | Bacteria | 9424 |
| 56 | Ga0070670_100007723 | 3300005331 | Bacteria | 9145 |
| 57 | Ga0070670_100009172 | 3300005331 | Bacteria | 8457 |
| 58 | Ga0070670_100013630 | 3300005331 | Bacteria | 6966 |
| 59 | Ga0068869_100001188 | 3300005334 | Bacteria | 15282 |
| 60 | Ga0068869_100007725 | 3300005334 | Bacteria | 6894 |
| 61 | Ga0070666_10000801 | 3300005335 | Bacteria | 19095 |
| 62 | Ga0070666_10004064 | 3300005335 | Bacteria | 8880 |
| 63 | Ga0070680_100032610 | 3300005336 | Bacteria | 4194 |
| 64 | Ga0070680_100033131 | 3300005336 | Bacteria | 4162 |
| 65 | Ga0070680_100055358 | 3300005336 | Bacteria | 3241 |
| 66 | Ga0070680_100061857 | 3300005336 | Bacteria | 3065 |
| 67 | Ga0068868_100022586 | 3300005338 | Bacteria | 4750 |
| 68 | Ga0070661_100001439 | 3300005344 | Bacteria | 16550 |
| 69 | Ga0070661_100032588 | 3300005344 | Bacteria | 3772 |
| 70 | Ga0070668_100000032 | 3300005347 | Bacteria | 85248 |
| 71 | Ga0070668_100001127 | 3300005347 | Bacteria | 18772 |
| 72 | Ga0070668_100001958 | 3300005347 | Bacteria | 15019 |
| 73 | Ga0070668_100004263 | 3300005347 | Bacteria | 10609 |
| 74 | Ga0070668_100006735 | 3300005347 | Bacteria | 8515 |
| 75 | Ga0070668_100027740 | 3300005347 | Bacteria | 4298 |
| 76 | Ga0070669_100000233 | 3300005353 | Bacteria | 46639 |
| 77 | Ga0070669_100004590 | 3300005353 | Bacteria | 9970 |
| 78 | Ga0070669_100004761 | 3300005353 | Bacteria | 9786 |
| 79 | Ga0070669_100008033 | 3300005353 | Bacteria | 7532 |
| 80 | Ga0070669_100009909 | 3300005353 | Bacteria | 6785 |
| 81 | Ga0070675_100004013 | 3300005354 | Bacteria | 11174 |
| 82 | Ga0070675_100006340 | 3300005354 | Bacteria | 9081 |
| 83 | Ga0070675_100024299 | 3300005354 | Bacteria | 4853 |
| 84 | Ga0070675_100034848 | 3300005354 | Bacteria | 4087 |
| 85 | Ga0070675_100044927 | 3300005354 | Bacteria | 3613 |
| 86 | Ga0070671_100012016 | 3300005355 | Bacteria | 6965 |
| 87 | Ga0070673_100001777 | 3300005364 | Bacteria | 12849 |
| 88 | Ga0070673_100019119 | 3300005364 | Bacteria | 4915 |
| 89 | Ga0070673_100023738 | 3300005364 | Bacteria | 4485 |
| 90 | Ga0070688_100003732 | 3300005365 | Bacteria | 7883 |
| 91 | Ga0070659_100009972 | 3300005366 | Bacteria | 6987 |
| 92 | Ga0070667_100000526 | 3300005367 | Bacteria | 38431 |
| 93 | Ga0070667_100000619 | 3300005367 | Bacteria | 34660 |
| 94 | Ga0070667_100002498 | 3300005367 | Bacteria | 16055 |
| 95 | Ga0070667_100011068 | 3300005367 | Bacteria | 7462 |
| 96 | Ga0070667_100016674 | 3300005367 | Bacteria | 6081 |
| 97 | Ga0070709_10008708 | 3300005434 | Bacteria | 5581 |
| 98 | Ga0070714_100030984 | 3300005435 | Bacteria | 4457 |
| 99 | Ga0070714_100061393 | 3300005435 | Bacteria | 3228 |
| 100 | Ga0070714_100066765 | 3300005435 | Bacteria | 3100 |
| 101 | Ga0070713_100000894 | 3300005436 | Bacteria | 19127 |
| 102 | Ga0070710_10004687 | 3300005437 | Bacteria | 6466 |
| 103 | Ga0070710_10009230 | 3300005437 | Bacteria | 4820 |
| 104 | Ga0070711_100002080 | 3300005439 | Bacteria | 11302 |
| 105 | Ga0070711_100008621 | 3300005439 | Bacteria | 6254 |
| 106 | Ga0070700_100007179 | 3300005441 | Bacteria | 5999 |
| 107 | Ga0070708_100000012 | 3300005445 | Bacteria | 133550 |
| 108 | Ga0070663_100008924 | 3300005455 | Bacteria | 6193 |
| 109 | Ga0070663_100020283 | 3300005455 | Bacteria | 4399 |
| 110 | Ga0070678_100000361 | 3300005456 | Bacteria | 21160 |
| 111 | Ga0070678_100010959 | 3300005456 | Bacteria | 5565 |
| 112 | Ga0070662_100001331 | 3300005457 | Bacteria | 15188 |
| 113 | Ga0070681_10008326 | 3300005458 | Bacteria | 10160 |
| 114 | Ga0068867_100001440 | 3300005459 | Bacteria | 16478 |
| 115 | Ga0068867_100001447 | 3300005459 | Bacteria | 16452 |
| 116 | Ga0070698_100022285 | 3300005471 | Bacteria | 6627 |
| 117 | Ga0070699_100017152 | 3300005518 | Bacteria | 6218 |
| 118 | Ga0070699_100021712 | 3300005518 | Bacteria | 5534 |
| 119 | Ga0070679_100006990 | 3300005530 | Bacteria | 10534 |
| 120 | Ga0070679_100019021 | 3300005530 | Bacteria | 6672 |
| 121 | Ga0070679_100034216 | 3300005530 | Bacteria | 5035 |
| 122 | Ga0070679_100059192 | 3300005530 | Bacteria | 3818 |
| 123 | Ga0070684_100003445 | 3300005535 | Bacteria | 11873 |
| 124 | Ga0070684_100017952 | 3300005535 | Bacteria | 5816 |
| 125 | Ga0070684_100051145 | 3300005535 | Bacteria | 3589 |
| 126 | Ga0068853_100000029 | 3300005539 | Bacteria | 121775 |
| 127 | Ga0068853_100004618 | 3300005539 | Bacteria | 10687 |
| 128 | Ga0068853_100008416 | 3300005539 | Bacteria | 8289 |
| 129 | Ga0070672_100014409 | 3300005543 | Bacteria | 5603 |
| 130 | Ga0070672_100036731 | 3300005543 | Bacteria | 3734 |
| 131 | Ga0070665_100000751 | 3300005548 | Bacteria | 43044 |
| 132 | Ga0070665_100000824 | 3300005548 | Bacteria | 40499 |
| 133 | Ga0070665_100003493 | 3300005548 | Bacteria | 16732 |
| 134 | Ga0070665_100006084 | 3300005548 | Bacteria | 12336 |
| 135 | Ga0070665_100012520 | 3300005548 | Bacteria | 8547 |
| 136 | Ga0070665_100036175 | 3300005548 | Bacteria | 4967 |
| 137 | Ga0070665_100036817 | 3300005548 | Bacteria | 4920 |
| 138 | Ga0068855_100016264 | 3300005563 | Bacteria | 8947 |
| 139 | Ga0068855_100042590 | 3300005563 | Bacteria | 5379 |
| 140 | Ga0070664_100000531 | 3300005564 | Bacteria | 29123 |
| 141 | Ga0070664_100010616 | 3300005564 | Bacteria | 7464 |
| 142 | Ga0068857_100005533 | 3300005577 | Bacteria | 10778 |
| 143 | Ga0068857_100027111 | 3300005577 | Bacteria | 5054 |
| 144 | Ga0068856_100000432 | 3300005614 | Bacteria | 45968 |
| 145 | Ga0068856_100034833 | 3300005614 | Bacteria | 4933 |
| 146 | Ga0068856_100057227 | 3300005614 | Bacteria | 3849 |
| 147 | Ga0068856_100062862 | 3300005614 | Bacteria | 3667 |
| 148 | Ga0070702_100025638 | 3300005615 | Bacteria | 3161 |
| 149 | Ga0068852_100025278 | 3300005616 | Bacteria | 4809 |
| 150 | Ga0068852_100036675 | 3300005616 | Bacteria | 4105 |
| 151 | Ga0068859_100002359 | 3300005617 | Bacteria | 19224 |
| 152 | Ga0068859_100003198 | 3300005617 | Bacteria | 16678 |
| 153 | Ga0068859_100012416 | 3300005617 | Bacteria | 8571 |
| 154 | Ga0068859_100083408 | 3300005617 | Bacteria | 3239 |
| 155 | Ga0068864_100000132 | 3300005618 | Bacteria | 72063 |
| 156 | Ga0068864_100000273 | 3300005618 | Bacteria | 45943 |
| 157 | Ga0068864_100001673 | 3300005618 | Bacteria | 18247 |
| 158 | Ga0068864_100016393 | 3300005618 | Bacteria | 6168 |
| 159 | Ga0068864_100022148 | 3300005618 | Bacteria | 5327 |
| 160 | Ga0068861_100002284 | 3300005719 | Bacteria | 12436 |
| 161 | Ga0068861_100031773 | 3300005719 | Bacteria | 3881 |
| 162 | Ga0068851_10000035 | 3300005834 | Bacteria | 106588 |
| 163 | Ga0068851_10006945 | 3300005834 | Bacteria | 5189 |
| 164 | Ga0068870_10004164 | 3300005840 | Bacteria | 6203 |
| 165 | Ga0068863_100000142 | 3300005841 | Bacteria | 75317 |
| 166 | Ga0068863_100002817 | 3300005841 | Bacteria | 17214 |
| 167 | Ga0068863_100003818 | 3300005841 | Bacteria | 14893 |
| 168 | Ga0068863_100004135 | 3300005841 | Bacteria | 14347 |
| 169 | Ga0068863_100011071 | 3300005841 | Bacteria | 8747 |
| 170 | Ga0068863_100017414 | 3300005841 | Bacteria | 6889 |
| 171 | Ga0068858_100001039 | 3300005842 | Bacteria | 28680 |
| 172 | Ga0068858_100002619 | 3300005842 | Bacteria | 18122 |
| 173 | Ga0068858_100007621 | 3300005842 | Bacteria | 10455 |
| 174 | Ga0068858_100029555 | 3300005842 | Bacteria | 5089 |
| 175 | Ga0068860_100000295 | 3300005843 | Bacteria | 69402 |
| 176 | Ga0068860_100004046 | 3300005843 | Bacteria | 15059 |
| 177 | Ga0068860_100004537 | 3300005843 | Bacteria | 14174 |
| 178 | Ga0068860_100018230 | 3300005843 | Bacteria | 6832 |
| 179 | Ga0068860_100026653 | 3300005843 | Bacteria | 5572 |
| 180 | Ga0068862_100000238 | 3300005844 | Bacteria | 61105 |
| 181 | Ga0068862_100011179 | 3300005844 | Bacteria | 7414 |
| 182 | Ga0068862_100011348 | 3300005844 | Bacteria | 7357 |
| 183 | Ga0068862_100058205 | 3300005844 | Bacteria | 3315 |
| 184 | Ga0081455_10000633 | 3300005937 | Bacteria | 45582 |
| 185 | Ga0081455_10002844 | 3300005937 | Bacteria | 20375 |
| 186 | Ga0081455_10008295 | 3300005937 | Bacteria | 10823 |
| 187 | Ga0081455_10012886 | 3300005937 | Bacteria | 8296 |
| 188 | Ga0081455_10020150 | 3300005937 | Bacteria | 6291 |
| 189 | Ga0081455_10023112 | 3300005937 | Bacteria | 5791 |
| 190 | Ga0081538_10005211 | 3300005981 | Bacteria | 11746 |
| 191 | Ga0081538_10034611 | 3300005981 | Bacteria | 3335 |
| 192 | Ga0081540_1003693 | 3300005983 | Bacteria | 11998 |
| 193 | Ga0081540_1005997 | 3300005983 | Bacteria | 8952 |
| 194 | Ga0081540_1014711 | 3300005983 | Bacteria | 4996 |
| 195 | Ga0081540_1020374 | 3300005983 | Bacteria | 3992 |
| 196 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 197 | Ga0081539_10002152 | 3300005985 | Bacteria | 29064 |
| 198 | Ga0070717_10003674 | 3300006028 | Bacteria | 11014 |
| 199 | Ga0070717_10018962 | 3300006028 | Bacteria | 5386 |
| 200 | Ga0070717_10027490 | 3300006028 | Bacteria | 4547 |
| 201 | Ga0070717_10035736 | 3300006028 | Bacteria | 4026 |
| 202 | Ga0075365_10010751 | 3300006038 | Bacteria | 5347 |
| 203 | Ga0075368_10011691 | 3300006042 | Bacteria | 3198 |
| 204 | Ga0075363_100032087 | 3300006048 | Bacteria | 2726 |
| 205 | Ga0075432_10005107 | 3300006058 | Bacteria | 4472 |
| 206 | Ga0070715_10001868 | 3300006163 | Bacteria | 6309 |
| 207 | Ga0070716_100012041 | 3300006173 | Bacteria | 4371 |
| 208 | Ga0070712_100004848 | 3300006175 | Bacteria | 8318 |
| 209 | Ga0070712_100010245 | 3300006175 | Bacteria | 5911 |
| 210 | Ga0070712_100012801 | 3300006175 | Bacteria | 5339 |
| 211 | Ga0075369_10005528 | 3300006186 | Bacteria | 4729 |
| 212 | Ga0097621_100019504 | 3300006237 | Bacteria | 5205 |
| 213 | Ga0097621_100023896 | 3300006237 | Bacteria | 4764 |
| 214 | Ga0068871_100025300 | 3300006358 | Bacteria | 4616 |
| 215 | Ga0075428_100020463 | 3300006844 | Bacteria | 7325 |
| 216 | Ga0075430_100000066 | 3300006846 | Bacteria | 56729 |
| 217 | Ga0075430_100002359 | 3300006846 | Bacteria | 15692 |
| 218 | Ga0075431_100102583 | 3300006847 | Bacteria | 2952 |
| 219 | Ga0068865_100049130 | 3300006881 | Bacteria | 2906 |
| 220 | Ga0097620_100002358 | 3300006931 | Bacteria | 19224 |
| 221 | Ga0097620_100003197 | 3300006931 | Bacteria | 16678 |
| 222 | Ga0097620_100012415 | 3300006931 | Bacteria | 8571 |
| 223 | Ga0097620_100083406 | 3300006931 | Bacteria | 3239 |
| 224 | Ga0099825_1016067 | 3300006941 | Bacteria | 6541 |
| 225 | Ga0099824_1014113 | 3300006942 | Bacteria | 8051 |
| 226 | Ga0099822_1006926 | 3300006943 | Bacteria | 14714 |
| 227 | Ga0099823_1007118 | 3300006944 | Bacteria | 11327 |
| 228 | Ga0079104_1000423 | 3300006946 | Bacteria | 48297 |
| 229 | Ga0079104_1001202 | 3300006946 | Bacteria | 18420 |
| 230 | Ga0105251_10000118 | 3300009011 | Bacteria | 79165 |
| 231 | Ga0105251_10000191 | 3300009011 | Bacteria | 62283 |
| 232 | Ga0105251_10001252 | 3300009011 | Bacteria | 21984 |
| 233 | Ga0105251_10005196 | 3300009011 | Bacteria | 8589 |
| 234 | Ga0105251_10005418 | 3300009011 | Bacteria | 8343 |
| 235 | Ga0105251_10014131 | 3300009011 | Bacteria | 4431 |
| 236 | Ga0105244_10000593 | 3300009036 | Bacteria | 32509 |
| 237 | Ga0105244_10000969 | 3300009036 | Bacteria | 24124 |
| 238 | Ga0105244_10001341 | 3300009036 | Bacteria | 20090 |
| 239 | Ga0105244_10019846 | 3300009036 | Bacteria | 3741 |
| 240 | Ga0105244_10020929 | 3300009036 | Bacteria | 3624 |
| 241 | Ga0105244_10025551 | 3300009036 | Bacteria | 3210 |
| 242 | Ga0105244_10027558 | 3300009036 | Bacteria | 3059 |
| 243 | Ga0105250_10000251 | 3300009092 | Bacteria | 44435 |
| 244 | Ga0105250_10002362 | 3300009092 | Bacteria | 9534 |
| 245 | Ga0105250_10002665 | 3300009092 | Bacteria | 8849 |
| 246 | Ga0105250_10003074 | 3300009092 | Bacteria | 8045 |
| 247 | Ga0105240_10002394 | 3300009093 | Bacteria | 30190 |
| 248 | Ga0105240_10047754 | 3300009093 | Bacteria | 5416 |
| 249 | Ga0105240_10056069 | 3300009093 | Bacteria | 4932 |
| 250 | Ga0105240_10092314 | 3300009093 | Bacteria | 3697 |
| 251 | Ga0111539_10000323 | 3300009094 | Bacteria | 58458 |
| 252 | Ga0111539_10050591 | 3300009094 | Bacteria | 4950 |
| 253 | Ga0114129_10009029 | 3300009147 | Bacteria | 14212 |
| 254 | Ga0114129_10044968 | 3300009147 | Bacteria | 6209 |
| 255 | Ga0105243_10000299 | 3300009148 | Bacteria | 54796 |
| 256 | Ga0105243_10001887 | 3300009148 | Bacteria | 17864 |
| 257 | Ga0105243_10003109 | 3300009148 | Bacteria | 13648 |
| 258 | Ga0105243_10020011 | 3300009148 | Bacteria | 5074 |
| 259 | Ga0105243_10042863 | 3300009148 | Bacteria | 3545 |
| 260 | Ga0105242_10000465 | 3300009176 | Bacteria | 32243 |
| 261 | Ga0105242_10040171 | 3300009176 | Bacteria | 3769 |
| 262 | Ga0105248_10000648 | 3300009177 | Bacteria | 39487 |
| 263 | Ga0105248_10001325 | 3300009177 | Bacteria | 27561 |
| 264 | Ga0105248_10009379 | 3300009177 | Bacteria | 10773 |
| 265 | Ga0105248_10009617 | 3300009177 | Bacteria | 10644 |
| 266 | Ga0105237_10002856 | 3300009545 | Bacteria | 21007 |
| 267 | Ga0105237_10023860 | 3300009545 | Bacteria | 6260 |
| 268 | Ga0105237_10025304 | 3300009545 | Bacteria | 6071 |
| 269 | Ga0105237_10027605 | 3300009545 | Bacteria | 5792 |
| 270 | Ga0105238_10014059 | 3300009551 | Bacteria | 8093 |
| 271 | Ga0105238_10014372 | 3300009551 | Bacteria | 8000 |
| 272 | Ga0105238_10015143 | 3300009551 | Bacteria | 7810 |
| 273 | Ga0105249_10000237 | 3300009553 | Bacteria | 62456 |
| 274 | Ga0105249_10045838 | 3300009553 | Bacteria | 3978 |
| 275 | Ga0105249_10076393 | 3300009553 | Bacteria | 3104 |
| 276 | Ga0105239_10013419 | 3300010375 | Bacteria | 9104 |
| 277 | Ga0105239_10036008 | 3300010375 | Bacteria | 5434 |
| 278 | Ga0105246_10000445 | 3300011119 | Bacteria | 22189 |
| 279 | Ga0105246_10005000 | 3300011119 | Bacteria | 8066 |
| 280 | Ga0105246_10016063 | 3300011119 | Bacteria | 4737 |
| 281 | Ga0157345_1000228 | 3300012498 | Bacteria | 8239 |
| 282 | Ga0157373_10004675 | 3300013100 | Bacteria | 10293 |
| 283 | Ga0157373_10006022 | 3300013100 | Bacteria | 9067 |
| 284 | Ga0157371_10000238 | 3300013102 | Bacteria | 78535 |
| 285 | Ga0157371_10006967 | 3300013102 | Bacteria | 9206 |
| 286 | Ga0157370_10026265 | 3300013104 | Bacteria | 5752 |
| 287 | Ga0157370_10037678 | 3300013104 | Bacteria | 4686 |
| 288 | Ga0157369_10014104 | 3300013105 | Bacteria | 9034 |
| 289 | Ga0157369_10014525 | 3300013105 | Bacteria | 8885 |
| 290 | Ga0157369_10055180 | 3300013105 | Bacteria | 4289 |
| 291 | Ga0157369_10066221 | 3300013105 | Bacteria | 3887 |
| 292 | Ga0157378_10004733 | 3300013297 | Bacteria | 11931 |
| 293 | Ga0163162_10020131 | 3300013306 | Bacteria | 6551 |
| 294 | Ga0163162_10022074 | 3300013306 | Bacteria | 6272 |
| 295 | Ga0163162_10042652 | 3300013306 | Bacteria | 4542 |
| 296 | Ga0163162_10047143 | 3300013306 | Bacteria | 4319 |
| 297 | Ga0163162_10073208 | 3300013306 | Bacteria | 3482 |
| 298 | Ga0163162_10134325 | 3300013306 | Bacteria | 2585 |
| 299 | Ga0157372_10000711 | 3300013307 | Bacteria | 36578 |
| 300 | Ga0157372_10020723 | 3300013307 | Bacteria | 7096 |
| 301 | Ga0157375_10009131 | 3300013308 | Bacteria | 8687 |
| 302 | Ga0157375_10018608 | 3300013308 | Bacteria | 6302 |
| 303 | Ga0157375_10021792 | 3300013308 | Bacteria | 5885 |
| 304 | Ga0157375_10044280 | 3300013308 | Bacteria | 4322 |
| 305 | Ga0163163_10003123 | 3300014325 | Bacteria | 14036 |
| 306 | Ga0163163_10004279 | 3300014325 | Bacteria | 12164 |
| 307 | Ga0163163_10019108 | 3300014325 | Bacteria | 6430 |
| 308 | Ga0163163_10075518 | 3300014325 | Bacteria | 3363 |
| 309 | Ga0157380_10016019 | 3300014326 | Bacteria | 5520 |
| 310 | Ga0157380_10020785 | 3300014326 | Bacteria | 4913 |
| 311 | Ga0182008_10004318 | 3300014497 | Bacteria | 8322 |
| 312 | Ga0182008_10004478 | 3300014497 | Bacteria | 8166 |
| 313 | Ga0182008_10008335 | 3300014497 | Bacteria | 5662 |
| 314 | Ga0182008_10012516 | 3300014497 | Bacteria | 4477 |
| 315 | Ga0182008_10019813 | 3300014497 | Bacteria | 3468 |
| 316 | Ga0157379_10000560 | 3300014968 | Bacteria | 29968 |
| 317 | Ga0157379_10002826 | 3300014968 | Bacteria | 14630 |
| 318 | Ga0157379_10002876 | 3300014968 | Bacteria | 14511 |
| 319 | Ga0157379_10010463 | 3300014968 | Bacteria | 8086 |
| 320 | Ga0157379_10018619 | 3300014968 | Bacteria | 6123 |
| 321 | Ga0157376_10028999 | 3300014969 | Bacteria | 4406 |
| 322 | Ga0182006_1000753 | 3300015261 | Bacteria | 22122 |
| 323 | Ga0182006_1002918 | 3300015261 | Bacteria | 9070 |
| 324 | Ga0182006_1003105 | 3300015261 | Bacteria | 8708 |
| 325 | Ga0182005_1002245 | 3300015265 | Bacteria | 7087 |
| 326 | Ga0182005_1005438 | 3300015265 | Bacteria | 3980 |
| 327 | Ga0163161_10010542 | 3300017792 | Bacteria | 6401 |
| 328 | Ga0163161_10012152 | 3300017792 | Bacteria | 5971 |
| 329 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 330 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 331 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 332 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 333 | Ga0213876_10002289 | 3300021384 | Bacteria | 11300 |
| 334 | Ga0213876_10009146 | 3300021384 | Bacteria | 5335 |
| 335 | Ga0213876_10013063 | 3300021384 | Bacteria | 4414 |
| 336 | Ga0213875_10000860 | 3300021388 | Bacteria | 22443 |
| 337 | Ga0213875_10002209 | 3300021388 | Bacteria | 11845 |
| 338 | Ga0209760_100080 | 3300025207 | Bacteria | 77279 |
| 339 | Ga0209760_100159 | 3300025207 | Bacteria | 40609 |
| 340 | Ga0209784_100087 | 3300025224 | Bacteria | 122062 |
| 341 | Ga0209566_100106 | 3300025225 | Bacteria | 122062 |
| 342 | Ga0209674_100128 | 3300025226 | Bacteria | 122062 |
| 343 | Ga0209147_100129 | 3300025229 | Bacteria | 122062 |
| 344 | Ga0209563_100122 | 3300025230 | Bacteria | 122062 |
| 345 | Ga0209563_100636 | 3300025230 | Bacteria | 11311 |
| 346 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 347 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 348 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 349 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 350 | Ga0209437_100499 | 3300025233 | Bacteria | 28332 |
| 351 | Ga0209258_100352 | 3300025242 | Bacteria | 64206 |
| 352 | Ga0209646_1000310 | 3300025246 | Bacteria | 38640 |
| 353 | Ga0209677_100078 | 3300025253 | Bacteria | 122062 |
| 354 | Ga0209677_100296 | 3300025253 | Bacteria | 32613 |
| 355 | Ga0209677_101858 | 3300025253 | Bacteria | 8575 |
| 356 | Ga0209148_1000526 | 3300025254 | Bacteria | 37777 |
| 357 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 358 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 359 | Ga0209233_1003377 | 3300025261 | Bacteria | 5635 |
| 360 | Ga0209455_1001742 | 3300025272 | Bacteria | 9248 |
| 361 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 362 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 363 | Ga0209676_1000208 | 3300025292 | Bacteria | 130879 |
| 364 | Ga0209676_1000519 | 3300025292 | Bacteria | 60439 |
| 365 | Ga0209676_1003834 | 3300025292 | Bacteria | 8847 |
| 366 | Ga0209564_1002226 | 3300025295 | Bacteria | 16043 |
| 367 | Ga0209564_1002401 | 3300025295 | Bacteria | 14944 |
| 368 | Ga0209564_1005204 | 3300025295 | Bacteria | 7531 |
| 369 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 370 | Ga0209758_1001439 | 3300025297 | Bacteria | 28039 |
| 371 | Ga0209758_1004188 | 3300025297 | Bacteria | 12254 |
| 372 | Ga0209758_1010096 | 3300025297 | Bacteria | 5718 |
| 373 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 374 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 375 | Ga0209050_1000381 | 3300025298 | Bacteria | 83623 |
| 376 | Ga0209050_1004562 | 3300025298 | Bacteria | 9294 |
| 377 | Ga0207426_1000380 | 3300025302 | Bacteria | 76046 |
| 378 | Ga0207426_1001158 | 3300025302 | Bacteria | 23695 |
| 379 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 380 | Ga0209051_1000039 | 3300025303 | Bacteria | 319632 |
| 381 | Ga0209051_1000047 | 3300025303 | Bacteria | 293227 |
| 382 | Ga0209051_1000080 | 3300025303 | Bacteria | 199694 |
| 383 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 384 | Ga0209257_1001899 | 3300025304 | Bacteria | 22595 |
| 385 | Ga0207656_10000008 | 3300025321 | Bacteria | 275365 |
| 386 | Ga0207656_10008944 | 3300025321 | Bacteria | 3710 |
| 387 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 388 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 389 | Ga0207696_1000074 | 3300025711 | Bacteria | 215333 |
| 390 | Ga0207696_1000084 | 3300025711 | Bacteria | 196086 |
| 391 | Ga0207696_1002815 | 3300025711 | Bacteria | 8249 |
| 392 | Ga0207696_1005271 | 3300025711 | Bacteria | 5389 |
| 393 | Ga0207696_1006465 | 3300025711 | Bacteria | 4720 |
| 394 | Ga0207696_1010017 | 3300025711 | Bacteria | 3498 |
| 395 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 396 | Ga0207655_1000556 | 3300025728 | Bacteria | 46531 |
| 397 | Ga0207655_1000904 | 3300025728 | Bacteria | 30971 |
| 398 | Ga0207655_1001007 | 3300025728 | Bacteria | 28675 |
| 399 | Ga0207655_1001055 | 3300025728 | Bacteria | 27513 |
| 400 | Ga0207655_1001190 | 3300025728 | Bacteria | 25175 |
| 401 | Ga0207655_1001386 | 3300025728 | Bacteria | 22646 |
| 402 | Ga0207655_1002635 | 3300025728 | Bacteria | 14206 |
| 403 | Ga0207655_1004166 | 3300025728 | Bacteria | 10378 |
| 404 | Ga0207655_1004754 | 3300025728 | Bacteria | 9474 |
| 405 | Ga0207655_1006994 | 3300025728 | Bacteria | 7389 |
| 406 | Ga0207655_1015505 | 3300025728 | Bacteria | 4227 |
| 407 | Ga0207655_1020640 | 3300025728 | Bacteria | 3376 |
| 408 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 409 | Ga0207713_1000114 | 3300025735 | Bacteria | 132170 |
| 410 | Ga0207713_1000814 | 3300025735 | Bacteria | 28848 |
| 411 | Ga0207713_1000823 | 3300025735 | Bacteria | 28708 |
| 412 | Ga0207713_1002649 | 3300025735 | Bacteria | 12860 |
| 413 | Ga0207713_1005023 | 3300025735 | Bacteria | 8422 |
| 414 | Ga0207713_1007272 | 3300025735 | Bacteria | 6568 |
| 415 | Ga0207713_1017048 | 3300025735 | Bacteria | 3661 |
| 416 | Ga0207713_1020419 | 3300025735 | Bacteria | 3210 |
| 417 | Ga0207713_1022163 | 3300025735 | Bacteria | 3023 |
| 418 | Ga0207682_10003038 | 3300025893 | Bacteria | 7367 |
| 419 | Ga0207692_10000619 | 3300025898 | Bacteria | 12488 |
| 420 | Ga0207688_10000740 | 3300025901 | Bacteria | 16209 |
| 421 | Ga0207688_10006116 | 3300025901 | Bacteria | 6549 |
| 422 | Ga0207688_10013242 | 3300025901 | Bacteria | 4482 |
| 423 | Ga0207680_10005696 | 3300025903 | Bacteria | 5967 |
| 424 | Ga0207647_10009114 | 3300025904 | Bacteria | 7065 |
| 425 | Ga0207685_10001110 | 3300025905 | Bacteria | 5345 |
| 426 | Ga0207645_10000381 | 3300025907 | Bacteria | 36628 |
| 427 | Ga0207645_10006829 | 3300025907 | Bacteria | 8141 |
| 428 | Ga0207645_10014705 | 3300025907 | Bacteria | 5225 |
| 429 | Ga0207643_10002073 | 3300025908 | Bacteria | 11044 |
| 430 | Ga0207643_10004363 | 3300025908 | Bacteria | 7598 |
| 431 | Ga0207643_10015612 | 3300025908 | Bacteria | 4134 |
| 432 | Ga0207684_10045086 | 3300025910 | Bacteria | 3740 |
| 433 | Ga0207654_10000611 | 3300025911 | Bacteria | 20145 |
| 434 | Ga0207707_10000749 | 3300025912 | Bacteria | 31978 |
| 435 | Ga0207707_10009487 | 3300025912 | Bacteria | 8440 |
| 436 | Ga0207707_10017756 | 3300025912 | Bacteria | 6206 |
| 437 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 438 | Ga0207695_10002336 | 3300025913 | Bacteria | 28213 |
| 439 | Ga0207695_10010723 | 3300025913 | Bacteria | 11186 |
| 440 | Ga0207695_10066281 | 3300025913 | Bacteria | 3709 |
| 441 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 442 | Ga0207671_10033720 | 3300025914 | Bacteria | 3808 |
| 443 | Ga0207671_10037354 | 3300025914 | Bacteria | 3602 |
| 444 | Ga0207693_10000701 | 3300025915 | Bacteria | 30084 |
| 445 | Ga0207693_10003425 | 3300025915 | Bacteria | 13537 |
| 446 | Ga0207693_10010113 | 3300025915 | Bacteria | 7663 |
| 447 | Ga0207693_10025339 | 3300025915 | Bacteria | 4704 |
| 448 | Ga0207663_10001487 | 3300025916 | Bacteria | 10928 |
| 449 | Ga0207663_10011188 | 3300025916 | Bacteria | 4808 |
| 450 | Ga0207663_10013624 | 3300025916 | Bacteria | 4424 |
| 451 | Ga0207660_10013218 | 3300025917 | Bacteria | 5406 |
| 452 | Ga0207660_10022948 | 3300025917 | Bacteria | 4209 |
| 453 | Ga0207660_10030875 | 3300025917 | Bacteria | 3685 |
| 454 | Ga0207657_10017514 | 3300025919 | Bacteria | 6865 |
| 455 | Ga0207657_10047722 | 3300025919 | Bacteria | 3742 |
| 456 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 457 | Ga0207652_10021894 | 3300025921 | Bacteria | 5281 |
| 458 | Ga0207646_10062663 | 3300025922 | Bacteria | 3320 |
| 459 | Ga0207681_10000683 | 3300025923 | Bacteria | 22278 |
| 460 | Ga0207681_10003174 | 3300025923 | Bacteria | 10320 |
| 461 | Ga0207681_10004247 | 3300025923 | Bacteria | 8846 |
| 462 | Ga0207694_10004635 | 3300025924 | Bacteria | 10703 |
| 463 | Ga0207694_10016745 | 3300025924 | Bacteria | 5541 |
| 464 | Ga0207694_10033461 | 3300025924 | Bacteria | 3938 |
| 465 | Ga0207650_10000110 | 3300025925 | Bacteria | 108519 |
| 466 | Ga0207650_10000239 | 3300025925 | Bacteria | 60879 |
| 467 | Ga0207650_10001925 | 3300025925 | Bacteria | 14614 |
| 468 | Ga0207700_10011969 | 3300025928 | Bacteria | 5565 |
| 469 | Ga0207700_10017997 | 3300025928 | Bacteria | 4734 |
| 470 | Ga0207664_10003529 | 3300025929 | Bacteria | 10445 |
| 471 | Ga0207644_10004280 | 3300025931 | Bacteria | 9261 |
| 472 | Ga0207706_10000885 | 3300025933 | Bacteria | 30776 |
| 473 | Ga0207706_10004496 | 3300025933 | Bacteria | 13092 |
| 474 | Ga0207706_10009929 | 3300025933 | Bacteria | 8727 |
| 475 | Ga0207706_10037403 | 3300025933 | Bacteria | 4310 |
| 476 | Ga0207706_10066218 | 3300025933 | Bacteria | 3180 |
| 477 | Ga0207709_10000451 | 3300025935 | Bacteria | 38328 |
| 478 | Ga0207709_10001143 | 3300025935 | Bacteria | 19344 |
| 479 | Ga0207709_10002422 | 3300025935 | Bacteria | 11739 |
| 480 | Ga0207709_10013497 | 3300025935 | Bacteria | 4506 |
| 481 | Ga0207669_10001538 | 3300025937 | Bacteria | 9831 |
| 482 | Ga0207704_10000667 | 3300025938 | Bacteria | 15204 |
| 483 | Ga0207665_10003410 | 3300025939 | Bacteria | 10639 |
| 484 | Ga0207665_10003934 | 3300025939 | Bacteria | 9947 |
| 485 | Ga0207691_10001601 | 3300025940 | Bacteria | 22500 |
| 486 | Ga0207691_10001942 | 3300025940 | Bacteria | 20182 |
| 487 | Ga0207691_10019038 | 3300025940 | Bacteria | 6501 |
| 488 | Ga0207691_10035493 | 3300025940 | Bacteria | 4627 |
| 489 | Ga0207711_10012404 | 3300025941 | Bacteria | 7085 |
| 490 | Ga0207711_10057207 | 3300025941 | Bacteria | 3353 |
| 491 | Ga0207689_10000548 | 3300025942 | Bacteria | 35796 |
| 492 | Ga0207689_10013134 | 3300025942 | Bacteria | 7068 |
| 493 | Ga0207689_10016085 | 3300025942 | Bacteria | 6332 |
| 494 | Ga0207661_10000379 | 3300025944 | Bacteria | 28634 |
| 495 | Ga0207679_10000009 | 3300025945 | Bacteria | 357262 |
| 496 | Ga0207667_10018585 | 3300025949 | Bacteria | 7790 |
| 497 | Ga0207667_10024759 | 3300025949 | Bacteria | 6582 |
| 498 | Ga0207667_10065460 | 3300025949 | Bacteria | 3790 |
| 499 | Ga0207651_10008314 | 3300025960 | Bacteria | 5598 |
| 500 | Ga0207651_10014919 | 3300025960 | Bacteria | 4500 |
| 501 | Ga0207651_10027417 | 3300025960 | Bacteria | 3577 |
| 502 | Ga0207712_10000185 | 3300025961 | Bacteria | 64444 |
| 503 | Ga0207712_10010895 | 3300025961 | Bacteria | 5787 |
| 504 | Ga0207668_10000003 | 3300025972 | Bacteria | 206959 |
| 505 | Ga0207668_10000658 | 3300025972 | Bacteria | 21211 |
| 506 | Ga0207668_10005943 | 3300025972 | Bacteria | 7191 |
| 507 | Ga0207668_10011392 | 3300025972 | Bacteria | 5401 |
| 508 | Ga0207640_10034871 | 3300025981 | Bacteria | 3144 |
| 509 | Ga0207658_10000158 | 3300025986 | Bacteria | 71472 |
| 510 | Ga0207658_10004094 | 3300025986 | Bacteria | 10170 |
| 511 | Ga0207658_10004956 | 3300025986 | Bacteria | 9182 |
| 512 | Ga0207658_10023472 | 3300025986 | Bacteria | 4305 |
| 513 | Ga0207703_10000746 | 3300026035 | Bacteria | 32065 |
| 514 | Ga0207703_10002726 | 3300026035 | Bacteria | 15138 |
| 515 | Ga0207703_10013036 | 3300026035 | Bacteria | 6479 |
| 516 | Ga0207703_10020233 | 3300026035 | Bacteria | 5204 |
| 517 | Ga0207639_10000090 | 3300026041 | Bacteria | 76134 |
| 518 | Ga0207639_10030720 | 3300026041 | Bacteria | 3942 |
| 519 | Ga0207678_10005581 | 3300026067 | Bacteria | 11246 |
| 520 | Ga0207678_10006762 | 3300026067 | Bacteria | 10170 |
| 521 | Ga0207678_10024159 | 3300026067 | Bacteria | 5310 |
| 522 | Ga0207708_10001830 | 3300026075 | Bacteria | 15686 |
| 523 | Ga0207708_10026202 | 3300026075 | Bacteria | 4410 |
| 524 | Ga0207702_10000122 | 3300026078 | Bacteria | 91685 |
| 525 | Ga0207702_10000598 | 3300026078 | Bacteria | 39935 |
| 526 | Ga0207702_10063134 | 3300026078 | Bacteria | 3167 |
| 527 | Ga0207641_10003431 | 3300026088 | Bacteria | 14035 |
| 528 | Ga0207641_10005395 | 3300026088 | Bacteria | 10923 |
| 529 | Ga0207641_10006693 | 3300026088 | Bacteria | 9660 |
| 530 | Ga0207641_10009156 | 3300026088 | Bacteria | 8175 |
| 531 | Ga0207641_10035165 | 3300026088 | Bacteria | 4172 |
| 532 | Ga0207648_10000330 | 3300026089 | Bacteria | 51825 |
| 533 | Ga0207648_10006413 | 3300026089 | Bacteria | 11693 |
| 534 | Ga0207648_10010744 | 3300026089 | Bacteria | 8651 |
| 535 | Ga0207648_10011827 | 3300026089 | Bacteria | 8201 |
| 536 | Ga0207648_10015832 | 3300026089 | Bacteria | 6912 |
| 537 | Ga0207676_10000522 | 3300026095 | Bacteria | 32307 |
| 538 | Ga0207676_10001311 | 3300026095 | Bacteria | 18516 |
| 539 | Ga0207676_10003518 | 3300026095 | Bacteria | 11086 |
| 540 | Ga0207676_10005910 | 3300026095 | Bacteria | 8646 |
| 541 | Ga0207674_10005808 | 3300026116 | Bacteria | 14643 |
| 542 | Ga0207674_10016864 | 3300026116 | Bacteria | 7981 |
| 543 | Ga0207674_10041147 | 3300026116 | Bacteria | 4781 |
| 544 | Ga0207675_100001548 | 3300026118 | Bacteria | 23038 |
| 545 | Ga0207675_100002647 | 3300026118 | Bacteria | 17671 |
| 546 | Ga0207675_100020818 | 3300026118 | Bacteria | 6115 |
| 547 | Ga0207675_100041472 | 3300026118 | Bacteria | 4299 |
| 548 | Ga0207683_10000528 | 3300026121 | Bacteria | 35475 |
| 549 | Ga0207683_10005690 | 3300026121 | Bacteria | 10693 |
| 550 | Ga0207683_10007332 | 3300026121 | Bacteria | 9451 |
| 551 | Ga0207698_10013528 | 3300026142 | Bacteria | 5388 |
| 552 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 553 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 554 | Ga0209281_1002039 | 3300027111 | Bacteria | 9127 |
| 555 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 556 | Ga0209389_1000165 | 3300027296 | Bacteria | 54591 |
| 557 | Ga0209389_1000190 | 3300027296 | Bacteria | 46313 |
| 558 | Ga0209371_1000630 | 3300027312 | Bacteria | 31210 |
| 559 | Ga0209589_1001841 | 3300027357 | Bacteria | 35751 |
| 560 | Ga0209589_1006092 | 3300027357 | Bacteria | 20135 |
| 561 | Ga0209489_100072 | 3300027361 | Bacteria | 138111 |
| 562 | Ga0209489_102693 | 3300027361 | Bacteria | 35754 |
| 563 | Ga0209489_105989 | 3300027361 | Bacteria | 20135 |
| 564 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 565 | Ga0209700_105810 | 3300027363 | Bacteria | 20135 |
| 566 | Ga0209995_1001318 | 3300027471 | Bacteria | 3820 |
| 567 | Ga0209983_1001251 | 3300027665 | Bacteria | 5645 |
| 568 | Ga0207428_10000129 | 3300027907 | Bacteria | 104467 |
| 569 | Ga0207428_10039490 | 3300027907 | Bacteria | 3833 |
| 570 | Ga0207428_10061338 | 3300027907 | Bacteria | 2978 |
| 571 | Ga0268266_10001049 | 3300028379 | Bacteria | 34622 |
| 572 | Ga0268266_10001217 | 3300028379 | Bacteria | 31646 |
| 573 | Ga0268266_10003843 | 3300028379 | Bacteria | 14661 |
| 574 | Ga0268266_10006228 | 3300028379 | Bacteria | 10954 |
| 575 | Ga0268266_10007906 | 3300028379 | Bacteria | 9521 |
| 576 | Ga0268266_10026479 | 3300028379 | Bacteria | 4934 |
| 577 | Ga0268265_10000246 | 3300028380 | Bacteria | 61853 |
| 578 | Ga0268265_10037023 | 3300028380 | Bacteria | 3577 |
| 579 | Ga0268264_10000187 | 3300028381 | Bacteria | 129270 |
| 580 | Ga0268264_10000232 | 3300028381 | Bacteria | 107399 |
| 581 | Ga0268264_10003098 | 3300028381 | Bacteria | 14393 |
| 582 | Ga0268264_10031183 | 3300028381 | Bacteria | 4370 |
| 583 | Ga0265337_1000506 | 3300028556 | Bacteria | 20742 |
| 584 | Ga0265334_10002104 | 3300028573 | Bacteria | 9404 |
| 585 | Ga0265334_10007245 | 3300028573 | Bacteria | 4758 |
| 586 | Ga0265323_10005048 | 3300028653 | Bacteria | 5636 |
| 587 | Ga0265336_10004816 | 3300028666 | Bacteria | 5055 |
| 588 | Ga0307517_10000066 | 3300028786 | Bacteria | 141370 |
| 589 | Ga0265338_10000973 | 3300028800 | Bacteria | 48208 |
| 590 | Ga0268256_1000273 | 3300030500 | Bacteria | 53445 |
| 591 | Ga0268256_1000278 | 3300030500 | Bacteria | 53027 |
| 592 | Ga0316178_1102168 | 3300030735 | Bacteria | 42019 |
| 593 | Ga0316181_1018381 | 3300030744 | Bacteria | 4565 |
| 594 | Ga0265330_10009710 | 3300031235 | Bacteria | 4559 |
| 595 | Ga0265330_10024206 | 3300031235 | Bacteria | 2754 |
| 596 | Ga0265332_10000730 | 3300031238 | Bacteria | 20533 |
| 597 | Ga0265332_10003203 | 3300031238 | Bacteria | 7967 |
| 598 | Ga0265332_10010155 | 3300031238 | Bacteria | 4192 |
| 599 | Ga0265328_10000008 | 3300031239 | Bacteria | 208282 |
| 600 | Ga0265328_10003910 | 3300031239 | Bacteria | 6552 |
| 601 | Ga0265325_10002761 | 3300031241 | Bacteria | 11731 |
| 602 | Ga0265340_10002240 | 3300031247 | Bacteria | 11048 |
| 603 | Ga0265339_10002540 | 3300031249 | Bacteria | 13011 |
| 604 | Ga0265331_10000038 | 3300031250 | Bacteria | 196951 |
| 605 | Ga0265331_10001798 | 3300031250 | Bacteria | 15260 |
| 606 | Ga0265327_10007946 | 3300031251 | Bacteria | 8028 |
| 607 | Ga0265316_10000387 | 3300031344 | Bacteria | 50269 |
| 608 | Ga0307513_10005099 | 3300031456 | Bacteria | 17386 |
| 609 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 610 | Ga0307408_100028865 | 3300031548 | Bacteria | 3837 |
| 611 | Ga0265313_10000223 | 3300031595 | Bacteria | 61143 |
| 612 | Ga0307508_10000613 | 3300031616 | Bacteria | 42773 |
| 613 | Ga0265314_10008057 | 3300031711 | Bacteria | 9069 |
| 614 | Ga0265314_10022262 | 3300031711 | Bacteria | 4856 |
| 615 | Ga0265342_10000308 | 3300031712 | Bacteria | 55378 |
| 616 | Ga0307516_10012541 | 3300031730 | Bacteria | 9124 |
| 617 | Ga0307410_10027576 | 3300031852 | Bacteria | 3591 |
| 618 | Ga0307411_10021448 | 3300032005 | Bacteria | 3781 |
| 619 | Ga0307411_10043985 | 3300032005 | Bacteria | 2860 |
| 620 | Ga0307510_10011043 | 3300033180 | Bacteria | 10735 |
| 621 | Ga0307510_10014026 | 3300033180 | Bacteria | 9488 |
| 622 | Ga0307510_10016531 | 3300033180 | Bacteria | 8708 |
| 623 | Ga0307510_10031045 | 3300033180 | Bacteria | 6043 |
| 624 | Ga0315911_1000024 | 3300033442 | Bacteria | 97712 |
| 625 | Ga0373934_0003933 | 3300035086 | Bacteria | 5460 |
| 626 | Ga0373936_0001548 | 3300035113 | Bacteria | 8369 |
| 627 | Ga0373941_0000462 | 3300035115 | Bacteria | 8113 |
| 628 | Ga0373945_0013387 | 3300035116 | Bacteria | 2736 |
| 629 | Ga0373953_0008441 | 3300035117 | Bacteria | 3499 |
| 630 | Ga0373954_0000471 | 3300035118 | Bacteria | 15110 |
| 631 | Ga0373954_0002347 | 3300035118 | Bacteria | 7908 |
| 632 | Ga0373957_0003107 | 3300035120 | Bacteria | 4846 |
| 633 | Ga0373924_0011467 | 3300035410 | Bacteria | 3292 |
| 634 | Ga0373935_0019326 | 3300035692 | Bacteria | 4155 |
| 635 | Ga0373927_0007892 | 3300035695 | Bacteria | 7193 |
| 636 | Ga0373927_0009614 | 3300035695 | Bacteria | 6485 |
| 637 | Ga0373927_0021704 | 3300035695 | Bacteria | 4207 |
| 638 | Ga0373933_0000915 | 3300035724 | Bacteria | 18020 |
| 639 | Ga0373947_0003547 | 3300035725 | Bacteria | 9210 |
| 640 | Ga0373947_0027058 | 3300035725 | Bacteria | 3355 |
| 641 | Ga0373937_0023179 | 3300036401 | Bacteria | 5588 |
| 642 | Ga0316584_0065528 | 3300036712 | Bacteria | 2721 |
| 643 | Ga0373925_0007117 | 3300037068 | Bacteria | 8178 |
| 644 | Ga0373925_0019996 | 3300037068 | Bacteria | 4871 |
| 645 | Ga0395900_0014639 | 3300037418 | Bacteria | 7999 |
| 646 | Ga0395898_0004776 | 3300037466 | Bacteria | 14745 |
| 647 | Ga0395898_0036586 | 3300037466 | Bacteria | 4874 |
| 648 | Ga0395898_0049242 | 3300037466 | Bacteria | 4129 |
| 649 | Ga0395905_0011164 | 3300037471 | Bacteria | 8685 |
| 650 | Ga0436364_0348338 | 3300037853 | Bacteria | 9011 |
| 651 | Ga0436364_0943018 | 3300037853 | Bacteria | 6542 |
| 652 | Ga0436364_1171513 | 3300037853 | Bacteria | 122046 |
| 653 | Ga0436364_1345588 | 3300037853 | Bacteria | 129670 |
| 654 | Ga0395901_0101157 | 3300038443 | Bacteria | 3025 |
| 655 | Ga0400483_231204 | 3300039062 | Bacteria | 8864 |
| 656 | Ga0436365_0957972 | 3300039437 | Bacteria | 5462 |
| 657 | Ga0436365_1045032 | 3300039437 | Bacteria | 24410 |
| 658 | Ga0436365_1910924 | 3300039437 | Bacteria | 11762 |
| 659 | Ga0436361_0615393 | 3300039447 | Bacteria | 3183 |
| 660 | Ga0436363_0711625 | 3300039450 | Bacteria | 8825 |
| 661 | Ga0436363_0726746 | 3300039450 | Bacteria | 4442 |
| 662 | Ga0436363_1463967 | 3300039450 | Bacteria | 16945 |
| 663 | Ga0436362_0841994 | 3300039453 | Bacteria | 4099 |
| 664 | Ga0439436_0000952 | 3300041404 | Bacteria | 7978 |
| 665 | Ga0439438_001868 | 3300041405 | Bacteria | 9216 |
| 666 | Ga0439438_001970 | 3300041405 | Bacteria | 8973 |
| 667 | Ga0439438_006265 | 3300041405 | Bacteria | 4228 |
| 668 | Ga0439438_011272 | 3300041405 | Bacteria | 2791 |
| 669 | Ga0439447_006383 | 3300041407 | Bacteria | 3834 |
| 670 | Ga0439466_0001535 | 3300041411 | Bacteria | 9020 |
| 671 | Ga0439466_0003548 | 3300041411 | Bacteria | 6031 |
| 672 | Ga0439466_0006413 | 3300041411 | Bacteria | 4471 |
| 673 | Ga0439466_0007342 | 3300041411 | Bacteria | 4174 |
| 674 | Ga0439432_000775 | 3300042006 | Bacteria | 11997 |
| 675 | Ga0439432_001464 | 3300042006 | Bacteria | 8860 |
| 676 | Ga0439452_000786 | 3300042010 | Bacteria | 15052 |
| 677 | Ga0439452_000858 | 3300042010 | Bacteria | 14069 |
| 678 | Ga0439452_000882 | 3300042010 | Bacteria | 13826 |
| 679 | Ga0439456_001355 | 3300042013 | Bacteria | 4892 |
| 680 | Ga0439463_000059 | 3300042016 | Bacteria | 23483 |
| 681 | Ga0450911_000004 | 3300042115 | Bacteria | 234537 |
| 682 | Ga0450911_000355 | 3300042115 | Bacteria | 15573 |
| 683 | Ga0450902_001778 | 3300042137 | Bacteria | 2978 |
| 684 | Ga0450904_000009 | 3300042139 | Bacteria | 43388 |
| 685 | Ga0450905_000464 | 3300042142 | Bacteria | 4957 |
| 686 | Ga0450905_000945 | 3300042142 | Bacteria | 3648 |
| 687 | Ga0450907_000601 | 3300042146 | Bacteria | 9590 |
| 688 | Ga0450910_000437 | 3300042147 | Bacteria | 4909 |
| 689 | Ga0439464_0005557 | 3300042439 | Bacteria | 3265 |
| 690 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 691 | Ga0451577_0000028 | 3300042876 | Bacteria | 395361 |
| 692 | Ga0466972_0000264 | 3300044658 | Bacteria | 33879 |
| 693 | Ga0453683_0008346 | 3300044673 | Bacteria | 6955 |
| 694 | Ga0466966_0002003 | 3300044684 | Bacteria | 13212 |
| 695 | Ga0466961_0001950 | 3300044693 | Bacteria | 12859 |
| 696 | Ga0466963_0018905 | 3300044694 | Bacteria | 4315 |
| 697 | Ga0453684_0000190 | 3300044712 | Bacteria | 269203 |
| 698 | Ga0453684_0000390 | 3300044712 | Bacteria | 180365 |
| 699 | Ga0453684_0001014 | 3300044712 | Bacteria | 90517 |
| 700 | Ga0453684_0002558 | 3300044712 | Bacteria | 43721 |
| 701 | Ga0466957_0031560 | 3300044842 | Bacteria | 3167 |
| 702 | Ga0466959_0046208 | 3300045049 | Bacteria | 3204 |
| 703 | Ga0451576_0000852 | 3300045051 | Bacteria | 59207 |
| 704 | Ga0466958_0011628 | 3300045836 | Bacteria | 4962 |
| 705 | Ga0495617_000455 | 3300046452 | Bacteria | 22035 |
| 706 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 707 | Ga0495627_000774 | 3300046453 | Bacteria | 23729 |
| 708 | Ga0495627_002193 | 3300046453 | Bacteria | 9734 |
| 709 | Ga0495627_006533 | 3300046453 | Bacteria | 4562 |
| 710 | Ga0495592_0020318 | 3300046454 | Bacteria | 5052 |
| 711 | Ga0495603_0003090 | 3300046455 | Bacteria | 9886 |
| 712 | Ga0495603_0011291 | 3300046455 | Bacteria | 5411 |
| 713 | Ga0495590_0008010 | 3300046457 | Bacteria | 4053 |
| 714 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 715 | Ga0495591_000668 | 3300046458 | Bacteria | 25300 |
| 716 | Ga0495591_001374 | 3300046458 | Bacteria | 15248 |
| 717 | Ga0495591_002991 | 3300046458 | Bacteria | 9023 |
| 718 | Ga0495591_003186 | 3300046458 | Bacteria | 8654 |
| 719 | Ga0495591_003225 | 3300046458 | Bacteria | 8583 |
| 720 | Ga0495591_006806 | 3300046458 | Bacteria | 4975 |
| 721 | Ga0495591_013521 | 3300046458 | Bacteria | 2978 |
| 722 | Ga0495629_0000151 | 3300046459 | Bacteria | 60632 |
| 723 | Ga0495629_0003854 | 3300046459 | Bacteria | 11309 |
| 724 | Ga0495638_0005305 | 3300046460 | Bacteria | 9619 |
| 725 | Ga0495638_0006494 | 3300046460 | Bacteria | 8503 |
| 726 | Ga0495638_0032114 | 3300046460 | Bacteria | 3368 |
| 727 | Ga0495651_0005755 | 3300046462 | Bacteria | 9453 |
| 728 | Ga0495651_0029501 | 3300046462 | Bacteria | 4278 |
| 729 | Ga0495651_0060342 | 3300046462 | Bacteria | 2905 |
| 730 | Ga0495653_0001308 | 3300046463 | Bacteria | 19293 |
| 731 | Ga0495653_0024403 | 3300046463 | Bacteria | 4873 |
| 732 | Ga0495653_0031130 | 3300046463 | Bacteria | 4242 |
| 733 | Ga0495650_0001958 | 3300046471 | Bacteria | 18190 |
| 734 | Ga0495650_0006161 | 3300046471 | Bacteria | 7539 |
| 735 | Ga0495650_0011367 | 3300046471 | Bacteria | 4882 |
| 736 | Ga0495582_0000218 | 3300046473 | Bacteria | 31814 |
| 737 | Ga0495582_0003858 | 3300046473 | Bacteria | 8439 |
| 738 | Ga0495605_0000095 | 3300046474 | Bacteria | 112622 |
| 739 | Ga0495605_0000210 | 3300046474 | Bacteria | 71875 |
| 740 | Ga0495605_0000677 | 3300046474 | Bacteria | 25677 |
| 741 | Ga0495605_0000927 | 3300046474 | Bacteria | 20060 |
| 742 | Ga0495605_0006722 | 3300046474 | Bacteria | 6577 |
| 743 | Ga0495639_0001263 | 3300046475 | Bacteria | 11392 |
| 744 | Ga0495639_0002288 | 3300046475 | Bacteria | 8396 |
| 745 | Ga0495662_0000275 | 3300046476 | Bacteria | 22031 |
| 746 | Ga0495664_0005513 | 3300046477 | Bacteria | 6951 |
| 747 | Ga0495664_0005666 | 3300046477 | Bacteria | 6871 |
| 748 | Ga0495664_0018049 | 3300046477 | Bacteria | 4035 |
| 749 | Ga0495664_0029990 | 3300046477 | Bacteria | 3184 |
| 750 | Ga0495584_0003049 | 3300046491 | Bacteria | 9300 |
| 751 | Ga0495584_0003944 | 3300046491 | Bacteria | 8021 |
| 752 | Ga0495584_0014091 | 3300046491 | Bacteria | 4074 |
| 753 | Ga0495585_0004764 | 3300046492 | Bacteria | 8731 |
| 754 | Ga0495585_0004972 | 3300046492 | Bacteria | 8500 |
| 755 | Ga0495585_0008391 | 3300046492 | Bacteria | 6265 |
| 756 | Ga0495585_0036910 | 3300046492 | Bacteria | 2753 |
| 757 | Ga0495594_0001418 | 3300046499 | Bacteria | 12441 |
| 758 | Ga0495596_0000545 | 3300046500 | Bacteria | 23624 |
| 759 | Ga0495596_0002377 | 3300046500 | Bacteria | 10178 |
| 760 | Ga0495607_0000069 | 3300046501 | Bacteria | 101754 |
| 761 | Ga0495607_0000673 | 3300046501 | Bacteria | 33089 |
| 762 | Ga0495607_0001262 | 3300046501 | Bacteria | 22625 |
| 763 | Ga0495607_0001270 | 3300046501 | Bacteria | 22565 |
| 764 | Ga0495607_0002719 | 3300046501 | Bacteria | 14112 |
| 765 | Ga0495607_0004514 | 3300046501 | Bacteria | 10214 |
| 766 | Ga0495607_0007059 | 3300046501 | Bacteria | 7811 |
| 767 | Ga0495607_0018106 | 3300046501 | Bacteria | 4499 |
| 768 | Ga0495607_0023960 | 3300046501 | Bacteria | 3813 |
| 769 | Ga0495607_0027869 | 3300046501 | Bacteria | 3487 |
| 770 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 771 | Ga0495583_0000779 | 3300046506 | Bacteria | 39867 |
| 772 | Ga0495583_0009541 | 3300046506 | Bacteria | 5784 |
| 773 | Ga0495606_0000447 | 3300046507 | Bacteria | 67335 |
| 774 | Ga0495606_0000453 | 3300046507 | Bacteria | 67136 |
| 775 | Ga0495606_0003923 | 3300046507 | Bacteria | 15309 |
| 776 | Ga0495606_0008979 | 3300046507 | Bacteria | 8551 |
| 777 | Ga0495606_0009017 | 3300046507 | Bacteria | 8526 |
| 778 | Ga0495606_0012643 | 3300046507 | Bacteria | 6742 |
| 779 | Ga0495606_0013024 | 3300046507 | Bacteria | 6610 |
| 780 | Ga0495606_0026931 | 3300046507 | Bacteria | 4084 |
| 781 | Ga0495610_0005104 | 3300046512 | Bacteria | 9444 |
| 782 | Ga0495610_0006937 | 3300046512 | Bacteria | 7667 |
| 783 | Ga0495610_0007026 | 3300046512 | Bacteria | 7607 |
| 784 | Ga0495610_0014582 | 3300046512 | Bacteria | 4609 |
| 785 | Ga0495616_0005043 | 3300046513 | Bacteria | 8215 |
| 786 | Ga0495616_0015427 | 3300046513 | Bacteria | 4249 |
| 787 | Ga0495620_0000042 | 3300046515 | Bacteria | 112107 |
| 788 | Ga0495620_0000146 | 3300046515 | Bacteria | 57888 |
| 789 | Ga0495620_0000422 | 3300046515 | Bacteria | 28117 |
| 790 | Ga0495620_0001025 | 3300046515 | Bacteria | 17183 |
| 791 | Ga0495631_0001255 | 3300046518 | Bacteria | 15676 |
| 792 | Ga0495631_0005285 | 3300046518 | Bacteria | 6781 |
| 793 | Ga0495631_0033636 | 3300046518 | Bacteria | 2301 |
| 794 | Ga0495632_0001743 | 3300046519 | Bacteria | 17635 |
| 795 | Ga0495632_0004240 | 3300046519 | Bacteria | 9796 |
| 796 | Ga0495632_0004428 | 3300046519 | Bacteria | 9547 |
| 797 | Ga0495632_0013905 | 3300046519 | Bacteria | 4573 |
| 798 | Ga0495637_0000682 | 3300046520 | Bacteria | 23481 |
| 799 | Ga0495637_0002317 | 3300046520 | Bacteria | 10534 |
| 800 | Ga0495637_0002721 | 3300046520 | Bacteria | 9633 |
| 801 | Ga0495637_0002917 | 3300046520 | Bacteria | 9236 |
| 802 | Ga0495637_0004370 | 3300046520 | Bacteria | 7333 |
| 803 | Ga0495637_0011231 | 3300046520 | Bacteria | 4309 |
| 804 | Ga0495637_0011386 | 3300046520 | Bacteria | 4274 |
| 805 | Ga0495637_0014482 | 3300046520 | Bacteria | 3721 |
| 806 | Ga0495637_0016000 | 3300046520 | Bacteria | 3512 |
| 807 | Ga0495643_0000291 | 3300046522 | Bacteria | 71440 |
| 808 | Ga0495643_0015422 | 3300046522 | Bacteria | 4515 |
| 809 | Ga0495643_0016513 | 3300046522 | Bacteria | 4336 |
| 810 | Ga0495643_0019980 | 3300046522 | Bacteria | 3869 |
| 811 | Ga0495648_0000581 | 3300046524 | Bacteria | 39115 |
| 812 | Ga0495648_0003184 | 3300046524 | Bacteria | 14604 |
| 813 | Ga0495648_0005967 | 3300046524 | Bacteria | 10017 |
| 814 | Ga0495648_0006246 | 3300046524 | Bacteria | 9747 |
| 815 | Ga0495648_0008715 | 3300046524 | Bacteria | 7945 |
| 816 | Ga0495648_0008856 | 3300046524 | Bacteria | 7872 |
| 817 | Ga0495648_0013653 | 3300046524 | Bacteria | 5989 |
| 818 | Ga0495648_0015287 | 3300046524 | Bacteria | 5581 |
| 819 | Ga0495648_0033685 | 3300046524 | Bacteria | 3342 |
| 820 | Ga0495642_0000662 | 3300046528 | Bacteria | 17247 |
| 821 | Ga0495652_0017151 | 3300046529 | Bacteria | 6466 |
| 822 | Ga0495652_0017750 | 3300046529 | Bacteria | 6351 |
| 823 | Ga0495652_0025015 | 3300046529 | Bacteria | 5283 |
| 824 | Ga0495654_0002507 | 3300046530 | Bacteria | 11794 |
| 825 | Ga0495654_0002748 | 3300046530 | Bacteria | 11095 |
| 826 | Ga0495654_0003902 | 3300046530 | Bacteria | 9009 |
| 827 | Ga0495654_0005124 | 3300046530 | Bacteria | 7656 |
| 828 | Ga0495654_0011853 | 3300046530 | Bacteria | 4704 |
| 829 | Ga0495654_0012016 | 3300046530 | Bacteria | 4666 |
| 830 | Ga0495654_0031443 | 3300046530 | Bacteria | 2694 |
| 831 | Ga0495665_0000163 | 3300046531 | Bacteria | 33358 |
| 832 | Ga0495640_0014322 | 3300046533 | Bacteria | 6004 |
| 833 | Ga0495587_0011173 | 3300046536 | Bacteria | 5695 |
| 834 | Ga0495587_0029971 | 3300046536 | Bacteria | 3301 |
| 835 | Ga0495609_0000053 | 3300046538 | Bacteria | 149126 |
| 836 | Ga0495609_0000133 | 3300046538 | Bacteria | 79787 |
| 837 | Ga0495609_0000283 | 3300046538 | Bacteria | 46879 |
| 838 | Ga0495609_0004006 | 3300046538 | Bacteria | 8224 |
| 839 | Ga0495609_0019392 | 3300046538 | Bacteria | 3147 |
| 840 | Ga0495597_0000229 | 3300046542 | Bacteria | 50600 |
| 841 | Ga0495597_0002956 | 3300046542 | Bacteria | 10300 |
| 842 | Ga0495645_0018664 | 3300046543 | Bacteria | 4985 |
| 843 | Ga0495645_0019601 | 3300046543 | Bacteria | 4870 |
| 844 | Ga0495645_0019829 | 3300046543 | Bacteria | 4845 |
| 845 | Ga0495622_0001532 | 3300046557 | Bacteria | 11519 |
| 846 | Ga0495633_0000115 | 3300046558 | Bacteria | 108676 |
| 847 | Ga0495667_0010071 | 3300046559 | Bacteria | 6401 |
| 848 | Ga0495668_0005524 | 3300046616 | Bacteria | 8523 |
| 849 | Ga0495668_0005672 | 3300046616 | Bacteria | 8364 |
| 850 | Ga0495668_0037455 | 3300046616 | Bacteria | 2713 |
| 851 | Ga0495634_0000460 | 3300046642 | Bacteria | 40242 |
| 852 | Ga0495634_0008719 | 3300046642 | Bacteria | 7520 |
| 853 | Ga0495611_0001987 | 3300046648 | Bacteria | 9695 |
| 854 | Ga0495625_0000086 | 3300046660 | Bacteria | 151735 |
| 855 | Ga0495625_0008159 | 3300046660 | Bacteria | 8969 |
| 856 | Ga0495625_0010636 | 3300046660 | Bacteria | 7588 |
| 857 | Ga0495625_0019236 | 3300046660 | Bacteria | 5304 |
| 858 | Ga0495635_0000220 | 3300046663 | Bacteria | 36107 |
| 859 | Ga0495635_0004179 | 3300046663 | Bacteria | 10018 |
| 860 | Ga0495635_0010274 | 3300046663 | Bacteria | 6545 |
| 861 | Ga0495659_0000820 | 3300046664 | Bacteria | 11054 |
| 862 | Ga0495661_0000212 | 3300046665 | Bacteria | 67078 |
| 863 | Ga0495661_0000346 | 3300046665 | Bacteria | 50529 |
| 864 | Ga0495661_0001033 | 3300046665 | Bacteria | 24720 |
| 865 | Ga0495661_0001808 | 3300046665 | Bacteria | 17152 |
| 866 | Ga0495661_0002096 | 3300046665 | Bacteria | 15649 |
| 867 | Ga0495661_0004232 | 3300046665 | Bacteria | 10429 |
| 868 | Ga0495661_0006792 | 3300046665 | Bacteria | 8022 |
| 869 | Ga0495661_0018066 | 3300046665 | Bacteria | 4644 |
| 870 | Ga0495661_0019490 | 3300046665 | Bacteria | 4444 |
| 871 | Ga0495661_0033117 | 3300046665 | Bacteria | 3261 |
| 872 | Ga0495588_0011868 | 3300046674 | Bacteria | 4101 |
| 873 | Ga0495657_0008639 | 3300046675 | Bacteria | 7772 |
| 874 | Ga0495657_0035214 | 3300046675 | Bacteria | 3471 |
| 875 | Ga0495599_0001306 | 3300046678 | Bacteria | 14176 |
| 876 | Ga0495623_0014332 | 3300046679 | Bacteria | 5132 |
| 877 | Ga0495646_0016370 | 3300046680 | Bacteria | 4705 |
| 878 | Ga0495646_0030360 | 3300046680 | Bacteria | 3375 |
| 879 | Ga0495647_0000198 | 3300046681 | Bacteria | 16065 |
| 880 | Ga0495658_0004750 | 3300046683 | Bacteria | 6671 |
| 881 | Ga0495669_0004199 | 3300046684 | Bacteria | 5927 |
| 882 | Ga0495624_0001125 | 3300046690 | Bacteria | 21160 |
| 883 | Ga0495624_0017858 | 3300046690 | Bacteria | 4754 |
| 884 | Ga0495671_0000835 | 3300046692 | Bacteria | 22013 |
| 885 | Ga0495671_0001729 | 3300046692 | Bacteria | 14173 |
| 886 | Ga0495671_0003942 | 3300046692 | Bacteria | 9001 |
| 887 | Ga0495671_0004570 | 3300046692 | Bacteria | 8233 |
| 888 | Ga0495671_0004646 | 3300046692 | Bacteria | 8137 |
| 889 | Ga0495671_0005715 | 3300046692 | Bacteria | 7251 |
| 890 | Ga0495671_0017444 | 3300046692 | Bacteria | 3822 |
| 891 | Ga0495649_0001824 | 3300046694 | Bacteria | 15645 |
| 892 | Ga0495649_0003218 | 3300046694 | Bacteria | 11152 |
| 893 | Ga0495649_0004772 | 3300046694 | Bacteria | 8784 |
| 894 | Ga0495649_0009899 | 3300046694 | Bacteria | 5639 |
| 895 | Ga0495649_0014957 | 3300046694 | Bacteria | 4432 |
| 896 | Ga0495649_0027064 | 3300046694 | Bacteria | 3182 |
| 897 | Ga0495589_0000918 | 3300046794 | Bacteria | 18098 |
| 898 | Ga0495589_0008535 | 3300046794 | Bacteria | 5342 |
| 899 | Ga0495600_0001974 | 3300046809 | Bacteria | 11534 |
| 900 | Ga0495600_0004746 | 3300046809 | Bacteria | 8153 |
| 901 | Ga0495600_0016566 | 3300046809 | Bacteria | 4681 |
| 902 | Ga0495600_0023155 | 3300046809 | Bacteria | 3994 |
| 903 | Ga0495660_0003154 | 3300046810 | Bacteria | 10267 |
| 904 | Ga0495660_0005301 | 3300046810 | Bacteria | 7722 |
| 905 | Ga0495660_0015068 | 3300046810 | Bacteria | 4470 |
| 906 | Ga0495660_0018836 | 3300046810 | Bacteria | 3963 |
| 907 | Ga0495660_0031101 | 3300046810 | Bacteria | 3003 |
| 908 | Ga0495581_0000291 | 3300047315 | Bacteria | 24325 |
| 909 | Ga0495581_0024438 | 3300047315 | Bacteria | 3501 |
| 910 | Ga0495604_0007232 | 3300047317 | Bacteria | 8790 |
| 911 | Ga0495604_0014146 | 3300047317 | Bacteria | 6363 |
| 912 | Ga0495604_0031685 | 3300047317 | Bacteria | 4193 |
| 913 | Ga0495604_0048267 | 3300047317 | Bacteria | 3312 |
| 914 | Ga0495674_0000664 | 3300047319 | Bacteria | 32284 |
| 915 | Ga0495674_0001989 | 3300047319 | Bacteria | 20095 |
| 916 | Ga0495674_0056283 | 3300047319 | Bacteria | 3445 |
| 917 | Ga0495672_0003884 | 3300047320 | Bacteria | 12561 |
| 918 | Ga0495672_0004098 | 3300047320 | Bacteria | 12155 |
| 919 | Ga0495672_0007315 | 3300047320 | Bacteria | 8326 |
| 920 | Ga0495672_0007556 | 3300047320 | Bacteria | 8157 |
| 921 | Ga0495672_0007891 | 3300047320 | Bacteria | 7940 |
| 922 | Ga0495672_0013420 | 3300047320 | Bacteria | 5654 |
| 923 | Ga0495672_0024326 | 3300047320 | Bacteria | 3904 |
| 924 | Ga0495676_0000022 | 3300047321 | Bacteria | 163719 |
| 925 | Ga0495676_0009309 | 3300047321 | Bacteria | 8953 |
| 926 | Ga0495676_0013537 | 3300047321 | Bacteria | 7331 |
| 927 | Ga0495680_0002433 | 3300047322 | Bacteria | 19048 |
| 928 | Ga0495680_0014855 | 3300047322 | Bacteria | 6731 |
| 929 | Ga0495680_0032392 | 3300047322 | Bacteria | 4243 |
| 930 | Ga0495680_0032827 | 3300047322 | Bacteria | 4209 |
| 931 | Ga0495680_0052704 | 3300047322 | Bacteria | 3170 |
| 932 | Ga0495683_0000030 | 3300047323 | Bacteria | 150551 |
| 933 | Ga0495683_0000586 | 3300047323 | Bacteria | 27461 |
| 934 | Ga0495683_0003253 | 3300047323 | Bacteria | 9496 |
| 935 | Ga0495683_0003911 | 3300047323 | Bacteria | 8567 |
| 936 | Ga0495683_0015622 | 3300047323 | Bacteria | 3946 |
| 937 | Ga0495687_004182 | 3300047443 | Bacteria | 9913 |
| 938 | Ga0495687_004249 | 3300047443 | Bacteria | 9814 |
| 939 | Ga0495675_0003482 | 3300047444 | Bacteria | 9478 |
| 940 | Ga0495675_0004129 | 3300047444 | Bacteria | 8797 |
| 941 | Ga0495675_0016335 | 3300047444 | Bacteria | 4696 |
| 942 | Ga0495679_000212 | 3300047446 | Bacteria | 49948 |
| 943 | Ga0495679_000341 | 3300047446 | Bacteria | 36651 |
| 944 | Ga0495679_003057 | 3300047446 | Bacteria | 8221 |
| 945 | Ga0495673_0001151 | 3300047469 | Bacteria | 22526 |
| 946 | Ga0495673_0001296 | 3300047469 | Bacteria | 20380 |
| 947 | Ga0495673_0004054 | 3300047469 | Bacteria | 9334 |
| 948 | Ga0495673_0005337 | 3300047469 | Bacteria | 7793 |
| 949 | Ga0495673_0006078 | 3300047469 | Bacteria | 7169 |
| 950 | Ga0495673_0006250 | 3300047469 | Bacteria | 7037 |
| 951 | Ga0495673_0013803 | 3300047469 | Bacteria | 4222 |
| 952 | Ga0495673_0023377 | 3300047469 | Bacteria | 3007 |
| 953 | Ga0495681_0004759 | 3300047470 | Bacteria | 9198 |
| 954 | Ga0495681_0006405 | 3300047470 | Bacteria | 7744 |
| 955 | Ga0495681_0026787 | 3300047470 | Bacteria | 2993 |
| 956 | Ga0495684_0000133 | 3300047471 | Bacteria | 54433 |
| 957 | Ga0495684_0020926 | 3300047471 | Bacteria | 5040 |
| 958 | Ga0495686_0058827 | 3300047472 | Bacteria | 2395 |
| 959 | Ga0495593_0000323 | 3300047673 | Bacteria | 26455 |
| 960 | Ga0495602_0049834 | 3300048088 | Bacteria | 3747 |
| 961 | Ga0495602_0054440 | 3300048088 | Bacteria | 3532 |
| 962 | Ga0495602_0058139 | 3300048088 | Bacteria | 3387 |
| 963 | Ga0495626_0000039 | 3300048091 | Bacteria | 175454 |
| 964 | Ga0495626_0000242 | 3300048091 | Bacteria | 63298 |
| 965 | Ga0495626_0001832 | 3300048091 | Bacteria | 15978 |
| 966 | Ga0495626_0003058 | 3300048091 | Bacteria | 10981 |
| 967 | Ga0495626_0004652 | 3300048091 | Bacteria | 8335 |
| 968 | Ga0495626_0004671 | 3300048091 | Bacteria | 8312 |
| 969 | Ga0495626_0018915 | 3300048091 | Bacteria | 3448 |
| 970 | Ga0496102_0002921 | 3300048905 | Bacteria | 14497 |
| 971 | Ga0496102_0025012 | 3300048905 | Bacteria | 5311 |
| 972 | Ga0496102_0029706 | 3300048905 | Bacteria | 4891 |
| 973 | Ga0496104_0002055 | 3300048907 | Bacteria | 17481 |
| 974 | Ga0496104_0002496 | 3300048907 | Bacteria | 15827 |
| 975 | Ga0496104_0012404 | 3300048907 | Bacteria | 7663 |
| 976 | Ga0496104_0014417 | 3300048907 | Bacteria | 7142 |
| 977 | Ga0496104_0026955 | 3300048907 | Bacteria | 5313 |
| 978 | Ga0496104_0028265 | 3300048907 | Bacteria | 5197 |
| 979 | Ga0496105_0000745 | 3300048908 | Bacteria | 22090 |
| 980 | Ga0496105_0009357 | 3300048908 | Bacteria | 7660 |
| 981 | Ga0496105_0012772 | 3300048908 | Bacteria | 6653 |
| 982 | Ga0496105_0041847 | 3300048908 | Bacteria | 3776 |
| 983 | Ga0496106_0004350 | 3300048909 | Bacteria | 10522 |
| 984 | Ga0496106_0014763 | 3300048909 | Bacteria | 5775 |
| 985 | Ga0496107_0003866 | 3300048910 | Bacteria | 10066 |
| 986 | Ga0496107_0007228 | 3300048910 | Bacteria | 7650 |
| 987 | Ga0496107_0055542 | 3300048910 | Bacteria | 2860 |
| 988 | Ga0496108_0000442 | 3300048911 | Bacteria | 33309 |
| 989 | Ga0496108_0001557 | 3300048911 | Bacteria | 18155 |
| 990 | Ga0496108_0010081 | 3300048911 | Bacteria | 7665 |
| 991 | Ga0496109_0001341 | 3300048912 | Bacteria | 20342 |
| 992 | Ga0496109_0022776 | 3300048912 | Bacteria | 5550 |
| 993 | Ga0496110_0014426 | 3300048913 | Bacteria | 6561 |
| 994 | Ga0496110_0019399 | 3300048913 | Bacteria | 5720 |
| 995 | Ga0496110_0025213 | 3300048913 | Bacteria | 5078 |
| 996 | Ga0496110_0026026 | 3300048913 | Bacteria | 5003 |
| 997 | Ga0496110_0036712 | 3300048913 | Bacteria | 4257 |
| 998 | Ga0496111_0028481 | 3300048914 | Bacteria | 3959 |
| 999 | Ga0496112_0000051 | 3300048915 | Bacteria | 82351 |
| 1000 | Ga0496112_0000655 | 3300048915 | Bacteria | 24037 |
| 1001 | Ga0496112_0030907 | 3300048915 | Bacteria | 5188 |
| 1002 | Ga0496113_0000982 | 3300048916 | Bacteria | 15219 |
| 1003 | Ga0496114_0007693 | 3300048917 | Bacteria | 8521 |
| 1004 | Ga0496114_0050155 | 3300048917 | Bacteria | 3474 |
| 1005 | Ga0496114_0078294 | 3300048917 | Bacteria | 2789 |
| 1006 | Ga0496115_0018715 | 3300048918 | Bacteria | 5324 |
| 1007 | Ga0496116_0000881 | 3300048919 | Bacteria | 37470 |
| 1008 | Ga0496116_0004615 | 3300048919 | Bacteria | 13063 |
| 1009 | Ga0496116_0005174 | 3300048919 | Bacteria | 12243 |
| 1010 | Ga0496116_0022410 | 3300048919 | Bacteria | 4732 |
| 1011 | Ga0496116_0027452 | 3300048919 | Bacteria | 4145 |
| 1012 | Ga0496117_0002861 | 3300048920 | Bacteria | 20985 |
| 1013 | Ga0496117_0008441 | 3300048920 | Bacteria | 9778 |
| 1014 | Ga0496117_0009463 | 3300048920 | Bacteria | 9063 |
| 1015 | Ga0496117_0029062 | 3300048920 | Bacteria | 4267 |
| 1016 | Ga0496117_0030174 | 3300048920 | Bacteria | 4164 |
| 1017 | Ga0496117_0041829 | 3300048920 | Bacteria | 3351 |
| 1018 | Ga0496118_0004108 | 3300048921 | Bacteria | 17620 |
| 1019 | Ga0496118_0009635 | 3300048921 | Bacteria | 9717 |
| 1020 | Ga0496118_0013389 | 3300048921 | Bacteria | 7763 |
| 1021 | Ga0496118_0024544 | 3300048921 | Bacteria | 5199 |
| 1022 | Ga0496118_0027349 | 3300048921 | Bacteria | 4829 |
| 1023 | Ga0496118_0045810 | 3300048921 | Bacteria | 3408 |
| 1024 | Ga0496119_0000060 | 3300048922 | Bacteria | 172646 |
| 1025 | Ga0496119_0002304 | 3300048922 | Bacteria | 21104 |
| 1026 | Ga0496119_0010712 | 3300048922 | Bacteria | 7685 |
| 1027 | Ga0496119_0022739 | 3300048922 | Bacteria | 4476 |
| 1028 | Ga0496119_0045531 | 3300048922 | Bacteria | 2749 |
| 1029 | Ga0496120_0003825 | 3300048923 | Bacteria | 13232 |
| 1030 | Ga0496121_0000144 | 3300048924 | Bacteria | 156856 |
| 1031 | Ga0496121_0001650 | 3300048924 | Bacteria | 36892 |
| 1032 | Ga0496121_0003740 | 3300048924 | Bacteria | 21314 |
| 1033 | Ga0496121_0007337 | 3300048924 | Bacteria | 13331 |
| 1034 | Ga0496121_0012757 | 3300048924 | Bacteria | 9102 |
| 1035 | Ga0496121_0013250 | 3300048924 | Bacteria | 8879 |
| 1036 | Ga0496121_0014564 | 3300048924 | Bacteria | 8331 |
| 1037 | Ga0496121_0014671 | 3300048924 | Bacteria | 8286 |
| 1038 | Ga0496121_0019695 | 3300048924 | Bacteria | 6731 |
| 1039 | Ga0496122_0001366 | 3300048925 | Bacteria | 39678 |
| 1040 | Ga0496122_0002897 | 3300048925 | Bacteria | 23445 |
| 1041 | Ga0496122_0005797 | 3300048925 | Bacteria | 14523 |
| 1042 | Ga0496122_0011268 | 3300048925 | Bacteria | 9082 |
| 1043 | Ga0496122_0034155 | 3300048925 | Bacteria | 4168 |
| 1044 | Ga0496122_0071400 | 3300048925 | Bacteria | 2475 |
| 1045 | Ga0496123_0001033 | 3300048926 | Bacteria | 42272 |
| 1046 | Ga0496123_0001703 | 3300048926 | Bacteria | 29387 |
| 1047 | Ga0496123_0013950 | 3300048926 | Bacteria | 6696 |
| 1048 | Ga0496124_0000120 | 3300048927 | Bacteria | 163899 |
| 1049 | Ga0496124_0010997 | 3300048927 | Bacteria | 9094 |
| 1050 | Ga0496124_0011914 | 3300048927 | Bacteria | 8653 |
| 1051 | Ga0496124_0021692 | 3300048927 | Bacteria | 5914 |
| 1052 | Ga0496124_0043648 | 3300048927 | Bacteria | 3853 |
| 1053 | Ga0496124_0047212 | 3300048927 | Bacteria | 3685 |
| 1054 | Ga0496124_0050045 | 3300048927 | Bacteria | 3562 |
| 1055 | Ga0496124_0065564 | 3300048927 | Bacteria | 3027 |
| 1056 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 1057 | Ga0496125_0003667 | 3300048928 | Bacteria | 18348 |
| 1058 | Ga0496125_0009550 | 3300048928 | Bacteria | 9944 |
| 1059 | Ga0496125_0010381 | 3300048928 | Bacteria | 9420 |
| 1060 | Ga0496125_0013483 | 3300048928 | Bacteria | 8029 |
| 1061 | Ga0496125_0021610 | 3300048928 | Bacteria | 5997 |
| 1062 | Ga0496125_0025971 | 3300048928 | Bacteria | 5350 |
| 1063 | Ga0496125_0031206 | 3300048928 | Bacteria | 4752 |
| 1064 | Ga0496126_0002484 | 3300048929 | Bacteria | 24807 |
| 1065 | Ga0496126_0026919 | 3300048929 | Bacteria | 5504 |
| 1066 | Ga0496126_0028855 | 3300048929 | Bacteria | 5280 |
| 1067 | Ga0496126_0054275 | 3300048929 | Bacteria | 3630 |
| 1068 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 1069 | Ga0495678_000238 | 3300049459 | Bacteria | 62224 |
| 1070 | Ga0495678_001946 | 3300049459 | Bacteria | 14952 |
| 1071 | Ga0495682_0001189 | 3300049460 | Bacteria | 14807 |
| 1072 | Ga0495682_0002650 | 3300049460 | Bacteria | 8362 |
| 1073 | Ga0501032_0000227 | 3300049569 | Bacteria | 46864 |
| 1074 | Ga0501032_0019020 | 3300049569 | Bacteria | 4806 |
| 1075 | Ga0501033_0004294 | 3300049570 | Bacteria | 11449 |
| 1076 | Ga0501033_0006907 | 3300049570 | Bacteria | 8861 |
| 1077 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 1078 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 1079 | Ga0501034_0000295 | 3300049571 | Bacteria | 88435 |
| 1080 | Ga0501034_0001845 | 3300049571 | Bacteria | 26903 |
| 1081 | Ga0501034_0047008 | 3300049571 | Bacteria | 4359 |
| 1082 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 1083 | Ga0501036_0000217 | 3300049572 | Bacteria | 38514 |
| 1084 | Ga0501037_0000183 | 3300049573 | Bacteria | 57879 |
| 1085 | Ga0501037_0016096 | 3300049573 | Bacteria | 5503 |
| 1086 | Ga0501038_0000054 | 3300049574 | Bacteria | 94123 |
| 1087 | Ga0501039_0000110 | 3300049575 | Bacteria | 55320 |
| 1088 | Ga0501039_0011119 | 3300049575 | Bacteria | 6861 |
| 1089 | Ga0501043_0000106 | 3300049579 | Bacteria | 77699 |
| 1090 | Ga0501043_0023015 | 3300049579 | Bacteria | 4886 |
| 1091 | Ga0501046_0004933 | 3300049580 | Bacteria | 11996 |
| 1092 | Ga0501047_0000363 | 3300049581 | Bacteria | 51477 |
| 1093 | Ga0501047_0000702 | 3300049581 | Bacteria | 34900 |
| 1094 | Ga0501047_0036630 | 3300049581 | Bacteria | 4742 |
| 1095 | Ga0501048_0000031 | 3300049582 | Bacteria | 65561 |
| 1096 | Ga0501048_0000456 | 3300049582 | Bacteria | 28577 |
| 1097 | Ga0501048_0052267 | 3300049582 | Bacteria | 2907 |
| 1098 | Ga0501067_0003366 | 3300049583 | Bacteria | 8788 |
| 1099 | Ga0501068_0005210 | 3300049584 | Bacteria | 7092 |
| 1100 | Ga0501070_0001016 | 3300049586 | Bacteria | 25196 |
| 1101 | Ga0501070_0033697 | 3300049586 | Bacteria | 4286 |
| 1102 | Ga0501072_0001530 | 3300049588 | Bacteria | 17298 |
| 1103 | Ga0501073_0000238 | 3300049589 | Bacteria | 36316 |
| 1104 | Ga0501074_0000259 | 3300049590 | Bacteria | 30031 |
| 1105 | Ga0501074_0031393 | 3300049590 | Bacteria | 3848 |
| 1106 | Ga0501079_0004438 | 3300049741 | Bacteria | 10393 |
| 1107 | Ga0501080_0000279 | 3300049742 | Bacteria | 38549 |
| 1108 | Ga0501083_0000550 | 3300049744 | Bacteria | 23969 |
| 1109 | Ga0501083_0001701 | 3300049744 | Bacteria | 14998 |
| 1110 | Ga0501035_0000817 | 3300049822 | Bacteria | 33190 |
| 1111 | Ga0501035_0008622 | 3300049822 | Bacteria | 9487 |
| 1112 | Ga0501044_0002385 | 3300049823 | Bacteria | 21410 |
| 1113 | Ga0501044_0009141 | 3300049823 | Bacteria | 10823 |
| 1114 | Ga0501044_0037223 | 3300049823 | Bacteria | 5087 |
| 1115 | Ga0501044_0039631 | 3300049823 | Bacteria | 4914 |
| 1116 | Ga0501226_000003 | 3300049853 | Bacteria | 358977 |
| 1117 | nmdc:mga03n38_25615_c1 | 3300050490 | Bacteria | 2425 |
| 1118 | nmdc:mga00v17_23809_c1 | 3300050491 | Bacteria | 3545 |
| 1119 | nmdc:mga00v17_28528_c1 | 3300050491 | Bacteria | 3269 |
| 1120 | nmdc:mga0yw44_1210_c1 | 3300050492 | Bacteria | 10107 |
| 1121 | nmdc:mga0yw44_7385_c1 | 3300050492 | Bacteria | 5403 |
| 1122 | nmdc:mga0k408_25096_c1 | 3300050493 | Bacteria | 3373 |
| 1123 | nmdc:mga07m45_2171_c1 | 3300050496 | Bacteria | 8803 |
| 1124 | nmdc:mga05p37_15019_c1 | 3300050507 | Bacteria | 9295 |
| 1125 | nmdc:mga05p37_4278_c1 | 3300050507 | Bacteria | 16673 |
| 1126 | nmdc:mga09592_32400_c1 | 3300050508 | Bacteria | 4357 |
| 1127 | nmdc:mga0qj67_235_c1 | 3300050509 | Bacteria | 37732 |
| 1128 | nmdc:mga06r32_49651_c1 | 3300050510 | Bacteria | 4013 |
| 1129 | nmdc:mga08y16_51_c1 | 3300050511 | Bacteria | 105348 |
| 1130 | nmdc:mga0n895_11393_c1 | 3300050512 | Bacteria | 7931 |
| 1131 | nmdc:mga0n895_24802_c1 | 3300050512 | Bacteria | 5657 |
| 1132 | Ga0495601_0000314 | 3300053077 | Bacteria | 25703 |
| 1133 | Ga0495601_0002711 | 3300053077 | Bacteria | 10052 |
| 1134 | Ga0495601_0025781 | 3300053077 | Bacteria | 3627 |
| 1135 | Ga0495612_0003727 | 3300053078 | Bacteria | 6333 |
| 1136 | Ga0495595_0001460 | 3300053084 | Bacteria | 9233 |
| 1137 | Ga0495619_0001836 | 3300053085 | Bacteria | 14121 |
| 1138 | Ga0500578_0032414 | 3300053086 | Bacteria | 3359 |
| 1139 | Ga0500643_000231 | 3300053087 | Bacteria | 51641 |
| 1140 | Ga0500651_0001006 | 3300053093 | Bacteria | 13869 |
| 1141 | Ga0500566_0000527 | 3300053094 | Bacteria | 21443 |
| 1142 | Ga0500566_0000931 | 3300053094 | Bacteria | 16746 |
| 1143 | Ga0500566_0001874 | 3300053094 | Bacteria | 12376 |
| 1144 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 1145 | Ga0500556_0000148 | 3300053104 | Bacteria | 58772 |
| 1146 | Ga0500557_000180 | 3300053105 | Bacteria | 12178 |
| 1147 | Ga0500562_000305 | 3300053108 | Bacteria | 12000 |
| 1148 | Ga0500595_000469 | 3300053119 | Bacteria | 24960 |
| 1149 | Ga0500595_002835 | 3300053119 | Bacteria | 8333 |
| 1150 | Ga0500595_005065 | 3300053119 | Bacteria | 5790 |
| 1151 | Ga0500595_005098 | 3300053119 | Bacteria | 5768 |
| 1152 | Ga0500608_000871 | 3300053122 | Bacteria | 10890 |
| 1153 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 1154 | Ga0500642_0000087 | 3300053130 | Bacteria | 48287 |
| 1155 | Ga0500652_001138 | 3300053131 | Bacteria | 8538 |
| 1156 | Ga0500658_0010195 | 3300053134 | Bacteria | 3463 |
| 1157 | Ga0500559_0000723 | 3300053136 | Bacteria | 21728 |
| 1158 | Ga0500559_0001753 | 3300053136 | Bacteria | 11902 |
| 1159 | Ga0500577_0001505 | 3300053142 | Bacteria | 5946 |
| 1160 | Ga0500586_002742 | 3300053145 | Bacteria | 4043 |
| 1161 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 1162 | Ga0500634_0033053 | 3300053161 | Bacteria | 2819 |
| 1163 | Ga0500636_0000344 | 3300053177 | Bacteria | 25582 |
| 1164 | Ga0500636_0002110 | 3300053177 | Bacteria | 10960 |
| 1165 | Ga0500637_0000471 | 3300053178 | Bacteria | 15567 |
| 1166 | Ga0500625_002579 | 3300053729 | Bacteria | 6848 |
| 1167 | Ga0500601_000438 | 3300053737 | Bacteria | 6849 |
| 1168 | Ga0501084_0016383 | 3300054114 | Bacteria | 6155 |
| 1169 | Ga0501082_0008684 | 3300060353 | Bacteria | 8761 |
| 1170 | 2507504681 | 2507262055 | Bacteria | 8048963 |
| 1171 | 2508539902 | 2508501009 | Bacteria | 7784016 |
| 1172 | 2508694961 | 2508501042 | Bacteria | 8719808 |
| 1173 | 2509149915 | 2508501128 | Bacteria | 8613869 |
| 1174 | 2511258458 | 2511231004 | Bacteria | 6669789 |
| 1175 | 2511265615 | 2511231006 | Bacteria | 6794709 |
| 1176 | 2511272588 | 2511231007 | Bacteria | 6306603 |
| 1177 | 2511280596 | 2511231008 | Bacteria | 6624100 |
| 1178 | 2511288868 | 2511231010 | Bacteria | 6373152 |
| 1179 | 2511293891 | 2511231011 | Bacteria | 6149768 |
| 1180 | 2511299463 | 2511231012 | Bacteria | 6738011 |
| 1181 | 2511315172 | 2511231014 | Bacteria | 6462302 |
| 1182 | 2511322573 | 2511231015 | Bacteria | 6598026 |
| 1183 | 2511323638 | 2511231016 | Bacteria | 6704427 |
| 1184 | 2511332721 | 2511231017 | Bacteria | 6503007 |
| 1185 | 2511337882 | 2511231018 | Bacteria | 6436256 |
| 1186 | 2511345099 | 2511231019 | Bacteria | 6520662 |
| 1187 | 2511349022 | 2511231020 | Bacteria | 6115223 |
| 1188 | 2511356186 | 2511231021 | Bacteria | 7302637 |
| 1189 | 2511361403 | 2511231022 | Bacteria | 6719296 |
| 1190 | 2511368546 | 2511231023 | Bacteria | 6808468 |
| 1191 | 2511378018 | 2511231024 | Bacteria | 5835885 |
| 1192 | 2511398851 | 2511231028 | Bacteria | 8046582 |
| 1193 | 2511411232 | 2511231031 | Bacteria | 6558529 |
| 1194 | 2511822351 | 2511231156 | Bacteria | 6845832 |
| 1195 | 2512325873 | 2512047018 | Bacteria | 6663241 |
| 1196 | 2513625625 | 2513237092 | Bacteria | 8341956 |
| 1197 | 2513640695 | 2513237094 | Bacteria | 8789602 |
| 1198 | 2513653439 | 2513237095 | Bacteria | 8976980 |
| 1199 | 2513658874 | 2513237096 | Bacteria | 8722461 |
| 1200 | 2513678455 | 2513237098 | Bacteria | 9902361 |
| 1201 | 2513698127 | 2513237101 | Bacteria | 7952346 |
| 1202 | 2513701756 | 2513237102 | Bacteria | 7703324 |
| 1203 | 2513714884 | 2513237104 | Bacteria | 10034502 |
| 1204 | 2513858934 | 2513237137 | Bacteria | 9558895 |
| 1205 | 2513874040 | 2513237139 | Bacteria | 8737671 |
| 1206 | 2513889652 | 2513237141 | Bacteria | 8496279 |
| 1207 | 2513921138 | 2513237145 | Bacteria | 8979722 |
| 1208 | 2514010190 | 2513237161 | Bacteria | 8871253 |
| 1209 | 2515627767 | 2515154112 | Bacteria | 8294334 |
| 1210 | 2517108692 | 2517093001 | Bacteria | 9002274 |
| 1211 | 2517889552 | 2517572143 | Bacteria | 9484767 |
| 1212 | 2524438604 | 2524023205 | Bacteria | 8918781 |
| 1213 | 2524466156 | 2524023210 | Bacteria | 9029266 |
| 1214 | 2524539572 | 2524023228 | Bacteria | 10118060 |
| 1215 | 2524610623 | 2524023250 | Bacteria | 5457705 |
| 1216 | 2528854749 | 2528768022 | Bacteria | 10457665 |
| 1217 | 2554815533 | 2554235132 | Bacteria | 6772433 |
| 1218 | 2555247801 | 2554235231 | Bacteria | 5215788 |
| 1219 | 2555667336 | 2554235341 | Bacteria | 6867980 |
| 1220 | 2583789886 | 2582580891 | Bacteria | 6800976 |
| 1221 | 2597855580 | 2597489887 | Bacteria | 6666321 |
| 1222 | 2597861582 | 2597489888 | Bacteria | 6179543 |
| 1223 | 2597867302 | 2597489889 | Bacteria | 6297495 |
| 1224 | 2599327479 | 2599185155 | Bacteria | 5827168 |
| 1225 | 2599356559 | 2599185160 | Bacteria | 6844013 |
| 1226 | 2599363411 | 2599185161 | Bacteria | 6960462 |
| 1227 | 2599369637 | 2599185162 | Bacteria | 6957254 |
| 1228 | 2599376520 | 2599185163 | Bacteria | 6995158 |
| 1229 | 2599381664 | 2599185164 | Bacteria | 6841688 |
| 1230 | 2599388192 | 2599185165 | Bacteria | 6843250 |
| 1231 | 2599395284 | 2599185166 | Bacteria | 6959206 |
| 1232 | 2599398938 | 2599185167 | Bacteria | 6353609 |
| 1233 | 2599407049 | 2599185168 | Bacteria | 6997636 |
| 1234 | 2599450993 | 2599185179 | Bacteria | 6611171 |
| 1235 | 2599463392 | 2599185181 | Bacteria | 6844519 |
| 1236 | 2599469258 | 2599185182 | Bacteria | 6883168 |
| 1237 | 2599485482 | 2599185185 | Bacteria | 6652270 |
| 1238 | 2599492409 | 2599185186 | Bacteria | 6831633 |
| 1239 | 2599502569 | 2599185188 | Bacteria | 6164180 |
| 1240 | 2599506352 | 2599185189 | Bacteria | 5862825 |
| 1241 | 2599514061 | 2599185190 | Bacteria | 6285678 |
| 1242 | 2599518662 | 2599185191 | Bacteria | 6297582 |
| 1243 | 2599613048 | 2599185212 | Bacteria | 6765997 |
| 1244 | 2599769307 | 2599185248 | Bacteria | 6696816 |
| 1245 | 2599806611 | 2599185257 | Bacteria | 6492581 |
| 1246 | 2599882574 | 2599185288 | Bacteria | 6666191 |
| 1247 | 2599888550 | 2599185289 | Bacteria | 6778765 |
| 1248 | 2599893604 | 2599185290 | Bacteria | 6289611 |
| 1249 | 2599900201 | 2599185291 | Bacteria | 6775623 |
| 1250 | 2599934153 | 2599185300 | Bacteria | 6062622 |
| 1251 | 2599943680 | 2599185302 | Bacteria | 5954930 |
| 1252 | 2599952116 | 2599185303 | Bacteria | 6512725 |
| 1253 | 2599955990 | 2599185304 | Bacteria | 5951361 |
| 1254 | 2599961784 | 2599185305 | Bacteria | 6748700 |
| 1255 | 2599966917 | 2599185306 | Bacteria | 6637356 |
| 1256 | 2599974404 | 2599185307 | Bacteria | 6194719 |
| 1257 | 2599978272 | 2599185308 | Bacteria | 6621546 |
| 1258 | 2599984684 | 2599185309 | Bacteria | 5969593 |
| 1259 | 2599991163 | 2599185310 | Bacteria | 6014457 |
| 1260 | 2599994953 | 2599185311 | Bacteria | 6354990 |
| 1261 | 2600002306 | 2599185312 | Bacteria | 5912071 |
| 1262 | 2600004760 | 2599185313 | Bacteria | 6658188 |
| 1263 | 2600012508 | 2599185314 | Bacteria | 6621749 |
| 1264 | 2600018744 | 2599185315 | Bacteria | 6771107 |
| 1265 | 2600026730 | 2599185316 | Bacteria | 6320029 |
| 1266 | 2600029881 | 2599185317 | Bacteria | 6435722 |
| 1267 | 2600034781 | 2599185318 | Bacteria | 6961590 |
| 1268 | 2600043906 | 2599185319 | Bacteria | 6637840 |
| 1269 | 2600047974 | 2599185320 | Bacteria | 5963263 |
| 1270 | 2600055622 | 2599185321 | Bacteria | 6764560 |
| 1271 | 2600060294 | 2599185322 | Bacteria | 6763055 |
| 1272 | 2600067554 | 2599185323 | Bacteria | 6688755 |
| 1273 | 2600071423 | 2599185324 | Bacteria | 6590677 |
| 1274 | 2600080405 | 2599185325 | Bacteria | 6324919 |
| 1275 | 2600216021 | 2599185356 | Bacteria | 6843884 |
| 1276 | 2600359190 | 2600254930 | Bacteria | 6431253 |
| 1277 | 2600364961 | 2600254931 | Bacteria | 6734225 |
| 1278 | 2600444595 | 2600254954 | Bacteria | 5100516 |
| 1279 | 2601627247 | 2600255283 | Bacteria | 6061572 |
| 1280 | 2601692262 | 2600255296 | Bacteria | 5784754 |
| 1281 | 2601776188 | 2600255313 | Bacteria | 6842543 |
| 1282 | 2601797748 | 2600255318 | Bacteria | 6383414 |
| 1283 | 2602011666 | 2600255389 | Bacteria | 5275336 |
| 1284 | 2603857953 | 2602042107 | Bacteria | 6226103 |
| 1285 | 2606076769 | 2603880185 | Bacteria | 6379190 |
| 1286 | 2606128817 | 2603880199 | Bacteria | 6377649 |
| 1287 | 2608383836 | 2606217733 | Bacteria | 6360972 |
| 1288 | 2617350168 | 2617270735 | Bacteria | 9163226 |
| 1289 | 2617377140 | 2617270741 | Bacteria | 8201522 |
| 1290 | 2621302257 | 2619619299 | Bacteria | 6649820 |
| 1291 | 2624478135 | 2623620443 | Bacteria | 6427864 |
| 1292 | 2624489680 | 2623620446 | Bacteria | 6500345 |
| 1293 | 2643740265 | 2643221543 | Bacteria | 6628015 |
| 1294 | 2643840900 | 2643221565 | Bacteria | 6216018 |
| 1295 | 2643872702 | 2643221571 | Bacteria | 6228673 |
| 1296 | 2643954997 | 2643221589 | Bacteria | 6250934 |
| 1297 | 2644024633 | 2643221602 | Bacteria | 6249926 |
| 1298 | 2644186038 | 2643221633 | Bacteria | 6733554 |
| 1299 | 2644282659 | 2643221650 | Bacteria | 7029547 |
| 1300 | 2644619568 | 2643221713 | Bacteria | 6554480 |
| 1301 | 2644732142 | 2643221733 | Bacteria | 5690728 |
| 1302 | 2671092677 | 2667528170 | Bacteria | 6786960 |
| 1303 | 2671100051 | 2667528171 | Bacteria | 6900659 |
| 1304 | 2671121259 | 2667528175 | Bacteria | 7532676 |
| 1305 | 2671127239 | 2667528176 | Bacteria | 6724917 |
| 1306 | 2671691934 | 2671180139 | Bacteria | 4196045 |
| 1307 | 2671772262 | 2671180172 | Bacteria | 6495783 |
| 1308 | 2677898298 | 2675903420 | Bacteria | 6247433 |
| 1309 | 2678260887 | 2675903515 | Bacteria | 6580491 |
| 1310 | 2715749124 | 2713897148 | Bacteria | 5883533 |
| 1311 | 2715754394 | 2713897149 | Bacteria | 6506249 |
| 1312 | 2718632081 | 2718217725 | Bacteria | 5758958 |
| 1313 | 2723246471 | 2721755607 | Bacteria | 5841722 |
| 1314 | 2723849177 | 2721755755 | Bacteria | 8322773 |
| 1315 | 2728749261 | 2728368998 | Bacteria | 8720350 |
| 1316 | 2729146694 | 2728369097 | Bacteria | 4333476 |
| 1317 | 2738674919 | 2738541265 | Bacteria | 6594665 |
| 1318 | 2738687637 | 2738541271 | Bacteria | 5657310 |
| 1319 | 2738753312 | 2738541282 | Bacteria | 6593925 |
| 1320 | 2738808001 | 2738541294 | Bacteria | 6925949 |
| 1321 | 2738862511 | 2738541303 | Bacteria | 6591772 |
| 1322 | 2738895361 | 2738541309 | Bacteria | 6926455 |
| 1323 | 2739197943 | 2738543004 | Bacteria | 6381073 |
| 1324 | 2739260396 | 2738543015 | Bacteria | 6750701 |
| 1325 | 2739263258 | 2738543016 | Bacteria | 5657564 |
| 1326 | 2739285344 | 2738543020 | Bacteria | 5718238 |
| 1327 | 2739290658 | 2738543021 | Bacteria | 5718241 |
| 1328 | 2739311199 | 2738543025 | Bacteria | 6600348 |
| 1329 | 2743734998 | 2740892503 | Bacteria | 6855563 |
| 1330 | 2745006200 | 2744054620 | Bacteria | 6551379 |
| 1331 | 2745077679 | 2744054633 | Bacteria | 8678936 |
| 1332 | 2765581551 | 2765235841 | Bacteria | 6137024 |
| 1333 | 2774119644 | 2773857670 | Bacteria | 6407454 |
| 1334 | 2774134657 | 2773857673 | Bacteria | 6513460 |
| 1335 | 2784261133 | 2784132063 | Bacteria | 6262788 |
| 1336 | 2784316282 | 2784132072 | Bacteria | 6596533 |
| 1337 | 2793073639 | 2791355197 | Bacteria | 8420563 |
| 1338 | 2793078465 | |||
| 1339 | 2794598752 | 2791355520 | Bacteria | 5948615 |
| 1340 | 2805920397 | 2802429603 | Bacteria | 8777136 |
| 1341 | 2807406180 | 2806310737 | Bacteria | 5751088 |
| 1342 | 2807454532 | 2806310745 | Bacteria | 5742165 |
| 1343 | 2808856559 | 2808606361 | Bacteria | 6136259 |
| 1344 | 2808922842 | 2808606376 | Bacteria | 6248667 |
| 1345 | 2808932098 | 2808606377 | Bacteria | 6646337 |
| 1346 | 2808936538 | 2808606378 | Bacteria | 6177535 |
| 1347 | 2808944529 | 2808606380 | Bacteria | 6248705 |
| 1348 | 2808954301 | 2808606381 | Bacteria | 6646461 |
| 1349 | 2808955775 | 2808606382 | Bacteria | 6841132 |
| 1350 | 2808964946 | 2808606383 | Bacteria | 6138645 |
| 1351 | 2808976748 | 2808606385 | Bacteria | 6711065 |
| 1352 | 2808991814 | 2808606388 | Bacteria | 6706662 |
| 1353 | 2808999838 | 2808606389 | Bacteria | 6138126 |
| 1354 | 2809217896 | 2808606445 | Bacteria | 6057339 |
| 1355 | 2812366386 | 2811994881 | Bacteria | 6298475 |
| 1356 | 2817488320 | 2816332298 | Bacteria | 6852809 |
| 1357 | 2818243496 | 2816332527 | Bacteria | 8933356 |
| 1358 | 2819657144 | 2818991456 | Bacteria | 6123676 |
| 1359 | 2819705133 | 2818991464 | Bacteria | 6907494 |
| 1360 | 2821113339 | 2821111986 | Bacteria | 6894338 |
| 1361 | 2823423726 | 2823421272 | Bacteria | 5372474 |
| 1362 | 2824605818 | 2824600985 | Bacteria | 8488197 |
| 1363 | 2824611968 | 2824609381 | Bacteria | 8672835 |
| 1364 | 2824622845 | 2824617872 | Bacteria | 8814715 |
| 1365 | 2824631934 | 2824626560 | Bacteria | 8813858 |
| 1366 | 2824642987 | 2824635225 | Bacteria | 8785348 |
| 1367 | 2824651069 | 2824644064 | Bacteria | 8743947 |
| 1368 | 2824658785 | 2824653114 | Bacteria | 8493680 |
| 1369 | 2824664317 | 2824661429 | Bacteria | 9877870 |
| 1370 | 2824676890 | 2824671348 | Bacteria | 8369588 |
| 1371 | 2824682000 | 2824679649 | Bacteria | 8248951 |
| 1372 | 2824693267 | 2824687955 | Bacteria | 8360029 |
| 1373 | 2824701511 | 2824696289 | Bacteria | 8335049 |
| 1374 | 2824710570 | 2824704595 | Bacteria | 9667483 |
| 1375 | 2824721082 | 2824714736 | Bacteria | 8717648 |
| 1376 | 2824731151 | 2824723954 | Bacteria | 8758240 |
| 1377 | 2824734118 | 2824732956 | Bacteria | 7810675 |
| 1378 | 2824749179 | 2824746037 | Bacteria | 7911610 |
| 1379 | 2824762237 | 2824753945 | Bacteria | 9787441 |
| 1380 | 2824772610 | 2824763712 | Bacteria | 9792355 |
| 1381 | 2824780098 | 2824773399 | Bacteria | 8360218 |
| 1382 | 2825654355 | 2825651385 | Bacteria | 6715909 |
| 1383 | 2826582507 | 2826581358 | Bacteria | 5963467 |
| 1384 | 2834032293 | 2834028612 | Bacteria | 6354979 |
| 1385 | 2838125897 | 2838122688 | Bacteria | 8803140 |
| 1386 | 2841942709 | 2841941048 | Bacteria | 8688029 |
| 1387 | 2841952940 | 2841949485 | Bacteria | 8680857 |
| 1388 | 2841963441 | 2841957949 | Bacteria | 8652217 |
| 1389 | 2841971032 | 2841966195 | Bacteria | 8673214 |
| 1390 | 2841977709 | 2841974524 | Bacteria | 8931498 |
| 1391 | 2841984729 | 2841983080 | Bacteria | 8395090 |
| 1392 | 2842041550 | 2842038055 | Bacteria | 8002051 |
| 1393 | 2842049592 | 2842045827 | Bacteria | 8006841 |
| 1394 | 2842695066 | 2842694124 | Bacteria | 4063419 |
| 1395 | 2842806977 | 2842805378 | Bacteria | 5385175 |
| 1396 | 2842817647 | 2842815866 | Bacteria | 5947510 |
| 1397 | 2842830634 | 2842826826 | Bacteria | 5974129 |
| 1398 | 2842834083 | 2842832357 | Bacteria | 5959113 |
| 1399 | 2842838538 | 2842837860 | Bacteria | 6066181 |
| 1400 | 2842846445 | 2842843487 | Bacteria | 6004777 |
| 1401 | 2842851605 | 2842849001 | Bacteria | 5924277 |
| 1402 | 2842859470 | 2842854478 | Bacteria | 6143501 |
| 1403 | 2844316008 | 2844315083 | Bacteria | 8138177 |
| 1404 | 2844667814 | 2844665904 | Bacteria | 6817974 |
| 1405 | 2847939764 | 2847930680 | Bacteria | 9342022 |
| 1406 | 2847943075 | 2847939898 | Bacteria | 8606328 |
| 1407 | 2849076819 | 2849076700 | Bacteria | 7039503 |
| 1408 | 2852616990 | 2852612431 | Bacteria | 6885235 |
| 1409 | 2852660535 | 2852657418 | Bacteria | 6472974 |
| 1410 | 2852672021 | 2852667396 | Bacteria | 6885555 |
| 1411 | 2857515780 | 2857509624 | Bacteria | 7472071 |
| 1412 | 2857527333 | 2857524615 | Bacteria | 6615449 |
| 1413 | 2860343722 | 2860339153 | Bacteria | 6846989 |
| 1414 | 2860868362 | 2860867994 | Bacteria | 5645326 |
| 1415 | 2864737258 | 2864733723 | Bacteria | 6770668 |
| 1416 | 2874593720 | 2874590934 | Bacteria | 8299676 |
| 1417 | 2874606886 | 2874604998 | Bacteria | 7834745 |
| 1418 | 2874617598 | 2874612657 | Bacteria | 8252029 |
| 1419 | 2874622008 | 2874620515 | Bacteria | 8290088 |
| 1420 | 2874629329 | 2874628541 | Bacteria | 8630250 |
| 1421 | 2874647983 | 2874645413 | Bacteria | 8214782 |
| 1422 | 2876763410 | 2876761206 | Bacteria | 10111113 |
| 1423 | 2876772811 | 2876771140 | Bacteria | 8287509 |
| 1424 | 2876826460 | 2876818435 | Bacteria | 8274608 |
| 1425 | 2878030080 | 2878029506 | Bacteria | 6418441 |
| 1426 | 2879077507 | 2879074833 | Bacteria | 8279565 |
| 1427 | 2879089976 | 2879083081 | Bacteria | 8587928 |
| 1428 | 2879105498 | 2879099564 | Bacteria | 10442239 |
| 1429 | 2879112607 | 2879110137 | Bacteria | 8907982 |
| 1430 | 2879134389 | 2879127579 | Bacteria | 8294491 |
| 1431 | 2879147348 | 2879142872 | Bacteria | 8267021 |
| 1432 | 2880231031 | 2880230671 | Bacteria | 6140320 |
| 1433 | 2881364487 | 2881364244 | Bacteria | 7710352 |
| 1434 | 2881666097 | 2881665667 | Bacteria | 8175609 |
| 1435 | 2885369073 | 2885366525 | Bacteria | 8326213 |
| 1436 | 2885376909 | 2885374607 | Bacteria | 8927485 |
| 1437 | 2885390003 | 2885383462 | Bacteria | 9473874 |
| 1438 | 2885411897 | 2885409591 | Bacteria | 9235467 |
| 1439 | 2885526610 | 2885526491 | Bacteria | 7164189 |
| 1440 | 2888378852 | 2888378607 | Bacteria | 9652610 |
| 1441 | 2888390139 | 2888388044 | Bacteria | 7304136 |
| 1442 | 2888427279 | 2888419890 | Bacteria | 7857137 |
| 1443 | 2889036128 | 2889033259 | Bacteria | 9099371 |
| 1444 | 2889045111 | 2889042446 | Bacteria | 7618936 |
| 1445 | 2893071874 | 2893066018 | Bacteria | 6158120 |
| 1446 | 2903729598 | 2903727486 | Bacteria | 8281579 |
| 1447 | 2903757085 | 2903748898 | Bacteria | 9972761 |
| 1448 | 2903774741 | 2903768456 | Bacteria | 9749579 |
| 1449 | 2904165159 | 2904162308 | Bacteria | 7086713 |
| 1450 | 2904492003 | 2904490793 | Bacteria | 7046938 |
| 1451 | 2904519490 | 2904518522 | Bacteria | 6068986 |
| 1452 | 2904552332 | 2904550169 | Bacteria | 6221258 |
| 1453 | 2904669400 | 2904666416 | Bacteria | 8226587 |
| 1454 | 2904692145 | 2904690495 | Bacteria | 9412302 |
| 1455 | 2904709371 | |||
| 1456 | 2904714488 | 2904711408 | Bacteria | 9771557 |
| 1457 | 2906606101 | 2906602504 | Bacteria | 8295279 |
| 1458 | 2906613068 | |||
| 1459 | 2906635093 | 2906626472 | Bacteria | 8826946 |
| 1460 | 2906641173 | 2906635258 | Bacteria | 8601019 |
| 1461 | 2906645618 | 2906643746 | Bacteria | 8722424 |
| 1462 | 2906665729 | 2906660503 | Bacteria | 8595048 |
| 1463 | 2908446946 | 2908446538 | Bacteria | 6829095 |
| 1464 | 2908748049 | 2908739725 | Bacteria | 8628932 |
| 1465 | 2908756676 | 2908756301 | Bacteria | 8864324 |
| 1466 | 2908783055 | 2908775508 | Bacteria | 8092255 |
| 1467 | 2912964121 | 2912963787 | Bacteria | 5646108 |
| 1468 | 2913037182 | 2913036834 | Bacteria | 6704877 |
| 1469 | 2917071087 | 2917070673 | Bacteria | 6868303 |
| 1470 | 2919066238 | 2919063839 | Bacteria | 6302690 |
| 1471 | 2919078445 | 2919073203 | Bacteria | 6531949 |
| 1472 | 2919157530 | 2919155634 | Bacteria | 4860545 |
| 1473 | 2919161240 | 2919160200 | Bacteria | 6929020 |
| 1474 | 2919389854 | 2919385768 | Bacteria | 5897293 |
| 1475 | 2919451829 | 2919450847 | Bacteria | 5631160 |
| 1476 | 2919459901 | 2919456309 | Bacteria | 6586567 |
| 1477 | 2919486481 | 2919481497 | Bacteria | 6907839 |
| 1478 | 2919488789 | 2919487758 | Bacteria | 5929766 |
| 1479 | 2919503355 | 2919501602 | Bacteria | 5286340 |
| 1480 | 2919699041 | 2919697872 | Bacteria | 6553725 |
| 1481 | 2922364507 | 2922361189 | Bacteria | 7436256 |
| 1482 | 2922377710 | |||
| 1483 | 2922389191 | 2922386360 | Bacteria | 7017218 |
| 1484 | 2922400910 | 2922393267 | Bacteria | 8285685 |
| 1485 | 2922433561 | |||
| 1486 | 2923153993 | 2923153595 | Bacteria | 6870622 |
| 1487 | 2923520410 | 2923519811 | Bacteria | 6298479 |
| 1488 | 2923589680 | 2923586266 | Bacteria | 6565975 |
| 1489 | 2926066074 | 2926063275 | Bacteria | 5285848 |
| 1490 | 2929144719 | 2929144301 | Bacteria | 6622272 |
| 1491 | 2929190222 | 2929189879 | Bacteria | 5930554 |
| 1492 | 2929623320 | 2929615660 | Bacteria | 9193770 |
| 1493 | 2929632589 | 2929624759 | Bacteria | 9339455 |
| 1494 | 2931371948 | 2931369376 | Bacteria | 6847892 |
| 1495 | 2931388547 | 2931384279 | Bacteria | 7299545 |
| 1496 | 2931391291 | 2931390751 | Bacteria | 6273349 |
| 1497 | 2931398754 | 2931396565 | Bacteria | 7251677 |
| 1498 | 2932788207 | 2932784394 | Bacteria | 9704911 |
| 1499 | 2932800064 | 2932794094 | Bacteria | 7915132 |
| 1500 | 2932808348 | 2932801729 | Bacteria | 7987968 |
| 1501 | 2932813578 | 2932809354 | Bacteria | 9135765 |
| 1502 | 2932820275 | 2932818245 | Bacteria | 9955613 |
| 1503 | 2932832658 | 2932828146 | Bacteria | 9745859 |
| 1504 | 2933585223 | 2933577622 | Bacteria | 9116884 |
| 1505 | 2935358915 | 2935353572 | Unclassified | 6955622 |
| 1506 | 2935615124 | 2935608549 | Bacteria | 8203142 |
| 1507 | 2935620148 | 2935616580 | Bacteria | 9032984 |
| 1508 | 2935635079 | 2935630451 | Bacteria | 8169952 |
| 1509 | 2935640466 | 2935638405 | Bacteria | 10015038 |
| 1510 | 2935651519 | 2935648319 | Bacteria | 8801166 |
| 1511 | 2935659713 | 2935656913 | Bacteria | 8965014 |
| 1512 | 2935668660 | 2935665750 | Bacteria | 9571747 |
| 1513 | 2935681962 | 2935675223 | Bacteria | 9928132 |
| 1514 | 2935686968 | 2935684952 | Bacteria | 9590419 |
| 1515 | 2935697062 | 2935694250 | Bacteria | 9291695 |
| 1516 | 2935709830 | 2935703347 | Bacteria | 10242284 |
| 1517 | 2935716656 | 2935713505 | Bacteria | 9608509 |
| 1518 | 2935723219 | 2935722832 | Bacteria | 9608746 |
| 1519 | 2935734776 | 2935732158 | Bacteria | 9706831 |
| 1520 | 2935744433 | 2935741537 | Bacteria | 9707219 |
| 1521 | 2935752934 | 2935750917 | Bacteria | 9590372 |
| 1522 | 2935766832 | 2935760218 | Bacteria | 9817913 |
| 1523 | 2935774808 | 2935769743 | Bacteria | 7878163 |
| 1524 | 2935779704 | 2935777560 | Bacteria | 8077691 |
| 1525 | 2935789677 | 2935785616 | Bacteria | 7962367 |
| 1526 | 2935797955 | 2935793552 | Bacteria | 8012592 |
| 1527 | 2935804580 | 2935801545 | Bacteria | 9301974 |
| 1528 | 2935815733 | 2935810662 | Bacteria | 9401221 |
| 1529 | 2935825838 | 2935819856 | Bacteria | 8261050 |
| 1530 | 2935831972 | 2935827899 | Bacteria | 10038562 |
| 1531 | 2935841196 | 2935837841 | Bacteria | 9454360 |
| 1532 | 2935851457 | 2935847175 | Bacteria | 8228321 |
| 1533 | 2935859034 | 2935855204 | Bacteria | 9035059 |
| 1534 | 2935864215 | 2935864058 | Bacteria | 9784707 |
| 1535 | 2935875433 | 2935873716 | Bacteria | 9632195 |
| 1536 | 2935883456 | 2935883170 | Bacteria | 7964738 |
| 1537 | 2935910517 | 2935908558 | Bacteria | 8568796 |
| 1538 | 2935918079 | 2935916978 | Bacteria | 9113783 |
| 1539 | 2935927572 | 2935926038 | Bacteria | 8601059 |
| 1540 | 2935936556 | 2935934488 | Bacteria | 8602579 |
| 1541 | 2935943891 | 2935942939 | Bacteria | 8599779 |
| 1542 | 2935952328 | 2935951376 | Bacteria | 8602333 |
| 1543 | 2935964385 | 2935959822 | Bacteria | 7869783 |
| 1544 | 2935969168 | 2935967501 | Bacteria | 8603075 |
| 1545 | 2935978432 | 2935975950 | Bacteria | 8347125 |
| 1546 | 2935984621 | 2935984226 | Bacteria | 8302647 |
| 1547 | 2935995588 | 2935992306 | Bacteria | 9802711 |
| 1548 | 2936008008 | 2936002035 | Bacteria | 9362176 |
| 1549 | 2936014129 | 2936011229 | Bacteria | 8801034 |
| 1550 | 2936022962 | 2936019824 | Bacteria | 8804134 |
| 1551 | 2936031098 | 2936028420 | Bacteria | 8965941 |
| 1552 | 2936041635 | 2936037263 | Bacteria | 9446081 |
| 1553 | 2936049220 | 2936046547 | Bacteria | 8903709 |
| 1554 | 2936055666 | 2936055302 | Bacteria | 8785755 |
| 1555 | 2939641017 | 2939636861 | Bacteria | 6297853 |
| 1556 | 2939654943 | 2939651529 | Bacteria | 5895393 |
| 1557 | 2939670308 | 2939669807 | Bacteria | 5028511 |
| 1558 | 2939682661 | 2939679117 | Bacteria | 6921672 |
| 1559 | 2940558847 | 2940556831 | Bacteria | 9590747 |
| 1560 | 2941511642 | 2941507105 | Bacteria | 8166816 |
| 1561 | 2941519375 | 2941515067 | Bacteria | 8166720 |
| 1562 | 2941527501 | 2941523033 | Bacteria | 8169134 |
| 1563 | 2941535872 | 2941531003 | Bacteria | 7653939 |
| 1564 | 2941543422 | 2941538514 | Bacteria | 9402094 |
| 1565 | 2945930260 | 2945928738 | Bacteria | 6053221 |
| 1566 | 2945967511 | 2945961074 | Bacteria | 7342064 |
| 1567 | 2945992863 | 2945991243 | Bacteria | 7008369 |
| 1568 | 2946012593 | 2946006987 | Bacteria | 6705746 |
| 1569 | 2946028561 | 2946027586 | Bacteria | 6049274 |
| 1570 | 2946055604 | 2946053406 | Bacteria | 6978655 |
| 1571 | 2947235093 | 2947233263 | Bacteria | 6439278 |
| 1572 | 2969304876 | 2969304461 | Bacteria | 6601805 |
| 1573 | 2974293430 | 2974289157 | Bacteria | 6080362 |
| 1574 | 2984292068 | 2984286254 | Bacteria | 6702062 |
| 1575 | 2988732113 | 2988728565 | Bacteria | 6124362 |
| 1576 | 2990197093 | 2990196909 | Bacteria | 4054280 |
| 1577 | 2998140377 | 2998139840 | Bacteria | 6073514 |
| 1578 | 3005483217 | 3005474847 | Bacteria | 9259049 |
| 1579 | 3005490543 | 3005483717 | Bacteria | 7877331 |
| 1580 | 3005506438 | 3005506211 | Bacteria | 6943378 |
| 1581 | 3005588916 | 3005587118 | Bacteria | 7794411 |
| 1582 | 3005595596 | 3005594810 | Bacteria | 8716512 |
| 1583 | 3005711588 | 3005710791 | Bacteria | 7622528 |
| 1584 | 3005718845 | 3005718088 | Bacteria | 8283608 |
| 1585 | 3007253257 | 3007252601 | Bacteria | 4559114 |
| 1586 | 3007317948 | 3007315729 | Bacteria | 5076637 |
| 1587 | 3007398006 | 3007395558 | Bacteria | 6755444 |
| 1588 | 3007419933 | 3007419365 | Bacteria | 7026924 |
| 1589 | 3007517812 | 3007511990 | Bacteria | 6481491 |
| 1590 | 3007616197 | 3007614139 | Bacteria | 6053559 |
| 1591 | 3007625369 | 3007619802 | Bacteria | 6411688 |
| 1592 | 3007724027 | 3007718800 | Bacteria | 5971527 |
| 1593 | 3007805672 | 3007803356 | Bacteria | 5931491 |
| 1594 | 3007857175 | 3007855910 | Bacteria | 5637581 |
| 1595 | 3007864417 | 3007861166 | Bacteria | 6045338 |
| 1596 | 3007871976 | 3007866637 | Bacteria | 5899198 |
| 1597 | 3007875579 | 3007872151 | Bacteria | 5268868 |
| 1598 | 637317733 | 637000220 | Bacteria | 7074893 |
| 1599 | 8001850074 | 8001845381 | Bacteria | 5804942 |
| 1600 | 8002061481 | 8002060224 | Bacteria | 4026565 |
| 1601 | 8006926997 | 8006926726 | Bacteria | 6749210 |
| 1602 | 8006935591 | 8006933436 | Bacteria | 10410654 |
| 1603 | 8006967717 | 8006964411 | Bacteria | 8966052 |
| 1604 | 8006975520 | 8006973647 | Bacteria | 10679141 |
| 1605 | 8006992625 | 8006984368 | Bacteria | 9651211 |
| 1606 | 8006998385 | 8006994254 | Bacteria | 8309700 |
| 1607 | 8015688242 | 8015687852 | Bacteria | 6613826 |
| 1608 | 8016517575 | 8016511872 | Bacteria | 9921665 |
| 1609 | 8016525655 | 8016522445 | Bacteria | 8156687 |
| 1610 | 8016539251 | 8016530956 | Bacteria | 8155261 |
| 1611 | 8016543541 | 8016539877 | Bacteria | 8155419 |
| 1612 | 8016549752 | 8016548790 | Bacteria | 8155074 |
| 1613 | 8016568940 | 8016566248 | Bacteria | 8158151 |
| 1614 | 8016581588 | 8016575299 | Bacteria | 8154085 |
| 1615 | 8016587056 | 8016583857 | Bacteria | 10421953 |
| 1616 | 8016596172 | 8016595262 | Bacteria | 8149947 |
| 1617 | 8016618968 | 8016613128 | Bacteria | 8794220 |
| 1618 | 8017059045 | 8017057580 | Bacteria | 10023680 |
| 1619 | 8019541056 | 8019538911 | Bacteria | 7872763 |
| 1620 | 8019549565 | 8019547302 | Bacteria | 7996444 |
| 1621 | 8019563217 | 8019555841 | Bacteria | 9642137 |
| 1622 | 8019573297 | 8019565922 | Bacteria | 9639779 |
| 1623 | 8019594466 | 8019586578 | Bacteria | 10212056 |
| 1624 | 8019607092 | 8019597564 | Bacteria | 10041141 |
| 1625 | 8019611415 | 8019608314 | Bacteria | 10042931 |
| 1626 | 8019622195 | 8019619141 | Bacteria | 9218857 |
| 1627 | 8019639504 | 8019638758 | Bacteria | 9062356 |
| 1628 | 8019653153 | 8019648815 | Bacteria | 10014479 |
| 1629 | 8019667923 | 8019659431 | Bacteria | 8577854 |
| 1630 | 8019677343 | 8019668869 | Bacteria | 8791617 |
| 1631 | 8019687612 | 8019678201 | Bacteria | 8863603 |
| 1632 | 8019696872 | 8019687851 | Bacteria | 8712826 |
| 1633 | 8019770231 | 8019769354 | Bacteria | 6924660 |
| 1634 | 8019777254 | 8019775933 | Bacteria | 6858656 |
| 1635 | 8030000355 | 8029995093 | Bacteria | 5990776 |
| 1636 | 8034964823 | 8034962539 | Bacteria | 4884839 |
| 1637 | 8052494990 | 8052494512 | Bacteria | 5765634 |
| 1638 | 8054286139 | 8054285046 | Bacteria | 6919322 |
| 1639 | 8054350206 | 8054347763 | Bacteria | 5901107 |
| 1640 | 8054503867 | 8054503363 | Bacteria | 6101651 |
| 1641 | 8054930646 | 8054929484 | Bacteria | 5599761 |
| 1642 | 8055743262 | 8055742211 | Bacteria | 9226248 |
| 1643 | 8055771338 | 8055770955 | Bacteria | 6827675 |
| 1644 | 8055818268 | 8055817908 | Bacteria | 6609162 |
| 1645 | 8055880034 | 8055878733 | Bacteria | 5907058 |
| 1646 | 8056116673 | 8056115690 | Bacteria | 5527654 |
| 1647 | 8056125531 | 8056120720 | Bacteria | 5758328 |
| 1648 | 8056126384 | 8056125926 | Bacteria | 6228218 |
| 1649 | 8056132252 | 8056131705 | Bacteria | 6107031 |
| 1650 | 8056142618 | 8056137416 | Bacteria | 6147080 |
| 1651 | 8056143645 | 8056143049 | Bacteria | 6307666 |
| 1652 | 8056152394 | 8056148874 | Bacteria | 6479865 |
| 1653 | 8056158433 | 8056155041 | Bacteria | 6486948 |
| 1654 | 8056164259 | 8056161164 | Bacteria | 6106669 |
| 1655 | 8056170669 | 8056166840 | Bacteria | 5820959 |
| 1656 | 8056176785 | 8056172158 | Bacteria | 6133900 |
| 1657 | 8056179710 | 8056177738 | Bacteria | 6748268 |
| 1658 | 8056572239 | 8056569372 | Bacteria | 5997322 |
| 1659 | 8056678427 | 8056673599 | Bacteria | 7871253 |
| 1660 | 8056687771 | 8056681323 | Bacteria | 8472857 |
| 1661 | 8056692794 | 8056689827 | Bacteria | 6712655 |
| 1662 | 8056970689 | 8056967851 | Bacteria | 9038162 |
| 1663 | 8057802629 | 8057798959 | Bacteria | 6713499 |
| 1664 | Ga0207697_10001813 | |||
| 1665 | MRS2a_Contig_52 | |||
| 1666 | SwRhRL2b_contig_613450 | |||
| 1667 | JGI24741J21665_1001182 | |||
| 1668 | JGI24740J21852_10007761 | |||
| 1669 | JGI24737J22298_10003323 | |||
| 1670 | JGI25162J39368_1000098 | |||
| 1671 | JGI25162J39368_1000129 | |||
| 1672 | JGI25154J39366_1004169 | |||
| 1673 | JGI25163J39215_1000689 | |||
| 1674 | JGI25163J39215_1001594 | |||
| 1675 | JGI25164J39214_1000076 | |||
| 1676 | JGI25164J39214_1000101 | |||
| 1677 | JGI25406J46586_10000308 | |||
| 1678 | JGI25406J46586_10003834 | |||
| 1679 | JGI25165J46597_1000150 | |||
| 1680 | JGI25165J46597_1000180 | |||
| 1681 | JGI25153J46596_10003462 | |||
| 1682 | JGI25160J50197_1007754 | |||
| 1683 | Ga0055538_1000115 | |||
| 1684 | Ga0055539_1000162 | |||
| 1685 | Ga0055533_1000164 | |||
| 1686 | Ga0055532_1000153 | |||
| 1687 | Ga0055525_1000224 | |||
| 1688 | Ga0055536_1000232 | |||
| 1689 | Ga0055536_1000312 | |||
| 1690 | Ga0055536_1003049 | |||
| 1691 | Ga0055530_10000404 | |||
| 1692 | Ga0055530_10002858 | |||
| 1693 | Ga0055530_10006098 | |||
| 1694 | Ga0055540_1000339 | |||
| 1695 | Ga0055540_1000753 | |||
| 1696 | Ga0055540_1002153 | |||
| 1697 | Ga0055531_10000455 | |||
| 1698 | Ga0055541_1000107 | |||
| 1699 | Ga0065165_1001384 | |||
| 1700 | Ga0065165_1001704 | |||
| 1701 | Ga0065714_10000618 | |||
| 1702 | Ga0065714_10003400 | |||
| 1703 | Ga0065714_10009637 | |||
| 1704 | Ga0065714_10068828 | |||
| 1705 | Ga0065714_10069561 | |||
| 1706 | Ga0065714_10074770 | |||
| 1707 | Ga0065714_10078921 | |||
| 1708 | Ga0065704_10005342 | |||
| 1709 | Ga0065704_10084010 | |||
| 1710 | Ga0065712_10003999 | |||
| 1711 | Ga0065712_10067807 | |||
| 1712 | Ga0065715_10013732 | |||
| 1713 | Ga0070658_10015788 | |||
| 1714 | Ga0070676_10000872 | |||
| 1715 | Ga0070676_10024434 | |||
| 1716 | Ga0070683_100007899 | |||
| 1717 | Ga0070670_100000066 | |||
| 1718 | Ga0070670_100007196 | |||
| 1719 | Ga0070670_100007723 | |||
| 1720 | Ga0070670_100009172 | |||
| 1721 | Ga0070670_100013630 | |||
| 1722 | Ga0068869_100001188 | |||
| 1723 | Ga0068869_100007725 | |||
| 1724 | Ga0070666_10000801 | |||
| 1725 | Ga0070666_10004064 | |||
| 1726 | Ga0070680_100032610 | |||
| 1727 | Ga0070680_100033131 | |||
| 1728 | Ga0070680_100055358 | |||
| 1729 | Ga0070680_100061857 | |||
| 1730 | Ga0068868_100022586 | |||
| 1731 | Ga0070661_100001439 | |||
| 1732 | Ga0070661_100032588 | |||
| 1733 | Ga0070668_100000032 | |||
| 1734 | Ga0070668_100001127 | |||
| 1735 | Ga0070668_100001958 | |||
| 1736 | Ga0070668_100004263 | |||
| 1737 | Ga0070668_100006735 | |||
| 1738 | Ga0070668_100027740 | |||
| 1739 | Ga0070669_100000233 | |||
| 1740 | Ga0070669_100004590 | |||
| 1741 | Ga0070669_100004761 | |||
| 1742 | Ga0070669_100008033 | |||
| 1743 | Ga0070669_100009909 | |||
| 1744 | Ga0070675_100004013 | |||
| 1745 | Ga0070675_100006340 | |||
| 1746 | Ga0070675_100024299 | |||
| 1747 | Ga0070675_100034848 | |||
| 1748 | Ga0070675_100044927 | |||
| 1749 | Ga0070671_100012016 | |||
| 1750 | Ga0070673_100001777 | |||
| 1751 | Ga0070673_100019119 | |||
| 1752 | Ga0070673_100023738 | |||
| 1753 | Ga0070688_100003732 | |||
| 1754 | Ga0070659_100009972 | |||
| 1755 | Ga0070667_100000526 | |||
| 1756 | Ga0070667_100000619 | |||
| 1757 | Ga0070667_100002498 | |||
| 1758 | Ga0070667_100011068 | |||
| 1759 | Ga0070667_100016674 | |||
| 1760 | Ga0070709_10008708 | |||
| 1761 | Ga0070714_100030984 | |||
| 1762 | Ga0070714_100061393 | |||
| 1763 | Ga0070714_100066765 | |||
| 1764 | Ga0070713_100000894 | |||
| 1765 | Ga0070710_10004687 | |||
| 1766 | Ga0070710_10009230 | |||
| 1767 | Ga0070711_100002080 | |||
| 1768 | Ga0070711_100008621 | |||
| 1769 | Ga0070700_100007179 | |||
| 1770 | Ga0070708_100000012 | |||
| 1771 | Ga0070663_100008924 | |||
| 1772 | Ga0070663_100020283 | |||
| 1773 | Ga0070678_100000361 | |||
| 1774 | Ga0070678_100010959 | |||
| 1775 | Ga0070662_100001331 | |||
| 1776 | Ga0070681_10008326 | |||
| 1777 | Ga0068867_100001440 | |||
| 1778 | Ga0068867_100001447 | |||
| 1779 | Ga0070698_100022285 | |||
| 1780 | Ga0070699_100017152 | |||
| 1781 | Ga0070699_100021712 | |||
| 1782 | Ga0070679_100006990 | |||
| 1783 | Ga0070679_100019021 | |||
| 1784 | Ga0070679_100034216 | |||
| 1785 | Ga0070679_100059192 | |||
| 1786 | Ga0070684_100003445 | |||
| 1787 | Ga0070684_100017952 | |||
| 1788 | Ga0070684_100051145 | |||
| 1789 | Ga0068853_100000029 | |||
| 1790 | Ga0068853_100004618 | |||
| 1791 | Ga0068853_100008416 | |||
| 1792 | Ga0070672_100014409 | |||
| 1793 | Ga0070672_100036731 | |||
| 1794 | Ga0070665_100000751 | |||
| 1795 | Ga0070665_100000824 | |||
| 1796 | Ga0070665_100003493 | |||
| 1797 | Ga0070665_100006084 | |||
| 1798 | Ga0070665_100012520 | |||
| 1799 | Ga0070665_100036175 | |||
| 1800 | Ga0070665_100036817 | |||
| 1801 | Ga0068855_100016264 | |||
| 1802 | Ga0068855_100042590 | |||
| 1803 | Ga0070664_100000531 | |||
| 1804 | Ga0070664_100010616 | |||
| 1805 | Ga0068857_100005533 | |||
| 1806 | Ga0068857_100027111 | |||
| 1807 | Ga0068856_100000432 | |||
| 1808 | Ga0068856_100034833 | |||
| 1809 | Ga0068856_100057227 | |||
| 1810 | Ga0068856_100062862 | |||
| 1811 | Ga0070702_100025638 | |||
| 1812 | Ga0068852_100025278 | |||
| 1813 | Ga0068852_100036675 | |||
| 1814 | Ga0068859_100002359 | |||
| 1815 | Ga0068859_100003198 | |||
| 1816 | Ga0068859_100012416 | |||
| 1817 | Ga0068859_100083408 | |||
| 1818 | Ga0068864_100000132 | |||
| 1819 | Ga0068864_100000273 | |||
| 1820 | Ga0068864_100001673 | |||
| 1821 | Ga0068864_100016393 | |||
| 1822 | Ga0068864_100022148 | |||
| 1823 | Ga0068861_100002284 | |||
| 1824 | Ga0068861_100031773 | |||
| 1825 | Ga0068851_10000035 | |||
| 1826 | Ga0068851_10006945 | |||
| 1827 | Ga0068870_10004164 | |||
| 1828 | Ga0068863_100000142 | |||
| 1829 | Ga0068863_100002817 | |||
| 1830 | Ga0068863_100003818 | |||
| 1831 | Ga0068863_100004135 | |||
| 1832 | Ga0068863_100011071 | |||
| 1833 | Ga0068863_100017414 | |||
| 1834 | Ga0068858_100001039 | |||
| 1835 | Ga0068858_100002619 | |||
| 1836 | Ga0068858_100007621 | |||
| 1837 | Ga0068858_100029555 | |||
| 1838 | Ga0068860_100000295 | |||
| 1839 | Ga0068860_100004046 | |||
| 1840 | Ga0068860_100004537 | |||
| 1841 | Ga0068860_100018230 | |||
| 1842 | Ga0068860_100026653 | |||
| 1843 | Ga0068862_100000238 | |||
| 1844 | Ga0068862_100011179 | |||
| 1845 | Ga0068862_100011348 | |||
| 1846 | Ga0068862_100058205 | |||
| 1847 | Ga0081455_10000633 | |||
| 1848 | Ga0081455_10002844 | |||
| 1849 | Ga0081455_10008295 | |||
| 1850 | Ga0081455_10012886 | |||
| 1851 | Ga0081455_10020150 | |||
| 1852 | Ga0081455_10023112 | |||
| 1853 | Ga0081538_10005211 | |||
| 1854 | Ga0081538_10034611 | |||
| 1855 | Ga0081540_1003693 | |||
| 1856 | Ga0081540_1005997 | |||
| 1857 | Ga0081540_1014711 | |||
| 1858 | Ga0081540_1020374 | |||
| 1859 | Ga0081539_10000040 | |||
| 1860 | Ga0081539_10002152 | |||
| 1861 | Ga0070717_10003674 | |||
| 1862 | Ga0070717_10018962 | |||
| 1863 | Ga0070717_10027490 | |||
| 1864 | Ga0070717_10035736 | |||
| 1865 | Ga0075365_10010751 | |||
| 1866 | Ga0075368_10011691 | |||
| 1867 | Ga0075363_100032087 | |||
| 1868 | Ga0075432_10005107 | |||
| 1869 | Ga0070715_10001868 | |||
| 1870 | Ga0070716_100012041 | |||
| 1871 | Ga0070712_100004848 | |||
| 1872 | Ga0070712_100010245 | |||
| 1873 | Ga0070712_100012801 | |||
| 1874 | Ga0075369_10005528 | |||
| 1875 | Ga0097621_100019504 | |||
| 1876 | Ga0097621_100023896 | |||
| 1877 | Ga0068871_100025300 | |||
| 1878 | Ga0075428_100020463 | |||
| 1879 | Ga0075430_100000066 | |||
| 1880 | Ga0075430_100002359 | |||
| 1881 | Ga0075431_100102583 | |||
| 1882 | Ga0068865_100049130 | |||
| 1883 | Ga0097620_100002358 | |||
| 1884 | Ga0097620_100003197 | |||
| 1885 | Ga0097620_100012415 | |||
| 1886 | Ga0097620_100083406 | |||
| 1887 | Ga0099825_1016067 | |||
| 1888 | Ga0099824_1014113 | |||
| 1889 | Ga0099822_1006926 | |||
| 1890 | Ga0099823_1007118 | |||
| 1891 | Ga0079104_1000423 | |||
| 1892 | Ga0079104_1001202 | |||
| 1893 | Ga0105251_10000118 | |||
| 1894 | Ga0105251_10000191 | |||
| 1895 | Ga0105251_10001252 | |||
| 1896 | Ga0105251_10005196 | |||
| 1897 | Ga0105251_10005418 | |||
| 1898 | Ga0105251_10014131 | |||
| 1899 | Ga0105244_10000593 | |||
| 1900 | Ga0105244_10000969 | |||
| 1901 | Ga0105244_10001341 | |||
| 1902 | Ga0105244_10019846 | |||
| 1903 | Ga0105244_10020929 | |||
| 1904 | Ga0105244_10025551 | |||
| 1905 | Ga0105244_10027558 | |||
| 1906 | Ga0105250_10000251 | |||
| 1907 | Ga0105250_10002362 | |||
| 1908 | Ga0105250_10002665 | |||
| 1909 | Ga0105250_10003074 | |||
| 1910 | Ga0105240_10002394 | |||
| 1911 | Ga0105240_10047754 | |||
| 1912 | Ga0105240_10056069 | |||
| 1913 | Ga0105240_10092314 | |||
| 1914 | Ga0111539_10000323 | |||
| 1915 | Ga0111539_10050591 | |||
| 1916 | Ga0114129_10009029 | |||
| 1917 | Ga0114129_10044968 | |||
| 1918 | Ga0105243_10000299 | |||
| 1919 | Ga0105243_10001887 | |||
| 1920 | Ga0105243_10003109 | |||
| 1921 | Ga0105243_10020011 | |||
| 1922 | Ga0105243_10042863 | |||
| 1923 | Ga0105242_10000465 | |||
| 1924 | Ga0105242_10040171 | |||
| 1925 | Ga0105248_10000648 | |||
| 1926 | Ga0105248_10001325 | |||
| 1927 | Ga0105248_10009379 | |||
| 1928 | Ga0105248_10009617 | |||
| 1929 | Ga0105237_10002856 | |||
| 1930 | Ga0105237_10023860 | |||
| 1931 | Ga0105237_10025304 | |||
| 1932 | Ga0105237_10027605 | |||
| 1933 | Ga0105238_10014059 | |||
| 1934 | Ga0105238_10014372 | |||
| 1935 | Ga0105238_10015143 | |||
| 1936 | Ga0105249_10000237 | |||
| 1937 | Ga0105249_10045838 | |||
| 1938 | Ga0105249_10076393 | |||
| 1939 | Ga0105239_10013419 | |||
| 1940 | Ga0105239_10036008 | |||
| 1941 | Ga0105246_10000445 | |||
| 1942 | Ga0105246_10005000 | |||
| 1943 | Ga0105246_10016063 | |||
| 1944 | Ga0157345_1000228 | |||
| 1945 | Ga0157373_10004675 | |||
| 1946 | Ga0157373_10006022 | |||
| 1947 | Ga0157371_10000238 | |||
| 1948 | Ga0157371_10006967 | |||
| 1949 | Ga0157370_10026265 | |||
| 1950 | Ga0157370_10037678 | |||
| 1951 | Ga0157369_10014104 | |||
| 1952 | Ga0157369_10014525 | |||
| 1953 | Ga0157369_10055180 | |||
| 1954 | Ga0157369_10066221 | |||
| 1955 | Ga0157378_10004733 | |||
| 1956 | Ga0163162_10020131 | |||
| 1957 | Ga0163162_10022074 | |||
| 1958 | Ga0163162_10042652 | |||
| 1959 | Ga0163162_10047143 | |||
| 1960 | Ga0163162_10073208 | |||
| 1961 | Ga0163162_10134325 | |||
| 1962 | Ga0157372_10000711 | |||
| 1963 | Ga0157372_10020723 | |||
| 1964 | Ga0157375_10009131 | |||
| 1965 | Ga0157375_10018608 | |||
| 1966 | Ga0157375_10021792 | |||
| 1967 | Ga0157375_10044280 | |||
| 1968 | Ga0163163_10003123 | |||
| 1969 | Ga0163163_10004279 | |||
| 1970 | Ga0163163_10019108 | |||
| 1971 | Ga0163163_10075518 | |||
| 1972 | Ga0157380_10016019 | |||
| 1973 | Ga0157380_10020785 | |||
| 1974 | Ga0182008_10004318 | |||
| 1975 | Ga0182008_10004478 | |||
| 1976 | Ga0182008_10008335 | |||
| 1977 | Ga0182008_10012516 | |||
| 1978 | Ga0182008_10019813 | |||
| 1979 | Ga0157379_10000560 | |||
| 1980 | Ga0157379_10002826 | |||
| 1981 | Ga0157379_10002876 | |||
| 1982 | Ga0157379_10010463 | |||
| 1983 | Ga0157379_10018619 | |||
| 1984 | Ga0157376_10028999 | |||
| 1985 | Ga0182006_1000753 | |||
| 1986 | Ga0182006_1002918 | |||
| 1987 | Ga0182006_1003105 | |||
| 1988 | Ga0182005_1002245 | |||
| 1989 | Ga0182005_1005438 | |||
| 1990 | Ga0163161_10010542 | |||
| 1991 | Ga0163161_10012152 | |||
| 1992 | Ga0214544_1000007 | |||
| 1993 | Ga0214542_1000007 | |||
| 1994 | Ga0214545_1000006 | |||
| 1995 | Ga0214543_1000009 | |||
| 1996 | Ga0213876_10002289 | |||
| 1997 | Ga0213876_10009146 | |||
| 1998 | Ga0213876_10013063 | |||
| 1999 | Ga0213875_10000860 | |||
| 2000 | Ga0213875_10002209 | |||
| 2001 | Ga0209760_100080 | |||
| 2002 | Ga0209760_100159 | |||
| 2003 | Ga0209784_100087 | |||
| 2004 | Ga0209566_100106 | |||
| 2005 | Ga0209674_100128 | |||
| 2006 | Ga0209147_100129 | |||
| 2007 | Ga0209563_100122 | |||
| 2008 | Ga0209563_100636 | |||
| 2009 | Ga0207427_100014 | |||
| 2010 | Ga0207427_100016 | |||
| 2011 | Ga0209437_100011 | |||
| 2012 | Ga0209437_100016 | |||
| 2013 | Ga0209437_100499 | |||
| 2014 | Ga0209258_100352 | |||
| 2015 | Ga0209646_1000310 | |||
| 2016 | Ga0209677_100078 | |||
| 2017 | Ga0209677_100296 | |||
| 2018 | Ga0209677_101858 | |||
| 2019 | Ga0209148_1000526 | |||
| 2020 | Ga0209233_1000019 | |||
| 2021 | Ga0209233_1000036 | |||
| 2022 | Ga0209233_1003377 | |||
| 2023 | Ga0209455_1001742 | |||
| 2024 | Ga0209676_1000025 | |||
| 2025 | Ga0209676_1000032 | |||
| 2026 | Ga0209676_1000208 | |||
| 2027 | Ga0209676_1000519 | |||
| 2028 | Ga0209676_1003834 | |||
| 2029 | Ga0209564_1002226 | |||
| 2030 | Ga0209564_1002401 | |||
| 2031 | Ga0209564_1005204 | |||
| 2032 | Ga0209758_1000030 | |||
| 2033 | Ga0209758_1001439 | |||
| 2034 | Ga0209758_1004188 | |||
| 2035 | Ga0209758_1010096 | |||
| 2036 | Ga0209050_1000025 | |||
| 2037 | Ga0209050_1000028 | |||
| 2038 | Ga0209050_1000381 | |||
| 2039 | Ga0209050_1004562 | |||
| 2040 | Ga0207426_1000380 | |||
| 2041 | Ga0207426_1001158 | |||
| 2042 | Ga0209051_1000026 | |||
| 2043 | Ga0209051_1000039 | |||
| 2044 | Ga0209051_1000047 | |||
| 2045 | Ga0209051_1000080 | |||
| 2046 | Ga0209257_1000034 | |||
| 2047 | Ga0209257_1001899 | |||
| 2048 | Ga0207656_10000008 | |||
| 2049 | Ga0207656_10008944 | |||
| 2050 | Ga0207696_1000020 | |||
| 2051 | Ga0207696_1000057 | |||
| 2052 | Ga0207696_1000074 | |||
| 2053 | Ga0207696_1000084 | |||
| 2054 | Ga0207696_1002815 | |||
| 2055 | Ga0207696_1005271 | |||
| 2056 | Ga0207696_1006465 | |||
| 2057 | Ga0207696_1010017 | |||
| 2058 | Ga0207655_1000014 | |||
| 2059 | Ga0207655_1000556 | |||
| 2060 | Ga0207655_1000904 | |||
| 2061 | Ga0207655_1001007 | |||
| 2062 | Ga0207655_1001055 | |||
| 2063 | Ga0207655_1001190 | |||
| 2064 | Ga0207655_1001386 | |||
| 2065 | Ga0207655_1002635 | |||
| 2066 | Ga0207655_1004166 | |||
| 2067 | Ga0207655_1004754 | |||
| 2068 | Ga0207655_1006994 | |||
| 2069 | Ga0207655_1015505 | |||
| 2070 | Ga0207655_1020640 | |||
| 2071 | Ga0207713_1000031 | |||
| 2072 | Ga0207713_1000114 | |||
| 2073 | Ga0207713_1000814 | |||
| 2074 | Ga0207713_1000823 | |||
| 2075 | Ga0207713_1002649 | |||
| 2076 | Ga0207713_1005023 | |||
| 2077 | Ga0207713_1007272 | |||
| 2078 | Ga0207713_1017048 | |||
| 2079 | Ga0207713_1020419 | |||
| 2080 | Ga0207713_1022163 | |||
| 2081 | Ga0207682_10003038 | |||
| 2082 | Ga0207692_10000619 | |||
| 2083 | Ga0207688_10000740 | |||
| 2084 | Ga0207688_10006116 | |||
| 2085 | Ga0207688_10013242 | |||
| 2086 | Ga0207680_10005696 | |||
| 2087 | Ga0207647_10009114 | |||
| 2088 | Ga0207685_10001110 | |||
| 2089 | Ga0207645_10000381 | |||
| 2090 | Ga0207645_10006829 | |||
| 2091 | Ga0207645_10014705 | |||
| 2092 | Ga0207643_10002073 | |||
| 2093 | Ga0207643_10004363 | |||
| 2094 | Ga0207643_10015612 | |||
| 2095 | Ga0207684_10045086 | |||
| 2096 | Ga0207654_10000611 | |||
| 2097 | Ga0207707_10000749 | |||
| 2098 | Ga0207707_10009487 | |||
| 2099 | Ga0207707_10017756 | |||
| 2100 | Ga0207695_10000006 | |||
| 2101 | Ga0207695_10002336 | |||
| 2102 | Ga0207695_10010723 | |||
| 2103 | Ga0207695_10066281 | |||
| 2104 | Ga0207671_10000015 | |||
| 2105 | Ga0207671_10033720 | |||
| 2106 | Ga0207671_10037354 | |||
| 2107 | Ga0207693_10000701 | |||
| 2108 | Ga0207693_10003425 | |||
| 2109 | Ga0207693_10010113 | |||
| 2110 | Ga0207693_10025339 | |||
| 2111 | Ga0207663_10001487 | |||
| 2112 | Ga0207663_10011188 | |||
| 2113 | Ga0207663_10013624 | |||
| 2114 | Ga0207660_10013218 | |||
| 2115 | Ga0207660_10022948 | |||
| 2116 | Ga0207660_10030875 | |||
| 2117 | Ga0207657_10017514 | |||
| 2118 | Ga0207657_10047722 | |||
| 2119 | Ga0207649_10000001 | |||
| 2120 | Ga0207652_10021894 | |||
| 2121 | Ga0207646_10062663 | |||
| 2122 | Ga0207681_10000683 | |||
| 2123 | Ga0207681_10003174 | |||
| 2124 | Ga0207681_10004247 | |||
| 2125 | Ga0207694_10004635 | |||
| 2126 | Ga0207694_10016745 | |||
| 2127 | Ga0207694_10033461 | |||
| 2128 | Ga0207650_10000110 | |||
| 2129 | Ga0207650_10000239 | |||
| 2130 | Ga0207650_10001925 | |||
| 2131 | Ga0207700_10011969 | |||
| 2132 | Ga0207700_10017997 | |||
| 2133 | Ga0207664_10003529 | |||
| 2134 | Ga0207644_10004280 | |||
| 2135 | Ga0207706_10000885 | |||
| 2136 | Ga0207706_10004496 | |||
| 2137 | Ga0207706_10009929 | |||
| 2138 | Ga0207706_10037403 | |||
| 2139 | Ga0207706_10066218 | |||
| 2140 | Ga0207709_10000451 | |||
| 2141 | Ga0207709_10001143 | |||
| 2142 | Ga0207709_10002422 | |||
| 2143 | Ga0207709_10013497 | |||
| 2144 | Ga0207669_10001538 | |||
| 2145 | Ga0207704_10000667 | |||
| 2146 | Ga0207665_10003410 | |||
| 2147 | Ga0207665_10003934 | |||
| 2148 | Ga0207691_10001601 | |||
| 2149 | Ga0207691_10001942 | |||
| 2150 | Ga0207691_10019038 | |||
| 2151 | Ga0207691_10035493 | |||
| 2152 | Ga0207711_10012404 | |||
| 2153 | Ga0207711_10057207 | |||
| 2154 | Ga0207689_10000548 | |||
| 2155 | Ga0207689_10013134 | |||
| 2156 | Ga0207689_10016085 | |||
| 2157 | Ga0207661_10000379 | |||
| 2158 | Ga0207679_10000009 | |||
| 2159 | Ga0207667_10018585 | |||
| 2160 | Ga0207667_10024759 | |||
| 2161 | Ga0207667_10065460 | |||
| 2162 | Ga0207651_10008314 | |||
| 2163 | Ga0207651_10014919 | |||
| 2164 | Ga0207651_10027417 | |||
| 2165 | Ga0207712_10000185 | |||
| 2166 | Ga0207712_10010895 | |||
| 2167 | Ga0207668_10000003 | |||
| 2168 | Ga0207668_10000658 | |||
| 2169 | Ga0207668_10005943 | |||
| 2170 | Ga0207668_10011392 | |||
| 2171 | Ga0207640_10034871 | |||
| 2172 | Ga0207658_10000158 | |||
| 2173 | Ga0207658_10004094 | |||
| 2174 | Ga0207658_10004956 | |||
| 2175 | Ga0207658_10023472 | |||
| 2176 | Ga0207703_10000746 | |||
| 2177 | Ga0207703_10002726 | |||
| 2178 | Ga0207703_10013036 | |||
| 2179 | Ga0207703_10020233 | |||
| 2180 | Ga0207639_10000090 | |||
| 2181 | Ga0207639_10030720 | |||
| 2182 | Ga0207678_10005581 | |||
| 2183 | Ga0207678_10006762 | |||
| 2184 | Ga0207678_10024159 | |||
| 2185 | Ga0207708_10001830 | |||
| 2186 | Ga0207708_10026202 | |||
| 2187 | Ga0207702_10000122 | |||
| 2188 | Ga0207702_10000598 | |||
| 2189 | Ga0207702_10063134 | |||
| 2190 | Ga0207641_10003431 | |||
| 2191 | Ga0207641_10005395 | |||
| 2192 | Ga0207641_10006693 | |||
| 2193 | Ga0207641_10009156 | |||
| 2194 | Ga0207641_10035165 | |||
| 2195 | Ga0207648_10000330 | |||
| 2196 | Ga0207648_10006413 | |||
| 2197 | Ga0207648_10010744 | |||
| 2198 | Ga0207648_10011827 | |||
| 2199 | Ga0207648_10015832 | |||
| 2200 | Ga0207676_10000522 | |||
| 2201 | Ga0207676_10001311 | |||
| 2202 | Ga0207676_10003518 | |||
| 2203 | Ga0207676_10005910 | |||
| 2204 | Ga0207674_10005808 | |||
| 2205 | Ga0207674_10016864 | |||
| 2206 | Ga0207674_10041147 | |||
| 2207 | Ga0207675_100001548 | |||
| 2208 | Ga0207675_100002647 | |||
| 2209 | Ga0207675_100020818 | |||
| 2210 | Ga0207675_100041472 | |||
| 2211 | Ga0207683_10000528 | |||
| 2212 | Ga0207683_10005690 | |||
| 2213 | Ga0207683_10007332 | |||
| 2214 | Ga0207698_10013528 | |||
| 2215 | Ga0209281_1000026 | |||
| 2216 | Ga0209281_1000033 | |||
| 2217 | Ga0209281_1002039 | |||
| 2218 | Ga0209389_1000015 | |||
| 2219 | Ga0209389_1000165 | |||
| 2220 | Ga0209389_1000190 | |||
| 2221 | Ga0209371_1000630 | |||
| 2222 | Ga0209589_1001841 | |||
| 2223 | Ga0209589_1006092 | |||
| 2224 | Ga0209489_100072 | |||
| 2225 | Ga0209489_102693 | |||
| 2226 | Ga0209489_105989 | |||
| 2227 | Ga0209700_100034 | |||
| 2228 | Ga0209700_105810 | |||
| 2229 | Ga0209995_1001318 | |||
| 2230 | Ga0209983_1001251 | |||
| 2231 | Ga0207428_10000129 | |||
| 2232 | Ga0207428_10039490 | |||
| 2233 | Ga0207428_10061338 | |||
| 2234 | Ga0268266_10001049 | |||
| 2235 | Ga0268266_10001217 | |||
| 2236 | Ga0268266_10003843 | |||
| 2237 | Ga0268266_10006228 | |||
| 2238 | Ga0268266_10007906 | |||
| 2239 | Ga0268266_10026479 | |||
| 2240 | Ga0268265_10000246 | |||
| 2241 | Ga0268265_10037023 | |||
| 2242 | Ga0268264_10000187 | |||
| 2243 | Ga0268264_10000232 | |||
| 2244 | Ga0268264_10003098 | |||
| 2245 | Ga0268264_10031183 | |||
| 2246 | Ga0265337_1000506 | |||
| 2247 | Ga0265334_10002104 | |||
| 2248 | Ga0265334_10007245 | |||
| 2249 | Ga0265323_10005048 | |||
| 2250 | Ga0265336_10004816 | |||
| 2251 | Ga0307517_10000066 | |||
| 2252 | Ga0265338_10000973 | |||
| 2253 | Ga0268256_1000273 | |||
| 2254 | Ga0268256_1000278 | |||
| 2255 | Ga0316178_1102168 | |||
| 2256 | Ga0316181_1018381 | |||
| 2257 | Ga0265330_10009710 | |||
| 2258 | Ga0265330_10024206 | |||
| 2259 | Ga0265332_10000730 | |||
| 2260 | Ga0265332_10003203 | |||
| 2261 | Ga0265332_10010155 | |||
| 2262 | Ga0265328_10000008 | |||
| 2263 | Ga0265328_10003910 | |||
| 2264 | Ga0265325_10002761 | |||
| 2265 | Ga0265340_10002240 | |||
| 2266 | Ga0265339_10002540 | |||
| 2267 | Ga0265331_10000038 | |||
| 2268 | Ga0265331_10001798 | |||
| 2269 | Ga0265327_10007946 | |||
| 2270 | Ga0265316_10000387 | |||
| 2271 | Ga0307513_10005099 | |||
| 2272 | Ga0307408_100000004 | |||
| 2273 | Ga0307408_100028865 | |||
| 2274 | Ga0265313_10000223 | |||
| 2275 | Ga0307508_10000613 | |||
| 2276 | Ga0265314_10008057 | |||
| 2277 | Ga0265314_10022262 | |||
| 2278 | Ga0265342_10000308 | |||
| 2279 | Ga0307516_10012541 | |||
| 2280 | Ga0307410_10027576 | |||
| 2281 | Ga0307411_10021448 | |||
| 2282 | Ga0307411_10043985 | |||
| 2283 | Ga0307510_10011043 | |||
| 2284 | Ga0307510_10014026 | |||
| 2285 | Ga0307510_10016531 | |||
| 2286 | Ga0307510_10031045 | |||
| 2287 | Ga0315911_1000024 | |||
| 2288 | Ga0373934_0003933 | |||
| 2289 | Ga0373936_0001548 | |||
| 2290 | Ga0373941_0000462 | |||
| 2291 | Ga0373945_0013387 | |||
| 2292 | Ga0373953_0008441 | |||
| 2293 | Ga0373954_0000471 | |||
| 2294 | Ga0373954_0002347 | |||
| 2295 | Ga0373957_0003107 | |||
| 2296 | Ga0373924_0011467 | |||
| 2297 | Ga0373935_0019326 | |||
| 2298 | Ga0373927_0007892 | |||
| 2299 | Ga0373927_0009614 | |||
| 2300 | Ga0373927_0021704 | |||
| 2301 | Ga0373933_0000915 | |||
| 2302 | Ga0373947_0003547 | |||
| 2303 | Ga0373947_0027058 | |||
| 2304 | Ga0373937_0023179 | |||
| 2305 | Ga0316584_0065528 | |||
| 2306 | Ga0373925_0007117 | |||
| 2307 | Ga0373925_0019996 | |||
| 2308 | Ga0395900_0014639 | |||
| 2309 | Ga0395898_0004776 | |||
| 2310 | Ga0395898_0036586 | |||
| 2311 | Ga0395898_0049242 | |||
| 2312 | Ga0395905_0011164 | |||
| 2313 | Ga0436364_0348338 | |||
| 2314 | Ga0436364_0943018 | |||
| 2315 | Ga0436364_1171513 | |||
| 2316 | Ga0436364_1345588 | |||
| 2317 | Ga0395901_0101157 | |||
| 2318 | Ga0400483_231204 | |||
| 2319 | Ga0436365_0957972 | |||
| 2320 | Ga0436365_1045032 | |||
| 2321 | Ga0436365_1910924 | |||
| 2322 | Ga0436361_0615393 | |||
| 2323 | Ga0436363_0711625 | |||
| 2324 | Ga0436363_0726746 | |||
| 2325 | Ga0436363_1463967 | |||
| 2326 | Ga0436362_0841994 | |||
| 2327 | Ga0439436_0000952 | |||
| 2328 | Ga0439438_001868 | |||
| 2329 | Ga0439438_001970 | |||
| 2330 | Ga0439438_006265 | |||
| 2331 | Ga0439438_011272 | |||
| 2332 | Ga0439447_006383 | |||
| 2333 | Ga0439466_0001535 | |||
| 2334 | Ga0439466_0003548 | |||
| 2335 | Ga0439466_0006413 | |||
| 2336 | Ga0439466_0007342 | |||
| 2337 | Ga0439432_000775 | |||
| 2338 | Ga0439432_001464 | |||
| 2339 | Ga0439452_000786 | |||
| 2340 | Ga0439452_000858 | |||
| 2341 | Ga0439452_000882 | |||
| 2342 | Ga0439456_001355 | |||
| 2343 | Ga0439463_000059 | |||
| 2344 | Ga0450911_000004 | |||
| 2345 | Ga0450911_000355 | |||
| 2346 | Ga0450902_001778 | |||
| 2347 | Ga0450904_000009 | |||
| 2348 | Ga0450905_000464 | |||
| 2349 | Ga0450905_000945 | |||
| 2350 | Ga0450907_000601 | |||
| 2351 | Ga0450910_000437 | |||
| 2352 | Ga0439464_0005557 | |||
| 2353 | Ga0451577_0000005 | |||
| 2354 | Ga0451577_0000028 | |||
| 2355 | Ga0466972_0000264 | |||
| 2356 | Ga0453683_0008346 | |||
| 2357 | Ga0466966_0002003 | |||
| 2358 | Ga0466961_0001950 | |||
| 2359 | Ga0466963_0018905 | |||
| 2360 | Ga0453684_0000190 | |||
| 2361 | Ga0453684_0000390 | |||
| 2362 | Ga0453684_0001014 | |||
| 2363 | Ga0453684_0002558 | |||
| 2364 | Ga0466957_0031560 | |||
| 2365 | Ga0466959_0046208 | |||
| 2366 | Ga0451576_0000852 | |||
| 2367 | Ga0466958_0011628 | |||
| 2368 | Ga0495617_000455 | |||
| 2369 | Ga0495627_000023 | |||
| 2370 | Ga0495627_000774 | |||
| 2371 | Ga0495627_002193 | |||
| 2372 | Ga0495627_006533 | |||
| 2373 | Ga0495592_0020318 | |||
| 2374 | Ga0495603_0003090 | |||
| 2375 | Ga0495603_0011291 | |||
| 2376 | Ga0495590_0008010 | |||
| 2377 | Ga0495591_000025 | |||
| 2378 | Ga0495591_000668 | |||
| 2379 | Ga0495591_001374 | |||
| 2380 | Ga0495591_002991 | |||
| 2381 | Ga0495591_003186 | |||
| 2382 | Ga0495591_003225 | |||
| 2383 | Ga0495591_006806 | |||
| 2384 | Ga0495591_013521 | |||
| 2385 | Ga0495629_0000151 | |||
| 2386 | Ga0495629_0003854 | |||
| 2387 | Ga0495638_0005305 | |||
| 2388 | Ga0495638_0006494 | |||
| 2389 | Ga0495638_0032114 | |||
| 2390 | Ga0495651_0005755 | |||
| 2391 | Ga0495651_0029501 | |||
| 2392 | Ga0495651_0060342 | |||
| 2393 | Ga0495653_0001308 | |||
| 2394 | Ga0495653_0024403 | |||
| 2395 | Ga0495653_0031130 | |||
| 2396 | Ga0495650_0001958 | |||
| 2397 | Ga0495650_0006161 | |||
| 2398 | Ga0495650_0011367 | |||
| 2399 | Ga0495582_0000218 | |||
| 2400 | Ga0495582_0003858 | |||
| 2401 | Ga0495605_0000095 | |||
| 2402 | Ga0495605_0000210 | |||
| 2403 | Ga0495605_0000677 | |||
| 2404 | Ga0495605_0000927 | |||
| 2405 | Ga0495605_0006722 | |||
| 2406 | Ga0495639_0001263 | |||
| 2407 | Ga0495639_0002288 | |||
| 2408 | Ga0495662_0000275 | |||
| 2409 | Ga0495664_0005513 | |||
| 2410 | Ga0495664_0005666 | |||
| 2411 | Ga0495664_0018049 | |||
| 2412 | Ga0495664_0029990 | |||
| 2413 | Ga0495584_0003049 | |||
| 2414 | Ga0495584_0003944 | |||
| 2415 | Ga0495584_0014091 | |||
| 2416 | Ga0495585_0004764 | |||
| 2417 | Ga0495585_0004972 | |||
| 2418 | Ga0495585_0008391 | |||
| 2419 | Ga0495585_0036910 | |||
| 2420 | Ga0495594_0001418 | |||
| 2421 | Ga0495596_0000545 | |||
| 2422 | Ga0495596_0002377 | |||
| 2423 | Ga0495607_0000069 | |||
| 2424 | Ga0495607_0000673 | |||
| 2425 | Ga0495607_0001262 | |||
| 2426 | Ga0495607_0001270 | |||
| 2427 | Ga0495607_0002719 | |||
| 2428 | Ga0495607_0004514 | |||
| 2429 | Ga0495607_0007059 | |||
| 2430 | Ga0495607_0018106 | |||
| 2431 | Ga0495607_0023960 | |||
| 2432 | Ga0495607_0027869 | |||
| 2433 | Ga0495583_0000015 | |||
| 2434 | Ga0495583_0000779 | |||
| 2435 | Ga0495583_0009541 | |||
| 2436 | Ga0495606_0000447 | |||
| 2437 | Ga0495606_0000453 | |||
| 2438 | Ga0495606_0003923 | |||
| 2439 | Ga0495606_0008979 | |||
| 2440 | Ga0495606_0009017 | |||
| 2441 | Ga0495606_0012643 | |||
| 2442 | Ga0495606_0013024 | |||
| 2443 | Ga0495606_0026931 | |||
| 2444 | Ga0495610_0005104 | |||
| 2445 | Ga0495610_0006937 | |||
| 2446 | Ga0495610_0007026 | |||
| 2447 | Ga0495610_0014582 | |||
| 2448 | Ga0495616_0005043 | |||
| 2449 | Ga0495616_0015427 | |||
| 2450 | Ga0495620_0000042 | |||
| 2451 | Ga0495620_0000146 | |||
| 2452 | Ga0495620_0000422 | |||
| 2453 | Ga0495620_0001025 | |||
| 2454 | Ga0495631_0001255 | |||
| 2455 | Ga0495631_0005285 | |||
| 2456 | Ga0495631_0033636 | |||
| 2457 | Ga0495632_0001743 | |||
| 2458 | Ga0495632_0004240 | |||
| 2459 | Ga0495632_0004428 | |||
| 2460 | Ga0495632_0013905 | |||
| 2461 | Ga0495637_0000682 | |||
| 2462 | Ga0495637_0002317 | |||
| 2463 | Ga0495637_0002721 | |||
| 2464 | Ga0495637_0002917 | |||
| 2465 | Ga0495637_0004370 | |||
| 2466 | Ga0495637_0011231 | |||
| 2467 | Ga0495637_0011386 | |||
| 2468 | Ga0495637_0014482 | |||
| 2469 | Ga0495637_0016000 | |||
| 2470 | Ga0495643_0000291 | |||
| 2471 | Ga0495643_0015422 | |||
| 2472 | Ga0495643_0016513 | |||
| 2473 | Ga0495643_0019980 | |||
| 2474 | Ga0495648_0000581 | |||
| 2475 | Ga0495648_0003184 | |||
| 2476 | Ga0495648_0005967 | |||
| 2477 | Ga0495648_0006246 | |||
| 2478 | Ga0495648_0008715 | |||
| 2479 | Ga0495648_0008856 | |||
| 2480 | Ga0495648_0013653 | |||
| 2481 | Ga0495648_0015287 | |||
| 2482 | Ga0495648_0033685 | |||
| 2483 | Ga0495642_0000662 | |||
| 2484 | Ga0495652_0017151 | |||
| 2485 | Ga0495652_0017750 | |||
| 2486 | Ga0495652_0025015 | |||
| 2487 | Ga0495654_0002507 | |||
| 2488 | Ga0495654_0002748 | |||
| 2489 | Ga0495654_0003902 | |||
| 2490 | Ga0495654_0005124 | |||
| 2491 | Ga0495654_0011853 | |||
| 2492 | Ga0495654_0012016 | |||
| 2493 | Ga0495654_0031443 | |||
| 2494 | Ga0495665_0000163 | |||
| 2495 | Ga0495640_0014322 | |||
| 2496 | Ga0495587_0011173 | |||
| 2497 | Ga0495587_0029971 | |||
| 2498 | Ga0495609_0000053 | |||
| 2499 | Ga0495609_0000133 | |||
| 2500 | Ga0495609_0000283 | |||
| 2501 | Ga0495609_0004006 | |||
| 2502 | Ga0495609_0019392 | |||
| 2503 | Ga0495597_0000229 | |||
| 2504 | Ga0495597_0002956 | |||
| 2505 | Ga0495645_0018664 | |||
| 2506 | Ga0495645_0019601 | |||
| 2507 | Ga0495645_0019829 | |||
| 2508 | Ga0495622_0001532 | |||
| 2509 | Ga0495633_0000115 | |||
| 2510 | Ga0495667_0010071 | |||
| 2511 | Ga0495668_0005524 | |||
| 2512 | Ga0495668_0005672 | |||
| 2513 | Ga0495668_0037455 | |||
| 2514 | Ga0495634_0000460 | |||
| 2515 | Ga0495634_0008719 | |||
| 2516 | Ga0495611_0001987 | |||
| 2517 | Ga0495625_0000086 | |||
| 2518 | Ga0495625_0008159 | |||
| 2519 | Ga0495625_0010636 | |||
| 2520 | Ga0495625_0019236 | |||
| 2521 | Ga0495635_0000220 | |||
| 2522 | Ga0495635_0004179 | |||
| 2523 | Ga0495635_0010274 | |||
| 2524 | Ga0495659_0000820 | |||
| 2525 | Ga0495661_0000212 | |||
| 2526 | Ga0495661_0000346 | |||
| 2527 | Ga0495661_0001033 | |||
| 2528 | Ga0495661_0001808 | |||
| 2529 | Ga0495661_0002096 | |||
| 2530 | Ga0495661_0004232 | |||
| 2531 | Ga0495661_0006792 | |||
| 2532 | Ga0495661_0018066 | |||
| 2533 | Ga0495661_0019490 | |||
| 2534 | Ga0495661_0033117 | |||
| 2535 | Ga0495588_0011868 | |||
| 2536 | Ga0495657_0008639 | |||
| 2537 | Ga0495657_0035214 | |||
| 2538 | Ga0495599_0001306 | |||
| 2539 | Ga0495623_0014332 | |||
| 2540 | Ga0495646_0016370 | |||
| 2541 | Ga0495646_0030360 | |||
| 2542 | Ga0495647_0000198 | |||
| 2543 | Ga0495658_0004750 | |||
| 2544 | Ga0495669_0004199 | |||
| 2545 | Ga0495624_0001125 | |||
| 2546 | Ga0495624_0017858 | |||
| 2547 | Ga0495671_0000835 | |||
| 2548 | Ga0495671_0001729 | |||
| 2549 | Ga0495671_0003942 | |||
| 2550 | Ga0495671_0004570 | |||
| 2551 | Ga0495671_0004646 | |||
| 2552 | Ga0495671_0005715 | |||
| 2553 | Ga0495671_0017444 | |||
| 2554 | Ga0495649_0001824 | |||
| 2555 | Ga0495649_0003218 | |||
| 2556 | Ga0495649_0004772 | |||
| 2557 | Ga0495649_0009899 | |||
| 2558 | Ga0495649_0014957 | |||
| 2559 | Ga0495649_0027064 | |||
| 2560 | Ga0495589_0000918 | |||
| 2561 | Ga0495589_0008535 | |||
| 2562 | Ga0495600_0001974 | |||
| 2563 | Ga0495600_0004746 | |||
| 2564 | Ga0495600_0016566 | |||
| 2565 | Ga0495600_0023155 | |||
| 2566 | Ga0495660_0003154 | |||
| 2567 | Ga0495660_0005301 | |||
| 2568 | Ga0495660_0015068 | |||
| 2569 | Ga0495660_0018836 | |||
| 2570 | Ga0495660_0031101 | |||
| 2571 | Ga0495581_0000291 | |||
| 2572 | Ga0495581_0024438 | |||
| 2573 | Ga0495604_0007232 | |||
| 2574 | Ga0495604_0014146 | |||
| 2575 | Ga0495604_0031685 | |||
| 2576 | Ga0495604_0048267 | |||
| 2577 | Ga0495674_0000664 | |||
| 2578 | Ga0495674_0001989 | |||
| 2579 | Ga0495674_0056283 | |||
| 2580 | Ga0495672_0003884 | |||
| 2581 | Ga0495672_0004098 | |||
| 2582 | Ga0495672_0007315 | |||
| 2583 | Ga0495672_0007556 | |||
| 2584 | Ga0495672_0007891 | |||
| 2585 | Ga0495672_0013420 | |||
| 2586 | Ga0495672_0024326 | |||
| 2587 | Ga0495676_0000022 | |||
| 2588 | Ga0495676_0009309 | |||
| 2589 | Ga0495676_0013537 | |||
| 2590 | Ga0495680_0002433 | |||
| 2591 | Ga0495680_0014855 | |||
| 2592 | Ga0495680_0032392 | |||
| 2593 | Ga0495680_0032827 | |||
| 2594 | Ga0495680_0052704 | |||
| 2595 | Ga0495683_0000030 | |||
| 2596 | Ga0495683_0000586 | |||
| 2597 | Ga0495683_0003253 | |||
| 2598 | Ga0495683_0003911 | |||
| 2599 | Ga0495683_0015622 | |||
| 2600 | Ga0495687_004182 | |||
| 2601 | Ga0495687_004249 | |||
| 2602 | Ga0495675_0003482 | |||
| 2603 | Ga0495675_0004129 | |||
| 2604 | Ga0495675_0016335 | |||
| 2605 | Ga0495679_000212 | |||
| 2606 | Ga0495679_000341 | |||
| 2607 | Ga0495679_003057 | |||
| 2608 | Ga0495673_0001151 | |||
| 2609 | Ga0495673_0001296 | |||
| 2610 | Ga0495673_0004054 | |||
| 2611 | Ga0495673_0005337 | |||
| 2612 | Ga0495673_0006078 | |||
| 2613 | Ga0495673_0006250 | |||
| 2614 | Ga0495673_0013803 | |||
| 2615 | Ga0495673_0023377 | |||
| 2616 | Ga0495681_0004759 | |||
| 2617 | Ga0495681_0006405 | |||
| 2618 | Ga0495681_0026787 | |||
| 2619 | Ga0495684_0000133 | |||
| 2620 | Ga0495684_0020926 | |||
| 2621 | Ga0495686_0058827 | |||
| 2622 | Ga0495593_0000323 | |||
| 2623 | Ga0495602_0049834 | |||
| 2624 | Ga0495602_0054440 | |||
| 2625 | Ga0495602_0058139 | |||
| 2626 | Ga0495626_0000039 | |||
| 2627 | Ga0495626_0000242 | |||
| 2628 | Ga0495626_0001832 | |||
| 2629 | Ga0495626_0003058 | |||
| 2630 | Ga0495626_0004652 | |||
| 2631 | Ga0495626_0004671 | |||
| 2632 | Ga0495626_0018915 | |||
| 2633 | Ga0496102_0002921 | |||
| 2634 | Ga0496102_0025012 | |||
| 2635 | Ga0496102_0029706 | |||
| 2636 | Ga0496104_0002055 | |||
| 2637 | Ga0496104_0002496 | |||
| 2638 | Ga0496104_0012404 | |||
| 2639 | Ga0496104_0014417 | |||
| 2640 | Ga0496104_0026955 | |||
| 2641 | Ga0496104_0028265 | |||
| 2642 | Ga0496105_0000745 | |||
| 2643 | Ga0496105_0009357 | |||
| 2644 | Ga0496105_0012772 | |||
| 2645 | Ga0496105_0041847 | |||
| 2646 | Ga0496106_0004350 | |||
| 2647 | Ga0496106_0014763 | |||
| 2648 | Ga0496107_0003866 | |||
| 2649 | Ga0496107_0007228 | |||
| 2650 | Ga0496107_0055542 | |||
| 2651 | Ga0496108_0000442 | |||
| 2652 | Ga0496108_0001557 | |||
| 2653 | Ga0496108_0010081 | |||
| 2654 | Ga0496109_0001341 | |||
| 2655 | Ga0496109_0022776 | |||
| 2656 | Ga0496110_0014426 | |||
| 2657 | Ga0496110_0019399 | |||
| 2658 | Ga0496110_0025213 | |||
| 2659 | Ga0496110_0026026 | |||
| 2660 | Ga0496110_0036712 | |||
| 2661 | Ga0496111_0028481 | |||
| 2662 | Ga0496112_0000051 | |||
| 2663 | Ga0496112_0000655 | |||
| 2664 | Ga0496112_0030907 | |||
| 2665 | Ga0496113_0000982 | |||
| 2666 | Ga0496114_0007693 | |||
| 2667 | Ga0496114_0050155 | |||
| 2668 | Ga0496114_0078294 | |||
| 2669 | Ga0496115_0018715 | |||
| 2670 | Ga0496116_0000881 | |||
| 2671 | Ga0496116_0004615 | |||
| 2672 | Ga0496116_0005174 | |||
| 2673 | Ga0496116_0022410 | |||
| 2674 | Ga0496116_0027452 | |||
| 2675 | Ga0496117_0002861 | |||
| 2676 | Ga0496117_0008441 | |||
| 2677 | Ga0496117_0009463 | |||
| 2678 | Ga0496117_0029062 | |||
| 2679 | Ga0496117_0030174 | |||
| 2680 | Ga0496117_0041829 | |||
| 2681 | Ga0496118_0004108 | |||
| 2682 | Ga0496118_0009635 | |||
| 2683 | Ga0496118_0013389 | |||
| 2684 | Ga0496118_0024544 | |||
| 2685 | Ga0496118_0027349 | |||
| 2686 | Ga0496118_0045810 | |||
| 2687 | Ga0496119_0000060 | |||
| 2688 | Ga0496119_0002304 | |||
| 2689 | Ga0496119_0010712 | |||
| 2690 | Ga0496119_0022739 | |||
| 2691 | Ga0496119_0045531 | |||
| 2692 | Ga0496120_0003825 | |||
| 2693 | Ga0496121_0000144 | |||
| 2694 | Ga0496121_0001650 | |||
| 2695 | Ga0496121_0003740 | |||
| 2696 | Ga0496121_0007337 | |||
| 2697 | Ga0496121_0012757 | |||
| 2698 | Ga0496121_0013250 | |||
| 2699 | Ga0496121_0014564 | |||
| 2700 | Ga0496121_0014671 | |||
| 2701 | Ga0496121_0019695 | |||
| 2702 | Ga0496122_0001366 | |||
| 2703 | Ga0496122_0002897 | |||
| 2704 | Ga0496122_0005797 | |||
| 2705 | Ga0496122_0011268 | |||
| 2706 | Ga0496122_0034155 | |||
| 2707 | Ga0496122_0071400 | |||
| 2708 | Ga0496123_0001033 | |||
| 2709 | Ga0496123_0001703 | |||
| 2710 | Ga0496123_0013950 | |||
| 2711 | Ga0496124_0000120 | |||
| 2712 | Ga0496124_0010997 | |||
| 2713 | Ga0496124_0011914 | |||
| 2714 | Ga0496124_0021692 | |||
| 2715 | Ga0496124_0043648 | |||
| 2716 | Ga0496124_0047212 | |||
| 2717 | Ga0496124_0050045 | |||
| 2718 | Ga0496124_0065564 | |||
| 2719 | Ga0496125_0000099 | |||
| 2720 | Ga0496125_0003667 | |||
| 2721 | Ga0496125_0009550 | |||
| 2722 | Ga0496125_0010381 | |||
| 2723 | Ga0496125_0013483 | |||
| 2724 | Ga0496125_0021610 | |||
| 2725 | Ga0496125_0025971 | |||
| 2726 | Ga0496125_0031206 | |||
| 2727 | Ga0496126_0002484 | |||
| 2728 | Ga0496126_0026919 | |||
| 2729 | Ga0496126_0028855 | |||
| 2730 | Ga0496126_0054275 | |||
| 2731 | Ga0495678_000017 | |||
| 2732 | Ga0495678_000238 | |||
| 2733 | Ga0495678_001946 | |||
| 2734 | Ga0495682_0001189 | |||
| 2735 | Ga0495682_0002650 | |||
| 2736 | Ga0501032_0000227 | |||
| 2737 | Ga0501032_0019020 | |||
| 2738 | Ga0501033_0004294 | |||
| 2739 | Ga0501033_0006907 | |||
| 2740 | Ga0501034_0000089 | |||
| 2741 | Ga0501034_0000100 | |||
| 2742 | Ga0501034_0000295 | |||
| 2743 | Ga0501034_0001845 | |||
| 2744 | Ga0501034_0047008 | |||
| 2745 | Ga0501036_0000010 | |||
| 2746 | Ga0501036_0000217 | |||
| 2747 | Ga0501037_0000183 | |||
| 2748 | Ga0501037_0016096 | |||
| 2749 | Ga0501038_0000054 | |||
| 2750 | Ga0501039_0000110 | |||
| 2751 | Ga0501039_0011119 | |||
| 2752 | Ga0501043_0000106 | |||
| 2753 | Ga0501043_0023015 | |||
| 2754 | Ga0501046_0004933 | |||
| 2755 | Ga0501047_0000363 | |||
| 2756 | Ga0501047_0000702 | |||
| 2757 | Ga0501047_0036630 | |||
| 2758 | Ga0501048_0000031 | |||
| 2759 | Ga0501048_0000456 | |||
| 2760 | Ga0501048_0052267 | |||
| 2761 | Ga0501067_0003366 | |||
| 2762 | Ga0501068_0005210 | |||
| 2763 | Ga0501070_0001016 | |||
| 2764 | Ga0501070_0033697 | |||
| 2765 | Ga0501072_0001530 | |||
| 2766 | Ga0501073_0000238 | |||
| 2767 | Ga0501074_0000259 | |||
| 2768 | Ga0501074_0031393 | |||
| 2769 | Ga0501079_0004438 | |||
| 2770 | Ga0501080_0000279 | |||
| 2771 | Ga0501083_0000550 | |||
| 2772 | Ga0501083_0001701 | |||
| 2773 | Ga0501035_0000817 | |||
| 2774 | Ga0501035_0008622 | |||
| 2775 | Ga0501044_0002385 | |||
| 2776 | Ga0501044_0009141 | |||
| 2777 | Ga0501044_0037223 | |||
| 2778 | Ga0501044_0039631 | |||
| 2779 | Ga0501226_000003 | |||
| 2780 | nmdc:mga03n38_25615_c1 | |||
| 2781 | nmdc:mga00v17_23809_c1 | |||
| 2782 | nmdc:mga00v17_28528_c1 | |||
| 2783 | nmdc:mga0yw44_1210_c1 | |||
| 2784 | nmdc:mga0yw44_7385_c1 | |||
| 2785 | nmdc:mga0k408_25096_c1 | |||
| 2786 | nmdc:mga07m45_2171_c1 | |||
| 2787 | nmdc:mga05p37_15019_c1 | |||
| 2788 | nmdc:mga05p37_4278_c1 | |||
| 2789 | nmdc:mga09592_32400_c1 | |||
| 2790 | nmdc:mga0qj67_235_c1 | |||
| 2791 | nmdc:mga06r32_49651_c1 | |||
| 2792 | nmdc:mga08y16_51_c1 | |||
| 2793 | nmdc:mga0n895_11393_c1 | |||
| 2794 | nmdc:mga0n895_24802_c1 | |||
| 2795 | Ga0495601_0000314 | |||
| 2796 | Ga0495601_0002711 | |||
| 2797 | Ga0495601_0025781 | |||
| 2798 | Ga0495612_0003727 | |||
| 2799 | Ga0495595_0001460 | |||
| 2800 | Ga0495619_0001836 | |||
| 2801 | Ga0500578_0032414 | |||
| 2802 | Ga0500643_000231 | |||
| 2803 | Ga0500651_0001006 | |||
| 2804 | Ga0500566_0000527 | |||
| 2805 | Ga0500566_0000931 | |||
| 2806 | Ga0500566_0001874 | |||
| 2807 | Ga0500556_0000005 | |||
| 2808 | Ga0500556_0000148 | |||
| 2809 | Ga0500557_000180 | |||
| 2810 | Ga0500562_000305 | |||
| 2811 | Ga0500595_000469 | |||
| 2812 | Ga0500595_002835 | |||
| 2813 | Ga0500595_005065 | |||
| 2814 | Ga0500595_005098 | |||
| 2815 | Ga0500608_000871 | |||
| 2816 | Ga0500642_0000009 | |||
| 2817 | Ga0500642_0000087 | |||
| 2818 | Ga0500652_001138 | |||
| 2819 | Ga0500658_0010195 | |||
| 2820 | Ga0500559_0000723 | |||
| 2821 | Ga0500559_0001753 | |||
| 2822 | Ga0500577_0001505 | |||
| 2823 | Ga0500586_002742 | |||
| 2824 | Ga0500616_0000035 | |||
| 2825 | Ga0500634_0033053 | |||
| 2826 | Ga0500636_0000344 | |||
| 2827 | Ga0500636_0002110 | |||
| 2828 | Ga0500637_0000471 | |||
| 2829 | Ga0500625_002579 | |||
| 2830 | Ga0500601_000438 | |||
| 2831 | Ga0501084_0016383 | |||
| 2832 | Ga0501082_0008684 | |||
| 2833 | 2507504681 | |||
| 2834 | 2508539902 | |||
| 2835 | 2508694961 | |||
| 2836 | 2509149915 | |||
| 2837 | 2511258458 | |||
| 2838 | 2511265615 | |||
| 2839 | 2511272588 | |||
| 2840 | 2511280596 | |||
| 2841 | 2511288868 | |||
| 2842 | 2511293891 | |||
| 2843 | 2511299463 | |||
| 2844 | 2511315172 | |||
| 2845 | 2511322573 | |||
| 2846 | 2511323638 | |||
| 2847 | 2511332721 | |||
| 2848 | 2511337882 | |||
| 2849 | 2511345099 | |||
| 2850 | 2511349022 | |||
| 2851 | 2511356186 | |||
| 2852 | 2511361403 | |||
| 2853 | 2511368546 | |||
| 2854 | 2511378018 | |||
| 2855 | 2511398851 | |||
| 2856 | 2511411232 | |||
| 2857 | 2511822351 | |||
| 2858 | 2512325873 | |||
| 2859 | 2513625625 | |||
| 2860 | 2513640695 | |||
| 2861 | 2513653439 | |||
| 2862 | 2513658874 | |||
| 2863 | 2513678455 | |||
| 2864 | 2513698127 | |||
| 2865 | 2513701756 | |||
| 2866 | 2513714884 | |||
| 2867 | 2513858934 | |||
| 2868 | 2513874040 | |||
| 2869 | 2513889652 | |||
| 2870 | 2513921138 | |||
| 2871 | 2514010190 | |||
| 2872 | 2515627767 | |||
| 2873 | 2517108692 | |||
| 2874 | 2517889552 | |||
| 2875 | 2524438604 | |||
| 2876 | 2524466156 | |||
| 2877 | 2524539572 | |||
| 2878 | 2524610623 | |||
| 2879 | 2528854749 | |||
| 2880 | 2554815533 | |||
| 2881 | 2555247801 | |||
| 2882 | 2555667336 | |||
| 2883 | 2583789886 | |||
| 2884 | 2597855580 | |||
| 2885 | 2597861582 | |||
| 2886 | 2597867302 | |||
| 2887 | 2599327479 | |||
| 2888 | 2599356559 | |||
| 2889 | 2599363411 | |||
| 2890 | 2599369637 | |||
| 2891 | 2599376520 | |||
| 2892 | 2599381664 | |||
| 2893 | 2599388192 | |||
| 2894 | 2599395284 | |||
| 2895 | 2599398938 | |||
| 2896 | 2599407049 | |||
| 2897 | 2599450993 | |||
| 2898 | 2599463392 | |||
| 2899 | 2599469258 | |||
| 2900 | 2599485482 | |||
| 2901 | 2599492409 | |||
| 2902 | 2599502569 | |||
| 2903 | 2599506352 | |||
| 2904 | 2599514061 | |||
| 2905 | 2599518662 | |||
| 2906 | 2599613048 | |||
| 2907 | 2599769307 | |||
| 2908 | 2599806611 | |||
| 2909 | 2599882574 | |||
| 2910 | 2599888550 | |||
| 2911 | 2599893604 | |||
| 2912 | 2599900201 | |||
| 2913 | 2599934153 | |||
| 2914 | 2599943680 | |||
| 2915 | 2599952116 | |||
| 2916 | 2599955990 | |||
| 2917 | 2599961784 | |||
| 2918 | 2599966917 | |||
| 2919 | 2599974404 | |||
| 2920 | 2599978272 | |||
| 2921 | 2599984684 | |||
| 2922 | 2599991163 | |||
| 2923 | 2599994953 | |||
| 2924 | 2600002306 | |||
| 2925 | 2600004760 | |||
| 2926 | 2600012508 | |||
| 2927 | 2600018744 | |||
| 2928 | 2600026730 | |||
| 2929 | 2600029881 | |||
| 2930 | 2600034781 | |||
| 2931 | 2600043906 | |||
| 2932 | 2600047974 | |||
| 2933 | 2600055622 | |||
| 2934 | 2600060294 | |||
| 2935 | 2600067554 | |||
| 2936 | 2600071423 | |||
| 2937 | 2600080405 | |||
| 2938 | 2600216021 | |||
| 2939 | 2600359190 | |||
| 2940 | 2600364961 | |||
| 2941 | 2600444595 | |||
| 2942 | 2601627247 | |||
| 2943 | 2601692262 | |||
| 2944 | 2601776188 | |||
| 2945 | 2601797748 | |||
| 2946 | 2602011666 | |||
| 2947 | 2603857953 | |||
| 2948 | 2606076769 | |||
| 2949 | 2606128817 | |||
| 2950 | 2608383836 | |||
| 2951 | 2617350168 | |||
| 2952 | 2617377140 | |||
| 2953 | 2621302257 | |||
| 2954 | 2624478135 | |||
| 2955 | 2624489680 | |||
| 2956 | 2643740265 | |||
| 2957 | 2643840900 | |||
| 2958 | 2643872702 | |||
| 2959 | 2643954997 | |||
| 2960 | 2644024633 | |||
| 2961 | 2644186038 | |||
| 2962 | 2644282659 | |||
| 2963 | 2644619568 | |||
| 2964 | 2644732142 | |||
| 2965 | 2671092677 | |||
| 2966 | 2671100051 | |||
| 2967 | 2671121259 | |||
| 2968 | 2671127239 | |||
| 2969 | 2671691934 | |||
| 2970 | 2671772262 | |||
| 2971 | 2677898298 | |||
| 2972 | 2678260887 | |||
| 2973 | 2715749124 | |||
| 2974 | 2715754394 | |||
| 2975 | 2718632081 | |||
| 2976 | 2723246471 | |||
| 2977 | 2723849177 | |||
| 2978 | 2728749261 | |||
| 2979 | 2729146694 | |||
| 2980 | 2738674919 | |||
| 2981 | 2738687637 | |||
| 2982 | 2738753312 | |||
| 2983 | 2738808001 | |||
| 2984 | 2738862511 | |||
| 2985 | 2738895361 | |||
| 2986 | 2739197943 | |||
| 2987 | 2739260396 | |||
| 2988 | 2739263258 | |||
| 2989 | 2739285344 | |||
| 2990 | 2739290658 | |||
| 2991 | 2739311199 | |||
| 2992 | 2743734998 | |||
| 2993 | 2745006200 | |||
| 2994 | 2745077679 | |||
| 2995 | 2765581551 | |||
| 2996 | 2774119644 | |||
| 2997 | 2774134657 | |||
| 2998 | 2784261133 | |||
| 2999 | 2784316282 | |||
| 3000 | 2793073639 | |||
| 3001 | 2793078465 | |||
| 3002 | 2794598752 | |||
| 3003 | 2805920397 | |||
| 3004 | 2807406180 | |||
| 3005 | 2807454532 | |||
| 3006 | 2808856559 | |||
| 3007 | 2808922842 | |||
| 3008 | 2808932098 | |||
| 3009 | 2808936538 | |||
| 3010 | 2808944529 | |||
| 3011 | 2808954301 | |||
| 3012 | 2808955775 | |||
| 3013 | 2808964946 | |||
| 3014 | 2808976748 | |||
| 3015 | 2808991814 | |||
| 3016 | 2808999838 | |||
| 3017 | 2809217896 | |||
| 3018 | 2812366386 | |||
| 3019 | 2817488320 | |||
| 3020 | 2818243496 | |||
| 3021 | 2819657144 | |||
| 3022 | 2819705133 | |||
| 3023 | 2821113339 | |||
| 3024 | 2823423726 | |||
| 3025 | 2824605818 | |||
| 3026 | 2824611968 | |||
| 3027 | 2824622845 | |||
| 3028 | 2824631934 | |||
| 3029 | 2824642987 | |||
| 3030 | 2824651069 | |||
| 3031 | 2824658785 | |||
| 3032 | 2824664317 | |||
| 3033 | 2824676890 | |||
| 3034 | 2824682000 | |||
| 3035 | 2824693267 | |||
| 3036 | 2824701511 | |||
| 3037 | 2824710570 | |||
| 3038 | 2824721082 | |||
| 3039 | 2824731151 | |||
| 3040 | 2824734118 | |||
| 3041 | 2824749179 | |||
| 3042 | 2824762237 | |||
| 3043 | 2824772610 | |||
| 3044 | 2824780098 | |||
| 3045 | 2825654355 | |||
| 3046 | 2826582507 | |||
| 3047 | 2834032293 | |||
| 3048 | 2838125897 | |||
| 3049 | 2841942709 | |||
| 3050 | 2841952940 | |||
| 3051 | 2841963441 | |||
| 3052 | 2841971032 | |||
| 3053 | 2841977709 | |||
| 3054 | 2841984729 | |||
| 3055 | 2842041550 | |||
| 3056 | 2842049592 | |||
| 3057 | 2842695066 | |||
| 3058 | 2842806977 | |||
| 3059 | 2842817647 | |||
| 3060 | 2842830634 | |||
| 3061 | 2842834083 | |||
| 3062 | 2842838538 | |||
| 3063 | 2842846445 | |||
| 3064 | 2842851605 | |||
| 3065 | 2842859470 | |||
| 3066 | 2844316008 | |||
| 3067 | 2844667814 | |||
| 3068 | 2847939764 | |||
| 3069 | 2847943075 | |||
| 3070 | 2849076819 | |||
| 3071 | 2852616990 | |||
| 3072 | 2852660535 | |||
| 3073 | 2852672021 | |||
| 3074 | 2857515780 | |||
| 3075 | 2857527333 | |||
| 3076 | 2860343722 | |||
| 3077 | 2860868362 | |||
| 3078 | 2864737258 | |||
| 3079 | 2874593720 | |||
| 3080 | 2874606886 | |||
| 3081 | 2874617598 | |||
| 3082 | 2874622008 | |||
| 3083 | 2874629329 | |||
| 3084 | 2874647983 | |||
| 3085 | 2876763410 | |||
| 3086 | 2876772811 | |||
| 3087 | 2876826460 | |||
| 3088 | 2878030080 | |||
| 3089 | 2879077507 | |||
| 3090 | 2879089976 | |||
| 3091 | 2879105498 | |||
| 3092 | 2879112607 | |||
| 3093 | 2879134389 | |||
| 3094 | 2879147348 | |||
| 3095 | 2880231031 | |||
| 3096 | 2881364487 | |||
| 3097 | 2881666097 | |||
| 3098 | 2885369073 | |||
| 3099 | 2885376909 | |||
| 3100 | 2885390003 | |||
| 3101 | 2885411897 | |||
| 3102 | 2885526610 | |||
| 3103 | 2888378852 | |||
| 3104 | 2888390139 | |||
| 3105 | 2888427279 | |||
| 3106 | 2889036128 | |||
| 3107 | 2889045111 | |||
| 3108 | 2893071874 | |||
| 3109 | 2903729598 | |||
| 3110 | 2903757085 | |||
| 3111 | 2903774741 | |||
| 3112 | 2904165159 | |||
| 3113 | 2904492003 | |||
| 3114 | 2904519490 | |||
| 3115 | 2904552332 | |||
| 3116 | 2904669400 | |||
| 3117 | 2904692145 | |||
| 3118 | 2904709371 | |||
| 3119 | 2904714488 | |||
| 3120 | 2906606101 | |||
| 3121 | 2906613068 | |||
| 3122 | 2906635093 | |||
| 3123 | 2906641173 | |||
| 3124 | 2906645618 | |||
| 3125 | 2906665729 | |||
| 3126 | 2908446946 | |||
| 3127 | 2908748049 | |||
| 3128 | 2908756676 | |||
| 3129 | 2908783055 | |||
| 3130 | 2912964121 | |||
| 3131 | 2913037182 | |||
| 3132 | 2917071087 | |||
| 3133 | 2919066238 | |||
| 3134 | 2919078445 | |||
| 3135 | 2919157530 | |||
| 3136 | 2919161240 | |||
| 3137 | 2919389854 | |||
| 3138 | 2919451829 | |||
| 3139 | 2919459901 | |||
| 3140 | 2919486481 | |||
| 3141 | 2919488789 | |||
| 3142 | 2919503355 | |||
| 3143 | 2919699041 | |||
| 3144 | 2922364507 | |||
| 3145 | 2922377710 | |||
| 3146 | 2922389191 | |||
| 3147 | 2922400910 | |||
| 3148 | 2922433561 | |||
| 3149 | 2923153993 | |||
| 3150 | 2923520410 | |||
| 3151 | 2923589680 | |||
| 3152 | 2926066074 | |||
| 3153 | 2929144719 | |||
| 3154 | 2929190222 | |||
| 3155 | 2929623320 | |||
| 3156 | 2929632589 | |||
| 3157 | 2931371948 | |||
| 3158 | 2931388547 | |||
| 3159 | 2931391291 | |||
| 3160 | 2931398754 | |||
| 3161 | 2932788207 | |||
| 3162 | 2932800064 | |||
| 3163 | 2932808348 | |||
| 3164 | 2932813578 | |||
| 3165 | 2932820275 | |||
| 3166 | 2932832658 | |||
| 3167 | 2933585223 | |||
| 3168 | 2935358915 | |||
| 3169 | 2935615124 | |||
| 3170 | 2935620148 | |||
| 3171 | 2935635079 | |||
| 3172 | 2935640466 | |||
| 3173 | 2935651519 | |||
| 3174 | 2935659713 | |||
| 3175 | 2935668660 | |||
| 3176 | 2935681962 | |||
| 3177 | 2935686968 | |||
| 3178 | 2935697062 | |||
| 3179 | 2935709830 | |||
| 3180 | 2935716656 | |||
| 3181 | 2935723219 | |||
| 3182 | 2935734776 | |||
| 3183 | 2935744433 | |||
| 3184 | 2935752934 | |||
| 3185 | 2935766832 | |||
| 3186 | 2935774808 | |||
| 3187 | 2935779704 | |||
| 3188 | 2935789677 | |||
| 3189 | 2935797955 | |||
| 3190 | 2935804580 | |||
| 3191 | 2935815733 | |||
| 3192 | 2935825838 | |||
| 3193 | 2935831972 | |||
| 3194 | 2935841196 | |||
| 3195 | 2935851457 | |||
| 3196 | 2935859034 | |||
| 3197 | 2935864215 | |||
| 3198 | 2935875433 | |||
| 3199 | 2935883456 | |||
| 3200 | 2935910517 | |||
| 3201 | 2935918079 | |||
| 3202 | 2935927572 | |||
| 3203 | 2935936556 | |||
| 3204 | 2935943891 | |||
| 3205 | 2935952328 | |||
| 3206 | 2935964385 | |||
| 3207 | 2935969168 | |||
| 3208 | 2935978432 | |||
| 3209 | 2935984621 | |||
| 3210 | 2935995588 | |||
| 3211 | 2936008008 | |||
| 3212 | 2936014129 | |||
| 3213 | 2936022962 | |||
| 3214 | 2936031098 | |||
| 3215 | 2936041635 | |||
| 3216 | 2936049220 | |||
| 3217 | 2936055666 | |||
| 3218 | 2939641017 | |||
| 3219 | 2939654943 | |||
| 3220 | 2939670308 | |||
| 3221 | 2939682661 | |||
| 3222 | 2940558847 | |||
| 3223 | 2941511642 | |||
| 3224 | 2941519375 | |||
| 3225 | 2941527501 | |||
| 3226 | 2941535872 | |||
| 3227 | 2941543422 | |||
| 3228 | 2945930260 | |||
| 3229 | 2945967511 | |||
| 3230 | 2945992863 | |||
| 3231 | 2946012593 | |||
| 3232 | 2946028561 | |||
| 3233 | 2946055604 | |||
| 3234 | 2947235093 | |||
| 3235 | 2969304876 | |||
| 3236 | 2974293430 | |||
| 3237 | 2984292068 | |||
| 3238 | 2988732113 | |||
| 3239 | 2990197093 | |||
| 3240 | 2998140377 | |||
| 3241 | 3005483217 | |||
| 3242 | 3005490543 | |||
| 3243 | 3005506438 | |||
| 3244 | 3005588916 | |||
| 3245 | 3005595596 | |||
| 3246 | 3005711588 | |||
| 3247 | 3005718845 | |||
| 3248 | 3007253257 | |||
| 3249 | 3007317948 | |||
| 3250 | 3007398006 | |||
| 3251 | 3007419933 | |||
| 3252 | 3007517812 | |||
| 3253 | 3007616197 | |||
| 3254 | 3007625369 | |||
| 3255 | 3007724027 | |||
| 3256 | 3007805672 | |||
| 3257 | 3007857175 | |||
| 3258 | 3007864417 | |||
| 3259 | 3007871976 | |||
| 3260 | 3007875579 | |||
| 3261 | 637317733 | |||
| 3262 | 8001850074 | |||
| 3263 | 8002061481 | |||
| 3264 | 8006926997 | |||
| 3265 | 8006935591 | |||
| 3266 | 8006967717 | |||
| 3267 | 8006975520 | |||
| 3268 | 8006992625 | |||
| 3269 | 8006998385 | |||
| 3270 | 8015688242 | |||
| 3271 | 8016517575 | |||
| 3272 | 8016525655 | |||
| 3273 | 8016539251 | |||
| 3274 | 8016543541 | |||
| 3275 | 8016549752 | |||
| 3276 | 8016568940 | |||
| 3277 | 8016581588 | |||
| 3278 | 8016587056 | |||
| 3279 | 8016596172 | |||
| 3280 | 8016618968 | |||
| 3281 | 8017059045 | |||
| 3282 | 8019541056 | |||
| 3283 | 8019549565 | |||
| 3284 | 8019563217 | |||
| 3285 | 8019573297 | |||
| 3286 | 8019594466 | |||
| 3287 | 8019607092 | |||
| 3288 | 8019611415 | |||
| 3289 | 8019622195 | |||
| 3290 | 8019639504 | |||
| 3291 | 8019653153 | |||
| 3292 | 8019667923 | |||
| 3293 | 8019677343 | |||
| 3294 | 8019687612 | |||
| 3295 | 8019696872 | |||
| 3296 | 8019770231 | |||
| 3297 | 8019777254 | |||
| 3298 | 8030000355 | |||
| 3299 | 8034964823 | |||
| 3300 | 8052494990 | |||
| 3301 | 8054286139 | |||
| 3302 | 8054350206 | |||
| 3303 | 8054503867 | |||
| 3304 | 8054930646 | |||
| 3305 | 8055743262 | |||
| 3306 | 8055771338 | |||
| 3307 | 8055818268 | |||
| 3308 | 8055880034 | |||
| 3309 | 8056116673 | |||
| 3310 | 8056125531 | |||
| 3311 | 8056126384 | |||
| 3312 | 8056132252 | |||
| 3313 | 8056142618 | |||
| 3314 | 8056143645 | |||
| 3315 | 8056152394 | |||
| 3316 | 8056158433 | |||
| 3317 | 8056164259 | |||
| 3318 | 8056170669 | |||
| 3319 | 8056176785 | |||
| 3320 | 8056179710 | |||
| 3321 | 8056572239 | |||
| 3322 | 8056678427 | |||
| 3323 | 8056687771 | |||
| 3324 | 8056692794 | |||
| 3325 | 8056970689 | |||
| 3326 | 8057802629 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g9q-assembly1.cif.gz_A-2 | the crystal structure of the glycogen phosphorylase b- 1ab complex | 0.9744 | 10 | 809 |
| 2zb2-assembly1.cif.gz_B | human liver glycogen phosphorylase a complexed with glcose and 5-chloro-n-[4-(1,2-dihydroxyethyl)phenyl]-1h-indole-2-carboxamide | 0.9736 | 12 | 809 |
| 1kti-assembly1.cif.gz_A | binding of 100 mm n-acetyl-n'-beta-d-glucopyranosyl urea to glycogen phosphorylase b: kinetic and crystallographic studies | 0.9724 | 10 | 808 |
| 1z62-assembly1.cif.gz_A-2 | indirubin-3'-aminooxy-acetate inhibits glycogen phosphorylase by binding at the inhibitor and the allosteric site. broad specificities of the two sites | 0.9722 | 10 | 808 |
| 2ieg-assembly1.cif.gz_A | crystal structure of rabbit muscle glycogen phosphorylase in complex with 3,4-dihydro-2-quinolone | 0.9721 | 10 | 809 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gpaA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9818 | 467 | 795 | 3.40.50.2000 |
| 1gpaA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9788 | 467 | 795 | 3.40.50.2000 |
| af_A0A1D8PQQ3_42_534_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9773 | 12 | 467 | 3.40.50.2000 |
| 1ahpA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9727 | 467 | 795 | 3.40.50.2000 |
| 1ahpA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9698 | 467 | 795 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M5YJK1-F1-model_v4 | deleted | 0.9977 | 269 | 812 |
|
| AF-A0A5E7G0T1-F1-model_v4 | deleted | 0.9973 | 406 | 812 |
|
| AF-A0A3M2VQ73-F1-model_v4 | Alpha-1,4 glucan phosphorylase (EC 2.4.1.1) | 0.9962 | 155 | 491 |
GO:0005737
GO:0005980 GO:0008184 GO:0030170 GO:0031220 |
| AF-A0A024EBA6-F1-model_v4 | Alpha-1,4 glucan phosphorylase (EC 2.4.1.1) | 0.9953 | 13 | 812 |
GO:0005737
GO:0005980 GO:0008184 GO:0030170 GO:0031220 |
| AF-A0A3D2D7N1-F1-model_v4 | deleted | 0.9952 | 307 | 811 |
|