metagRoot

F495262

General Info

Members	Datasets	Scaffolds	Average Seq Length
1664	715	3328	341

Family's Representative Sequence

Representative Sequence	3300049572\|Ga0501036_0008748\|Ga0501036_0008748_3778_4935
Length	385
Sequence	VAHGFKPKKSGQLPDLGLYLDINKSLQMILVTGGAGYIGSHTCLELLNAGFEVAVFDNFCNSHPEALSRVEAITGKKLQVIPGDCRDRAALTAALCSSKAEAVIHFAGLKAVGESVEQPLSYYDNNVVGSIRLLEAMEESGVHTVVFSSSATVYGDPQRLPLTEDHPLSATNPYGRSKLMIEEILRDLHRSNNTWRCGILRYFNPVGAHSSGLIGEDPQGMPNNLMPFVSQVAIGRREFLNVWGDDYPTPDGTGVRDYIHVVDLAVGHIKILEALSSLEIDAGSCMTINLGTGIGYSVLEMVHAFEQASGRPVPYKIAPRRPGDIASCYADPALAFNLLGWKAQRGLNEMCADAWRWQEGNPNGYGVKNQEMLSRFLSAHSTNAE

Samples

	Sample ID	Description	Type	Environment
1	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
2	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
3	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
4	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
8	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
9	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
10	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
11	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
12	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
13	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
14	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
15	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
16	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
17	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
18	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
19	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
20	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
21	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
22	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
23	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
24	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
25	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
26	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
27	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
28	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
29	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
30	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
31	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
32	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
33	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
34	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
35	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
36	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
37	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
38	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
39	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
40	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
41	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
42	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
43	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
44	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
45	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
46	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
47	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
48	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
49	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
50	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
51	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
52	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
53	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
54	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
55	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
56	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
57	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
58	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
59	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
60	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
61	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
62	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
63	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
64	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
65	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
66	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
67	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
68	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
69	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
70	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
71	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
72	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
73	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
74	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
75	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
76	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
77	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
78	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
79	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
80	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
81	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
82	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
83	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
84	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
85	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
86	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
87	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
88	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
89	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
90	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
91	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
92	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
93	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
94	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
95	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
96	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
97	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
98	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
99	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
100	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
101	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
102	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
103	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
104	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
105	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
106	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
107	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
108	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
109	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
110	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
111	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
112	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
113	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
114	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
115	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
116	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
117	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
118	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
119	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
120	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
121	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
122	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
123	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
124	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
125	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
126	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
127	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
128	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
130	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
131	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
132	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
133	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
134	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
135	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
136	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
137	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
138	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
139	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
140	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
141	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
142	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
143	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
144	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
145	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
146	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
147	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
148	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
149	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
150	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
151	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
152	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
153	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
154	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
155	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
156	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
157	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
158	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
159	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
160	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
161	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
162	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
163	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
164	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
165	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
166	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
167	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
168	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
169	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
170	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
171	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
172	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
173	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
174	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
183	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
184	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
185	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
186	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
189	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
190	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
192	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
193	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
194	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
196	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
198	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
199	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
200	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
202	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
204	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
205	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
260	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
263	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
266	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
270	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
271	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
272	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
273	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
274	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
275	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
276	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
277	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
278	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
279	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
280	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
281	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
282	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
283	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
284	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
285	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
286	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
287	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
288	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
289	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
290	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
291	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
292	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
293	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
294	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
295	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
296	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
297	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
298	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
299	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
300	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
301	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
302	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
303	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
304	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
305	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
306	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
307	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
308	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
309	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
310	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
311	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
312	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
313	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
314	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
315	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
316	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
317	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
318	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
319	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
320	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
321	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
322	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
323	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
324	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
325	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
326	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
327	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
328	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
329	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
330	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
331	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
332	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
333	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
334	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
335	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
336	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
337	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
338	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
339	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
340	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
341	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
342	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
343	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
344	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
345	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
346	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
347	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
348	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
349	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
350	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
351	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
352	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
353	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
354	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
355	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
356	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
357	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
358	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
359	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
360	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
361	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
362	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
363	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
364	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
365	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
366	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
367	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
368	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
369	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
370	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
371	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
372	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
373	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
374	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
375	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
376	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
377	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
378	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
379	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
380	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
381	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
382	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
383	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
384	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
385	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
386	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
387	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
388	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
389	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
390	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
391	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
392	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
393	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
394	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
395	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
396	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
397	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
398	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
399	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
400	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
401	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
402	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
403	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
404	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
405	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
406	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
407	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
408	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
409	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
410	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
411	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
412	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
413	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
414	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
415	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
416	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
417	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
418	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
419	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
420	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
421	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
422	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
423	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
424	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
425	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
426	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
427	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
428	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
429	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
430	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
431	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
432	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
433	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
434	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
435	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
436	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
437	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
438	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
439	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
440	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
441	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
442	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
443	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
444	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
445	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
446	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
447	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
448	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
449	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
450	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
451	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
452	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
453	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
454	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
455	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
456	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
457	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
458	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
459	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
460	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
461	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
462	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
463	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
464	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
465	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
466	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
467	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
468	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
469	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
470	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
471	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
472	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
473	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
474	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
475	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
476	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
477	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
478	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
479	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
480	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
481	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
482	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
483	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
484	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
485	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
486	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
487	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
488	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
489	3300049131	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
490	3300049132	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
491	3300049133	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
492	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
493	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
494	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
495	3300049547	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
496	3300049549	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
497	3300049550	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
498	3300049551	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
499	3300049553	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
500	3300049554	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
501	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
502	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
503	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
504	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
506	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
507	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
509	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
510	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
511	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
512	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
513	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
514	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
515	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
516	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
517	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
518	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
519	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
520	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
521	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
522	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
523	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
524	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
525	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
526	3300049656	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought	Metagenome	Rhizosphere
527	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
528	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
529	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
530	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
531	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
532	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
533	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
534	3300049773	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control	Metagenome	Rhizosphere
535	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
536	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
537	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
538	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
539	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
540	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
541	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
542	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
543	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
544	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
545	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
546	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
547	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
548	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
549	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
550	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
551	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
552	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
553	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
554	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
555	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
556	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
557	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
558	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
559	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
560	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
561	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
562	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
563	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
564	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
565	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
566	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
567	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
568	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
569	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
570	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
571	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
572	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
573	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
574	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
575	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
576	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
577	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
578	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
579	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
580	3300059513	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
581	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
582	3300059624	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
583	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
584	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
585	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
586	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
587	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
588	3300059649	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
589	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
590	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
591	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
592	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
593	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
594	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
595	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
596	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
597	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
598	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
599	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
600	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
601	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
602	2565956521	Vibrio rhizosphaerae DSM 18581	Isolate	Rhizosphere
603	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
604	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
605	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
606	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
607	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
608	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
609	2593339131	Bacillus sp. UNCCL81	Isolate	Unclassified
610	2596583598	Ralstonia sp. UNCCL144	Isolate	Unclassified
611	2599185178	Ralstonia sp. NFACC01	Isolate	Rhizoplane
612	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
613	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
614	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
615	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
616	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
617	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
618	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
619	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
620	2643221567	Phycicoccus sp. Root563	Isolate	Unclassified
621	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
622	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
623	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
624	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
625	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
626	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
627	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
628	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
629	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
630	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
631	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
632	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
633	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
634	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
635	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
636	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
637	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
638	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
639	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
640	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
641	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
642	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
643	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
644	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
645	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
646	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
647	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
648	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
649	2818991436	Collimonas arenae 515	Isolate	Unclassified
650	2818991459	Paenibacillus sp. 597	Isolate	Unclassified
651	2831864461	Roseateles noduli HZ7	Isolate	Nodule
652	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
653	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
654	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
655	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
656	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
657	2842882022	Bacillus sp. R-71893	Isolate	Unclassified
658	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
659	2852653556	Sphingopyxis sp. JAI108	Isolate	Rhizosphere
660	2852680915	Sphingopyxis sp. JAI128	Isolate	Rhizosphere
661	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
662	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
663	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
664	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
665	2857609550	Domibacillus sp. R-71929	Isolate	Unclassified
666	2858950400	Achromobacter sp. K91	Isolate	Unclassified
667	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
668	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
669	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
670	2881644220	Siminovitchia terrae LMG 29736	Isolate	Rhizosphere
671	2885266251	Ralstonia sp. SET104	Isolate	Nodule
672	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
673	2887630918	Psychrosphaera haliotis UCD-MCMsp1aY	Isolate	Unclassified
674	2891633521	Azoarcus rhizosphaerae CC-YHH848	Isolate	Rhizosphere
675	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
676	2904113452	Paenibacillus paridis py1325	Isolate	Unclassified
677	2904434214	Robbsia andropogonis 1567	Isolate	Rhizosphere
678	2904755435	Paenibacillus aceris KACC 19194	Isolate	Rhizosphere
679	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
680	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
681	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
682	2919425241	Bacillus sp. 3255	Isolate	Rhizosphere
683	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
684	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
685	2919497567	Shewanella putrefaciens 3469	Isolate	Unclassified
686	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
687	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
688	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
689	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
690	2928510474	Sporosarcina psychrophila 1288	Isolate	Rhizosphere
691	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
692	2941479691
693	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
694	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
695	2980182181	Paenibacillus cymbidii R196	Isolate	Unclassified
696	2981284811	Paenibacillus sp. PvR052	Isolate	Rhizosphere
697	2981289755	Paenibacillus sp. PvR148	Isolate	Rhizosphere
698	2981980479	Paenibacillus sp. PvR018	Isolate	Rhizosphere
699	2981985349	Paenibacillus sp. PvR053	Isolate	Rhizosphere
700	2995726249	Leucobacter zeae CC-MF41	Isolate	Rhizosphere
701	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
702	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
703	3006969106	Bacillus sp. FJAT-50079	Isolate	Rhizosphere
704	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
705	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
706	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
707	639633007	Azoarcus olearius BH72	Isolate	Unclassified
708	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
709	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
710	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
711	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
712	8054563764	Acuticoccus kalidii M5D2P5	Isolate	Unclassified
713	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
714	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
715	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.44
Metatranscriptomes	2.16
Isolates	7.39

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.54
Nodule	1.44
Rhizoplane	1.86
Rhizosphere	73.14
Stem	0
Stem Tuber	0
Unclassified	0.12

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0501036_0008748	3300049572	Bacteria	8308
2	MRS2a_Contig_9185	2124908027	Bacteria	2360
3	JGI24741J21665_1001349	3300001915	Bacteria	7106
4	JGI24740J21852_10000009	3300001979	Bacteria	73210
5	JGI24740J21852_10001375	3300001979	Bacteria	11107
6	JGI24737J22298_10033454	3300001990	Bacteria	1597
7	JGI24735J21928_10008433	3300002067	Bacteria	3331
8	JGI25155J39150_1000030	3300002704	Bacteria	114492
9	JGI25156J39149_1010181	3300002705	Bacteria	2227
10	JGI25162J39368_1000032	3300002737	Bacteria	195871
11	JGI25154J39366_1002196	3300002738	Bacteria	5408
12	JGI25164J39214_1003610	3300002772	Bacteria	1919
13	JGI25152J39213_1000481	3300002773	Bacteria	22817
14	JGI25152J39213_1006808	3300002773	Bacteria	3039
15	JGI25150J39212_1000175	3300002774	Bacteria	35998
16	JGI25150J39212_1000274	3300002774	Bacteria	27353
17	JGI25159J45721_1000129	3300002987	Bacteria	36238
18	JGI25151J46595_10000518	3300003187	Bacteria	35998
19	JGI25151J46595_10003077	3300003187	Bacteria	9407
20	JGI25151J46595_10003578	3300003187	Bacteria	8519
21	JGI25151J46595_10003645	3300003187	Bacteria	8403
22	JGI25165J46597_1000067	3300003214	Bacteria	196411
23	JGI25153J46596_10004548	3300003215	Bacteria	7455
24	JGI25153J46596_10005250	3300003215	Bacteria	6811
25	rootH1_10015201	3300003316	Bacteria	3462
26	rootH2_10007203	3300003320	Bacteria	2554
27	rootL2_10001457	3300003322	Bacteria	117785
28	rootL2_10060031	3300003322	Bacteria	18266
29	rootL2_10089786	3300003322	Bacteria	2844
30	rootH1_10003030	3300003323	Bacteria	3301
31	rootH1_10044493	3300003323	Bacteria	6421
32	rootH1_10047909	3300003323	Bacteria	6661
33	rootH1_10350405	3300003323	Bacteria	1447
34	JGI25160J50197_1000286	3300003354	Bacteria	36574
35	JGI25161J50226_1000217	3300003374	Bacteria	36238
36	Ga0006562J51391_1096986	3300003578	Bacteria	1690
37	Ga0055538_1000033	3300003751	Bacteria	195914
38	Ga0055538_1000119	3300003751	Bacteria	60124
39	Ga0055539_1000045	3300003752	Bacteria	195316
40	Ga0055539_1000079	3300003752	Bacteria	126504
41	Ga0055539_1000164	3300003752	Bacteria	60124
42	Ga0055533_1000054	3300003756	Bacteria	195914
43	Ga0055533_1000168	3300003756	Bacteria	60124
44	Ga0055533_1006114	3300003756	Bacteria	1823
45	Ga0055532_1000075	3300003758	Bacteria	124604
46	Ga0055525_1000065	3300003759	Bacteria	195779
47	Ga0055525_1000228	3300003759	Bacteria	60124
48	Ga0055525_1000581	3300003759	Bacteria	15994
49	Ga0055535_1000013	3300003761	Bacteria	299614
50	Ga0055542_1003633	3300003762	Bacteria	4070
51	Ga0055529_1000085	3300003763	Bacteria	140832
52	Ga0055526_1000496	3300003771	Bacteria	31280
53	Ga0055526_1001357	3300003771	Bacteria	17504
54	Ga0055526_1002293	3300003771	Bacteria	13057
55	Ga0055526_1019097	3300003771	Bacteria	2515
56	Ga0055526_1025428	3300003771	Bacteria	1900
57	Ga0055537_1000694	3300003773	Bacteria	17504
58	Ga0055537_1000791	3300003773	Bacteria	15837
59	Ga0055537_1002773	3300003773	Bacteria	5649
60	Ga0055537_1004056	3300003773	Bacteria	4297
61	Ga0055524_1000308	3300003775	Bacteria	46487
62	Ga0055524_1001112	3300003775	Bacteria	16237
63	Ga0055524_1001231	3300003775	Bacteria	15109
64	Ga0055524_1002502	3300003775	Bacteria	9450
65	Ga0055524_1007094	3300003775	Bacteria	4803
66	Ga0055524_1007242	3300003775	Bacteria	4738
67	Ga0055524_1007718	3300003775	Bacteria	4542
68	Ga0055536_1000053	3300003781	Bacteria	110030
69	Ga0055536_1000072	3300003781	Bacteria	91344
70	Ga0055536_1000142	3300003781	Bacteria	61219
71	Ga0055536_1000792	3300003781	Bacteria	21010
72	Ga0055536_1000882	3300003781	Bacteria	19504
73	Ga0055536_1002672	3300003781	Bacteria	9894
74	Ga0055534_1000329	3300003784	Bacteria	31280
75	Ga0055534_1000952	3300003784	Bacteria	12859
76	Ga0055534_1007066	3300003784	Bacteria	2732
77	Ga0055530_10000035	3300003791	Bacteria	117598
78	Ga0055530_10000219	3300003791	Bacteria	51126
79	Ga0055530_10036691	3300003791	Bacteria	1232
80	Ga0055540_1000006	3300003792	Bacteria	372018
81	Ga0055540_1000015	3300003792	Bacteria	232986
82	Ga0055531_10000075	3300003794	Bacteria	107839
83	Ga0055531_10002466	3300003794	Bacteria	12360
84	Ga0055531_10003216	3300003794	Bacteria	10484
85	Ga0055531_10005858	3300003794	Bacteria	7099
86	Ga0055531_10010799	3300003794	Bacteria	4494
87	Ga0055531_10011272	3300003794	Bacteria	4336
88	Ga0055531_10013982	3300003794	Bacteria	3654
89	Ga0055531_10024191	3300003794	Bacteria	2250
90	Ga0055541_1000031	3300003841	Bacteria	195914
91	Ga0055541_1000111	3300003841	Bacteria	60124
92	Ga0055541_1004698	3300003841	Bacteria	2457
93	Ga0055543_1000267	3300004625	Bacteria	38844
94	Ga0055543_1020393	3300004625	Bacteria	1218
95	Ga0065165_1000220	3300005262	Bacteria	100027
96	Ga0065165_1000898	3300005262	Bacteria	38426
97	Ga0065165_1001691	3300005262	Bacteria	22265
98	Ga0065165_1002199	3300005262	Bacteria	17488
99	Ga0065714_10002341	3300005288	Bacteria	31600
100	Ga0065714_10010623	3300005288	Bacteria	3089
101	Ga0065714_10066209	3300005288	Bacteria	7361
102	Ga0065707_10093512	3300005295	Bacteria	3619
103	Ga0070658_10009173	3300005327	Bacteria	7953
104	Ga0070658_10035084	3300005327	Bacteria	4039
105	Ga0070658_10107882	3300005327	Bacteria	2304
106	Ga0070683_100011894	3300005329	Bacteria	7545
107	Ga0070683_100017921	3300005329	Bacteria	6261
108	Ga0070683_100103775	3300005329	Bacteria	2679
109	Ga0070683_100133498	3300005329	Bacteria	2350
110	Ga0070690_100002307	3300005330	Bacteria	10235
111	Ga0070670_100038654	3300005331	Bacteria	4103
112	Ga0068869_100000375	3300005334	Bacteria	24179
113	Ga0068869_100087765	3300005334	Bacteria	2334
114	Ga0068869_100229206	3300005334	Bacteria	1475
115	Ga0070680_100007225	3300005336	Bacteria	8464
116	Ga0070680_100014772	3300005336	Bacteria	6108
117	Ga0070680_100336747	3300005336	Bacteria	1282
118	Ga0070682_100040106	3300005337	Bacteria	2880
119	Ga0068868_100002270	3300005338	Bacteria	13291
120	Ga0068868_100034780	3300005338	Bacteria	3892
121	Ga0070660_100002357	3300005339	Bacteria	12980
122	Ga0070660_100008557	3300005339	Bacteria	7165
123	Ga0070660_100010995	3300005339	Bacteria	6412
124	Ga0070660_100020210	3300005339	Bacteria	4890
125	Ga0070660_100058015	3300005339	Bacteria	3001
126	Ga0070660_100097390	3300005339	Bacteria	2327
127	Ga0070660_100169578	3300005339	Bacteria	1762
128	Ga0070660_100184438	3300005339	Bacteria	1689
129	Ga0070689_100000039	3300005340	Bacteria	81597
130	Ga0070689_100000515	3300005340	Bacteria	22798
131	Ga0070691_10002196	3300005341	Bacteria	8631
132	Ga0070687_100000478	3300005343	Bacteria	13360
133	Ga0070661_100000007	3300005344	Bacteria	202433
134	Ga0070661_100003248	3300005344	Bacteria	11209
135	Ga0070661_100023116	3300005344	Bacteria	4454
136	Ga0070661_100146131	3300005344	Bacteria	1785
137	Ga0070692_10005547	3300005345	Bacteria	5396
138	Ga0070692_10005560	3300005345	Bacteria	5390
139	Ga0070692_10052267	3300005345	Bacteria	2128
140	Ga0070668_100073807	3300005347	Bacteria	2660
141	Ga0070675_100042043	3300005354	Bacteria	3734
142	Ga0070675_100216237	3300005354	Bacteria	1668
143	Ga0070671_100000018	3300005355	Bacteria	147427
144	Ga0070671_100138663	3300005355	Bacteria	2051
145	Ga0070673_100066643	3300005364	Bacteria	2877
146	Ga0070688_100000087	3300005365	Bacteria	46867
147	Ga0070659_100000597	3300005366	Bacteria	26436
148	Ga0070659_100001284	3300005366	Bacteria	18213
149	Ga0070659_100002891	3300005366	Bacteria	12223
150	Ga0070659_100028383	3300005366	Bacteria	4321
151	Ga0070659_100049330	3300005366	Bacteria	3310
152	Ga0070659_100098137	3300005366	Bacteria	2355
153	Ga0070659_100138301	3300005366	Bacteria	1982
154	Ga0070667_100000026	3300005367	Bacteria	183244
155	Ga0070703_10021175	3300005406	Bacteria	1898
156	Ga0070714_100001810	3300005435	Bacteria	15531
157	Ga0070710_10024464	3300005437	Bacteria	3186
158	Ga0070701_10000043	3300005438	Bacteria	32096
159	Ga0070705_100000550	3300005440	Bacteria	21825
160	Ga0070705_100056595	3300005440	Bacteria	2310
161	Ga0070700_100000655	3300005441	Bacteria	17084
162	Ga0070700_100003551	3300005441	Bacteria	8053
163	Ga0070700_100121146	3300005441	Bacteria	1753
164	Ga0070694_100000619	3300005444	Bacteria	19541
165	Ga0070694_100071761	3300005444	Bacteria	2387
166	Ga0070708_100187618	3300005445	Bacteria	1934
167	Ga0070663_100000002	3300005455	Bacteria	298075
168	Ga0070678_100120752	3300005456	Bacteria	2066
169	Ga0070662_100092768	3300005457	Bacteria	2270
170	Ga0070681_10021126	3300005458	Bacteria	6523
171	Ga0070681_10022516	3300005458	Bacteria	6327
172	Ga0070681_10213241	3300005458	Bacteria	1847
173	Ga0070681_10298494	3300005458	Bacteria	1521
174	Ga0068867_100000084	3300005459	Bacteria	58558
175	Ga0068867_100005207	3300005459	Bacteria	9177
176	Ga0070685_10000211	3300005466	Bacteria	38855
177	Ga0070685_10001823	3300005466	Bacteria	11087
178	Ga0070707_100000005	3300005468	Bacteria	205406
179	Ga0070707_100001692	3300005468	Bacteria	21281
180	Ga0070707_100055807	3300005468	Bacteria	3787
181	Ga0070707_100116133	3300005468	Bacteria	2598
182	Ga0070698_100193058	3300005471	Bacteria	1973
183	Ga0070698_100259863	3300005471	Bacteria	1669
184	Ga0070698_100285763	3300005471	Bacteria	1581
185	Ga0070699_100001900	3300005518	Bacteria	18856
186	Ga0070699_100005177	3300005518	Bacteria	11472
187	Ga0070679_100024512	3300005530	Bacteria	5912
188	Ga0070679_100025018	3300005530	Bacteria	5853
189	Ga0070684_100034152	3300005535	Bacteria	4347
190	Ga0070684_100130230	3300005535	Bacteria	2269
191	Ga0070684_100169335	3300005535	Bacteria	1984
192	Ga0070684_100295198	3300005535	Bacteria	1486
193	Ga0070697_100069210	3300005536	Bacteria	2890
194	Ga0070686_100000802	3300005544	Bacteria	18174
195	Ga0070686_100001812	3300005544	Bacteria	11919
196	Ga0070686_100004350	3300005544	Bacteria	7804
197	Ga0070695_100006142	3300005545	Bacteria	7099
198	Ga0070695_100019466	3300005545	Bacteria	4134
199	Ga0070696_100000284	3300005546	Bacteria	30526
200	Ga0070696_100069119	3300005546	Bacteria	2481
201	Ga0070696_100216974	3300005546	Bacteria	1434
202	Ga0070693_100000158	3300005547	Bacteria	30990
203	Ga0070665_100004790	3300005548	Bacteria	14077
204	Ga0070704_100002568	3300005549	Bacteria	10235
205	Ga0070704_100004419	3300005549	Bacteria	8120
206	Ga0070704_100015728	3300005549	Bacteria	4762
207	Ga0070704_100139710	3300005549	Bacteria	1889
208	Ga0068855_100000220	3300005563	Bacteria	72936
209	Ga0068855_100000242	3300005563	Bacteria	68674
210	Ga0068855_100042662	3300005563	Bacteria	5375
211	Ga0068855_100073449	3300005563	Bacteria	3974
212	Ga0068855_100114870	3300005563	Bacteria	3086
213	Ga0068855_100209164	3300005563	Bacteria	2193
214	Ga0070664_100000004	3300005564	Bacteria	298075
215	Ga0070664_100059979	3300005564	Bacteria	3238
216	Ga0070664_100238293	3300005564	Bacteria	1632
217	Ga0070664_100267776	3300005564	Bacteria	1538
218	Ga0068857_100026564	3300005577	Bacteria	5103
219	Ga0068857_100032939	3300005577	Bacteria	4582
220	Ga0068857_100309097	3300005577	Bacteria	1458
221	Ga0068854_100000034	3300005578	Bacteria	102389
222	Ga0068854_100002193	3300005578	Bacteria	12002
223	Ga0068854_100203453	3300005578	Bacteria	1558
224	Ga0068856_100004536	3300005614	Bacteria	13807
225	Ga0068856_100041554	3300005614	Bacteria	4519
226	Ga0068856_100071108	3300005614	Bacteria	3444
227	Ga0068856_100430220	3300005614	Bacteria	1340
228	Ga0070702_100000091	3300005615	Bacteria	26542
229	Ga0070702_100003779	3300005615	Bacteria	6839
230	Ga0068852_100129276	3300005616	Bacteria	2324
231	Ga0068852_100498982	3300005616	Bacteria	1212
232	Ga0068859_100000257	3300005617	Bacteria	52795
233	Ga0068859_100003784	3300005617	Bacteria	15435
234	Ga0068859_100006088	3300005617	Bacteria	12251
235	Ga0068859_100082165	3300005617	Bacteria	3265
236	Ga0068864_100000012	3300005618	Bacteria	335070
237	Ga0068864_100106475	3300005618	Bacteria	2493
238	Ga0068864_100328410	3300005618	Bacteria	1438
239	Ga0068866_10001238	3300005718	Bacteria	11077
240	Ga0068861_100002493	3300005719	Bacteria	12007
241	Ga0068861_100379991	3300005719	Bacteria	1248
242	Ga0068863_100074649	3300005841	Bacteria	3208
243	Ga0068863_100203570	3300005841	Bacteria	1904
244	Ga0068858_100000844	3300005842	Bacteria	31724
245	Ga0068858_100005016	3300005842	Bacteria	12972
246	Ga0068858_100015245	3300005842	Bacteria	7231
247	Ga0068858_100164089	3300005842	Bacteria	2093
248	Ga0068860_100000973	3300005843	Bacteria	31743
249	Ga0068860_100002335	3300005843	Bacteria	19910
250	Ga0068860_100059964	3300005843	Bacteria	3617
251	Ga0068862_100000899	3300005844	Bacteria	28835
252	Ga0068862_100042918	3300005844	Bacteria	3854
253	Ga0081455_10190727	3300005937	Bacteria	1543
254	Ga0081455_10202263	3300005937	Bacteria	1487
255	Ga0081539_10001286	3300005985	Bacteria	44180
256	Ga0081539_10061242	3300005985	Bacteria	2063
257	Ga0075365_10010932	3300006038	Bacteria	5316
258	Ga0075365_10029230	3300006038	Bacteria	3521
259	Ga0075365_10038446	3300006038	Bacteria	3110
260	Ga0075364_10016924	3300006051	Bacteria	4544
261	Ga0075432_10000923	3300006058	Bacteria	9274
262	Ga0075432_10031555	3300006058	Bacteria	1834
263	Ga0070716_100033705	3300006173	Bacteria	2803
264	Ga0075362_10000327	3300006177	Bacteria	13518
265	Ga0075367_10099489	3300006178	Bacteria	1776
266	Ga0075366_10005684	3300006195	Bacteria	6764
267	Ga0075366_10168390	3300006195	Bacteria	1329
268	Ga0097621_100003574	3300006237	Bacteria	10747
269	Ga0097621_100064646	3300006237	Bacteria	3009
270	Ga0097621_100081548	3300006237	Bacteria	2692
271	Ga0097621_100281482	3300006237	Bacteria	1464
272	Ga0075370_10000995	3300006353	Bacteria	11706
273	Ga0075370_10069274	3300006353	Bacteria	2016
274	Ga0075370_10074716	3300006353	Bacteria	1942
275	Ga0068871_100001933	3300006358	Bacteria	14021
276	Ga0068871_100003805	3300006358	Bacteria	10401
277	Ga0068871_100025385	3300006358	Bacteria	4610
278	Ga0068871_100184644	3300006358	Bacteria	1793
279	Ga0075428_100234827	3300006844	Bacteria	1979
280	Ga0075430_100181833	3300006846	Bacteria	1749
281	Ga0075431_100118168	3300006847	Bacteria	2736
282	Ga0075431_100248252	3300006847	Bacteria	1809
283	Ga0075433_10000608	3300006852	Bacteria	23843
284	Ga0075434_100002189	3300006871	Bacteria	17038
285	Ga0075434_100026060	3300006871	Bacteria	5725
286	Ga0075429_100000044	3300006880	Bacteria	56916
287	Ga0075429_100130668	3300006880	Bacteria	2197
288	Ga0068865_100000397	3300006881	Bacteria	24266
289	Ga0068865_100030417	3300006881	Bacteria	3592
290	Ga0068865_100209486	3300006881	Bacteria	1518
291	Ga0075436_100000521	3300006914	Bacteria	25029
292	Ga0075436_100008674	3300006914	Bacteria	6949
293	Ga0075436_100065224	3300006914	Bacteria	2517
294	Ga0075436_100226566	3300006914	Bacteria	1327
295	Ga0097620_100000257	3300006931	Bacteria	52795
296	Ga0097620_100003784	3300006931	Bacteria	15435
297	Ga0097620_100006088	3300006931	Bacteria	12251
298	Ga0097620_100082163	3300006931	Bacteria	3265
299	Ga0099823_1000072	3300006944	Bacteria	48607
300	Ga0079104_1000173	3300006946	Bacteria	91782
301	Ga0079104_1003379	3300006946	Bacteria	7485
302	Ga0079104_1009820	3300006946	Bacteria	3209
303	Ga0079104_1024169	3300006946	Bacteria	1604
304	Ga0099826_10000013	3300006948	Bacteria	265459
305	Ga0099794_10024642	3300007265	Bacteria	2764
306	Ga0105251_10093207	3300009011	Bacteria	1382
307	Ga0105244_10000583	3300009036	Bacteria	32757
308	Ga0105244_10005356	3300009036	Bacteria	8542
309	Ga0105244_10117618	3300009036	Bacteria	1289
310	Ga0105250_10001246	3300009092	Bacteria	14107
311	Ga0105240_10006473	3300009093	Bacteria	17203
312	Ga0105240_10027941	3300009093	Bacteria	7379
313	Ga0105240_10199980	3300009093	Bacteria	2343
314	Ga0111539_10008666	3300009094	Bacteria	12912
315	Ga0111539_10012214	3300009094	Bacteria	10772
316	Ga0111539_10017078	3300009094	Bacteria	8984
317	Ga0111539_10393149	3300009094	Bacteria	1615
318	Ga0105245_10000245	3300009098	Bacteria	51952
319	Ga0105245_10080827	3300009098	Bacteria	2970
320	Ga0105247_10019973	3300009101	Bacteria	4025
321	Ga0105243_10000677	3300009148	Bacteria	33243
322	Ga0105243_10003678	3300009148	Bacteria	12325
323	Ga0105243_10009810	3300009148	Bacteria	7290
324	Ga0105243_10091778	3300009148	Bacteria	2502
325	Ga0105243_10170661	3300009148	Bacteria	1883
326	Ga0105243_10209338	3300009148	Bacteria	1716
327	Ga0105241_10034102	3300009174	Bacteria	3823
328	Ga0105242_10012509	3300009176	Bacteria	6533
329	Ga0105242_10112984	3300009176	Bacteria	2319
330	Ga0105248_10000428	3300009177	Bacteria	47662
331	Ga0105248_10094150	3300009177	Bacteria	3373
332	Ga0105248_10168580	3300009177	Bacteria	2468
333	Ga0105237_10010970	3300009545	Bacteria	9615
334	Ga0105238_10153055	3300009551	Bacteria	2281
335	Ga0105249_10005105	3300009553	Bacteria	11316
336	Ga0105249_10059050	3300009553	Bacteria	3517
337	Ga0105239_10003062	3300010375	Bacteria	20778
338	Ga0105246_10016928	3300011119	Bacteria	4627
339	Ga0105246_10132846	3300011119	Bacteria	1861
340	Ga0105246_10254757	3300011119	Bacteria	1395
341	Ga0157319_1000003	3300012497	Bacteria	397199
342	Ga0157373_10005421	3300013100	Bacteria	9582
343	Ga0157373_10009732	3300013100	Bacteria	7093
344	Ga0157373_10097144	3300013100	Bacteria	2074
345	Ga0157371_10000270	3300013102	Bacteria	70773
346	Ga0157371_10000379	3300013102	Bacteria	55919
347	Ga0157371_10001000	3300013102	Bacteria	31259
348	Ga0157371_10004897	3300013102	Bacteria	11506
349	Ga0157371_10077092	3300013102	Bacteria	2360
350	Ga0157370_10000014	3300013104	Bacteria	194894
351	Ga0157370_10000901	3300013104	Bacteria	37713
352	Ga0157370_10001358	3300013104	Bacteria	30312
353	Ga0157370_10013072	3300013104	Bacteria	8569
354	Ga0157370_10032811	3300013104	Bacteria	5069
355	Ga0157370_10036107	3300013104	Bacteria	4798
356	Ga0157370_10175654	3300013104	Bacteria	1991
357	Ga0157369_10000259	3300013105	Bacteria	72294
358	Ga0157369_10160796	3300013105	Bacteria	2371
359	Ga0157369_10360636	3300013105	Bacteria	1509
360	Ga0157374_10000102	3300013296	Bacteria	78555
361	Ga0157374_10026076	3300013296	Bacteria	5255
362	Ga0157378_10000294	3300013297	Bacteria	48405
363	Ga0157378_10048835	3300013297	Bacteria	3764
364	Ga0157378_10137124	3300013297	Bacteria	2269
365	Ga0157378_10493855	3300013297	Bacteria	1222
366	Ga0163162_10015320	3300013306	Bacteria	7490
367	Ga0163162_10058544	3300013306	Bacteria	3882
368	Ga0163162_10077781	3300013306	Bacteria	3382
369	Ga0163162_10211155	3300013306	Bacteria	2071
370	Ga0157372_10000032	3300013307	Bacteria	178666
371	Ga0157372_10001972	3300013307	Bacteria	22319
372	Ga0157372_10003490	3300013307	Bacteria	16948
373	Ga0157372_10006664	3300013307	Bacteria	12292
374	Ga0157375_10021753	3300013308	Bacteria	5889
375	Ga0157375_10070855	3300013308	Bacteria	3497
376	Ga0157375_10134241	3300013308	Bacteria	2597
377	Ga0163163_10000051	3300014325	Bacteria	128275
378	Ga0163163_10007862	3300014325	Bacteria	9425
379	Ga0163163_10046912	3300014325	Bacteria	4245
380	Ga0163163_10148894	3300014325	Bacteria	2385
381	Ga0157380_10290266	3300014326	Bacteria	1501
382	Ga0157380_10316295	3300014326	Bacteria	1445
383	Ga0182008_10000915	3300014497	Bacteria	20550
384	Ga0182008_10004759	3300014497	Bacteria	7859
385	Ga0182008_10033183	3300014497	Bacteria	2591
386	Ga0182008_10038663	3300014497	Bacteria	2386
387	Ga0182008_10058735	3300014497	Bacteria	1898
388	Ga0182008_10086730	3300014497	Bacteria	1542
389	Ga0157379_10036436	3300014968	Bacteria	4387
390	Ga0157379_10058095	3300014968	Bacteria	3458
391	Ga0157379_10061367	3300014968	Bacteria	3362
392	Ga0157379_10081105	3300014968	Bacteria	2906
393	Ga0157376_10000642	3300014969	Bacteria	22664
394	Ga0157376_10001613	3300014969	Bacteria	14923
395	Ga0157376_10099985	3300014969	Bacteria	2532
396	Ga0182006_1000010	3300015261	Bacteria	413414
397	Ga0182006_1000526	3300015261	Bacteria	29067
398	Ga0182006_1001367	3300015261	Bacteria	14875
399	Ga0182006_1004334	3300015261	Bacteria	7019
400	Ga0182006_1004806	3300015261	Bacteria	6570
401	Ga0182006_1007216	3300015261	Bacteria	5105
402	Ga0182006_1020616	3300015261	Bacteria	2759
403	Ga0182007_10000031	3300015262	Bacteria	152299
404	Ga0182007_10003582	3300015262	Bacteria	7298
405	Ga0182007_10020677	3300015262	Bacteria	2349
406	Ga0182005_1000182	3300015265	Bacteria	43296
407	Ga0182005_1000801	3300015265	Bacteria	14322
408	Ga0182005_1001209	3300015265	Bacteria	10672
409	Ga0182005_1007928	3300015265	Bacteria	3156
410	Ga0183362_10005	3300015683	Bacteria	437616
411	Ga0163161_10000220	3300017792	Bacteria	51987
412	Ga0163161_10000267	3300017792	Bacteria	45913
413	Ga0163161_10003388	3300017792	Bacteria	11186
414	Ga0163161_10036862	3300017792	Bacteria	3503
415	Ga0163161_10072162	3300017792	Bacteria	2528
416	Ga0163161_10072194	3300017792	Bacteria	2527
417	Ga0206351_10899730	3300020077	Bacteria	1498
418	Ga0206353_10316548	3300020082	Bacteria	3267
419	Ga0154015_1045624	3300020610	Bacteria	1752
420	Ga0213872_10000035	3300021361	Bacteria	133053
421	Ga0213872_10001791	3300021361	Bacteria	13399
422	Ga0213872_10024519	3300021361	Bacteria	2775
423	Ga0213875_10039885	3300021388	Bacteria	2211
424	Ga0209436_100116	3300025208	Bacteria	39369
425	Ga0209784_100018	3300025224	Bacteria	456816
426	Ga0209784_100048	3300025224	Bacteria	198885
427	Ga0209784_100259	3300025224	Bacteria	32974
428	Ga0209784_100280	3300025224	Bacteria	29012
429	Ga0209566_100006	3300025225	Bacteria	789272
430	Ga0209566_100016	3300025225	Bacteria	456824
431	Ga0209566_100060	3300025225	Bacteria	198885
432	Ga0209566_100142	3300025225	Bacteria	86059
433	Ga0209566_100733	3300025225	Bacteria	18425
434	Ga0209566_101617	3300025225	Bacteria	5857
435	Ga0209674_100030	3300025226	Bacteria	456824
436	Ga0209674_100082	3300025226	Bacteria	198885
437	Ga0209674_100083	3300025226	Bacteria	197744
438	Ga0209674_100142	3300025226	Bacteria	107750
439	Ga0209147_100005	3300025229	Bacteria	1036530
440	Ga0209147_103239	3300025229	Bacteria	3304
441	Ga0209563_100016	3300025230	Bacteria	802091
442	Ga0209563_100034	3300025230	Bacteria	456824
443	Ga0209563_100082	3300025230	Bacteria	198750
444	Ga0207427_100378	3300025231	Bacteria	26906
445	Ga0209437_100125	3300025233	Bacteria	198146
446	Ga0209258_100007	3300025242	Bacteria	1036530
447	Ga0209258_102357	3300025242	Bacteria	4982
448	Ga0207425_1000050	3300025245	Bacteria	177008
449	Ga0207425_1000300	3300025245	Bacteria	36053
450	Ga0207425_1001155	3300025245	Bacteria	11830
451	Ga0209646_1000016	3300025246	Bacteria	501688
452	Ga0209026_1004873	3300025250	Bacteria	3805
453	Ga0209677_100008	3300025253	Bacteria	802091
454	Ga0209677_100019	3300025253	Bacteria	456824
455	Ga0209677_100046	3300025253	Bacteria	198287
456	Ga0209677_101784	3300025253	Bacteria	8894
457	Ga0209148_1000051	3300025254	Bacteria	401000
458	Ga0209759_1002464	3300025256	Bacteria	8109
459	Ga0209759_1005347	3300025256	Bacteria	4524
460	Ga0209759_1006283	3300025256	Bacteria	4016
461	Ga0209129_1000588	3300025258	Bacteria	24948
462	Ga0209129_1000808	3300025258	Bacteria	19776
463	Ga0209233_1000138	3300025261	Bacteria	198287
464	Ga0209565_1000086	3300025263	Bacteria	152204
465	Ga0209565_1000239	3300025263	Bacteria	59435
466	Ga0209565_1000296	3300025263	Bacteria	47631
467	Ga0209565_1000348	3300025263	Bacteria	40662
468	Ga0209565_1000367	3300025263	Bacteria	38709
469	Ga0209565_1000421	3300025263	Bacteria	34378
470	Ga0209565_1010251	3300025263	Bacteria	2330
471	Ga0209455_1000011	3300025272	Bacteria	947242
472	Ga0209455_1001222	3300025272	Bacteria	12210
473	Ga0209673_1005541	3300025273	Bacteria	6317
474	Ga0209673_1010879	3300025273	Bacteria	3799
475	Ga0209673_1011135	3300025273	Bacteria	3730
476	Ga0209130_1000518	3300025284	Bacteria	38858
477	Ga0209130_1014052	3300025284	Bacteria	2026
478	Ga0209675_1000076	3300025291	Bacteria	159428
479	Ga0209675_1000171	3300025291	Bacteria	75668
480	Ga0209675_1000268	3300025291	Bacteria	49787
481	Ga0209675_1000418	3300025291	Bacteria	34762
482	Ga0209675_1000743	3300025291	Bacteria	21986
483	Ga0209675_1000960	3300025291	Bacteria	18264
484	Ga0209675_1001504	3300025291	Bacteria	13379
485	Ga0209675_1009515	3300025291	Bacteria	3425
486	Ga0209676_1000002	3300025292	Bacteria	1732948
487	Ga0209676_1000020	3300025292	Bacteria	617256
488	Ga0209676_1000053	3300025292	Bacteria	370111
489	Ga0209676_1000070	3300025292	Bacteria	312074
490	Ga0209676_1000161	3300025292	Bacteria	160605
491	Ga0209676_1000454	3300025292	Bacteria	69136
492	Ga0209676_1000809	3300025292	Bacteria	40893
493	Ga0209676_1002192	3300025292	Bacteria	14616
494	Ga0209676_1037090	3300025292	Bacteria	1411
495	Ga0209025_1000003	3300025294	Bacteria	1366495
496	Ga0209025_1000059	3300025294	Bacteria	305480
497	Ga0209025_1000550	3300025294	Bacteria	70073
498	Ga0209025_1000890	3300025294	Bacteria	46568
499	Ga0209025_1000992	3300025294	Bacteria	42037
500	Ga0209025_1002799	3300025294	Bacteria	17571
501	Ga0209025_1003787	3300025294	Bacteria	13843
502	Ga0209025_1017994	3300025294	Bacteria	4044
503	Ga0209025_1059794	3300025294	Bacteria	1435
504	Ga0209564_1000003	3300025295	Bacteria	1585848
505	Ga0209564_1000248	3300025295	Bacteria	116617
506	Ga0209564_1000451	3300025295	Bacteria	69674
507	Ga0209564_1000454	3300025295	Bacteria	69231
508	Ga0209564_1000908	3300025295	Bacteria	38758
509	Ga0209564_1001027	3300025295	Bacteria	34378
510	Ga0209564_1001580	3300025295	Bacteria	22275
511	Ga0209564_1001651	3300025295	Bacteria	21523
512	Ga0209564_1003283	3300025295	Bacteria	11274
513	Ga0209758_1000122	3300025297	Bacteria	190970
514	Ga0209758_1000860	3300025297	Bacteria	42010
515	Ga0209758_1003855	3300025297	Bacteria	13151
516	Ga0209758_1016286	3300025297	Bacteria	3786
517	Ga0209758_1050705	3300025297	Bacteria	1452
518	Ga0209050_1000006	3300025298	Bacteria	1359702
519	Ga0209050_1000042	3300025298	Bacteria	402842
520	Ga0209050_1000143	3300025298	Bacteria	171806
521	Ga0209050_1000170	3300025298	Bacteria	151162
522	Ga0209050_1002102	3300025298	Bacteria	18196
523	Ga0209050_1002805	3300025298	Bacteria	13925
524	Ga0209050_1007591	3300025298	Bacteria	6028
525	Ga0209050_1030361	3300025298	Bacteria	1708
526	Ga0209256_1000086	3300025299	Bacteria	218837
527	Ga0209256_1000150	3300025299	Bacteria	146086
528	Ga0209256_1000344	3300025299	Bacteria	75635
529	Ga0209256_1000638	3300025299	Bacteria	47804
530	Ga0209256_1000757	3300025299	Bacteria	42054
531	Ga0209256_1000922	3300025299	Bacteria	35957
532	Ga0209256_1001282	3300025299	Bacteria	27177
533	Ga0207426_1000506	3300025302	Bacteria	57538
534	Ga0209051_1000001	3300025303	Bacteria	1732974
535	Ga0209051_1000020	3300025303	Bacteria	508628
536	Ga0209051_1003037	3300025303	Bacteria	11353
537	Ga0209051_1022737	3300025303	Bacteria	2629
538	Ga0209051_1025136	3300025303	Bacteria	2432
539	Ga0209051_1038369	3300025303	Bacteria	1744
540	Ga0209257_1000029	3300025304	Bacteria	695617
541	Ga0209257_1000260	3300025304	Bacteria	121653
542	Ga0209257_1000285	3300025304	Bacteria	112113
543	Ga0209257_1000318	3300025304	Bacteria	101186
544	Ga0209257_1000399	3300025304	Bacteria	85231
545	Ga0209257_1000622	3300025304	Bacteria	57122
546	Ga0209257_1001782	3300025304	Bacteria	23720
547	Ga0209257_1001860	3300025304	Bacteria	22903
548	Ga0209257_1005823	3300025304	Bacteria	8360
549	Ga0209257_1010098	3300025304	Bacteria	4874
550	Ga0207655_1000125	3300025728	Bacteria	152896
551	Ga0207655_1003721	3300025728	Bacteria	11203
552	Ga0207655_1071627	3300025728	Bacteria	1285
553	Ga0207713_1000518	3300025735	Bacteria	39106
554	Ga0207713_1001773	3300025735	Bacteria	16507
555	Ga0207713_1009373	3300025735	Bacteria	5519
556	Ga0207653_10009970	3300025885	Bacteria	2963
557	Ga0207642_10000931	3300025899	Bacteria	9163
558	Ga0207710_10016816	3300025900	Bacteria	3097
559	Ga0207688_10011233	3300025901	Bacteria	4873
560	Ga0207688_10188053	3300025901	Bacteria	1234
561	Ga0207680_10005607	3300025903	Bacteria	6006
562	Ga0207647_10017820	3300025904	Bacteria	4818
563	Ga0207647_10022117	3300025904	Bacteria	4230
564	Ga0207647_10179984	3300025904	Bacteria	1228
565	Ga0207705_10027347	3300025909	Bacteria	4068
566	Ga0207705_10040886	3300025909	Bacteria	3326
567	Ga0207705_10154884	3300025909	Bacteria	1719
568	Ga0207654_10062188	3300025911	Bacteria	2186
569	Ga0207707_10013398	3300025912	Bacteria	7149
570	Ga0207707_10103511	3300025912	Bacteria	2488
571	Ga0207695_10003419	3300025913	Bacteria	22406
572	Ga0207695_10033679	3300025913	Bacteria	5582
573	Ga0207671_10032160	3300025914	Bacteria	3906
574	Ga0207660_10022365	3300025917	Bacteria	4260
575	Ga0207662_10001141	3300025918	Bacteria	12542
576	Ga0207662_10083695	3300025918	Bacteria	1950
577	Ga0207657_10000560	3300025919	Bacteria	39490
578	Ga0207657_10012715	3300025919	Bacteria	8292
579	Ga0207657_10013915	3300025919	Bacteria	7872
580	Ga0207657_10054066	3300025919	Bacteria	3474
581	Ga0207657_10057187	3300025919	Bacteria	3363
582	Ga0207657_10082950	3300025919	Bacteria	2689
583	Ga0207657_10148660	3300025919	Bacteria	1909
584	Ga0207657_10300739	3300025919	Bacteria	1271
585	Ga0207649_10000131	3300025920	Bacteria	63801
586	Ga0207649_10023078	3300025920	Bacteria	3600
587	Ga0207652_10050542	3300025921	Bacteria	3563
588	Ga0207652_10054963	3300025921	Bacteria	3423
589	Ga0207652_10240030	3300025921	Bacteria	1634
590	Ga0207646_10000022	3300025922	Bacteria	259328
591	Ga0207694_10057424	3300025924	Bacteria	3025
592	Ga0207694_10104151	3300025924	Bacteria	2251
593	Ga0207650_10000002	3300025925	Bacteria	1439222
594	Ga0207659_10111452	3300025926	Bacteria	2081
595	Ga0207687_10000506	3300025927	Bacteria	26240
596	Ga0207664_10004053	3300025929	Bacteria	9868
597	Ga0207664_10144346	3300025929	Bacteria	2017
598	Ga0207644_10000026	3300025931	Bacteria	147255
599	Ga0207644_10095868	3300025931	Bacteria	2219
600	Ga0207690_10009142	3300025932	Bacteria	5882
601	Ga0207690_10010402	3300025932	Bacteria	5527
602	Ga0207690_10025855	3300025932	Bacteria	3691
603	Ga0207690_10033188	3300025932	Bacteria	3317
604	Ga0207690_10047597	3300025932	Bacteria	2847
605	Ga0207690_10126818	3300025932	Bacteria	1862
606	Ga0207706_10086732	3300025933	Bacteria	2752
607	Ga0207706_10091762	3300025933	Bacteria	2670
608	Ga0207686_10002377	3300025934	Bacteria	10265
609	Ga0207686_10204917	3300025934	Bacteria	1415
610	Ga0207709_10000395	3300025935	Bacteria	42894
611	Ga0207709_10001717	3300025935	Bacteria	14764
612	Ga0207670_10000035	3300025936	Bacteria	107909
613	Ga0207670_10002127	3300025936	Bacteria	10358
614	Ga0207704_10000218	3300025938	Bacteria	28751
615	Ga0207704_10031309	3300025938	Bacteria	2995
616	Ga0207704_10178792	3300025938	Bacteria	1531
617	Ga0207691_10041037	3300025940	Bacteria	4275
618	Ga0207711_10000279	3300025941	Bacteria	55112
619	Ga0207711_10003450	3300025941	Bacteria	13680
620	Ga0207711_10045344	3300025941	Bacteria	3757
621	Ga0207711_10046582	3300025941	Bacteria	3705
622	Ga0207711_10070318	3300025941	Bacteria	3035
623	Ga0207689_10000293	3300025942	Bacteria	45522
624	Ga0207661_10019890	3300025944	Bacteria	5010
625	Ga0207661_10031292	3300025944	Bacteria	4108
626	Ga0207679_10000002	3300025945	Bacteria	634491
627	Ga0207679_10002836	3300025945	Bacteria	10749
628	Ga0207667_10000044	3300025949	Bacteria	248251
629	Ga0207667_10009572	3300025949	Bacteria	11402
630	Ga0207667_10025947	3300025949	Bacteria	6409
631	Ga0207667_10052136	3300025949	Bacteria	4311
632	Ga0207667_10171632	3300025949	Bacteria	2228
633	Ga0207651_10071797	3300025960	Bacteria	2456
634	Ga0207712_10257784	3300025961	Bacteria	1413
635	Ga0207668_10402605	3300025972	Bacteria	1157
636	Ga0207640_10000121	3300025981	Bacteria	59308
637	Ga0207640_10001384	3300025981	Bacteria	13125
638	Ga0207658_10000001	3300025986	Bacteria	1439333
639	Ga0207677_10041525	3300026023	Bacteria	3042
640	Ga0207703_10004550	3300026035	Bacteria	11368
641	Ga0207703_10020304	3300026035	Bacteria	5195
642	Ga0207703_10026544	3300026035	Bacteria	4559
643	Ga0207703_10142242	3300026035	Bacteria	2083
644	Ga0207703_10278027	3300026035	Bacteria	1519
645	Ga0207639_10099171	3300026041	Bacteria	2350
646	Ga0207678_10000003	3300026067	Bacteria	282716
647	Ga0207678_10132874	3300026067	Bacteria	2123
648	Ga0207708_10001685	3300026075	Bacteria	16375
649	Ga0207708_10006837	3300026075	Bacteria	8437
650	Ga0207702_10000282	3300026078	Bacteria	58756
651	Ga0207702_10014595	3300026078	Bacteria	6520
652	Ga0207702_10116006	3300026078	Bacteria	2389
653	Ga0207702_10192200	3300026078	Bacteria	1887
654	Ga0207641_10004150	3300026088	Bacteria	12625
655	Ga0207641_10014833	3300026088	Bacteria	6387
656	Ga0207641_10091515	3300026088	Bacteria	2662
657	Ga0207641_10243962	3300026088	Bacteria	1675
658	Ga0207641_10624941	3300026088	Bacteria	1056
659	Ga0207648_10000185	3300026089	Bacteria	65925
660	Ga0207648_10003664	3300026089	Bacteria	16079
661	Ga0207648_10118560	3300026089	Bacteria	2326
662	Ga0207676_10000001	3300026095	Bacteria	1439222
663	Ga0207676_10298002	3300026095	Bacteria	1471
664	Ga0207674_10001225	3300026116	Bacteria	33458
665	Ga0207674_10008819	3300026116	Bacteria	11606
666	Ga0207674_10024443	3300026116	Bacteria	6457
667	Ga0207674_10368538	3300026116	Bacteria	1388
668	Ga0207675_100000150	3300026118	Bacteria	61064
669	Ga0207683_10037070	3300026121	Bacteria	4246
670	Ga0207683_10154655	3300026121	Bacteria	2071
671	Ga0209281_1000292	3300027111	Bacteria	91706
672	Ga0209281_1002052	3300027111	Bacteria	9083
673	Ga0209281_1006101	3300027111	Bacteria	3199
674	Ga0209281_1008623	3300027111	Bacteria	2458
675	Ga0209281_1013738	3300027111	Bacteria	1737
676	Ga0209371_1019408	3300027312	Bacteria	1698
677	Ga0209179_1006859	3300027512	Bacteria	1856
678	Ga0209282_1000104	3300027666	Bacteria	56438
679	Ga0209588_1002255	3300027671	Bacteria	5213
680	Ga0209971_1009011	3300027682	Bacteria	2367
681	Ga0207428_10024969	3300027907	Bacteria	5010
682	Ga0268266_10002310	3300028379	Bacteria	20684
683	Ga0268266_10003308	3300028379	Bacteria	16191
684	Ga0268266_10227594	3300028379	Bacteria	1716
685	Ga0268265_10001178	3300028380	Bacteria	22895
686	Ga0268265_10001756	3300028380	Bacteria	17426
687	Ga0268264_10000061	3300028381	Bacteria	303123
688	Ga0268264_10000580	3300028381	Bacteria	44357
689	Ga0307517_10045409	3300028786	Bacteria	4615
690	Ga0307515_10000109	3300028794	Bacteria	195895
691	Ga0307515_10002570	3300028794	Bacteria	39179
692	Ga0307515_10058618	3300028794	Bacteria	5541
693	Ga0307515_10156171	3300028794	Bacteria	2353
694	Ga0268256_1028313	3300030500	Bacteria	1385
695	Ga0307512_10043819	3300030522	Bacteria	3686
696	Ga0265332_10000006	3300031238	Bacteria	327963
697	Ga0265332_10000286	3300031238	Bacteria	39704
698	Ga0265325_10001603	3300031241	Bacteria	15771
699	Ga0265331_10001750	3300031250	Bacteria	15608
700	Ga0265331_10027842	3300031250	Bacteria	2830
701	Ga0265327_10000002	3300031251	Bacteria	856593
702	Ga0265327_10000112	3300031251	Bacteria	175878
703	Ga0265327_10000135	3300031251	Bacteria	162683
704	Ga0265327_10000283	3300031251	Bacteria	100296
705	Ga0265327_10011154	3300031251	Bacteria	6230
706	Ga0265316_10000005	3300031344	Bacteria	304442
707	Ga0307513_10020924	3300031456	Bacteria	7739
708	Ga0307513_10052125	3300031456	Bacteria	4408
709	Ga0307513_10060128	3300031456	Bacteria	4029
710	Ga0307509_10000009	3300031507	Bacteria	350890
711	Ga0307408_100004765	3300031548	Bacteria	9147
712	Ga0307408_100043117	3300031548	Bacteria	3209
713	Ga0265313_10000827	3300031595	Bacteria	31277
714	Ga0307514_10003041	3300031649	Bacteria	16567
715	Ga0316579_10000672	3300031691	Bacteria	11564
716	Ga0316579_10002365	3300031691	Bacteria	7110
717	Ga0316576_10021768	3300031727	Bacteria	4439
718	Ga0316576_10053582	3300031727	Bacteria	2939
719	Ga0316576_10110243	3300031727	Bacteria	2062
720	Ga0316578_10007257	3300031728	Bacteria	5542
721	Ga0316578_10045680	3300031728	Bacteria	2551
722	Ga0316578_10082532	3300031728	Bacteria	1913
723	Ga0307516_10000092	3300031730	Bacteria	100931
724	Ga0307516_10027572	3300031730	Bacteria	5759
725	Ga0307516_10033971	3300031730	Bacteria	5129
726	Ga0307405_10032478	3300031731	Bacteria	3086
727	Ga0316577_10013353	3300031733	Bacteria	4488
728	Ga0316577_10094367	3300031733	Bacteria	1675
729	Ga0307413_10061791	3300031824	Bacteria	2314
730	Ga0307410_10000820	3300031852	Bacteria	13175
731	Ga0307406_10115055	3300031901	Bacteria	1859
732	Ga0307406_10331301	3300031901	Bacteria	1182
733	Ga0307407_10002471	3300031903	Bacteria	7249
734	Ga0307412_10005786	3300031911	Bacteria	6951
735	Ga0307412_10035732	3300031911	Bacteria	3177
736	Ga0307412_10140411	3300031911	Bacteria	1768
737	Ga0307412_10187018	3300031911	Bacteria	1563
738	Ga0307412_10296288	3300031911	Bacteria	1276
739	Ga0307409_100002729	3300031995	Bacteria	9320
740	Ga0307409_100026937	3300031995	Bacteria	4064
741	Ga0307409_100076579	3300031995	Bacteria	2683
742	Ga0307409_100429329	3300031995	Bacteria	1270
743	Ga0307416_100014234	3300032002	Bacteria	5441
744	Ga0307416_100093847	3300032002	Bacteria	2586
745	Ga0307414_10000209	3300032004	Bacteria	39278
746	Ga0307414_10148228	3300032004	Bacteria	1847
747	Ga0307411_10000152	3300032005	Bacteria	21979
748	Ga0307415_100044860	3300032126	Bacteria	2959
749	Ga0316583_10003647	3300032133	Bacteria	5440
750	Ga0316583_10020451	3300032133	Bacteria	2371
751	Ga0316583_10051767	3300032133	Bacteria	1445
752	Ga0316583_10056894	3300032133	Bacteria	1374
753	Ga0316585_10005954	3300032137	Bacteria	3465
754	Ga0316585_10008322	3300032137	Bacteria	3008
755	Ga0316585_10064889	3300032137	Bacteria	1182
756	Ga0316580_10005455	3300032139	Bacteria	3711
757	Ga0316580_10011312	3300032139	Bacteria	2707
758	Ga0316593_10045703	3300032168	Bacteria	1468
759	Ga0316592_1005196	3300033524	Bacteria	2460
760	Ga0316588_1003391	3300033528	Bacteria	2903
761	Ga0316596_1001689	3300033541	Bacteria	4557
762	Ga0316596_1002580	3300033541	Bacteria	3880
763	Ga0316596_1024272	3300033541	Bacteria	1557
764	Ga0373950_0006780	3300034818	Bacteria	1760
765	Ga0373926_0003726	3300035083	Bacteria	4959
766	Ga0373926_0022418	3300035083	Bacteria	2192
767	Ga0373934_0003309	3300035086	Bacteria	5900
768	Ga0373934_0069390	3300035086	Bacteria	1409
769	Ga0373944_0011370	3300035089	Bacteria	2438
770	Ga0373944_0035390	3300035089	Bacteria	1522
771	Ga0373923_0000746	3300035111	Bacteria	8415
772	Ga0373923_0045907	3300035111	Bacteria	1815
773	Ga0373932_0059872	3300035112	Bacteria	1154
774	Ga0373936_0000944	3300035113	Bacteria	10374
775	Ga0373936_0002959	3300035113	Bacteria	6352
776	Ga0373945_0017893	3300035116	Bacteria	2405
777	Ga0373953_0002650	3300035117	Bacteria	5423
778	Ga0373953_0014727	3300035117	Bacteria	2819
779	Ga0373954_0000460	3300035118	Bacteria	15238
780	Ga0373954_0002190	3300035118	Bacteria	8122
781	Ga0373954_0002349	3300035118	Bacteria	7904
782	Ga0373956_0005665	3300035119	Bacteria	4995
783	Ga0373956_0005694	3300035119	Bacteria	4982
784	Ga0373957_0001628	3300035120	Bacteria	6152
785	Ga0373957_0009304	3300035120	Bacteria	3212
786	Ga0373946_0063295	3300035171	Bacteria	1579
787	Ga0373955_0004736	3300035172	Bacteria	6051
788	Ga0373955_0006690	3300035172	Bacteria	5260
789	Ga0373955_0078382	3300035172	Bacteria	1862
790	Ga0373942_0007330	3300035207	Bacteria	2557
791	Ga0373942_0008470	3300035207	Bacteria	2398
792	Ga0316574_0000684	3300035398	Bacteria	14385
793	Ga0316574_0002855	3300035398	Bacteria	8772
794	Ga0316574_0005125	3300035398	Bacteria	6966
795	Ga0316574_0065379	3300035398	Bacteria	2289
796	Ga0316574_0101268	3300035398	Bacteria	1844
797	Ga0316574_0230001	3300035398	Bacteria	1187
798	Ga0373924_0001313	3300035410	Bacteria	7991
799	Ga0373924_0007038	3300035410	Bacteria	4050
800	Ga0373924_0013557	3300035410	Bacteria	3064
801	Ga0373924_0049214	3300035410	Bacteria	1743
802	Ga0373924_0054479	3300035410	Bacteria	1663
803	Ga0373931_0007119	3300035691	Bacteria	5260
804	Ga0373935_0047311	3300035692	Bacteria	2719
805	Ga0373927_0031287	3300035695	Bacteria	3469
806	Ga0373927_0054218	3300035695	Bacteria	2593
807	Ga0373933_0002728	3300035724	Bacteria	9875
808	Ga0373933_0003128	3300035724	Bacteria	9228
809	Ga0373933_0020715	3300035724	Bacteria	3728
810	Ga0373933_0136342	3300035724	Bacteria	1546
811	Ga0373937_0006427	3300036401	Bacteria	10145
812	Ga0373937_0034259	3300036401	Bacteria	4619
813	Ga0373937_0044183	3300036401	Bacteria	4068
814	Ga0373937_0056039	3300036401	Bacteria	3619
815	Ga0373937_0059221	3300036401	Bacteria	3519
816	Ga0316582_0003428	3300036647	Bacteria	7775
817	Ga0316582_0010032	3300036647	Bacteria	5169
818	Ga0316582_0057790	3300036647	Bacteria	2479
819	Ga0316584_0002366	3300036712	Bacteria	11909
820	Ga0316584_0010705	3300036712	Bacteria	6423
821	Ga0316584_0029937	3300036712	Bacteria	4020
822	Ga0316584_0107980	3300036712	Bacteria	2082
823	Ga0373925_0062944	3300037068	Bacteria	2790
824	Ga0395899_0001968	3300037312	Bacteria	16886
825	Ga0395899_0003139	3300037312	Bacteria	13145
826	Ga0395899_0004622	3300037312	Bacteria	10729
827	Ga0395899_0067333	3300037312	Bacteria	2628
828	Ga0395900_0001121	3300037418	Bacteria	33924
829	Ga0395900_0011305	3300037418	Bacteria	9131
830	Ga0395900_0038804	3300037418	Bacteria	4910
831	Ga0395900_0056967	3300037418	Bacteria	4023
832	Ga0395900_0060354	3300037418	Bacteria	3903
833	Ga0395900_0277675	3300037418	Bacteria	1668
834	Ga0395898_0031221	3300037466	Bacteria	5325
835	Ga0395898_0052937	3300037466	Bacteria	3964
836	Ga0395898_0219030	3300037466	Bacteria	1816
837	Ga0395905_0002363	3300037471	Bacteria	21022
838	Ga0395905_0006067	3300037471	Bacteria	12227
839	Ga0395905_0018367	3300037471	Bacteria	6637
840	Ga0395905_0019311	3300037471	Bacteria	6462
841	Ga0395905_0037579	3300037471	Bacteria	4545
842	Ga0395905_0051936	3300037471	Bacteria	3839
843	Ga0395905_0079937	3300037471	Bacteria	3064
844	Ga0395905_0163344	3300037471	Bacteria	2093
845	Ga0395905_0282722	3300037471	Bacteria	1545
846	Ga0395905_0446185	3300037471	Bacteria	1191
847	Ga0436364_0685277	3300037853	Unclassified	4008
848	Ga0395901_0010884	3300038443	Bacteria	9218
849	Ga0395901_0023730	3300038443	Bacteria	6290
850	Ga0395901_0072023	3300038443	Bacteria	3602
851	Ga0395901_0088181	3300038443	Bacteria	3245
852	Ga0395901_0138724	3300038443	Bacteria	2556
853	Ga0395901_0184923	3300038443	Bacteria	2185
854	Ga0395901_0211109	3300038443	Bacteria	2032
855	Ga0395901_0258346	3300038443	Bacteria	1813
856	Ga0395901_0269719	3300038443	Bacteria	1770
857	Ga0400490_55232	3300038726	Bacteria	3331
858	Ga0400488_07026	3300038741	Bacteria	6545
859	Ga0400483_016983	3300039062	Bacteria	1311
860	Ga0400487_46529	3300039110	Bacteria	1848
861	Ga0436361_0713752	3300039447	Bacteria	26171
862	Ga0436361_0760581	3300039447	Bacteria	1337
863	Ga0436361_0923738	3300039447	Bacteria	3193
864	Ga0436361_1065758	3300039447	Bacteria	1148
865	Ga0436361_1195827	3300039447	Bacteria	32379
866	Ga0436361_1201305	3300039447	Bacteria	11197
867	Ga0439436_0022205	3300041404	Bacteria	1881
868	Ga0439438_000048	3300041405	Bacteria	58674
869	Ga0439438_000210	3300041405	Bacteria	26908
870	Ga0439438_000804	3300041405	Bacteria	14024
871	Ga0439438_043701	3300041405	Bacteria	1156
872	Ga0439447_000014	3300041407	Bacteria	72178
873	Ga0439447_005040	3300041407	Bacteria	4444
874	Ga0439466_0004146	3300041411	Bacteria	5599
875	Ga0439466_0007672	3300041411	Bacteria	4074
876	Ga0439466_0026629	3300041411	Bacteria	2008
877	Ga0439465_0008806	3300041413	Bacteria	3179
878	Ga0451789_0664144	3300041443	Bacteria	2090
879	Ga0451795_1136473	3300041456	Bacteria	3096
880	Ga0451804_0937624	3300041463	Bacteria	1832
881	Ga0451855_0381342	3300041511	Unclassified	3015
882	Ga0451855_0502112	3300041511	Bacteria	1170
883	Ga0439448_0001377	3300042005	Bacteria	6248
884	Ga0439432_002991	3300042006	Bacteria	6292
885	Ga0439452_000043	3300042010	Bacteria	132609
886	Ga0439452_000137	3300042010	Bacteria	55736
887	Ga0439452_001318	3300042010	Bacteria	10419
888	Ga0439456_000485	3300042013	Bacteria	8685
889	Ga0439456_001239	3300042013	Bacteria	5086
890	Ga0450911_000009	3300042115	Bacteria	162968
891	Ga0450911_000056	3300042115	Bacteria	46087
892	Ga0450911_000877	3300042115	Bacteria	8125
893	Ga0450919_001181	3300042121	Bacteria	3404
894	Ga0450890_000657	3300042127	Bacteria	5037
895	Ga0450890_002504	3300042127	Bacteria	2523
896	Ga0450900_002343	3300042136	Bacteria	1996
897	Ga0450903_004906	3300042138	Bacteria	2256
898	Ga0450906_000005	3300042145	Bacteria	44636
899	Ga0450906_001283	3300042145	Bacteria	5518
900	Ga0450907_000411	3300042146	Bacteria	12887
901	Ga0450907_000785	3300042146	Bacteria	7955
902	Ga0450910_001385	3300042147	Bacteria	3041
903	Ga0450908_000330	3300042184	Bacteria	9268
904	Ga0450908_002970	3300042184	Bacteria	3305
905	Ga0450909_000738	3300042185	Bacteria	4411
906	Ga0439460_0002495	3300042461	Bacteria	4441
907	Ga0451577_0004564	3300042876	Bacteria	14571
908	Ga0451577_0011981	3300042876	Bacteria	8169
909	Ga0451577_0036460	3300042876	Bacteria	4426
910	Ga0451577_0059564	3300042876	Bacteria	3404
911	Ga0451577_0072597	3300042876	Bacteria	3071
912	Ga0451577_0386029	3300042876	Bacteria	1271
913	Ga0439440_0000098	3300042993	Bacteria	11469
914	Ga0466972_0001821	3300044658	Bacteria	10444
915	Ga0466972_0010034	3300044658	Bacteria	4756
916	Ga0466972_0087775	3300044658	Bacteria	1477
917	Ga0453683_0003765	3300044673	Bacteria	11061
918	Ga0453683_0005613	3300044673	Bacteria	8719
919	Ga0453683_0019623	3300044673	Bacteria	4327
920	Ga0453683_0081177	3300044673	Bacteria	2031
921	Ga0466965_0000030	3300044683	Bacteria	54195
922	Ga0466961_0000035	3300044693	Bacteria	82931
923	Ga0466961_0023786	3300044693	Bacteria	3942
924	Ga0466963_0062855	3300044694	Bacteria	2484
925	Ga0466963_0077200	3300044694	Bacteria	2250
926	Ga0466963_0183722	3300044694	Bacteria	1460
927	Ga0466964_0149151	3300044706	Bacteria	1082
928	Ga0453684_0000508	3300044712	Bacteria	151703
929	Ga0453684_0094889	3300044712	Bacteria	3668
930	Ga0453684_0127701	3300044712	Bacteria	3057
931	Ga0453684_0136145	3300044712	Bacteria	2941
932	Ga0453684_0165303	3300044712	Bacteria	2613
933	Ga0453684_0501639	3300044712	Bacteria	1343
934	Ga0453684_0508102	3300044712	Bacteria	1333
935	Ga0466970_0058561	3300044765	Bacteria	2062
936	Ga0466959_0023064	3300045049	Bacteria	4604
937	Ga0451576_0000174	3300045051	Bacteria	162062
938	Ga0451576_0000564	3300045051	Bacteria	79450
939	Ga0451576_0001107	3300045051	Bacteria	49185
940	Ga0451576_0002742	3300045051	Bacteria	25555
941	Ga0451576_0006044	3300045051	Bacteria	14944
942	Ga0451576_0019963	3300045051	Bacteria	7303
943	Ga0451576_0039996	3300045051	Bacteria	4964
944	Ga0451576_0069612	3300045051	Bacteria	3662
945	Ga0451576_0148438	3300045051	Bacteria	2445
946	Ga0451576_0230025	3300045051	Bacteria	1936
947	Ga0466967_0000106	3300045976	Bacteria	30566
948	Ga0466967_0047260	3300045976	Bacteria	3751
949	Ga0466967_0338459	3300045976	Bacteria	1454
950	Ga0495617_000325	3300046452	Bacteria	26752
951	Ga0495617_010045	3300046452	Bacteria	3245
952	Ga0495617_014754	3300046452	Bacteria	2654
953	Ga0495592_0027753	3300046454	Bacteria	4289
954	Ga0495592_0108332	3300046454	Bacteria	1969
955	Ga0495592_0155690	3300046454	Bacteria	1577
956	Ga0495592_0173224	3300046454	Bacteria	1476
957	Ga0495603_0033279	3300046455	Bacteria	3102
958	Ga0495603_0088988	3300046455	Bacteria	1806
959	Ga0495603_0108658	3300046455	Bacteria	1619
960	Ga0495603_0126065	3300046455	Bacteria	1492
961	Ga0495590_0000259	3300046457	Bacteria	28903
962	Ga0495590_0018152	3300046457	Bacteria	2521
963	Ga0495590_0085508	3300046457	Bacteria	1113
964	Ga0495591_000139	3300046458	Bacteria	78636
965	Ga0495591_002976	3300046458	Bacteria	9042
966	Ga0495629_0076797	3300046459	Bacteria	2332
967	Ga0495638_0000117	3300046460	Bacteria	127788
968	Ga0495638_0001627	3300046460	Bacteria	19997
969	Ga0495638_0027175	3300046460	Bacteria	3706
970	Ga0495638_0053999	3300046460	Bacteria	2499
971	Ga0495641_0042616	3300046461	Bacteria	2102
972	Ga0495651_0042963	3300046462	Bacteria	3507
973	Ga0495651_0057562	3300046462	Bacteria	2984
974	Ga0495651_0072562	3300046462	Bacteria	2614
975	Ga0495653_0002466	3300046463	Bacteria	14706
976	Ga0495653_0004204	3300046463	Bacteria	11656
977	Ga0495653_0040257	3300046463	Bacteria	3653
978	Ga0495653_0174436	3300046463	Bacteria	1481
979	Ga0495650_0001284	3300046471	Bacteria	25747
980	Ga0495650_0003472	3300046471	Bacteria	11462
981	Ga0495650_0005742	3300046471	Bacteria	7924
982	Ga0495580_0002887	3300046472	Bacteria	14785
983	Ga0495580_0168240	3300046472	Bacteria	1516
984	Ga0495582_0014675	3300046473	Bacteria	4305
985	Ga0495582_0042697	3300046473	Bacteria	2497
986	Ga0495605_0000294	3300046474	Bacteria	54833
987	Ga0495605_0000886	3300046474	Bacteria	20625
988	Ga0495605_0006814	3300046474	Bacteria	6527
989	Ga0495605_0008053	3300046474	Bacteria	5967
990	Ga0495605_0012236	3300046474	Bacteria	4765
991	Ga0495605_0132121	3300046474	Bacteria	1125
992	Ga0495639_0000033	3300046475	Bacteria	64043
993	Ga0495639_0002535	3300046475	Bacteria	7972
994	Ga0495639_0013216	3300046475	Bacteria	3562
995	Ga0495639_0034155	3300046475	Bacteria	2274
996	Ga0495664_0004827	3300046477	Bacteria	7370
997	Ga0495664_0062169	3300046477	Bacteria	2223
998	Ga0495584_0000012	3300046491	Bacteria	189225
999	Ga0495584_0007276	3300046491	Bacteria	5775
1000	Ga0495584_0047147	3300046491	Bacteria	2173
1001	Ga0495585_0000715	3300046492	Bacteria	29808
1002	Ga0495585_0002814	3300046492	Bacteria	12133
1003	Ga0495585_0004460	3300046492	Bacteria	9075
1004	Ga0495585_0026369	3300046492	Bacteria	3318
1005	Ga0495585_0033467	3300046492	Bacteria	2908
1006	Ga0495594_0000528	3300046499	Bacteria	19643
1007	Ga0495594_0003739	3300046499	Bacteria	7809
1008	Ga0495594_0004458	3300046499	Bacteria	7195
1009	Ga0495596_0000688	3300046500	Bacteria	20983
1010	Ga0495607_0000344	3300046501	Bacteria	48079
1011	Ga0495607_0001542	3300046501	Bacteria	20175
1012	Ga0495607_0024629	3300046501	Bacteria	3749
1013	Ga0495607_0026797	3300046501	Bacteria	3572
1014	Ga0495607_0032141	3300046501	Bacteria	3206
1015	Ga0495607_0051284	3300046501	Bacteria	2397
1016	Ga0495607_0114548	3300046501	Bacteria	1425
1017	Ga0495583_0014221	3300046506	Bacteria	4401
1018	Ga0495583_0015460	3300046506	Bacteria	4149
1019	Ga0495606_0000077	3300046507	Bacteria	166824
1020	Ga0495606_0002297	3300046507	Bacteria	22610
1021	Ga0495606_0002337	3300046507	Bacteria	22341
1022	Ga0495606_0002486	3300046507	Bacteria	21331
1023	Ga0495606_0010465	3300046507	Bacteria	7692
1024	Ga0495606_0064091	3300046507	Bacteria	2340
1025	Ga0495608_0040537	3300046511	Bacteria	3119
1026	Ga0495608_0187141	3300046511	Bacteria	1308
1027	Ga0495610_0001830	3300046512	Bacteria	18460
1028	Ga0495610_0008477	3300046512	Bacteria	6651
1029	Ga0495610_0009848	3300046512	Bacteria	5986
1030	Ga0495616_0002277	3300046513	Bacteria	12837
1031	Ga0495616_0002760	3300046513	Bacteria	11489
1032	Ga0495616_0011570	3300046513	Bacteria	5049
1033	Ga0495616_0017376	3300046513	Bacteria	3968
1034	Ga0495618_0006408	3300046514	Bacteria	7143
1035	Ga0495618_0085830	3300046514	Bacteria	2012
1036	Ga0495620_0002267	3300046515	Bacteria	11129
1037	Ga0495628_0032773	3300046516	Bacteria	4191
1038	Ga0495630_0002002	3300046517	Bacteria	14176
1039	Ga0495630_0015933	3300046517	Bacteria	5494
1040	Ga0495630_0141042	3300046517	Bacteria	1832
1041	Ga0495631_0000002	3300046518	Bacteria	178694
1042	Ga0495631_0009955	3300046518	Bacteria	4726
1043	Ga0495631_0023343	3300046518	Bacteria	2868
1044	Ga0495632_0000698	3300046519	Bacteria	30511
1045	Ga0495632_0002226	3300046519	Bacteria	14960
1046	Ga0495632_0004210	3300046519	Bacteria	9836
1047	Ga0495632_0007317	3300046519	Bacteria	6956
1048	Ga0495632_0010237	3300046519	Bacteria	5572
1049	Ga0495632_0014124	3300046519	Bacteria	4531
1050	Ga0495637_0001843	3300046520	Bacteria	12125
1051	Ga0495637_0002243	3300046520	Bacteria	10749
1052	Ga0495637_0002962	3300046520	Bacteria	9138
1053	Ga0495637_0003867	3300046520	Bacteria	7859
1054	Ga0495637_0005166	3300046520	Bacteria	6685
1055	Ga0495643_0001583	3300046522	Bacteria	20197
1056	Ga0495643_0032486	3300046522	Bacteria	2897
1057	Ga0495643_0072048	3300046522	Bacteria	1813
1058	Ga0495643_0077467	3300046522	Bacteria	1737
1059	Ga0495643_0128095	3300046522	Bacteria	1276
1060	Ga0495648_0005945	3300046524	Bacteria	10044
1061	Ga0495648_0008088	3300046524	Bacteria	8314
1062	Ga0495648_0026126	3300046524	Bacteria	3935
1063	Ga0495648_0049733	3300046524	Bacteria	2567
1064	Ga0495666_0006632	3300046526	Bacteria	5821
1065	Ga0495666_0017456	3300046526	Bacteria	3574
1066	Ga0495666_0023892	3300046526	Bacteria	3023
1067	Ga0495666_0028142	3300046526	Bacteria	2766
1068	Ga0495642_0000247	3300046528	Bacteria	30419
1069	Ga0495642_0018609	3300046528	Bacteria	2720
1070	Ga0495652_0007448	3300046529	Bacteria	10088
1071	Ga0495652_0044352	3300046529	Bacteria	3830
1072	Ga0495652_0105470	3300046529	Bacteria	2277
1073	Ga0495654_0001046	3300046530	Bacteria	20265
1074	Ga0495654_0001387	3300046530	Bacteria	16790
1075	Ga0495654_0003664	3300046530	Bacteria	9331
1076	Ga0495654_0009956	3300046530	Bacteria	5193
1077	Ga0495654_0090888	3300046530	Bacteria	1417
1078	Ga0495665_0050790	3300046531	Bacteria	2198
1079	Ga0495640_0007240	3300046533	Bacteria	8739
1080	Ga0495586_0002207	3300046535	Bacteria	10572
1081	Ga0495586_0016337	3300046535	Bacteria	3947
1082	Ga0495586_0031894	3300046535	Bacteria	2824
1083	Ga0495586_0037499	3300046535	Bacteria	2602
1084	Ga0495586_0108344	3300046535	Bacteria	1545
1085	Ga0495586_0110670	3300046535	Bacteria	1528
1086	Ga0495587_0005832	3300046536	Bacteria	8018
1087	Ga0495598_0010168	3300046537	Bacteria	2248
1088	Ga0495609_0002525	3300046538	Bacteria	11223
1089	Ga0495609_0003623	3300046538	Bacteria	8767
1090	Ga0495609_0013498	3300046538	Bacteria	3855
1091	Ga0495597_0000326	3300046542	Bacteria	43111
1092	Ga0495597_0008526	3300046542	Bacteria	5131
1093	Ga0495597_0034305	3300046542	Bacteria	2293
1094	Ga0495597_0064672	3300046542	Bacteria	1588
1095	Ga0495645_0087451	3300046543	Bacteria	2229
1096	Ga0495622_0000738	3300046557	Bacteria	18434
1097	Ga0495622_0015515	3300046557	Bacteria	3542
1098	Ga0495622_0025994	3300046557	Bacteria	2735
1099	Ga0495622_0129926	3300046557	Bacteria	1148
1100	Ga0495633_0000682	3300046558	Bacteria	31296
1101	Ga0495633_0000940	3300046558	Bacteria	24435
1102	Ga0495633_0004864	3300046558	Bacteria	8400
1103	Ga0495667_0036934	3300046559	Bacteria	3257
1104	Ga0495667_0041909	3300046559	Bacteria	3035
1105	Ga0495667_0090899	3300046559	Bacteria	1977
1106	Ga0495667_0091182	3300046559	Bacteria	1974
1107	Ga0495668_0000001	3300046616	Bacteria	1013420
1108	Ga0495634_0000666	3300046642	Bacteria	33439
1109	Ga0495634_0127033	3300046642	Bacteria	1628
1110	Ga0495611_0002377	3300046648	Bacteria	8666
1111	Ga0495625_0000237	3300046660	Bacteria	86257
1112	Ga0495625_0000947	3300046660	Bacteria	38804
1113	Ga0495625_0001545	3300046660	Bacteria	27479
1114	Ga0495625_0008120	3300046660	Bacteria	8996
1115	Ga0495625_0015716	3300046660	Bacteria	5981
1116	Ga0495625_0120026	3300046660	Bacteria	1790
1117	Ga0495635_0000684	3300046663	Bacteria	21844
1118	Ga0495635_0013704	3300046663	Bacteria	5672
1119	Ga0495635_0035765	3300046663	Bacteria	3444
1120	Ga0495635_0119981	3300046663	Bacteria	1794
1121	Ga0495635_0188397	3300046663	Bacteria	1401
1122	Ga0495659_0000088	3300046664	Bacteria	40625
1123	Ga0495661_0000350	3300046665	Bacteria	50303
1124	Ga0495661_0000963	3300046665	Bacteria	26140
1125	Ga0495661_0012934	3300046665	Bacteria	5622
1126	Ga0495661_0106266	3300046665	Bacteria	1571
1127	Ga0495657_0003489	3300046675	Bacteria	12828
1128	Ga0495657_0017800	3300046675	Bacteria	5153
1129	Ga0495657_0182546	3300046675	Bacteria	1287
1130	Ga0495657_0232832	3300046675	Bacteria	1114
1131	Ga0495599_0001215	3300046678	Bacteria	14613
1132	Ga0495599_0037862	3300046678	Bacteria	3030
1133	Ga0495623_0000826	3300046679	Bacteria	20903
1134	Ga0495647_0005442	3300046681	Bacteria	4171
1135	Ga0495647_0008798	3300046681	Bacteria	3401
1136	Ga0495658_0021176	3300046683	Bacteria	3425
1137	Ga0495658_0034803	3300046683	Bacteria	2766
1138	Ga0495658_0037284	3300046683	Bacteria	2686
1139	Ga0495658_0042853	3300046683	Bacteria	2528
1140	Ga0495613_0019556	3300046689	Bacteria	5048
1141	Ga0495613_0023758	3300046689	Bacteria	4568
1142	Ga0495613_0056062	3300046689	Bacteria	2894
1143	Ga0495613_0069097	3300046689	Bacteria	2576
1144	Ga0495624_0066244	3300046690	Bacteria	2255
1145	Ga0495624_0076535	3300046690	Bacteria	2076
1146	Ga0495670_0000057	3300046691	Bacteria	54709
1147	Ga0495670_0000159	3300046691	Bacteria	29368
1148	Ga0495670_0013830	3300046691	Bacteria	3968
1149	Ga0495670_0022924	3300046691	Bacteria	3082
1150	Ga0495670_0026821	3300046691	Bacteria	2852
1151	Ga0495670_0051107	3300046691	Bacteria	2068
1152	Ga0495671_0000044	3300046692	Bacteria	160337
1153	Ga0495671_0000164	3300046692	Bacteria	58434
1154	Ga0495671_0000376	3300046692	Bacteria	36686
1155	Ga0495671_0001104	3300046692	Bacteria	18651
1156	Ga0495671_0009383	3300046692	Bacteria	5464
1157	Ga0495671_0035346	3300046692	Bacteria	2537
1158	Ga0495649_0000153	3300046694	Bacteria	60597
1159	Ga0495649_0001103	3300046694	Bacteria	21058
1160	Ga0495649_0001217	3300046694	Bacteria	19844
1161	Ga0495649_0002469	3300046694	Bacteria	12994
1162	Ga0495649_0007712	3300046694	Bacteria	6535
1163	Ga0495649_0016508	3300046694	Bacteria	4183
1164	Ga0495649_0021797	3300046694	Bacteria	3589
1165	Ga0495649_0032794	3300046694	Bacteria	2859
1166	Ga0495649_0047156	3300046694	Bacteria	2344
1167	Ga0495649_0103115	3300046694	Bacteria	1515
1168	Ga0495589_0000057	3300046794	Bacteria	108136
1169	Ga0495589_0000764	3300046794	Bacteria	20540
1170	Ga0495589_0004333	3300046794	Bacteria	7570
1171	Ga0495589_0026032	3300046794	Bacteria	2965
1172	Ga0495600_0000287	3300046809	Bacteria	27204
1173	Ga0495600_0006382	3300046809	Bacteria	7176
1174	Ga0495600_0190300	3300046809	Bacteria	1320
1175	Ga0495660_0000351	3300046810	Bacteria	40836
1176	Ga0495660_0008290	3300046810	Bacteria	6085
1177	Ga0495660_0014611	3300046810	Bacteria	4540
1178	Ga0495660_0016020	3300046810	Bacteria	4324
1179	Ga0495660_0020099	3300046810	Bacteria	3830
1180	Ga0495660_0023165	3300046810	Bacteria	3543
1181	Ga0495660_0026094	3300046810	Bacteria	3315
1182	Ga0495660_0041469	3300046810	Bacteria	2548
1183	Ga0495660_0094201	3300046810	Bacteria	1551
1184	Ga0495581_0000537	3300047315	Bacteria	19502
1185	Ga0495604_0008675	3300047317	Bacteria	8032
1186	Ga0495604_0018160	3300047317	Bacteria	5631
1187	Ga0495604_0030452	3300047317	Bacteria	4286
1188	Ga0495604_0034492	3300047317	Bacteria	4002
1189	Ga0495604_0035672	3300047317	Bacteria	3926
1190	Ga0495636_0004950	3300047318	Bacteria	5223
1191	Ga0495636_0050639	3300047318	Bacteria	1739
1192	Ga0495674_0002736	3300047319	Bacteria	17126
1193	Ga0495674_0023787	3300047319	Bacteria	5640
1194	Ga0495672_0001002	3300047320	Bacteria	29119
1195	Ga0495672_0001180	3300047320	Bacteria	26503
1196	Ga0495672_0012599	3300047320	Bacteria	5890
1197	Ga0495672_0027914	3300047320	Bacteria	3579
1198	Ga0495680_0005668	3300047322	Bacteria	11694
1199	Ga0495680_0014295	3300047322	Bacteria	6881
1200	Ga0495680_0021677	3300047322	Bacteria	5374
1201	Ga0495680_0031806	3300047322	Bacteria	4290
1202	Ga0495680_0037120	3300047322	Bacteria	3905
1203	Ga0495680_0266166	3300047322	Bacteria	1211
1204	Ga0495683_0000037	3300047323	Bacteria	140632
1205	Ga0495683_0000049	3300047323	Bacteria	124659
1206	Ga0495687_000432	3300047443	Bacteria	51756
1207	Ga0495687_000469	3300047443	Bacteria	48871
1208	Ga0495687_026353	3300047443	Bacteria	2737
1209	Ga0495675_0002793	3300047444	Bacteria	10477
1210	Ga0495675_0019702	3300047444	Bacteria	4286
1211	Ga0495675_0030091	3300047444	Bacteria	3465
1212	Ga0495679_001305	3300047446	Bacteria	14527
1213	Ga0495679_001528	3300047446	Bacteria	13061
1214	Ga0495685_000726	3300047447	Bacteria	10101
1215	Ga0495685_010072	3300047447	Bacteria	3166
1216	Ga0495673_0000093	3300047469	Bacteria	185841
1217	Ga0495673_0007225	3300047469	Bacteria	6418
1218	Ga0495673_0007438	3300047469	Bacteria	6295
1219	Ga0495673_0009280	3300047469	Bacteria	5456
1220	Ga0495673_0015570	3300047469	Bacteria	3914
1221	Ga0495673_0015864	3300047469	Bacteria	3868
1222	Ga0495673_0016560	3300047469	Bacteria	3766
1223	Ga0495673_0121563	3300047469	Bacteria	1034
1224	Ga0495681_0001735	3300047470	Bacteria	16116
1225	Ga0495681_0036583	3300047470	Bacteria	2426
1226	Ga0495684_0018670	3300047471	Bacteria	5342
1227	Ga0495684_0024299	3300047471	Bacteria	4664
1228	Ga0495684_0257313	3300047471	Bacteria	1268
1229	Ga0495686_0004189	3300047472	Bacteria	11977
1230	Ga0495593_0001113	3300047673	Bacteria	15701
1231	Ga0495614_0004011	3300048089	Bacteria	6608
1232	Ga0495626_0000072	3300048091	Bacteria	134289
1233	Ga0495626_0000375	3300048091	Bacteria	46679
1234	Ga0495626_0000626	3300048091	Bacteria	34453
1235	Ga0495626_0001638	3300048091	Bacteria	17367
1236	Ga0495626_0002535	3300048091	Bacteria	12553
1237	Ga0495626_0003095	3300048091	Bacteria	10908
1238	Ga0496102_0000073	3300048905	Bacteria	149887
1239	Ga0496102_0014630	3300048905	Bacteria	6821
1240	Ga0496102_0018581	3300048905	Bacteria	6112
1241	Ga0496102_0101279	3300048905	Bacteria	2675
1242	Ga0496102_0348315	3300048905	Bacteria	1395
1243	Ga0496103_0001000	3300048906	Bacteria	19873
1244	Ga0496103_0073955	3300048906	Bacteria	2135
1245	Ga0496103_0151751	3300048906	Bacteria	1484
1246	Ga0496104_0058669	3300048907	Bacteria	3643
1247	Ga0496104_0065159	3300048907	Bacteria	3456
1248	Ga0496104_0085495	3300048907	Bacteria	3011
1249	Ga0496104_0149810	3300048907	Bacteria	2240
1250	Ga0496104_0237953	3300048907	Bacteria	1733
1251	Ga0496105_0218307	3300048908	Bacteria	1552
1252	Ga0496108_0005607	3300048911	Bacteria	10158
1253	Ga0496109_0032898	3300048912	Bacteria	4665
1254	Ga0496109_0312423	3300048912	Bacteria	1483
1255	Ga0496111_0003492	3300048914	Bacteria	9725
1256	Ga0496112_0027227	3300048915	Bacteria	5512
1257	Ga0496112_0065145	3300048915	Bacteria	3596
1258	Ga0496113_0174067	3300048916	Bacteria	1705
1259	Ga0496114_0003651	3300048917	Bacteria	11836
1260	Ga0496114_0013607	3300048917	Bacteria	6525
1261	Ga0496116_0000258	3300048919	Bacteria	93019
1262	Ga0496116_0002973	3300048919	Bacteria	17232
1263	Ga0496116_0004731	3300048919	Bacteria	12858
1264	Ga0496116_0017601	3300048919	Bacteria	5538
1265	Ga0496116_0134928	3300048919	Bacteria	1400
1266	Ga0496117_0004145	3300048920	Bacteria	16212
1267	Ga0496117_0038442	3300048920	Bacteria	3548
1268	Ga0496117_0044968	3300048920	Bacteria	3194
1269	Ga0496117_0079418	3300048920	Bacteria	2162
1270	Ga0496117_0114067	3300048920	Bacteria	1676
1271	Ga0496117_0168411	3300048920	Bacteria	1274
1272	Ga0496118_0016625	3300048921	Bacteria	6741
1273	Ga0496118_0017796	3300048921	Bacteria	6449
1274	Ga0496118_0034126	3300048921	Bacteria	4159
1275	Ga0496118_0066369	3300048921	Bacteria	2634
1276	Ga0496119_0005305	3300048922	Bacteria	12404
1277	Ga0496119_0157266	3300048922	Bacteria	1212
1278	Ga0496120_0007411	3300048923	Bacteria	8163
1279	Ga0496121_0000324	3300048924	Bacteria	100083
1280	Ga0496121_0002826	3300048924	Bacteria	25667
1281	Ga0496121_0009869	3300048924	Bacteria	10888
1282	Ga0496121_0040668	3300048924	Bacteria	4074
1283	Ga0496121_0062446	3300048924	Bacteria	3051
1284	Ga0496121_0089757	3300048924	Bacteria	2405
1285	Ga0496121_0210528	3300048924	Bacteria	1378
1286	Ga0496122_0000029	3300048925	Bacteria	336396
1287	Ga0496122_0000256	3300048925	Bacteria	120178
1288	Ga0496122_0003738	3300048925	Bacteria	19649
1289	Ga0496122_0004595	3300048925	Bacteria	16998
1290	Ga0496122_0022555	3300048925	Bacteria	5590
1291	Ga0496122_0060180	3300048925	Bacteria	2799
1292	Ga0496122_0117136	3300048925	Bacteria	1730
1293	Ga0496122_0192204	3300048925	Bacteria	1203
1294	Ga0496123_0000196	3300048926	Bacteria	122955
1295	Ga0496123_0000427	3300048926	Bacteria	75952
1296	Ga0496123_0003595	3300048926	Bacteria	17169
1297	Ga0496123_0012356	3300048926	Bacteria	7290
1298	Ga0496124_0012711	3300048927	Bacteria	8278
1299	Ga0496124_0016981	3300048927	Bacteria	6889
1300	Ga0496124_0026958	3300048927	Bacteria	5171
1301	Ga0496124_0035814	3300048927	Bacteria	4337
1302	Ga0496124_0110605	3300048927	Bacteria	2212
1303	Ga0496124_0151094	3300048927	Bacteria	1821
1304	Ga0496125_0001115	3300048928	Bacteria	41081
1305	Ga0496125_0005320	3300048928	Bacteria	14388
1306	Ga0496125_0007203	3300048928	Bacteria	11858
1307	Ga0496125_0014898	3300048928	Bacteria	7551
1308	Ga0496125_0026914	3300048928	Bacteria	5223
1309	Ga0496125_0028702	3300048928	Bacteria	5017
1310	Ga0496125_0040292	3300048928	Bacteria	4009
1311	Ga0496126_0017756	3300048929	Bacteria	7082
1312	Ga0496126_0026184	3300048929	Bacteria	5597
1313	Ga0496126_0177375	3300048929	Bacteria	1812
1314	Ga0501310_001466	3300049130	Bacteria	2154
1315	Ga0501341_01061	3300049131	Bacteria	1315
1316	Ga0501343_000031	3300049132	Bacteria	5541
1317	Ga0501344_00091	3300049133	Bacteria	2843
1318	Ga0501305_009751	3300049161	Bacteria	1269
1319	Ga0495678_000576	3300049459	Bacteria	34953
1320	Ga0495678_000585	3300049459	Bacteria	34385
1321	Ga0495678_001691	3300049459	Bacteria	16681
1322	Ga0495678_007723	3300049459	Bacteria	5542
1323	Ga0495678_007894	3300049459	Bacteria	5458
1324	Ga0495678_016690	3300049459	Bacteria	3349
1325	Ga0495678_029464	3300049459	Bacteria	2304
1326	Ga0495682_0017369	3300049460	Bacteria	2716
1327	Ga0495682_0026554	3300049460	Bacteria	2149
1328	Ga0501331_01109	3300049547	Bacteria	1255
1329	Ga0501333_000289	3300049549	Bacteria	2167
1330	Ga0501334_01299	3300049550	Bacteria	1359
1331	Ga0501335_000778	3300049551	Bacteria	2216
1332	Ga0501337_001194	3300049553	Bacteria	1452
1333	Ga0501338_00294	3300049554	Bacteria	2140
1334	Ga0501031_0001674	3300049568	Bacteria	13916
1335	Ga0501031_0003143	3300049568	Bacteria	10586
1336	Ga0501031_0018727	3300049568	Bacteria	4507
1337	Ga0501031_0047910	3300049568	Bacteria	2786
1338	Ga0501032_0000170	3300049569	Bacteria	53079
1339	Ga0501032_0001766	3300049569	Bacteria	17061
1340	Ga0501032_0021899	3300049569	Bacteria	4437
1341	Ga0501032_0048941	3300049569	Bacteria	2853
1342	Ga0501032_0189529	3300049569	Bacteria	1344
1343	Ga0501033_0016591	3300049570	Bacteria	5572
1344	Ga0501033_0020683	3300049570	Bacteria	4972
1345	Ga0501033_0037313	3300049570	Bacteria	3638
1346	Ga0501034_0000194	3300049571	Bacteria	114531
1347	Ga0501034_0005535	3300049571	Bacteria	13778
1348	Ga0501034_0006491	3300049571	Bacteria	12591
1349	Ga0501034_0008323	3300049571	Bacteria	10976
1350	Ga0501034_0009347	3300049571	Bacteria	10272
1351	Ga0501034_0014696	3300049571	Bacteria	8060
1352	Ga0501034_0047384	3300049571	Bacteria	4340
1353	Ga0501034_0057424	3300049571	Bacteria	3913
1354	Ga0501034_0195052	3300049571	Bacteria	1986
1355	Ga0501034_0443876	3300049571	Bacteria	1216
1356	Ga0501036_0004191	3300049572	Bacteria	11619
1357	Ga0501036_0007652	3300049572	Bacteria	8818
1358	Ga0501036_0133299	3300049572	Bacteria	2097
1359	Ga0501036_0155119	3300049572	Bacteria	1931
1360	Ga0501037_0000011	3300049573	Bacteria	196525
1361	Ga0501037_0000691	3300049573	Bacteria	25695
1362	Ga0501037_0034975	3300049573	Bacteria	3706
1363	Ga0501037_0042206	3300049573	Bacteria	3353
1364	Ga0501037_0073922	3300049573	Bacteria	2478
1365	Ga0501037_0077221	3300049573	Bacteria	2417
1366	Ga0501038_0006590	3300049574	Bacteria	10738
1367	Ga0501038_0018536	3300049574	Bacteria	6285
1368	Ga0501038_0029587	3300049574	Bacteria	4851
1369	Ga0501038_0038089	3300049574	Bacteria	4212
1370	Ga0501038_0042732	3300049574	Bacteria	3946
1371	Ga0501039_0004913	3300049575	Bacteria	10127
1372	Ga0501039_0021441	3300049575	Bacteria	4956
1373	Ga0501039_0037588	3300049575	Bacteria	3737
1374	Ga0501039_0083093	3300049575	Bacteria	2494
1375	Ga0501039_0135210	3300049575	Bacteria	1936
1376	Ga0501040_0002856	3300049576	Bacteria	11153
1377	Ga0501040_0026666	3300049576	Bacteria	3887
1378	Ga0501040_0099762	3300049576	Bacteria	2024
1379	Ga0501041_0002598	3300049577	Bacteria	10302
1380	Ga0501041_0005996	3300049577	Bacteria	7110
1381	Ga0501041_0255537	3300049577	Bacteria	1102
1382	Ga0501042_0002804	3300049578	Bacteria	10785
1383	Ga0501042_0012652	3300049578	Bacteria	5724
1384	Ga0501042_0059879	3300049578	Bacteria	2719
1385	Ga0501043_0001748	3300049579	Bacteria	18724
1386	Ga0501043_0006371	3300049579	Bacteria	9481
1387	Ga0501043_0007300	3300049579	Bacteria	8773
1388	Ga0501043_0136455	3300049579	Bacteria	1922
1389	Ga0501043_0190697	3300049579	Bacteria	1594
1390	Ga0501043_0213638	3300049579	Bacteria	1494
1391	Ga0501043_0249676	3300049579	Bacteria	1367
1392	Ga0501046_0000547	3300049580	Bacteria	37402
1393	Ga0501046_0020797	3300049580	Bacteria	5421
1394	Ga0501046_0023182	3300049580	Bacteria	5110
1395	Ga0501046_0098497	3300049580	Bacteria	2245
1396	Ga0501047_0033410	3300049581	Bacteria	4965
1397	Ga0501047_0256980	3300049581	Bacteria	1595
1398	Ga0501048_0002762	3300049582	Bacteria	13393
1399	Ga0501048_0003478	3300049582	Bacteria	11973
1400	Ga0501048_0011705	3300049582	Bacteria	6544
1401	Ga0501048_0161430	3300049582	Bacteria	1586
1402	Ga0501067_0009802	3300049583	Bacteria	5300
1403	Ga0501067_0021414	3300049583	Bacteria	3577
1404	Ga0501067_0038196	3300049583	Bacteria	2666
1405	Ga0501068_0001156	3300049584	Bacteria	13994
1406	Ga0501068_0007418	3300049584	Bacteria	6072
1407	Ga0501069_0010332	3300049585	Bacteria	4940
1408	Ga0501069_0069080	3300049585	Bacteria	1978
1409	Ga0501069_0125556	3300049585	Bacteria	1467
1410	Ga0501070_0021559	3300049586	Bacteria	5405
1411	Ga0501070_0024910	3300049586	Bacteria	5018
1412	Ga0501070_0029671	3300049586	Bacteria	4583
1413	Ga0501070_0080547	3300049586	Bacteria	2694
1414	Ga0501070_0096557	3300049586	Bacteria	2445
1415	Ga0501071_0002182	3300049587	Bacteria	11771
1416	Ga0501071_0007596	3300049587	Bacteria	7138
1417	Ga0501071_0363382	3300049587	Bacteria	1102
1418	Ga0501072_0048487	3300049588	Bacteria	3345
1419	Ga0501072_0243810	3300049588	Bacteria	1431
1420	Ga0501073_0005377	3300049589	Bacteria	9592
1421	Ga0501074_0001274	3300049590	Bacteria	16657
1422	Ga0501074_0008034	3300049590	Bacteria	7642
1423	Ga0501074_0014418	3300049590	Bacteria	5752
1424	Ga0501074_0032960	3300049590	Bacteria	3754
1425	Ga0501074_0048582	3300049590	Bacteria	3065
1426	Ga0501075_0007608	3300049591	Bacteria	7517
1427	Ga0501076_0022230	3300049592	Bacteria	4872
1428	Ga0501077_0012236	3300049593	Bacteria	5374
1429	Ga0501077_0036645	3300049593	Bacteria	3125
1430	Ga0501077_0092310	3300049593	Bacteria	1918
1431	Ga0501077_0235677	3300049593	Bacteria	1163
1432	Ga0501209_000183	3300049656	Bacteria	7216
1433	Ga0501217_013421	3300049661	Bacteria	1839
1434	Ga0501079_0013743	3300049741	Bacteria	6174
1435	Ga0501079_0016472	3300049741	Bacteria	5644
1436	Ga0501079_0038197	3300049741	Bacteria	3703
1437	Ga0501080_0013525	3300049742	Bacteria	7510
1438	Ga0501080_0035908	3300049742	Bacteria	4626
1439	Ga0501080_0116248	3300049742	Bacteria	2480
1440	Ga0501080_0124261	3300049742	Bacteria	2390
1441	Ga0501081_0007295	3300049743	Bacteria	7181
1442	Ga0501081_0037686	3300049743	Bacteria	3300
1443	Ga0501083_0000498	3300049744	Bacteria	25151
1444	Ga0501083_0029772	3300049744	Bacteria	3752
1445	Ga0501241_000248	3300049758	Bacteria	12094
1446	Ga0501269_002601	3300049766	Bacteria	2208
1447	Ga0501276_000283	3300049773	Bacteria	2955
1448	Ga0501279_001541	3300049775	Bacteria	3033
1449	Ga0501035_0001627	3300049822	Bacteria	22735
1450	Ga0501035_0014784	3300049822	Bacteria	7207
1451	Ga0501035_0104404	3300049822	Bacteria	2485
1452	Ga0501035_0114669	3300049822	Bacteria	2359
1453	Ga0501035_0137929	3300049822	Bacteria	2122
1454	Ga0501044_0000699	3300049823	Bacteria	40459
1455	Ga0501044_0007107	3300049823	Bacteria	12314
1456	Ga0501044_0027519	3300049823	Bacteria	6008
1457	Ga0501044_0070631	3300049823	Bacteria	3551
1458	Ga0501044_0106395	3300049823	Bacteria	2817
1459	Ga0501044_0433077	3300049823	Bacteria	1224
1460	Ga0501045_0000835	3300049824	Bacteria	19938
1461	Ga0501045_0078257	3300049824	Bacteria	2437
1462	nmdc:mga03683_1321_c1	3300050489	Bacteria	7341
1463	nmdc:mga03683_157_c2	3300050489	Bacteria	19392
1464	nmdc:mga00v17_7604_c1	3300050491	Bacteria	5790
1465	nmdc:mga0yw44_12460_c1	3300050492	Bacteria	4434
1466	nmdc:mga0k408_161770_c1	3300050493	Bacteria	1334
1467	nmdc:mga0k408_7238_c1	3300050493	Bacteria	5931
1468	nmdc:mga0k408_97374_c1	3300050493	Bacteria	1732
1469	nmdc:mga06z11_225675_c1	3300050494	Bacteria	1096
1470	nmdc:mga07m45_60072_c1	3300050496	Bacteria	2151
1471	nmdc:mga07m45_80562_c1	3300050496	Bacteria	1859
1472	nmdc:mga09592_17883_c1	3300050508	Bacteria	5807
1473	nmdc:mga0qj67_180986_c1	3300050509	Bacteria	1712
1474	nmdc:mga06r32_154992_c1	3300050510	Bacteria	2271
1475	nmdc:mga06r32_170752_c1	3300050510	Bacteria	2158
1476	nmdc:mga06r32_382378_c1	3300050510	Bacteria	1390
1477	nmdc:mga08y16_312972_c1	3300050511	Bacteria	1617
1478	nmdc:mga08y16_583_c1	3300050511	Bacteria	33926
1479	nmdc:mga0n895_3901_c1	3300050512	Bacteria	12122
1480	nmdc:mga0n895_54075_c1	3300050512	Bacteria	3947
1481	nmdc:mga0rr50_324702_c1	3300050513	Bacteria	1291
1482	nmdc:mga0rr50_6676_c1	3300050513	Bacteria	7057
1483	nmdc:mga08x19_2313_c1	3300050514	Bacteria	11553
1484	nmdc:mga08x19_88428_c1	3300050514	Bacteria	2042
1485	nmdc:mga0a205_137_c1	3300050515	Bacteria	46112
1486	nmdc:mga0a205_25100_c1	3300050515	Bacteria	5675
1487	Ga0495601_0001769	3300053077	Bacteria	11968
1488	Ga0495601_0135349	3300053077	Bacteria	1606
1489	Ga0495601_0139775	3300053077	Bacteria	1579
1490	Ga0495595_0002433	3300053084	Bacteria	7270
1491	Ga0495619_0029057	3300053085	Bacteria	3570
1492	Ga0495619_0059104	3300053085	Bacteria	2547
1493	Ga0500578_0001174	3300053086	Bacteria	27675
1494	Ga0500643_000131	3300053087	Bacteria	77188
1495	Ga0500643_003461	3300053087	Bacteria	7602
1496	Ga0500644_0040692	3300053088	Bacteria	1539
1497	Ga0500646_0012195	3300053090	Bacteria	2217
1498	Ga0500583_0015316	3300053092	Bacteria	3029
1499	Ga0500651_0000021	3300053093	Bacteria	137927
1500	Ga0500562_021115	3300053108	Bacteria	1692
1501	Ga0500594_0000008	3300053118	Bacteria	102101
1502	Ga0500618_000099	3300053125	Bacteria	70839
1503	Ga0500628_001156	3300053129	Bacteria	4587
1504	Ga0500642_0001865	3300053130	Bacteria	6088
1505	Ga0500652_000714	3300053131	Bacteria	11287
1506	Ga0500655_001148	3300053133	Bacteria	5041
1507	Ga0500568_0004680	3300053139	Bacteria	7271
1508	Ga0500568_0017628	3300053139	Bacteria	3148
1509	Ga0500574_000178	3300053141	Bacteria	7474
1510	Ga0500619_001329	3300053154	Bacteria	4339
1511	Ga0500622_0000327	3300053156	Bacteria	47411
1512	Ga0500622_0003958	3300053156	Bacteria	9565
1513	Ga0500627_0000413	3300053158	Bacteria	11533
1514	Ga0500611_000524	3300053727	Bacteria	3879
1515	Ga0501084_0003848	3300054114	Bacteria	12219
1516	Ga0501084_0004110	3300054114	Bacteria	11855
1517	Ga0501084_0010998	3300054114	Bacteria	7496
1518	Ga0501084_0015867	3300054114	Bacteria	6249
1519	Ga0590071_017007	3300059421	Bacteria	1707
1520	Ga0587066_003179	3300059490	Bacteria	1904
1521	Ga0587077_011483	3300059493	Bacteria	1394
1522	Ga0587086_006842	3300059507	Bacteria	1288
1523	Ga0587094_005529	3300059513	Bacteria	1480
1524	Ga0587101_003661	3300059623	Bacteria	1582
1525	Ga0587109_022916	3300059624	Bacteria	1128
1526	Ga0587067_009163	3300059640	Bacteria	1468
1527	Ga0587068_008782	3300059641	Bacteria	1474
1528	Ga0587072_007204	3300059643	Bacteria	1722
1529	Ga0587072_022910	3300059643	Bacteria	1118
1530	Ga0587076_002897	3300059645	Bacteria	1982
1531	Ga0587076_003287	3300059645	Bacteria	1912
1532	Ga0587079_024483	3300059647	Bacteria	1113
1533	Ga0587102_002617	3300059649	Bacteria	1408
1534	Ga0587111_0000372	3300060346	Bacteria	4065
1535	Ga0501082_0019317	3300060353	Bacteria	5874
1536	Ga0501082_0057939	3300060353	Bacteria	3337
1537	Ga0501082_0067353	3300060353	Bacteria	3083
1538	Ga0466962_0008216	3300061719	Bacteria	5005
1539	Ga0466962_0017622	3300061719	Bacteria	3439
1540	Ga0530510_0000263	3300061734	Bacteria	33169
1541	Ga0530510_0053201	3300061734	Bacteria	2926
1542	2511258197	2511231004	Bacteria	6669789
1543	2511288074	2511231010	Bacteria	6373152
1544	2511328737	2511231016	Bacteria	6704427
1545	2511364852	2511231022	Bacteria	6719296
1546	2511383570	2511231026	Bacteria	5225445
1547	2513953421	2513237150	Bacteria	6553639
1548	2514044638	2513237165	Bacteria	6771773
1549	2548847101	2547132512	Bacteria	3416496
1550	2553005137	2551306416	Bacteria	6152985
1551	2566036534	2565956521	Bacteria	4468993
1552	2574429643	2574179768	Bacteria	4907129
1553	2585847933	2585427594	Bacteria	6180594
1554	2587726566	2585428057	Bacteria	6737412
1555	2587733375	2585428058	Bacteria	6853932
1556	2587757110	2585428062	Bacteria	6842168
1557	2588290980	2588253510	Bacteria	6901809
1558	2595090350	2593339131	Bacteria	5116855
1559	2597030974	2596583598	Bacteria	5251611
1560	2599445946	2599185178	Bacteria	5365746
1561	2599905809	2599185292	Bacteria	6290804
1562	2601798987	2600255318	Bacteria	6383414
1563	2606077882	2603880185	Bacteria	6379190
1564	2606129943	2603880199	Bacteria	6377649
1565	2624480892	2623620443	Bacteria	6427864
1566	2624491957	2623620446	Bacteria	6500345
1567	2643832105	2643221563	Bacteria	4726935
1568	2643843357	2643221565	Bacteria	6216018
1569	2643851808	2643221567	Bacteria	4163945
1570	2643860705	2643221569	Bacteria	6064337
1571	2643972088	2643221592	Bacteria	6608788
1572	2643981449	2643221594	Bacteria	5811388
1573	2644031009	2643221603	Bacteria	6147767
1574	2644054100	2643221608	Bacteria	4724829
1575	2644119550	2643221621	Bacteria	6212786
1576	2644137603	2643221624	Bacteria	4384879
1577	2644142287	2643221625	Bacteria	6512927
1578	2644245786	2643221644	Bacteria	6865017
1579	2644260657	2643221646	Bacteria	6433402
1580	2644275981	2643221648	Bacteria	6521465
1581	2644337805	2643221660	Bacteria	4208257
1582	2644610108	2643221711	Bacteria	4865335
1583	2649120404	2648501241	Bacteria	5312320
1584	2652972967	2651869818	Bacteria	5864031
1585	2715751431	2713897148	Bacteria	5883533
1586	2715756945	2713897149	Bacteria	6506249
1587	2718634033	2718217725	Bacteria	5758958
1588	2739056448	2738541337	Bacteria	6183410
1589	2739201540	2738543004	Bacteria	6381073
1590	2739287689	2738543020	Bacteria	5718238
1591	2739293002	2738543021	Bacteria	5718241
1592	2765571508	2765235838	Bacteria	5445269
1593	2808872393	2808606365	Bacteria	4301966
1594	2808982330	2808606386	Bacteria	4471946
1595	2809035356	2808606395	Bacteria	6020352
1596	2809129869	2808606415	Bacteria	4576710
1597	2809149076	2808606419	Bacteria	4576925
1598	2819544900	2818991436	Bacteria	5376622
1599	2819671209	2818991459	Bacteria	8736032
1600	2831865889	2831864461	Bacteria	6502356
1601	2834643097	2834641062	Bacteria	5559922
1602	2839098799	2839094727	Bacteria	5534556
1603	2842808683	2842805378	Bacteria	5385175
1604	2842834468	2842832357	Bacteria	5959113
1605	2842846701	2842843487	Bacteria	6004777
1606	2842888199	2842882022	Bacteria	6158489
1607	2852619216	2852618963	Bacteria	4577824
1608	2852655548	2852653556	Bacteria	4050083
1609	2852681027	2852680915	Bacteria	4100189
1610	2855731124	2855730933	Bacteria	7047938
1611	2855770275	2855767633	Bacteria	7049357
1612	2857541073	2857537821	Bacteria	5248181
1613	2857548404	2857547612	Bacteria	6179999
1614	2857610181	2857609550	Bacteria	3753890
1615	2858953472	2858950400	Bacteria	6783797
1616	2860342454	2860339153	Bacteria	6846989
1617	2878032824	2878029506	Bacteria	6418441
1618	2881414496	2881412998	Bacteria	6492157
1619	2881649278	2881644220	Bacteria	5302661
1620	2885268233	2885266251	Bacteria	4796748
1621	2886849272	2886848708	Bacteria	5632523
1622	2887631361	2887630918	Bacteria	3239855
1623	2891635717	2891633521	Bacteria	4602265
1624	2900579827	2900577576	Bacteria	5438534
1625	2904118699	2904113452	Bacteria	7796941
1626	2904435520	2904434214	Bacteria	6230908
1627	2904756561	2904755435	Bacteria	7986759
1628	2919048784	2919046199	Bacteria	5567169
1629	2919064888	2919063839	Bacteria	6302690
1630	2919390373	2919385768	Bacteria	5897293
1631	2919425628	2919425241	Bacteria	8055701
1632	2919448741	2919446982	Bacteria	3994487
1633	2919460290	2919456309	Bacteria	6586567
1634	2919498989	2919497567	Bacteria	4408621
1635	2919689578	2919688452	Bacteria	4595932
1636	2919698133	2919697872	Bacteria	6553725
1637	2928059097	2928058823	Bacteria	5520022
1638	2928134629	2928130867	Bacteria	5467269
1639	2928511085	2928510474	Bacteria	4815308
1640	2931402539	2931396565	Bacteria	7251677
1641	2941483511
1642	2969307431	2969304461	Bacteria	6601805
1643	2974291113	2974289157	Bacteria	6080362
1644	2980183129	2980182181	Bacteria	9454109
1645	2981286521	2981284811	Bacteria	4641497
1646	2981291472	2981289755	Bacteria	4641509
1647	2981982164	2981980479	Bacteria	4641628
1648	2981987065	2981985349	Bacteria	4641497
1649	2995728835	2995726249	Bacteria	3470435
1650	2998142582	2998139840	Bacteria	6073514
1651	2998347779	2998344455	Bacteria	4222996
1652	3006972302	3006969106	Bacteria	4739423
1653	3007615103	3007614139	Bacteria	6053559
1654	3007856937	3007855910	Bacteria	5637581
1655	3007862077	3007861166	Bacteria	6045338
1656	639788551	639633007	Bacteria	4376040
1657	644750294	644736347	Bacteria	6476522
1658	8003405349	8003400568	Bacteria	5535898
1659	8019779980	8019775933	Bacteria	6858656
1660	8029998066	8029995093	Bacteria	5990776
1661	8054563882	8054563764	Bacteria	5592885
1662	8056158972	8056155041	Bacteria	6486948
1663	8056168481	8056166840	Bacteria	5820959
1664	8056178121	8056177738	Bacteria	6748268
1665	Ga0501036_0008748
1666	MRS2a_Contig_9185
1667	JGI24741J21665_1001349
1668	JGI24740J21852_10000009
1669	JGI24740J21852_10001375
1670	JGI24737J22298_10033454
1671	JGI24735J21928_10008433
1672	JGI25155J39150_1000030
1673	JGI25156J39149_1010181
1674	JGI25162J39368_1000032
1675	JGI25154J39366_1002196
1676	JGI25164J39214_1003610
1677	JGI25152J39213_1000481
1678	JGI25152J39213_1006808
1679	JGI25150J39212_1000175
1680	JGI25150J39212_1000274
1681	JGI25159J45721_1000129
1682	JGI25151J46595_10000518
1683	JGI25151J46595_10003077
1684	JGI25151J46595_10003578
1685	JGI25151J46595_10003645
1686	JGI25165J46597_1000067
1687	JGI25153J46596_10004548
1688	JGI25153J46596_10005250
1689	rootH1_10015201
1690	rootH2_10007203
1691	rootL2_10001457
1692	rootL2_10060031
1693	rootL2_10089786
1694	rootH1_10003030
1695	rootH1_10044493
1696	rootH1_10047909
1697	rootH1_10350405
1698	JGI25160J50197_1000286
1699	JGI25161J50226_1000217
1700	Ga0006562J51391_1096986
1701	Ga0055538_1000033
1702	Ga0055538_1000119
1703	Ga0055539_1000045
1704	Ga0055539_1000079
1705	Ga0055539_1000164
1706	Ga0055533_1000054
1707	Ga0055533_1000168
1708	Ga0055533_1006114
1709	Ga0055532_1000075
1710	Ga0055525_1000065
1711	Ga0055525_1000228
1712	Ga0055525_1000581
1713	Ga0055535_1000013
1714	Ga0055542_1003633
1715	Ga0055529_1000085
1716	Ga0055526_1000496
1717	Ga0055526_1001357
1718	Ga0055526_1002293
1719	Ga0055526_1019097
1720	Ga0055526_1025428
1721	Ga0055537_1000694
1722	Ga0055537_1000791
1723	Ga0055537_1002773
1724	Ga0055537_1004056
1725	Ga0055524_1000308
1726	Ga0055524_1001112
1727	Ga0055524_1001231
1728	Ga0055524_1002502
1729	Ga0055524_1007094
1730	Ga0055524_1007242
1731	Ga0055524_1007718
1732	Ga0055536_1000053
1733	Ga0055536_1000072
1734	Ga0055536_1000142
1735	Ga0055536_1000792
1736	Ga0055536_1000882
1737	Ga0055536_1002672
1738	Ga0055534_1000329
1739	Ga0055534_1000952
1740	Ga0055534_1007066
1741	Ga0055530_10000035
1742	Ga0055530_10000219
1743	Ga0055530_10036691
1744	Ga0055540_1000006
1745	Ga0055540_1000015
1746	Ga0055531_10000075
1747	Ga0055531_10002466
1748	Ga0055531_10003216
1749	Ga0055531_10005858
1750	Ga0055531_10010799
1751	Ga0055531_10011272
1752	Ga0055531_10013982
1753	Ga0055531_10024191
1754	Ga0055541_1000031
1755	Ga0055541_1000111
1756	Ga0055541_1004698
1757	Ga0055543_1000267
1758	Ga0055543_1020393
1759	Ga0065165_1000220
1760	Ga0065165_1000898
1761	Ga0065165_1001691
1762	Ga0065165_1002199
1763	Ga0065714_10002341
1764	Ga0065714_10010623
1765	Ga0065714_10066209
1766	Ga0065707_10093512
1767	Ga0070658_10009173
1768	Ga0070658_10035084
1769	Ga0070658_10107882
1770	Ga0070683_100011894
1771	Ga0070683_100017921
1772	Ga0070683_100103775
1773	Ga0070683_100133498
1774	Ga0070690_100002307
1775	Ga0070670_100038654
1776	Ga0068869_100000375
1777	Ga0068869_100087765
1778	Ga0068869_100229206
1779	Ga0070680_100007225
1780	Ga0070680_100014772
1781	Ga0070680_100336747
1782	Ga0070682_100040106
1783	Ga0068868_100002270
1784	Ga0068868_100034780
1785	Ga0070660_100002357
1786	Ga0070660_100008557
1787	Ga0070660_100010995
1788	Ga0070660_100020210
1789	Ga0070660_100058015
1790	Ga0070660_100097390
1791	Ga0070660_100169578
1792	Ga0070660_100184438
1793	Ga0070689_100000039
1794	Ga0070689_100000515
1795	Ga0070691_10002196
1796	Ga0070687_100000478
1797	Ga0070661_100000007
1798	Ga0070661_100003248
1799	Ga0070661_100023116
1800	Ga0070661_100146131
1801	Ga0070692_10005547
1802	Ga0070692_10005560
1803	Ga0070692_10052267
1804	Ga0070668_100073807
1805	Ga0070675_100042043
1806	Ga0070675_100216237
1807	Ga0070671_100000018
1808	Ga0070671_100138663
1809	Ga0070673_100066643
1810	Ga0070688_100000087
1811	Ga0070659_100000597
1812	Ga0070659_100001284
1813	Ga0070659_100002891
1814	Ga0070659_100028383
1815	Ga0070659_100049330
1816	Ga0070659_100098137
1817	Ga0070659_100138301
1818	Ga0070667_100000026
1819	Ga0070703_10021175
1820	Ga0070714_100001810
1821	Ga0070710_10024464
1822	Ga0070701_10000043
1823	Ga0070705_100000550
1824	Ga0070705_100056595
1825	Ga0070700_100000655
1826	Ga0070700_100003551
1827	Ga0070700_100121146
1828	Ga0070694_100000619
1829	Ga0070694_100071761
1830	Ga0070708_100187618
1831	Ga0070663_100000002
1832	Ga0070678_100120752
1833	Ga0070662_100092768
1834	Ga0070681_10021126
1835	Ga0070681_10022516
1836	Ga0070681_10213241
1837	Ga0070681_10298494
1838	Ga0068867_100000084
1839	Ga0068867_100005207
1840	Ga0070685_10000211
1841	Ga0070685_10001823
1842	Ga0070707_100000005
1843	Ga0070707_100001692
1844	Ga0070707_100055807
1845	Ga0070707_100116133
1846	Ga0070698_100193058
1847	Ga0070698_100259863
1848	Ga0070698_100285763
1849	Ga0070699_100001900
1850	Ga0070699_100005177
1851	Ga0070679_100024512
1852	Ga0070679_100025018
1853	Ga0070684_100034152
1854	Ga0070684_100130230
1855	Ga0070684_100169335
1856	Ga0070684_100295198
1857	Ga0070697_100069210
1858	Ga0070686_100000802
1859	Ga0070686_100001812
1860	Ga0070686_100004350
1861	Ga0070695_100006142
1862	Ga0070695_100019466
1863	Ga0070696_100000284
1864	Ga0070696_100069119
1865	Ga0070696_100216974
1866	Ga0070693_100000158
1867	Ga0070665_100004790
1868	Ga0070704_100002568
1869	Ga0070704_100004419
1870	Ga0070704_100015728
1871	Ga0070704_100139710
1872	Ga0068855_100000220
1873	Ga0068855_100000242
1874	Ga0068855_100042662
1875	Ga0068855_100073449
1876	Ga0068855_100114870
1877	Ga0068855_100209164
1878	Ga0070664_100000004
1879	Ga0070664_100059979
1880	Ga0070664_100238293
1881	Ga0070664_100267776
1882	Ga0068857_100026564
1883	Ga0068857_100032939
1884	Ga0068857_100309097
1885	Ga0068854_100000034
1886	Ga0068854_100002193
1887	Ga0068854_100203453
1888	Ga0068856_100004536
1889	Ga0068856_100041554
1890	Ga0068856_100071108
1891	Ga0068856_100430220
1892	Ga0070702_100000091
1893	Ga0070702_100003779
1894	Ga0068852_100129276
1895	Ga0068852_100498982
1896	Ga0068859_100000257
1897	Ga0068859_100003784
1898	Ga0068859_100006088
1899	Ga0068859_100082165
1900	Ga0068864_100000012
1901	Ga0068864_100106475
1902	Ga0068864_100328410
1903	Ga0068866_10001238
1904	Ga0068861_100002493
1905	Ga0068861_100379991
1906	Ga0068863_100074649
1907	Ga0068863_100203570
1908	Ga0068858_100000844
1909	Ga0068858_100005016
1910	Ga0068858_100015245
1911	Ga0068858_100164089
1912	Ga0068860_100000973
1913	Ga0068860_100002335
1914	Ga0068860_100059964
1915	Ga0068862_100000899
1916	Ga0068862_100042918
1917	Ga0081455_10190727
1918	Ga0081455_10202263
1919	Ga0081539_10001286
1920	Ga0081539_10061242
1921	Ga0075365_10010932
1922	Ga0075365_10029230
1923	Ga0075365_10038446
1924	Ga0075364_10016924
1925	Ga0075432_10000923
1926	Ga0075432_10031555
1927	Ga0070716_100033705
1928	Ga0075362_10000327
1929	Ga0075367_10099489
1930	Ga0075366_10005684
1931	Ga0075366_10168390
1932	Ga0097621_100003574
1933	Ga0097621_100064646
1934	Ga0097621_100081548
1935	Ga0097621_100281482
1936	Ga0075370_10000995
1937	Ga0075370_10069274
1938	Ga0075370_10074716
1939	Ga0068871_100001933
1940	Ga0068871_100003805
1941	Ga0068871_100025385
1942	Ga0068871_100184644
1943	Ga0075428_100234827
1944	Ga0075430_100181833
1945	Ga0075431_100118168
1946	Ga0075431_100248252
1947	Ga0075433_10000608
1948	Ga0075434_100002189
1949	Ga0075434_100026060
1950	Ga0075429_100000044
1951	Ga0075429_100130668
1952	Ga0068865_100000397
1953	Ga0068865_100030417
1954	Ga0068865_100209486
1955	Ga0075436_100000521
1956	Ga0075436_100008674
1957	Ga0075436_100065224
1958	Ga0075436_100226566
1959	Ga0097620_100000257
1960	Ga0097620_100003784
1961	Ga0097620_100006088
1962	Ga0097620_100082163
1963	Ga0099823_1000072
1964	Ga0079104_1000173
1965	Ga0079104_1003379
1966	Ga0079104_1009820
1967	Ga0079104_1024169
1968	Ga0099826_10000013
1969	Ga0099794_10024642
1970	Ga0105251_10093207
1971	Ga0105244_10000583
1972	Ga0105244_10005356
1973	Ga0105244_10117618
1974	Ga0105250_10001246
1975	Ga0105240_10006473
1976	Ga0105240_10027941
1977	Ga0105240_10199980
1978	Ga0111539_10008666
1979	Ga0111539_10012214
1980	Ga0111539_10017078
1981	Ga0111539_10393149
1982	Ga0105245_10000245
1983	Ga0105245_10080827
1984	Ga0105247_10019973
1985	Ga0105243_10000677
1986	Ga0105243_10003678
1987	Ga0105243_10009810
1988	Ga0105243_10091778
1989	Ga0105243_10170661
1990	Ga0105243_10209338
1991	Ga0105241_10034102
1992	Ga0105242_10012509
1993	Ga0105242_10112984
1994	Ga0105248_10000428
1995	Ga0105248_10094150
1996	Ga0105248_10168580
1997	Ga0105237_10010970
1998	Ga0105238_10153055
1999	Ga0105249_10005105
2000	Ga0105249_10059050
2001	Ga0105239_10003062
2002	Ga0105246_10016928
2003	Ga0105246_10132846
2004	Ga0105246_10254757
2005	Ga0157319_1000003
2006	Ga0157373_10005421
2007	Ga0157373_10009732
2008	Ga0157373_10097144
2009	Ga0157371_10000270
2010	Ga0157371_10000379
2011	Ga0157371_10001000
2012	Ga0157371_10004897
2013	Ga0157371_10077092
2014	Ga0157370_10000014
2015	Ga0157370_10000901
2016	Ga0157370_10001358
2017	Ga0157370_10013072
2018	Ga0157370_10032811
2019	Ga0157370_10036107
2020	Ga0157370_10175654
2021	Ga0157369_10000259
2022	Ga0157369_10160796
2023	Ga0157369_10360636
2024	Ga0157374_10000102
2025	Ga0157374_10026076
2026	Ga0157378_10000294
2027	Ga0157378_10048835
2028	Ga0157378_10137124
2029	Ga0157378_10493855
2030	Ga0163162_10015320
2031	Ga0163162_10058544
2032	Ga0163162_10077781
2033	Ga0163162_10211155
2034	Ga0157372_10000032
2035	Ga0157372_10001972
2036	Ga0157372_10003490
2037	Ga0157372_10006664
2038	Ga0157375_10021753
2039	Ga0157375_10070855
2040	Ga0157375_10134241
2041	Ga0163163_10000051
2042	Ga0163163_10007862
2043	Ga0163163_10046912
2044	Ga0163163_10148894
2045	Ga0157380_10290266
2046	Ga0157380_10316295
2047	Ga0182008_10000915
2048	Ga0182008_10004759
2049	Ga0182008_10033183
2050	Ga0182008_10038663
2051	Ga0182008_10058735
2052	Ga0182008_10086730
2053	Ga0157379_10036436
2054	Ga0157379_10058095
2055	Ga0157379_10061367
2056	Ga0157379_10081105
2057	Ga0157376_10000642
2058	Ga0157376_10001613
2059	Ga0157376_10099985
2060	Ga0182006_1000010
2061	Ga0182006_1000526
2062	Ga0182006_1001367
2063	Ga0182006_1004334
2064	Ga0182006_1004806
2065	Ga0182006_1007216
2066	Ga0182006_1020616
2067	Ga0182007_10000031
2068	Ga0182007_10003582
2069	Ga0182007_10020677
2070	Ga0182005_1000182
2071	Ga0182005_1000801
2072	Ga0182005_1001209
2073	Ga0182005_1007928
2074	Ga0183362_10005
2075	Ga0163161_10000220
2076	Ga0163161_10000267
2077	Ga0163161_10003388
2078	Ga0163161_10036862
2079	Ga0163161_10072162
2080	Ga0163161_10072194
2081	Ga0206351_10899730
2082	Ga0206353_10316548
2083	Ga0154015_1045624
2084	Ga0213872_10000035
2085	Ga0213872_10001791
2086	Ga0213872_10024519
2087	Ga0213875_10039885
2088	Ga0209436_100116
2089	Ga0209784_100018
2090	Ga0209784_100048
2091	Ga0209784_100259
2092	Ga0209784_100280
2093	Ga0209566_100006
2094	Ga0209566_100016
2095	Ga0209566_100060
2096	Ga0209566_100142
2097	Ga0209566_100733
2098	Ga0209566_101617
2099	Ga0209674_100030
2100	Ga0209674_100082
2101	Ga0209674_100083
2102	Ga0209674_100142
2103	Ga0209147_100005
2104	Ga0209147_103239
2105	Ga0209563_100016
2106	Ga0209563_100034
2107	Ga0209563_100082
2108	Ga0207427_100378
2109	Ga0209437_100125
2110	Ga0209258_100007
2111	Ga0209258_102357
2112	Ga0207425_1000050
2113	Ga0207425_1000300
2114	Ga0207425_1001155
2115	Ga0209646_1000016
2116	Ga0209026_1004873
2117	Ga0209677_100008
2118	Ga0209677_100019
2119	Ga0209677_100046
2120	Ga0209677_101784
2121	Ga0209148_1000051
2122	Ga0209759_1002464
2123	Ga0209759_1005347
2124	Ga0209759_1006283
2125	Ga0209129_1000588
2126	Ga0209129_1000808
2127	Ga0209233_1000138
2128	Ga0209565_1000086
2129	Ga0209565_1000239
2130	Ga0209565_1000296
2131	Ga0209565_1000348
2132	Ga0209565_1000367
2133	Ga0209565_1000421
2134	Ga0209565_1010251
2135	Ga0209455_1000011
2136	Ga0209455_1001222
2137	Ga0209673_1005541
2138	Ga0209673_1010879
2139	Ga0209673_1011135
2140	Ga0209130_1000518
2141	Ga0209130_1014052
2142	Ga0209675_1000076
2143	Ga0209675_1000171
2144	Ga0209675_1000268
2145	Ga0209675_1000418
2146	Ga0209675_1000743
2147	Ga0209675_1000960
2148	Ga0209675_1001504
2149	Ga0209675_1009515
2150	Ga0209676_1000002
2151	Ga0209676_1000020
2152	Ga0209676_1000053
2153	Ga0209676_1000070
2154	Ga0209676_1000161
2155	Ga0209676_1000454
2156	Ga0209676_1000809
2157	Ga0209676_1002192
2158	Ga0209676_1037090
2159	Ga0209025_1000003
2160	Ga0209025_1000059
2161	Ga0209025_1000550
2162	Ga0209025_1000890
2163	Ga0209025_1000992
2164	Ga0209025_1002799
2165	Ga0209025_1003787
2166	Ga0209025_1017994
2167	Ga0209025_1059794
2168	Ga0209564_1000003
2169	Ga0209564_1000248
2170	Ga0209564_1000451
2171	Ga0209564_1000454
2172	Ga0209564_1000908
2173	Ga0209564_1001027
2174	Ga0209564_1001580
2175	Ga0209564_1001651
2176	Ga0209564_1003283
2177	Ga0209758_1000122
2178	Ga0209758_1000860
2179	Ga0209758_1003855
2180	Ga0209758_1016286
2181	Ga0209758_1050705
2182	Ga0209050_1000006
2183	Ga0209050_1000042
2184	Ga0209050_1000143
2185	Ga0209050_1000170
2186	Ga0209050_1002102
2187	Ga0209050_1002805
2188	Ga0209050_1007591
2189	Ga0209050_1030361
2190	Ga0209256_1000086
2191	Ga0209256_1000150
2192	Ga0209256_1000344
2193	Ga0209256_1000638
2194	Ga0209256_1000757
2195	Ga0209256_1000922
2196	Ga0209256_1001282
2197	Ga0207426_1000506
2198	Ga0209051_1000001
2199	Ga0209051_1000020
2200	Ga0209051_1003037
2201	Ga0209051_1022737
2202	Ga0209051_1025136
2203	Ga0209051_1038369
2204	Ga0209257_1000029
2205	Ga0209257_1000260
2206	Ga0209257_1000285
2207	Ga0209257_1000318
2208	Ga0209257_1000399
2209	Ga0209257_1000622
2210	Ga0209257_1001782
2211	Ga0209257_1001860
2212	Ga0209257_1005823
2213	Ga0209257_1010098
2214	Ga0207655_1000125
2215	Ga0207655_1003721
2216	Ga0207655_1071627
2217	Ga0207713_1000518
2218	Ga0207713_1001773
2219	Ga0207713_1009373
2220	Ga0207653_10009970
2221	Ga0207642_10000931
2222	Ga0207710_10016816
2223	Ga0207688_10011233
2224	Ga0207688_10188053
2225	Ga0207680_10005607
2226	Ga0207647_10017820
2227	Ga0207647_10022117
2228	Ga0207647_10179984
2229	Ga0207705_10027347
2230	Ga0207705_10040886
2231	Ga0207705_10154884
2232	Ga0207654_10062188
2233	Ga0207707_10013398
2234	Ga0207707_10103511
2235	Ga0207695_10003419
2236	Ga0207695_10033679
2237	Ga0207671_10032160
2238	Ga0207660_10022365
2239	Ga0207662_10001141
2240	Ga0207662_10083695
2241	Ga0207657_10000560
2242	Ga0207657_10012715
2243	Ga0207657_10013915
2244	Ga0207657_10054066
2245	Ga0207657_10057187
2246	Ga0207657_10082950
2247	Ga0207657_10148660
2248	Ga0207657_10300739
2249	Ga0207649_10000131
2250	Ga0207649_10023078
2251	Ga0207652_10050542
2252	Ga0207652_10054963
2253	Ga0207652_10240030
2254	Ga0207646_10000022
2255	Ga0207694_10057424
2256	Ga0207694_10104151
2257	Ga0207650_10000002
2258	Ga0207659_10111452
2259	Ga0207687_10000506
2260	Ga0207664_10004053
2261	Ga0207664_10144346
2262	Ga0207644_10000026
2263	Ga0207644_10095868
2264	Ga0207690_10009142
2265	Ga0207690_10010402
2266	Ga0207690_10025855
2267	Ga0207690_10033188
2268	Ga0207690_10047597
2269	Ga0207690_10126818
2270	Ga0207706_10086732
2271	Ga0207706_10091762
2272	Ga0207686_10002377
2273	Ga0207686_10204917
2274	Ga0207709_10000395
2275	Ga0207709_10001717
2276	Ga0207670_10000035
2277	Ga0207670_10002127
2278	Ga0207704_10000218
2279	Ga0207704_10031309
2280	Ga0207704_10178792
2281	Ga0207691_10041037
2282	Ga0207711_10000279
2283	Ga0207711_10003450
2284	Ga0207711_10045344
2285	Ga0207711_10046582
2286	Ga0207711_10070318
2287	Ga0207689_10000293
2288	Ga0207661_10019890
2289	Ga0207661_10031292
2290	Ga0207679_10000002
2291	Ga0207679_10002836
2292	Ga0207667_10000044
2293	Ga0207667_10009572
2294	Ga0207667_10025947
2295	Ga0207667_10052136
2296	Ga0207667_10171632
2297	Ga0207651_10071797
2298	Ga0207712_10257784
2299	Ga0207668_10402605
2300	Ga0207640_10000121
2301	Ga0207640_10001384
2302	Ga0207658_10000001
2303	Ga0207677_10041525
2304	Ga0207703_10004550
2305	Ga0207703_10020304
2306	Ga0207703_10026544
2307	Ga0207703_10142242
2308	Ga0207703_10278027
2309	Ga0207639_10099171
2310	Ga0207678_10000003
2311	Ga0207678_10132874
2312	Ga0207708_10001685
2313	Ga0207708_10006837
2314	Ga0207702_10000282
2315	Ga0207702_10014595
2316	Ga0207702_10116006
2317	Ga0207702_10192200
2318	Ga0207641_10004150
2319	Ga0207641_10014833
2320	Ga0207641_10091515
2321	Ga0207641_10243962
2322	Ga0207641_10624941
2323	Ga0207648_10000185
2324	Ga0207648_10003664
2325	Ga0207648_10118560
2326	Ga0207676_10000001
2327	Ga0207676_10298002
2328	Ga0207674_10001225
2329	Ga0207674_10008819
2330	Ga0207674_10024443
2331	Ga0207674_10368538
2332	Ga0207675_100000150
2333	Ga0207683_10037070
2334	Ga0207683_10154655
2335	Ga0209281_1000292
2336	Ga0209281_1002052
2337	Ga0209281_1006101
2338	Ga0209281_1008623
2339	Ga0209281_1013738
2340	Ga0209371_1019408
2341	Ga0209179_1006859
2342	Ga0209282_1000104
2343	Ga0209588_1002255
2344	Ga0209971_1009011
2345	Ga0207428_10024969
2346	Ga0268266_10002310
2347	Ga0268266_10003308
2348	Ga0268266_10227594
2349	Ga0268265_10001178
2350	Ga0268265_10001756
2351	Ga0268264_10000061
2352	Ga0268264_10000580
2353	Ga0307517_10045409
2354	Ga0307515_10000109
2355	Ga0307515_10002570
2356	Ga0307515_10058618
2357	Ga0307515_10156171
2358	Ga0268256_1028313
2359	Ga0307512_10043819
2360	Ga0265332_10000006
2361	Ga0265332_10000286
2362	Ga0265325_10001603
2363	Ga0265331_10001750
2364	Ga0265331_10027842
2365	Ga0265327_10000002
2366	Ga0265327_10000112
2367	Ga0265327_10000135
2368	Ga0265327_10000283
2369	Ga0265327_10011154
2370	Ga0265316_10000005
2371	Ga0307513_10020924
2372	Ga0307513_10052125
2373	Ga0307513_10060128
2374	Ga0307509_10000009
2375	Ga0307408_100004765
2376	Ga0307408_100043117
2377	Ga0265313_10000827
2378	Ga0307514_10003041
2379	Ga0316579_10000672
2380	Ga0316579_10002365
2381	Ga0316576_10021768
2382	Ga0316576_10053582
2383	Ga0316576_10110243
2384	Ga0316578_10007257
2385	Ga0316578_10045680
2386	Ga0316578_10082532
2387	Ga0307516_10000092
2388	Ga0307516_10027572
2389	Ga0307516_10033971
2390	Ga0307405_10032478
2391	Ga0316577_10013353
2392	Ga0316577_10094367
2393	Ga0307413_10061791
2394	Ga0307410_10000820
2395	Ga0307406_10115055
2396	Ga0307406_10331301
2397	Ga0307407_10002471
2398	Ga0307412_10005786
2399	Ga0307412_10035732
2400	Ga0307412_10140411
2401	Ga0307412_10187018
2402	Ga0307412_10296288
2403	Ga0307409_100002729
2404	Ga0307409_100026937
2405	Ga0307409_100076579
2406	Ga0307409_100429329
2407	Ga0307416_100014234
2408	Ga0307416_100093847
2409	Ga0307414_10000209
2410	Ga0307414_10148228
2411	Ga0307411_10000152
2412	Ga0307415_100044860
2413	Ga0316583_10003647
2414	Ga0316583_10020451
2415	Ga0316583_10051767
2416	Ga0316583_10056894
2417	Ga0316585_10005954
2418	Ga0316585_10008322
2419	Ga0316585_10064889
2420	Ga0316580_10005455
2421	Ga0316580_10011312
2422	Ga0316593_10045703
2423	Ga0316592_1005196
2424	Ga0316588_1003391
2425	Ga0316596_1001689
2426	Ga0316596_1002580
2427	Ga0316596_1024272
2428	Ga0373950_0006780
2429	Ga0373926_0003726
2430	Ga0373926_0022418
2431	Ga0373934_0003309
2432	Ga0373934_0069390
2433	Ga0373944_0011370
2434	Ga0373944_0035390
2435	Ga0373923_0000746
2436	Ga0373923_0045907
2437	Ga0373932_0059872
2438	Ga0373936_0000944
2439	Ga0373936_0002959
2440	Ga0373945_0017893
2441	Ga0373953_0002650
2442	Ga0373953_0014727
2443	Ga0373954_0000460
2444	Ga0373954_0002190
2445	Ga0373954_0002349
2446	Ga0373956_0005665
2447	Ga0373956_0005694
2448	Ga0373957_0001628
2449	Ga0373957_0009304
2450	Ga0373946_0063295
2451	Ga0373955_0004736
2452	Ga0373955_0006690
2453	Ga0373955_0078382
2454	Ga0373942_0007330
2455	Ga0373942_0008470
2456	Ga0316574_0000684
2457	Ga0316574_0002855
2458	Ga0316574_0005125
2459	Ga0316574_0065379
2460	Ga0316574_0101268
2461	Ga0316574_0230001
2462	Ga0373924_0001313
2463	Ga0373924_0007038
2464	Ga0373924_0013557
2465	Ga0373924_0049214
2466	Ga0373924_0054479
2467	Ga0373931_0007119
2468	Ga0373935_0047311
2469	Ga0373927_0031287
2470	Ga0373927_0054218
2471	Ga0373933_0002728
2472	Ga0373933_0003128
2473	Ga0373933_0020715
2474	Ga0373933_0136342
2475	Ga0373937_0006427
2476	Ga0373937_0034259
2477	Ga0373937_0044183
2478	Ga0373937_0056039
2479	Ga0373937_0059221
2480	Ga0316582_0003428
2481	Ga0316582_0010032
2482	Ga0316582_0057790
2483	Ga0316584_0002366
2484	Ga0316584_0010705
2485	Ga0316584_0029937
2486	Ga0316584_0107980
2487	Ga0373925_0062944
2488	Ga0395899_0001968
2489	Ga0395899_0003139
2490	Ga0395899_0004622
2491	Ga0395899_0067333
2492	Ga0395900_0001121
2493	Ga0395900_0011305
2494	Ga0395900_0038804
2495	Ga0395900_0056967
2496	Ga0395900_0060354
2497	Ga0395900_0277675
2498	Ga0395898_0031221
2499	Ga0395898_0052937
2500	Ga0395898_0219030
2501	Ga0395905_0002363
2502	Ga0395905_0006067
2503	Ga0395905_0018367
2504	Ga0395905_0019311
2505	Ga0395905_0037579
2506	Ga0395905_0051936
2507	Ga0395905_0079937
2508	Ga0395905_0163344
2509	Ga0395905_0282722
2510	Ga0395905_0446185
2511	Ga0436364_0685277
2512	Ga0395901_0010884
2513	Ga0395901_0023730
2514	Ga0395901_0072023
2515	Ga0395901_0088181
2516	Ga0395901_0138724
2517	Ga0395901_0184923
2518	Ga0395901_0211109
2519	Ga0395901_0258346
2520	Ga0395901_0269719
2521	Ga0400490_55232
2522	Ga0400488_07026
2523	Ga0400483_016983
2524	Ga0400487_46529
2525	Ga0436361_0713752
2526	Ga0436361_0760581
2527	Ga0436361_0923738
2528	Ga0436361_1065758
2529	Ga0436361_1195827
2530	Ga0436361_1201305
2531	Ga0439436_0022205
2532	Ga0439438_000048
2533	Ga0439438_000210
2534	Ga0439438_000804
2535	Ga0439438_043701
2536	Ga0439447_000014
2537	Ga0439447_005040
2538	Ga0439466_0004146
2539	Ga0439466_0007672
2540	Ga0439466_0026629
2541	Ga0439465_0008806
2542	Ga0451789_0664144
2543	Ga0451795_1136473
2544	Ga0451804_0937624
2545	Ga0451855_0381342
2546	Ga0451855_0502112
2547	Ga0439448_0001377
2548	Ga0439432_002991
2549	Ga0439452_000043
2550	Ga0439452_000137
2551	Ga0439452_001318
2552	Ga0439456_000485
2553	Ga0439456_001239
2554	Ga0450911_000009
2555	Ga0450911_000056
2556	Ga0450911_000877
2557	Ga0450919_001181
2558	Ga0450890_000657
2559	Ga0450890_002504
2560	Ga0450900_002343
2561	Ga0450903_004906
2562	Ga0450906_000005
2563	Ga0450906_001283
2564	Ga0450907_000411
2565	Ga0450907_000785
2566	Ga0450910_001385
2567	Ga0450908_000330
2568	Ga0450908_002970
2569	Ga0450909_000738
2570	Ga0439460_0002495
2571	Ga0451577_0004564
2572	Ga0451577_0011981
2573	Ga0451577_0036460
2574	Ga0451577_0059564
2575	Ga0451577_0072597
2576	Ga0451577_0386029
2577	Ga0439440_0000098
2578	Ga0466972_0001821
2579	Ga0466972_0010034
2580	Ga0466972_0087775
2581	Ga0453683_0003765
2582	Ga0453683_0005613
2583	Ga0453683_0019623
2584	Ga0453683_0081177
2585	Ga0466965_0000030
2586	Ga0466961_0000035
2587	Ga0466961_0023786
2588	Ga0466963_0062855
2589	Ga0466963_0077200
2590	Ga0466963_0183722
2591	Ga0466964_0149151
2592	Ga0453684_0000508
2593	Ga0453684_0094889
2594	Ga0453684_0127701
2595	Ga0453684_0136145
2596	Ga0453684_0165303
2597	Ga0453684_0501639
2598	Ga0453684_0508102
2599	Ga0466970_0058561
2600	Ga0466959_0023064
2601	Ga0451576_0000174
2602	Ga0451576_0000564
2603	Ga0451576_0001107
2604	Ga0451576_0002742
2605	Ga0451576_0006044
2606	Ga0451576_0019963
2607	Ga0451576_0039996
2608	Ga0451576_0069612
2609	Ga0451576_0148438
2610	Ga0451576_0230025
2611	Ga0466967_0000106
2612	Ga0466967_0047260
2613	Ga0466967_0338459
2614	Ga0495617_000325
2615	Ga0495617_010045
2616	Ga0495617_014754
2617	Ga0495592_0027753
2618	Ga0495592_0108332
2619	Ga0495592_0155690
2620	Ga0495592_0173224
2621	Ga0495603_0033279
2622	Ga0495603_0088988
2623	Ga0495603_0108658
2624	Ga0495603_0126065
2625	Ga0495590_0000259
2626	Ga0495590_0018152
2627	Ga0495590_0085508
2628	Ga0495591_000139
2629	Ga0495591_002976
2630	Ga0495629_0076797
2631	Ga0495638_0000117
2632	Ga0495638_0001627
2633	Ga0495638_0027175
2634	Ga0495638_0053999
2635	Ga0495641_0042616
2636	Ga0495651_0042963
2637	Ga0495651_0057562
2638	Ga0495651_0072562
2639	Ga0495653_0002466
2640	Ga0495653_0004204
2641	Ga0495653_0040257
2642	Ga0495653_0174436
2643	Ga0495650_0001284
2644	Ga0495650_0003472
2645	Ga0495650_0005742
2646	Ga0495580_0002887
2647	Ga0495580_0168240
2648	Ga0495582_0014675
2649	Ga0495582_0042697
2650	Ga0495605_0000294
2651	Ga0495605_0000886
2652	Ga0495605_0006814
2653	Ga0495605_0008053
2654	Ga0495605_0012236
2655	Ga0495605_0132121
2656	Ga0495639_0000033
2657	Ga0495639_0002535
2658	Ga0495639_0013216
2659	Ga0495639_0034155
2660	Ga0495664_0004827
2661	Ga0495664_0062169
2662	Ga0495584_0000012
2663	Ga0495584_0007276
2664	Ga0495584_0047147
2665	Ga0495585_0000715
2666	Ga0495585_0002814
2667	Ga0495585_0004460
2668	Ga0495585_0026369
2669	Ga0495585_0033467
2670	Ga0495594_0000528
2671	Ga0495594_0003739
2672	Ga0495594_0004458
2673	Ga0495596_0000688
2674	Ga0495607_0000344
2675	Ga0495607_0001542
2676	Ga0495607_0024629
2677	Ga0495607_0026797
2678	Ga0495607_0032141
2679	Ga0495607_0051284
2680	Ga0495607_0114548
2681	Ga0495583_0014221
2682	Ga0495583_0015460
2683	Ga0495606_0000077
2684	Ga0495606_0002297
2685	Ga0495606_0002337
2686	Ga0495606_0002486
2687	Ga0495606_0010465
2688	Ga0495606_0064091
2689	Ga0495608_0040537
2690	Ga0495608_0187141
2691	Ga0495610_0001830
2692	Ga0495610_0008477
2693	Ga0495610_0009848
2694	Ga0495616_0002277
2695	Ga0495616_0002760
2696	Ga0495616_0011570
2697	Ga0495616_0017376
2698	Ga0495618_0006408
2699	Ga0495618_0085830
2700	Ga0495620_0002267
2701	Ga0495628_0032773
2702	Ga0495630_0002002
2703	Ga0495630_0015933
2704	Ga0495630_0141042
2705	Ga0495631_0000002
2706	Ga0495631_0009955
2707	Ga0495631_0023343
2708	Ga0495632_0000698
2709	Ga0495632_0002226
2710	Ga0495632_0004210
2711	Ga0495632_0007317
2712	Ga0495632_0010237
2713	Ga0495632_0014124
2714	Ga0495637_0001843
2715	Ga0495637_0002243
2716	Ga0495637_0002962
2717	Ga0495637_0003867
2718	Ga0495637_0005166
2719	Ga0495643_0001583
2720	Ga0495643_0032486
2721	Ga0495643_0072048
2722	Ga0495643_0077467
2723	Ga0495643_0128095
2724	Ga0495648_0005945
2725	Ga0495648_0008088
2726	Ga0495648_0026126
2727	Ga0495648_0049733
2728	Ga0495666_0006632
2729	Ga0495666_0017456
2730	Ga0495666_0023892
2731	Ga0495666_0028142
2732	Ga0495642_0000247
2733	Ga0495642_0018609
2734	Ga0495652_0007448
2735	Ga0495652_0044352
2736	Ga0495652_0105470
2737	Ga0495654_0001046
2738	Ga0495654_0001387
2739	Ga0495654_0003664
2740	Ga0495654_0009956
2741	Ga0495654_0090888
2742	Ga0495665_0050790
2743	Ga0495640_0007240
2744	Ga0495586_0002207
2745	Ga0495586_0016337
2746	Ga0495586_0031894
2747	Ga0495586_0037499
2748	Ga0495586_0108344
2749	Ga0495586_0110670
2750	Ga0495587_0005832
2751	Ga0495598_0010168
2752	Ga0495609_0002525
2753	Ga0495609_0003623
2754	Ga0495609_0013498
2755	Ga0495597_0000326
2756	Ga0495597_0008526
2757	Ga0495597_0034305
2758	Ga0495597_0064672
2759	Ga0495645_0087451
2760	Ga0495622_0000738
2761	Ga0495622_0015515
2762	Ga0495622_0025994
2763	Ga0495622_0129926
2764	Ga0495633_0000682
2765	Ga0495633_0000940
2766	Ga0495633_0004864
2767	Ga0495667_0036934
2768	Ga0495667_0041909
2769	Ga0495667_0090899
2770	Ga0495667_0091182
2771	Ga0495668_0000001
2772	Ga0495634_0000666
2773	Ga0495634_0127033
2774	Ga0495611_0002377
2775	Ga0495625_0000237
2776	Ga0495625_0000947
2777	Ga0495625_0001545
2778	Ga0495625_0008120
2779	Ga0495625_0015716
2780	Ga0495625_0120026
2781	Ga0495635_0000684
2782	Ga0495635_0013704
2783	Ga0495635_0035765
2784	Ga0495635_0119981
2785	Ga0495635_0188397
2786	Ga0495659_0000088
2787	Ga0495661_0000350
2788	Ga0495661_0000963
2789	Ga0495661_0012934
2790	Ga0495661_0106266
2791	Ga0495657_0003489
2792	Ga0495657_0017800
2793	Ga0495657_0182546
2794	Ga0495657_0232832
2795	Ga0495599_0001215
2796	Ga0495599_0037862
2797	Ga0495623_0000826
2798	Ga0495647_0005442
2799	Ga0495647_0008798
2800	Ga0495658_0021176
2801	Ga0495658_0034803
2802	Ga0495658_0037284
2803	Ga0495658_0042853
2804	Ga0495613_0019556
2805	Ga0495613_0023758
2806	Ga0495613_0056062
2807	Ga0495613_0069097
2808	Ga0495624_0066244
2809	Ga0495624_0076535
2810	Ga0495670_0000057
2811	Ga0495670_0000159
2812	Ga0495670_0013830
2813	Ga0495670_0022924
2814	Ga0495670_0026821
2815	Ga0495670_0051107
2816	Ga0495671_0000044
2817	Ga0495671_0000164
2818	Ga0495671_0000376
2819	Ga0495671_0001104
2820	Ga0495671_0009383
2821	Ga0495671_0035346
2822	Ga0495649_0000153
2823	Ga0495649_0001103
2824	Ga0495649_0001217
2825	Ga0495649_0002469
2826	Ga0495649_0007712
2827	Ga0495649_0016508
2828	Ga0495649_0021797
2829	Ga0495649_0032794
2830	Ga0495649_0047156
2831	Ga0495649_0103115
2832	Ga0495589_0000057
2833	Ga0495589_0000764
2834	Ga0495589_0004333
2835	Ga0495589_0026032
2836	Ga0495600_0000287
2837	Ga0495600_0006382
2838	Ga0495600_0190300
2839	Ga0495660_0000351
2840	Ga0495660_0008290
2841	Ga0495660_0014611
2842	Ga0495660_0016020
2843	Ga0495660_0020099
2844	Ga0495660_0023165
2845	Ga0495660_0026094
2846	Ga0495660_0041469
2847	Ga0495660_0094201
2848	Ga0495581_0000537
2849	Ga0495604_0008675
2850	Ga0495604_0018160
2851	Ga0495604_0030452
2852	Ga0495604_0034492
2853	Ga0495604_0035672
2854	Ga0495636_0004950
2855	Ga0495636_0050639
2856	Ga0495674_0002736
2857	Ga0495674_0023787
2858	Ga0495672_0001002
2859	Ga0495672_0001180
2860	Ga0495672_0012599
2861	Ga0495672_0027914
2862	Ga0495680_0005668
2863	Ga0495680_0014295
2864	Ga0495680_0021677
2865	Ga0495680_0031806
2866	Ga0495680_0037120
2867	Ga0495680_0266166
2868	Ga0495683_0000037
2869	Ga0495683_0000049
2870	Ga0495687_000432
2871	Ga0495687_000469
2872	Ga0495687_026353
2873	Ga0495675_0002793
2874	Ga0495675_0019702
2875	Ga0495675_0030091
2876	Ga0495679_001305
2877	Ga0495679_001528
2878	Ga0495685_000726
2879	Ga0495685_010072
2880	Ga0495673_0000093
2881	Ga0495673_0007225
2882	Ga0495673_0007438
2883	Ga0495673_0009280
2884	Ga0495673_0015570
2885	Ga0495673_0015864
2886	Ga0495673_0016560
2887	Ga0495673_0121563
2888	Ga0495681_0001735
2889	Ga0495681_0036583
2890	Ga0495684_0018670
2891	Ga0495684_0024299
2892	Ga0495684_0257313
2893	Ga0495686_0004189
2894	Ga0495593_0001113
2895	Ga0495614_0004011
2896	Ga0495626_0000072
2897	Ga0495626_0000375
2898	Ga0495626_0000626
2899	Ga0495626_0001638
2900	Ga0495626_0002535
2901	Ga0495626_0003095
2902	Ga0496102_0000073
2903	Ga0496102_0014630
2904	Ga0496102_0018581
2905	Ga0496102_0101279
2906	Ga0496102_0348315
2907	Ga0496103_0001000
2908	Ga0496103_0073955
2909	Ga0496103_0151751
2910	Ga0496104_0058669
2911	Ga0496104_0065159
2912	Ga0496104_0085495
2913	Ga0496104_0149810
2914	Ga0496104_0237953
2915	Ga0496105_0218307
2916	Ga0496108_0005607
2917	Ga0496109_0032898
2918	Ga0496109_0312423
2919	Ga0496111_0003492
2920	Ga0496112_0027227
2921	Ga0496112_0065145
2922	Ga0496113_0174067
2923	Ga0496114_0003651
2924	Ga0496114_0013607
2925	Ga0496116_0000258
2926	Ga0496116_0002973
2927	Ga0496116_0004731
2928	Ga0496116_0017601
2929	Ga0496116_0134928
2930	Ga0496117_0004145
2931	Ga0496117_0038442
2932	Ga0496117_0044968
2933	Ga0496117_0079418
2934	Ga0496117_0114067
2935	Ga0496117_0168411
2936	Ga0496118_0016625
2937	Ga0496118_0017796
2938	Ga0496118_0034126
2939	Ga0496118_0066369
2940	Ga0496119_0005305
2941	Ga0496119_0157266
2942	Ga0496120_0007411
2943	Ga0496121_0000324
2944	Ga0496121_0002826
2945	Ga0496121_0009869
2946	Ga0496121_0040668
2947	Ga0496121_0062446
2948	Ga0496121_0089757
2949	Ga0496121_0210528
2950	Ga0496122_0000029
2951	Ga0496122_0000256
2952	Ga0496122_0003738
2953	Ga0496122_0004595
2954	Ga0496122_0022555
2955	Ga0496122_0060180
2956	Ga0496122_0117136
2957	Ga0496122_0192204
2958	Ga0496123_0000196
2959	Ga0496123_0000427
2960	Ga0496123_0003595
2961	Ga0496123_0012356
2962	Ga0496124_0012711
2963	Ga0496124_0016981
2964	Ga0496124_0026958
2965	Ga0496124_0035814
2966	Ga0496124_0110605
2967	Ga0496124_0151094
2968	Ga0496125_0001115
2969	Ga0496125_0005320
2970	Ga0496125_0007203
2971	Ga0496125_0014898
2972	Ga0496125_0026914
2973	Ga0496125_0028702
2974	Ga0496125_0040292
2975	Ga0496126_0017756
2976	Ga0496126_0026184
2977	Ga0496126_0177375
2978	Ga0501310_001466
2979	Ga0501341_01061
2980	Ga0501343_000031
2981	Ga0501344_00091
2982	Ga0501305_009751
2983	Ga0495678_000576
2984	Ga0495678_000585
2985	Ga0495678_001691
2986	Ga0495678_007723
2987	Ga0495678_007894
2988	Ga0495678_016690
2989	Ga0495678_029464
2990	Ga0495682_0017369
2991	Ga0495682_0026554
2992	Ga0501331_01109
2993	Ga0501333_000289
2994	Ga0501334_01299
2995	Ga0501335_000778
2996	Ga0501337_001194
2997	Ga0501338_00294
2998	Ga0501031_0001674
2999	Ga0501031_0003143
3000	Ga0501031_0018727
3001	Ga0501031_0047910
3002	Ga0501032_0000170
3003	Ga0501032_0001766
3004	Ga0501032_0021899
3005	Ga0501032_0048941
3006	Ga0501032_0189529
3007	Ga0501033_0016591
3008	Ga0501033_0020683
3009	Ga0501033_0037313
3010	Ga0501034_0000194
3011	Ga0501034_0005535
3012	Ga0501034_0006491
3013	Ga0501034_0008323
3014	Ga0501034_0009347
3015	Ga0501034_0014696
3016	Ga0501034_0047384
3017	Ga0501034_0057424
3018	Ga0501034_0195052
3019	Ga0501034_0443876
3020	Ga0501036_0004191
3021	Ga0501036_0007652
3022	Ga0501036_0133299
3023	Ga0501036_0155119
3024	Ga0501037_0000011
3025	Ga0501037_0000691
3026	Ga0501037_0034975
3027	Ga0501037_0042206
3028	Ga0501037_0073922
3029	Ga0501037_0077221
3030	Ga0501038_0006590
3031	Ga0501038_0018536
3032	Ga0501038_0029587
3033	Ga0501038_0038089
3034	Ga0501038_0042732
3035	Ga0501039_0004913
3036	Ga0501039_0021441
3037	Ga0501039_0037588
3038	Ga0501039_0083093
3039	Ga0501039_0135210
3040	Ga0501040_0002856
3041	Ga0501040_0026666
3042	Ga0501040_0099762
3043	Ga0501041_0002598
3044	Ga0501041_0005996
3045	Ga0501041_0255537
3046	Ga0501042_0002804
3047	Ga0501042_0012652
3048	Ga0501042_0059879
3049	Ga0501043_0001748
3050	Ga0501043_0006371
3051	Ga0501043_0007300
3052	Ga0501043_0136455
3053	Ga0501043_0190697
3054	Ga0501043_0213638
3055	Ga0501043_0249676
3056	Ga0501046_0000547
3057	Ga0501046_0020797
3058	Ga0501046_0023182
3059	Ga0501046_0098497
3060	Ga0501047_0033410
3061	Ga0501047_0256980
3062	Ga0501048_0002762
3063	Ga0501048_0003478
3064	Ga0501048_0011705
3065	Ga0501048_0161430
3066	Ga0501067_0009802
3067	Ga0501067_0021414
3068	Ga0501067_0038196
3069	Ga0501068_0001156
3070	Ga0501068_0007418
3071	Ga0501069_0010332
3072	Ga0501069_0069080
3073	Ga0501069_0125556
3074	Ga0501070_0021559
3075	Ga0501070_0024910
3076	Ga0501070_0029671
3077	Ga0501070_0080547
3078	Ga0501070_0096557
3079	Ga0501071_0002182
3080	Ga0501071_0007596
3081	Ga0501071_0363382
3082	Ga0501072_0048487
3083	Ga0501072_0243810
3084	Ga0501073_0005377
3085	Ga0501074_0001274
3086	Ga0501074_0008034
3087	Ga0501074_0014418
3088	Ga0501074_0032960
3089	Ga0501074_0048582
3090	Ga0501075_0007608
3091	Ga0501076_0022230
3092	Ga0501077_0012236
3093	Ga0501077_0036645
3094	Ga0501077_0092310
3095	Ga0501077_0235677
3096	Ga0501209_000183
3097	Ga0501217_013421
3098	Ga0501079_0013743
3099	Ga0501079_0016472
3100	Ga0501079_0038197
3101	Ga0501080_0013525
3102	Ga0501080_0035908
3103	Ga0501080_0116248
3104	Ga0501080_0124261
3105	Ga0501081_0007295
3106	Ga0501081_0037686
3107	Ga0501083_0000498
3108	Ga0501083_0029772
3109	Ga0501241_000248
3110	Ga0501269_002601
3111	Ga0501276_000283
3112	Ga0501279_001541
3113	Ga0501035_0001627
3114	Ga0501035_0014784
3115	Ga0501035_0104404
3116	Ga0501035_0114669
3117	Ga0501035_0137929
3118	Ga0501044_0000699
3119	Ga0501044_0007107
3120	Ga0501044_0027519
3121	Ga0501044_0070631
3122	Ga0501044_0106395
3123	Ga0501044_0433077
3124	Ga0501045_0000835
3125	Ga0501045_0078257
3126	nmdc:mga03683_1321_c1
3127	nmdc:mga03683_157_c2
3128	nmdc:mga00v17_7604_c1
3129	nmdc:mga0yw44_12460_c1
3130	nmdc:mga0k408_161770_c1
3131	nmdc:mga0k408_7238_c1
3132	nmdc:mga0k408_97374_c1
3133	nmdc:mga06z11_225675_c1
3134	nmdc:mga07m45_60072_c1
3135	nmdc:mga07m45_80562_c1
3136	nmdc:mga09592_17883_c1
3137	nmdc:mga0qj67_180986_c1
3138	nmdc:mga06r32_154992_c1
3139	nmdc:mga06r32_170752_c1
3140	nmdc:mga06r32_382378_c1
3141	nmdc:mga08y16_312972_c1
3142	nmdc:mga08y16_583_c1
3143	nmdc:mga0n895_3901_c1
3144	nmdc:mga0n895_54075_c1
3145	nmdc:mga0rr50_324702_c1
3146	nmdc:mga0rr50_6676_c1
3147	nmdc:mga08x19_2313_c1
3148	nmdc:mga08x19_88428_c1
3149	nmdc:mga0a205_137_c1
3150	nmdc:mga0a205_25100_c1
3151	Ga0495601_0001769
3152	Ga0495601_0135349
3153	Ga0495601_0139775
3154	Ga0495595_0002433
3155	Ga0495619_0029057
3156	Ga0495619_0059104
3157	Ga0500578_0001174
3158	Ga0500643_000131
3159	Ga0500643_003461
3160	Ga0500644_0040692
3161	Ga0500646_0012195
3162	Ga0500583_0015316
3163	Ga0500651_0000021
3164	Ga0500562_021115
3165	Ga0500594_0000008
3166	Ga0500618_000099
3167	Ga0500628_001156
3168	Ga0500642_0001865
3169	Ga0500652_000714
3170	Ga0500655_001148
3171	Ga0500568_0004680
3172	Ga0500568_0017628
3173	Ga0500574_000178
3174	Ga0500619_001329
3175	Ga0500622_0000327
3176	Ga0500622_0003958
3177	Ga0500627_0000413
3178	Ga0500611_000524
3179	Ga0501084_0003848
3180	Ga0501084_0004110
3181	Ga0501084_0010998
3182	Ga0501084_0015867
3183	Ga0590071_017007
3184	Ga0587066_003179
3185	Ga0587077_011483
3186	Ga0587086_006842
3187	Ga0587094_005529
3188	Ga0587101_003661
3189	Ga0587109_022916
3190	Ga0587067_009163
3191	Ga0587068_008782
3192	Ga0587072_007204
3193	Ga0587072_022910
3194	Ga0587076_002897
3195	Ga0587076_003287
3196	Ga0587079_024483
3197	Ga0587102_002617
3198	Ga0587111_0000372
3199	Ga0501082_0019317
3200	Ga0501082_0057939
3201	Ga0501082_0067353
3202	Ga0466962_0008216
3203	Ga0466962_0017622
3204	Ga0530510_0000263
3205	Ga0530510_0053201
3206	2511258197
3207	2511288074
3208	2511328737
3209	2511364852
3210	2511383570
3211	2513953421
3212	2514044638
3213	2548847101
3214	2553005137
3215	2566036534
3216	2574429643
3217	2585847933
3218	2587726566
3219	2587733375
3220	2587757110
3221	2588290980
3222	2595090350
3223	2597030974
3224	2599445946
3225	2599905809
3226	2601798987
3227	2606077882
3228	2606129943
3229	2624480892
3230	2624491957
3231	2643832105
3232	2643843357
3233	2643851808
3234	2643860705
3235	2643972088
3236	2643981449
3237	2644031009
3238	2644054100
3239	2644119550
3240	2644137603
3241	2644142287
3242	2644245786
3243	2644260657
3244	2644275981
3245	2644337805
3246	2644610108
3247	2649120404
3248	2652972967
3249	2715751431
3250	2715756945
3251	2718634033
3252	2739056448
3253	2739201540
3254	2739287689
3255	2739293002
3256	2765571508
3257	2808872393
3258	2808982330
3259	2809035356
3260	2809129869
3261	2809149076
3262	2819544900
3263	2819671209
3264	2831865889
3265	2834643097
3266	2839098799
3267	2842808683
3268	2842834468
3269	2842846701
3270	2842888199
3271	2852619216
3272	2852655548
3273	2852681027
3274	2855731124
3275	2855770275
3276	2857541073
3277	2857548404
3278	2857610181
3279	2858953472
3280	2860342454
3281	2878032824
3282	2881414496
3283	2881649278
3284	2885268233
3285	2886849272
3286	2887631361
3287	2891635717
3288	2900579827
3289	2904118699
3290	2904435520
3291	2904756561
3292	2919048784
3293	2919064888
3294	2919390373
3295	2919425628
3296	2919448741
3297	2919460290
3298	2919498989
3299	2919689578
3300	2919698133
3301	2928059097
3302	2928134629
3303	2928511085
3304	2931402539
3305	2941483511
3306	2969307431
3307	2974291113
3308	2980183129
3309	2981286521
3310	2981291472
3311	2981982164
3312	2981987065
3313	2995728835
3314	2998142582
3315	2998347779
3316	3006972302
3317	3007615103
3318	3007856937
3319	3007862077
3320	639788551
3321	644750294
3322	8003405349
3323	8019779980
3324	8029998066
3325	8054563882
3326	8056158972
3327	8056168481
3328	8056178121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

29

291

0.96 PF00106

adh_short

short chain dehydrogenase

27

155

0.9 PF04321

RmlD_sub_bind

RmlD substrate binding domain

27

205

0.9 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

30

354

0.87 PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

30

213

0.86 PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

29

214

0.86 PF08659

KR

KR domain

27

163

0.82 PF07993

NAD_binding_4

Male sterility protein

31

226

0.76 PF13460

NAD_binding_10

NAD(P)H-binding

33

199

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1a9y-assembly1.cif.gz_A-2	udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose	0.9868	5	340
1kvs-assembly1.cif.gz_A	udp-galactose 4-epimerase complexed with udp-phenol	0.9868	5	340
1a9z-assembly1.cif.gz_A-2	udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-galactose	0.9867	4	340
1kvu-assembly1.cif.gz_A-2	udp-galactose 4-epimerase complexed with udp-phenol	0.9867	4	340
1kvq-assembly1.cif.gz_A-2	udp-galactose 4-epimerase complexed with udp-phenol	0.9867	5	340

ID	Description	Score	Start	End	Superfamily
af_A0A1D6I245_15_71_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9639	8	59	3.40.50.720
4lisA02	Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1	0.9633	184	342	3.90.25.10
af_P18645_3_269_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9586	3	264	3.40.50.720
af_A0A1D6K005_288_418_3.90.25.10	Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1	0.957	208	337	3.90.25.10
3enkB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9564	4	264	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A5C4PXQ7-F1-model_v4	UDP-glucose 4-epimerase (EC 5.1.3.2)	0.9918	4	340	GO:0003978 GO:0005829 GO:0006012
AF-A0A704VGE9-F1-model_v4	UDP-glucose 4-epimerase (EC 5.1.3.2)	0.9913	4	338	GO:0003978 GO:0005829 GO:0006012
AF-R9LNV4-F1-model_v4	UDP-glucose 4-epimerase (EC 5.1.3.2)	0.989	4	335	GO:0003978 GO:0005829 GO:0006012
AF-A0A5E4A169-F1-model_v4	UDP-N-acetylglucosamine 4-epimerase (EC 4.1.3.4) (EC 5.1.3.2) (EC 5.1.3.7)	0.9887	1	342	GO:0003974 GO:0003978 GO:0004419 GO:0005829 GO:0033499
AF-T0P1N5-F1-model_v4	deleted	0.9886	96	340

Map