F495276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1669 | 686 | 3338 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10006154|Ga0182007_100061548 |
| Length | 142 |
| Sequence | MSSSNVSMNIFDVAGSAMSAQSQRMNVTASNLANADSVSGPDGQPYRAKQVVFAVAAGDQQDGAAAVGGVQVTGVVEDQSPLRMVYNPKHPLADASGYVTMPNVNVVEEMVNMISASRSYQANVEVLNTAKTMMLKTLTIGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 46 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 50 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 132 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 133 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 134 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 135 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 233 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 234 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 235 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 236 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 237 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 238 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 239 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 240 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 241 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 248 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 249 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 250 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 253 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 254 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 278 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 279 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 280 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 281 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 282 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 289 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 290 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 291 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 292 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 293 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 294 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 295 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 296 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 297 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 298 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 299 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 300 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 301 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 302 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 303 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 304 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 305 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 306 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 307 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 308 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 309 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 310 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 311 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 312 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 313 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 314 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 315 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 316 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 317 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 318 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 319 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 320 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 321 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 416 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 432 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 448 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 449 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 450 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 451 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 452 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 453 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 457 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 458 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 459 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 476 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 477 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 478 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 480 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 481 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 484 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 485 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 489 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 490 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 491 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 493 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 498 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 499 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 500 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 504 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 505 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 506 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 509 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 510 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 511 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 513 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 514 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 515 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 516 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 517 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 518 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 519 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 520 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 521 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 522 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 523 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 524 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 525 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 526 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 527 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 528 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 529 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 530 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 531 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 532 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 533 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 534 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 535 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 536 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 537 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 538 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 539 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 540 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 541 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 542 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 543 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 544 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 545 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 546 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 547 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 548 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 549 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 550 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 551 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 552 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 553 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 554 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 555 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 556 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 557 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 558 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 559 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 560 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 561 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 562 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 563 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 564 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 565 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 566 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 567 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 568 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 569 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 570 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 571 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 572 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 573 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 574 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 575 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 576 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 577 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 578 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 579 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 580 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 581 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 582 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 583 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 584 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 585 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 586 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 587 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 588 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 589 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 590 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 591 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 592 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 593 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 594 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 595 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 596 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 597 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 598 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 599 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 600 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 601 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 602 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 603 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 604 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 605 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 606 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 607 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 608 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 609 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 610 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 611 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 612 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 613 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 614 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 615 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 616 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 617 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 618 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 619 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 620 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 621 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 622 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 623 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 624 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 625 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 626 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 627 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 628 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 629 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 630 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 631 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 632 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 633 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 634 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 635 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 636 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 637 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 638 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 639 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 640 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 641 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 642 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 643 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 644 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 645 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 646 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 647 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 648 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 649 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 650 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 651 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 652 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 653 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 654 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 655 | 2941479691 | |||
| 656 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 657 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 658 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 659 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 660 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 661 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 662 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 663 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 664 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 665 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 666 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 667 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 668 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 669 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 670 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 671 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 672 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 673 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 674 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 675 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 676 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 677 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 678 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 679 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 680 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 681 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 682 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 683 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 684 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 685 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 686 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.72 |
| Metatranscriptomes | 0.96 |
| Isolates | 11.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0.06 |
| Endosphere | 17.38 |
| Nodule | 2.22 |
| Rhizoplane | 4.55 |
| Rhizosphere | 56.5 |
| Stem | 0.12 |
| Stem Tuber | 0.36 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182007_10006154 | 3300015262 | Bacteria | 5180 |
| 2 | SwRhRL2b_contig_1532308 | 2162886007 | Bacteria | 4061 |
| 3 | SwRhRL2b_contig_1817389 | 2162886007 | Bacteria | 3884 |
| 4 | SwRhRL2b_contig_211812 | 2162886007 | Bacteria | 3566 |
| 5 | SwRhRL2b_contig_3815225 | 2162886007 | Bacteria | 1537 |
| 6 | SwRhRL2b_contig_648880 | 2162886007 | Bacteria | 991 |
| 7 | SwRhRL2b_contig_811231 | 2162886007 | Bacteria | 3323 |
| 8 | JGI24741J21665_1002439 | 3300001915 | Bacteria | 4831 |
| 9 | JGI24740J21852_10001465 | 3300001979 | Bacteria | 10823 |
| 10 | JGI24740J21852_10005400 | 3300001979 | Bacteria | 5412 |
| 11 | JGI24740J21852_10108564 | 3300001979 | Bacteria | 701 |
| 12 | JGI24739J22299_10000528 | 3300001989 | Bacteria | 13630 |
| 13 | JGI24739J22299_10019327 | 3300001989 | Bacteria | 2439 |
| 14 | JGI25162J39368_1000019 | 3300002737 | Bacteria | 262053 |
| 15 | JGI25162J39368_1000139 | 3300002737 | Bacteria | 78439 |
| 16 | JGI25162J39368_1004044 | 3300002737 | Bacteria | 3670 |
| 17 | JGI25158J39367_1004522 | 3300002739 | Bacteria | 2085 |
| 18 | JGI25158J39367_1014677 | 3300002739 | Bacteria | 1009 |
| 19 | JGI25163J39215_1000008 | 3300002771 | Bacteria | 109086 |
| 20 | JGI25163J39215_1000036 | 3300002771 | Bacteria | 61837 |
| 21 | JGI25163J39215_1001578 | 3300002771 | Bacteria | 3464 |
| 22 | JGI25164J39214_1000011 | 3300002772 | Bacteria | 262057 |
| 23 | JGI25152J39213_1000725 | 3300002773 | Bacteria | 16934 |
| 24 | JGI25152J39213_1001419 | 3300002773 | Bacteria | 10372 |
| 25 | JGI25152J39213_1001623 | 3300002773 | Bacteria | 9388 |
| 26 | JGI25152J39213_1008926 | 3300002773 | Bacteria | 2432 |
| 27 | JGI25150J39212_1001793 | 3300002774 | Bacteria | 5716 |
| 28 | JGI25150J39212_1009982 | 3300002774 | Bacteria | 1785 |
| 29 | JGI25159J45721_1000435 | 3300002987 | Bacteria | 19303 |
| 30 | JGI25159J45721_1001336 | 3300002987 | Bacteria | 10374 |
| 31 | Ga0006759J45824_1061774 | 3300003163 | Bacteria | 2780 |
| 32 | JGI25151J46595_10000198 | 3300003187 | Bacteria | 73969 |
| 33 | JGI25151J46595_10000666 | 3300003187 | Bacteria | 29207 |
| 34 | JGI25151J46595_10000713 | 3300003187 | Bacteria | 27800 |
| 35 | JGI25151J46595_10000957 | 3300003187 | Bacteria | 22074 |
| 36 | JGI25151J46595_10002229 | 3300003187 | Bacteria | 11962 |
| 37 | JGI25151J46595_10011933 | 3300003187 | Bacteria | 3970 |
| 38 | JGI25151J46595_10015566 | 3300003187 | Bacteria | 3347 |
| 39 | JGI25151J46595_10018492 | 3300003187 | Bacteria | 2989 |
| 40 | JGI25151J46595_10064364 | 3300003187 | Bacteria | 1148 |
| 41 | JGI25165J46597_1000227 | 3300003214 | Bacteria | 78439 |
| 42 | JGI25153J46596_10002586 | 3300003215 | Bacteria | 10372 |
| 43 | JGI25153J46596_10027801 | 3300003215 | Bacteria | 1974 |
| 44 | rootH2_10001915 | 3300003320 | Bacteria | 32137 |
| 45 | rootH2_10011746 | 3300003320 | Bacteria | 2643 |
| 46 | rootL2_10010810 | 3300003322 | Bacteria | 8638 |
| 47 | rootL2_10038684 | 3300003322 | Bacteria | 7153 |
| 48 | rootH1_10022702 | 3300003323 | Bacteria | 3321 |
| 49 | JGI25160J50197_1000093 | 3300003354 | Bacteria | 89962 |
| 50 | JGI25160J50197_1001793 | 3300003354 | Bacteria | 10374 |
| 51 | JGI25160J50197_1002516 | 3300003354 | Bacteria | 8502 |
| 52 | JGI25161J50226_1000443 | 3300003374 | Bacteria | 19496 |
| 53 | JGI25161J50226_1001737 | 3300003374 | Bacteria | 6161 |
| 54 | JGI25161J50226_1006112 | 3300003374 | Bacteria | 2225 |
| 55 | Ga0007410J51695_1038845 | 3300003574 | Bacteria | 3771 |
| 56 | Ga0007409J51694_1018424 | 3300003575 | Bacteria | 3742 |
| 57 | Ga0007416J51690_1050216 | 3300003577 | Bacteria | 1207 |
| 58 | Ga0006562J51391_1020559 | 3300003578 | Bacteria | 4830 |
| 59 | Ga0032354_1047181 | 3300003693 | Bacteria | 3724 |
| 60 | Ga0055538_1000021 | 3300003751 | Bacteria | 262057 |
| 61 | Ga0055538_1000089 | 3300003751 | Bacteria | 78439 |
| 62 | Ga0055539_1000026 | 3300003752 | Bacteria | 262057 |
| 63 | Ga0055539_1000133 | 3300003752 | Bacteria | 78439 |
| 64 | Ga0055533_1000035 | 3300003756 | Bacteria | 262057 |
| 65 | Ga0055533_1000136 | 3300003756 | Bacteria | 78439 |
| 66 | Ga0055532_1008571 | 3300003758 | Bacteria | 1272 |
| 67 | Ga0055525_1000045 | 3300003759 | Bacteria | 262057 |
| 68 | Ga0055525_1000181 | 3300003759 | Bacteria | 78439 |
| 69 | Ga0055527_1015720 | 3300003760 | Bacteria | 823 |
| 70 | Ga0055535_1000128 | 3300003761 | Bacteria | 80324 |
| 71 | Ga0055542_1000062 | 3300003762 | Bacteria | 161494 |
| 72 | Ga0055526_1003281 | 3300003771 | Bacteria | 10374 |
| 73 | Ga0055526_1004616 | 3300003771 | Bacteria | 8207 |
| 74 | Ga0055526_1025264 | 3300003771 | Bacteria | 1910 |
| 75 | Ga0055537_1001084 | 3300003773 | Bacteria | 11962 |
| 76 | Ga0055537_1001152 | 3300003773 | Bacteria | 11308 |
| 77 | Ga0055537_1005883 | 3300003773 | Bacteria | 3208 |
| 78 | Ga0055537_1030973 | 3300003773 | Bacteria | 688 |
| 79 | Ga0055524_1002106 | 3300003775 | Bacteria | 10514 |
| 80 | Ga0055524_1002148 | 3300003775 | Bacteria | 10374 |
| 81 | Ga0055524_1003128 | 3300003775 | Bacteria | 8167 |
| 82 | Ga0055524_1009474 | 3300003775 | Bacteria | 3956 |
| 83 | Ga0055524_1064653 | 3300003775 | Bacteria | 737 |
| 84 | Ga0055536_1000045 | 3300003781 | Bacteria | 120495 |
| 85 | Ga0055536_1001927 | 3300003781 | Bacteria | 12006 |
| 86 | Ga0055536_1008144 | 3300003781 | Bacteria | 4563 |
| 87 | Ga0055536_1029855 | 3300003781 | Bacteria | 1455 |
| 88 | Ga0055534_1000607 | 3300003784 | Bacteria | 18537 |
| 89 | Ga0055534_1000680 | 3300003784 | Bacteria | 16840 |
| 90 | Ga0055534_1000948 | 3300003784 | Bacteria | 12920 |
| 91 | Ga0055534_1001053 | 3300003784 | Bacteria | 11964 |
| 92 | Ga0055534_1026656 | 3300003784 | Bacteria | 917 |
| 93 | Ga0055534_1030244 | 3300003784 | Bacteria | 838 |
| 94 | Ga0055528_1001880 | 3300003790 | Bacteria | 11962 |
| 95 | Ga0055528_1012891 | 3300003790 | Bacteria | 3208 |
| 96 | Ga0055530_10001484 | 3300003791 | Bacteria | 17030 |
| 97 | Ga0055530_10036030 | 3300003791 | Bacteria | 1248 |
| 98 | Ga0055540_1002723 | 3300003792 | Bacteria | 9092 |
| 99 | Ga0055540_1003970 | 3300003792 | Bacteria | 6892 |
| 100 | Ga0055540_1004043 | 3300003792 | Bacteria | 6819 |
| 101 | Ga0055540_1010254 | 3300003792 | Bacteria | 3131 |
| 102 | Ga0055531_10002613 | 3300003794 | Bacteria | 11930 |
| 103 | Ga0055531_10042539 | 3300003794 | Bacteria | 1297 |
| 104 | Ga0055541_1000020 | 3300003841 | Bacteria | 262057 |
| 105 | Ga0055541_1000088 | 3300003841 | Bacteria | 78439 |
| 106 | Ga0058692_1000058 | 3300003856 | Bacteria | 99195 |
| 107 | Ga0058692_1000127 | 3300003856 | Bacteria | 48125 |
| 108 | Ga0058692_1000356 | 3300003856 | Bacteria | 22204 |
| 109 | Ga0058692_1000889 | 3300003856 | Bacteria | 11763 |
| 110 | Ga0058692_1001028 | 3300003856 | Bacteria | 10963 |
| 111 | Ga0058692_1003139 | 3300003856 | Bacteria | 5239 |
| 112 | Ga0058692_1005468 | 3300003856 | Bacteria | 3620 |
| 113 | Ga0058692_1006611 | 3300003856 | Bacteria | 3158 |
| 114 | Ga0058692_1008376 | 3300003856 | Bacteria | 2669 |
| 115 | Ga0058692_1008738 | 3300003856 | Bacteria | 2599 |
| 116 | Ga0058692_1009721 | 3300003856 | Bacteria | 2410 |
| 117 | Ga0058692_1016142 | 3300003856 | Bacteria | 1667 |
| 118 | Ga0058692_1036964 | 3300003856 | Bacteria | 880 |
| 119 | Ga0055543_1001728 | 3300004625 | Bacteria | 8190 |
| 120 | Ga0055543_1002173 | 3300004625 | Bacteria | 6747 |
| 121 | Ga0058861_10505237 | 3300004800 | Bacteria | 2053 |
| 122 | Ga0065165_1003326 | 3300005262 | Bacteria | 11487 |
| 123 | Ga0065165_1005438 | 3300005262 | Bacteria | 7159 |
| 124 | Ga0065165_1010696 | 3300005262 | Bacteria | 3926 |
| 125 | Ga0065165_1116696 | 3300005262 | Bacteria | 651 |
| 126 | Ga0065165_1131492 | 3300005262 | Bacteria | 598 |
| 127 | Ga0065703_1020318 | 3300005272 | Bacteria | 1878 |
| 128 | Ga0065714_10166784 | 3300005288 | Bacteria | 1024 |
| 129 | Ga0065704_10000333 | 3300005289 | Bacteria | 49423 |
| 130 | Ga0065704_10000631 | 3300005289 | Bacteria | 14774 |
| 131 | Ga0065704_10001218 | 3300005289 | Bacteria | 18433 |
| 132 | Ga0065704_10003968 | 3300005289 | Bacteria | 10032 |
| 133 | Ga0065704_10071586 | 3300005289 | Bacteria | 10614 |
| 134 | Ga0065704_10086036 | 3300005289 | Bacteria | 3162 |
| 135 | Ga0065704_10086235 | 3300005289 | Bacteria | 3141 |
| 136 | Ga0065704_10129206 | 3300005289 | Bacteria | 1651 |
| 137 | Ga0065704_10141574 | 3300005289 | Bacteria | 1512 |
| 138 | Ga0070658_10070073 | 3300005327 | Bacteria | 2870 |
| 139 | Ga0070658_10148408 | 3300005327 | Bacteria | 1962 |
| 140 | Ga0070658_10243894 | 3300005327 | Bacteria | 1523 |
| 141 | Ga0070658_10557291 | 3300005327 | Bacteria | 992 |
| 142 | Ga0070676_10065117 | 3300005328 | Bacteria | 2175 |
| 143 | Ga0070670_100679234 | 3300005331 | Bacteria | 925 |
| 144 | Ga0070677_10324179 | 3300005333 | Bacteria | 790 |
| 145 | Ga0070680_100022363 | 3300005336 | Bacteria | 5037 |
| 146 | Ga0070680_100495764 | 3300005336 | Bacteria | 1045 |
| 147 | Ga0070682_100010205 | 3300005337 | Bacteria | 5325 |
| 148 | Ga0070682_101235099 | 3300005337 | Bacteria | 632 |
| 149 | Ga0068868_102001739 | 3300005338 | Bacteria | 550 |
| 150 | Ga0070660_100907056 | 3300005339 | Bacteria | 743 |
| 151 | Ga0070691_10006226 | 3300005341 | Bacteria | 5445 |
| 152 | Ga0070691_10036380 | 3300005341 | Bacteria | 2320 |
| 153 | Ga0070691_10198210 | 3300005341 | Bacteria | 1053 |
| 154 | Ga0070687_100056664 | 3300005343 | Bacteria | 2051 |
| 155 | Ga0070661_100015748 | 3300005344 | Bacteria | 5337 |
| 156 | Ga0070661_100398030 | 3300005344 | Bacteria | 1088 |
| 157 | Ga0070661_100546966 | 3300005344 | Bacteria | 931 |
| 158 | Ga0070692_10041561 | 3300005345 | Bacteria | 2356 |
| 159 | Ga0070692_10064627 | 3300005345 | Bacteria | 1935 |
| 160 | Ga0070668_100017378 | 3300005347 | Bacteria | 5387 |
| 161 | Ga0070668_100239409 | 3300005347 | Bacteria | 1503 |
| 162 | Ga0070668_101124166 | 3300005347 | Bacteria | 710 |
| 163 | Ga0070669_100006871 | 3300005353 | Bacteria | 8179 |
| 164 | Ga0070674_100027809 | 3300005356 | Bacteria | 3709 |
| 165 | Ga0070673_100319045 | 3300005364 | Bacteria | 1372 |
| 166 | Ga0070659_100282356 | 3300005366 | Bacteria | 1381 |
| 167 | Ga0070659_100518883 | 3300005366 | Bacteria | 1017 |
| 168 | Ga0070667_100013220 | 3300005367 | Bacteria | 6821 |
| 169 | Ga0070667_100051123 | 3300005367 | Bacteria | 3484 |
| 170 | Ga0070667_100133305 | 3300005367 | Bacteria | 2170 |
| 171 | Ga0070663_100005681 | 3300005455 | Bacteria | 7432 |
| 172 | Ga0070663_100023732 | 3300005455 | Bacteria | 4116 |
| 173 | Ga0070678_100417589 | 3300005456 | Bacteria | 1169 |
| 174 | Ga0070678_101657403 | 3300005456 | Bacteria | 601 |
| 175 | Ga0070662_100017220 | 3300005457 | Bacteria | 4866 |
| 176 | Ga0070662_100235146 | 3300005457 | Bacteria | 1467 |
| 177 | Ga0070681_10000088 | 3300005458 | Bacteria | 69295 |
| 178 | Ga0070681_10002015 | 3300005458 | Bacteria | 18385 |
| 179 | Ga0070681_10984032 | 3300005458 | Bacteria | 763 |
| 180 | Ga0070679_100000061 | 3300005530 | Bacteria | 80570 |
| 181 | Ga0070679_100287609 | 3300005530 | Bacteria | 1595 |
| 182 | Ga0068853_100001354 | 3300005539 | Bacteria | 17657 |
| 183 | Ga0068853_100047998 | 3300005539 | Bacteria | 3665 |
| 184 | Ga0068853_100302849 | 3300005539 | Bacteria | 1478 |
| 185 | Ga0068853_100355525 | 3300005539 | Bacteria | 1363 |
| 186 | Ga0070696_100015635 | 3300005546 | Bacteria | 5099 |
| 187 | Ga0070696_100024095 | 3300005546 | Bacteria | 4136 |
| 188 | Ga0070693_100008374 | 3300005547 | Bacteria | 5095 |
| 189 | Ga0070665_100000262 | 3300005548 | Bacteria | 86632 |
| 190 | Ga0070665_100010362 | 3300005548 | Bacteria | 9432 |
| 191 | Ga0070665_100070998 | 3300005548 | Bacteria | 3489 |
| 192 | Ga0070665_100775281 | 3300005548 | Bacteria | 972 |
| 193 | Ga0070665_100833059 | 3300005548 | Bacteria | 936 |
| 194 | Ga0070665_101682702 | 3300005548 | Bacteria | 642 |
| 195 | Ga0068855_100010497 | 3300005563 | Bacteria | 11173 |
| 196 | Ga0068855_100224695 | 3300005563 | Bacteria | 2104 |
| 197 | Ga0070664_100099825 | 3300005564 | Bacteria | 2523 |
| 198 | Ga0068857_100000082 | 3300005577 | Bacteria | 55308 |
| 199 | Ga0068857_100036973 | 3300005577 | Bacteria | 4324 |
| 200 | Ga0068857_100650963 | 3300005577 | Bacteria | 999 |
| 201 | Ga0068857_101000606 | 3300005577 | Bacteria | 805 |
| 202 | Ga0068854_100061734 | 3300005578 | Bacteria | 2715 |
| 203 | Ga0068852_100320257 | 3300005616 | Bacteria | 1506 |
| 204 | Ga0068852_100805233 | 3300005616 | Bacteria | 954 |
| 205 | Ga0068859_100135523 | 3300005617 | Bacteria | 2535 |
| 206 | Ga0068851_10001818 | 3300005834 | Bacteria | 9333 |
| 207 | Ga0068851_10012101 | 3300005834 | Bacteria | 4062 |
| 208 | Ga0068870_11119288 | 3300005840 | Bacteria | 567 |
| 209 | Ga0068863_100031760 | 3300005841 | Bacteria | 5038 |
| 210 | Ga0068860_100301337 | 3300005843 | Bacteria | 1570 |
| 211 | Ga0081539_10075937 | 3300005985 | Bacteria | 1782 |
| 212 | Ga0075365_10093978 | 3300006038 | Bacteria | 2046 |
| 213 | Ga0075363_100698181 | 3300006048 | Bacteria | 613 |
| 214 | Ga0075364_10004261 | 3300006051 | Bacteria | 8212 |
| 215 | Ga0075364_10019925 | 3300006051 | Bacteria | 4214 |
| 216 | Ga0075364_10039524 | 3300006051 | Bacteria | 3058 |
| 217 | Ga0075364_10090303 | 3300006051 | Bacteria | 2032 |
| 218 | Ga0075364_10122334 | 3300006051 | Bacteria | 1743 |
| 219 | Ga0075364_10139974 | 3300006051 | Bacteria | 1627 |
| 220 | Ga0075364_10141236 | 3300006051 | Bacteria | 1620 |
| 221 | Ga0075364_10229103 | 3300006051 | Bacteria | 1262 |
| 222 | Ga0075364_10252742 | 3300006051 | Bacteria | 1198 |
| 223 | Ga0075364_10669159 | 3300006051 | Bacteria | 709 |
| 224 | Ga0075432_10045356 | 3300006058 | Bacteria | 1542 |
| 225 | Ga0075362_10000528 | 3300006177 | Bacteria | 11099 |
| 226 | Ga0075362_10002538 | 3300006177 | Bacteria | 6156 |
| 227 | Ga0075362_10017911 | 3300006177 | Bacteria | 2924 |
| 228 | Ga0075369_10155822 | 3300006186 | Bacteria | 1045 |
| 229 | Ga0075369_10203553 | 3300006186 | Bacteria | 914 |
| 230 | Ga0075366_10036012 | 3300006195 | Bacteria | 2917 |
| 231 | Ga0075366_10255351 | 3300006195 | Bacteria | 1069 |
| 232 | Ga0075370_10004045 | 3300006353 | Bacteria | 7049 |
| 233 | Ga0075370_10016704 | 3300006353 | Bacteria | 3951 |
| 234 | Ga0075370_10019421 | 3300006353 | Bacteria | 3701 |
| 235 | Ga0075370_10367422 | 3300006353 | Bacteria | 861 |
| 236 | Ga0075430_100079155 | 3300006846 | Bacteria | 2755 |
| 237 | Ga0075433_10254037 | 3300006852 | Bacteria | 1559 |
| 238 | Ga0097620_100135524 | 3300006931 | Bacteria | 2535 |
| 239 | Ga0079104_1000035 | 3300006946 | Bacteria | 198709 |
| 240 | Ga0079104_1000274 | 3300006946 | Bacteria | 67264 |
| 241 | Ga0079104_1000343 | 3300006946 | Bacteria | 56060 |
| 242 | Ga0079104_1000464 | 3300006946 | Bacteria | 45595 |
| 243 | Ga0079104_1000819 | 3300006946 | Bacteria | 25996 |
| 244 | Ga0079104_1001653 | 3300006946 | Bacteria | 14405 |
| 245 | Ga0079104_1001797 | 3300006946 | Bacteria | 13307 |
| 246 | Ga0079104_1003555 | 3300006946 | Bacteria | 7168 |
| 247 | Ga0079104_1015838 | 3300006946 | Bacteria | 2221 |
| 248 | Ga0079104_1022141 | 3300006946 | Bacteria | 1716 |
| 249 | Ga0079104_1022902 | 3300006946 | Bacteria | 1671 |
| 250 | Ga0079104_1024210 | 3300006946 | Bacteria | 1602 |
| 251 | Ga0079104_1051905 | 3300006946 | Bacteria | 911 |
| 252 | Ga0079104_1066673 | 3300006946 | Bacteria | 763 |
| 253 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 254 | Ga0099826_10139907 | 3300006948 | Bacteria | 1400 |
| 255 | Ga0099826_10481446 | 3300006948 | Bacteria | 584 |
| 256 | Ga0105251_10002660 | 3300009011 | Bacteria | 13773 |
| 257 | Ga0105251_10002718 | 3300009011 | Bacteria | 13563 |
| 258 | Ga0105251_10002876 | 3300009011 | Bacteria | 12987 |
| 259 | Ga0105251_10007342 | 3300009011 | Bacteria | 6810 |
| 260 | Ga0105251_10008589 | 3300009011 | Bacteria | 6129 |
| 261 | Ga0105251_10011774 | 3300009011 | Bacteria | 4980 |
| 262 | Ga0105251_10025606 | 3300009011 | Bacteria | 3015 |
| 263 | Ga0105251_10027110 | 3300009011 | Bacteria | 2909 |
| 264 | Ga0105251_10035985 | 3300009011 | Bacteria | 2439 |
| 265 | Ga0105251_10079343 | 3300009011 | Bacteria | 1519 |
| 266 | Ga0105251_10098773 | 3300009011 | Bacteria | 1335 |
| 267 | Ga0105251_10110569 | 3300009011 | Bacteria | 1252 |
| 268 | Ga0105251_10213105 | 3300009011 | Bacteria | 869 |
| 269 | Ga0105244_10000117 | 3300009036 | Bacteria | 83982 |
| 270 | Ga0105244_10000123 | 3300009036 | Bacteria | 79547 |
| 271 | Ga0105244_10000491 | 3300009036 | Bacteria | 35705 |
| 272 | Ga0105244_10001091 | 3300009036 | Bacteria | 22607 |
| 273 | Ga0105244_10001372 | 3300009036 | Bacteria | 19788 |
| 274 | Ga0105244_10002148 | 3300009036 | Bacteria | 15132 |
| 275 | Ga0105244_10002204 | 3300009036 | Bacteria | 14884 |
| 276 | Ga0105244_10003085 | 3300009036 | Bacteria | 12193 |
| 277 | Ga0105244_10014092 | 3300009036 | Bacteria | 4639 |
| 278 | Ga0105244_10025906 | 3300009036 | Bacteria | 3180 |
| 279 | Ga0105244_10038004 | 3300009036 | Bacteria | 2513 |
| 280 | Ga0105244_10065064 | 3300009036 | Bacteria | 1827 |
| 281 | Ga0105244_10124884 | 3300009036 | Bacteria | 1244 |
| 282 | Ga0105244_10144566 | 3300009036 | Bacteria | 1142 |
| 283 | Ga0105244_10206087 | 3300009036 | Bacteria | 926 |
| 284 | Ga0105250_10000037 | 3300009092 | Bacteria | 143923 |
| 285 | Ga0105250_10000414 | 3300009092 | Bacteria | 31316 |
| 286 | Ga0105250_10000650 | 3300009092 | Bacteria | 22037 |
| 287 | Ga0105250_10000917 | 3300009092 | Bacteria | 17339 |
| 288 | Ga0105250_10001186 | 3300009092 | Bacteria | 14627 |
| 289 | Ga0105250_10002778 | 3300009092 | Bacteria | 8595 |
| 290 | Ga0105250_10002792 | 3300009092 | Bacteria | 8567 |
| 291 | Ga0105250_10004534 | 3300009092 | Bacteria | 6375 |
| 292 | Ga0105250_10065924 | 3300009092 | Bacteria | 1460 |
| 293 | Ga0105250_10067681 | 3300009092 | Bacteria | 1441 |
| 294 | Ga0105250_10077887 | 3300009092 | Bacteria | 1342 |
| 295 | Ga0105250_10272096 | 3300009092 | Bacteria | 727 |
| 296 | Ga0105240_10062558 | 3300009093 | Bacteria | 4633 |
| 297 | Ga0105240_10273746 | 3300009093 | Bacteria | 1943 |
| 298 | Ga0105240_10335586 | 3300009093 | Bacteria | 1718 |
| 299 | Ga0105240_10498509 | 3300009093 | Bacteria | 1354 |
| 300 | Ga0105240_11260892 | 3300009093 | Bacteria | 781 |
| 301 | Ga0105240_11310510 | 3300009093 | Bacteria | 764 |
| 302 | Ga0105247_10000086 | 3300009101 | Bacteria | 99603 |
| 303 | Ga0105243_10003849 | 3300009148 | Bacteria | 11994 |
| 304 | Ga0105243_10092126 | 3300009148 | Bacteria | 2498 |
| 305 | Ga0105243_12744318 | 3300009148 | Bacteria | 533 |
| 306 | Ga0105241_10000001 | 3300009174 | Bacteria | 879793 |
| 307 | Ga0105241_10130865 | 3300009174 | Bacteria | 2031 |
| 308 | Ga0105241_12690589 | 3300009174 | Bacteria | 501 |
| 309 | Ga0105242_10002597 | 3300009176 | Bacteria | 14150 |
| 310 | Ga0105242_10068733 | 3300009176 | Bacteria | 2931 |
| 311 | Ga0105242_11474481 | 3300009176 | Bacteria | 710 |
| 312 | Ga0105242_11525997 | 3300009176 | Bacteria | 700 |
| 313 | Ga0105248_10253265 | 3300009177 | Bacteria | 1981 |
| 314 | Ga0105237_10011495 | 3300009545 | Bacteria | 9366 |
| 315 | Ga0105237_10150560 | 3300009545 | Bacteria | 2323 |
| 316 | Ga0105237_10395502 | 3300009545 | Bacteria | 1387 |
| 317 | Ga0105238_10001283 | 3300009551 | Bacteria | 25225 |
| 318 | Ga0105238_10634030 | 3300009551 | Bacteria | 1078 |
| 319 | Ga0105249_10340702 | 3300009553 | Bacteria | 1516 |
| 320 | Ga0105239_10013831 | 3300010375 | Bacteria | 8956 |
| 321 | Ga0105246_10073988 | 3300011119 | Bacteria | 2407 |
| 322 | Ga0105246_10155285 | 3300011119 | Bacteria | 1737 |
| 323 | Ga0105246_10493964 | 3300011119 | Bacteria | 1038 |
| 324 | Ga0105246_11291391 | 3300011119 | Bacteria | 676 |
| 325 | Ga0157347_1033606 | 3300012502 | Bacteria | 652 |
| 326 | Ga0157373_10000200 | 3300013100 | Bacteria | 49401 |
| 327 | Ga0157373_10005859 | 3300013100 | Bacteria | 9193 |
| 328 | Ga0157373_10018164 | 3300013100 | Bacteria | 5122 |
| 329 | Ga0157373_10029150 | 3300013100 | Bacteria | 3979 |
| 330 | Ga0157373_10031860 | 3300013100 | Bacteria | 3796 |
| 331 | Ga0157373_10040095 | 3300013100 | Bacteria | 3352 |
| 332 | Ga0157373_10046256 | 3300013100 | Bacteria | 3105 |
| 333 | Ga0157373_10137322 | 3300013100 | Bacteria | 1719 |
| 334 | Ga0157373_10174876 | 3300013100 | Bacteria | 1511 |
| 335 | Ga0157373_10258326 | 3300013100 | Bacteria | 1232 |
| 336 | Ga0157371_10000067 | 3300013102 | Bacteria | 168242 |
| 337 | Ga0157371_10000156 | 3300013102 | Bacteria | 100191 |
| 338 | Ga0157371_10003023 | 3300013102 | Bacteria | 15617 |
| 339 | Ga0157371_10006525 | 3300013102 | Bacteria | 9599 |
| 340 | Ga0157371_10016466 | 3300013102 | Bacteria | 5517 |
| 341 | Ga0157371_10028186 | 3300013102 | Bacteria | 4069 |
| 342 | Ga0157371_10049077 | 3300013102 | Bacteria | 2999 |
| 343 | Ga0157371_10146989 | 3300013102 | Bacteria | 1680 |
| 344 | Ga0157371_10149671 | 3300013102 | Bacteria | 1664 |
| 345 | Ga0157371_10381989 | 3300013102 | Bacteria | 1028 |
| 346 | Ga0157371_10474916 | 3300013102 | Bacteria | 921 |
| 347 | Ga0157371_10503224 | 3300013102 | Bacteria | 895 |
| 348 | Ga0157371_11187912 | 3300013102 | Bacteria | 587 |
| 349 | Ga0157370_10000814 | 3300013104 | Bacteria | 39443 |
| 350 | Ga0157370_10003193 | 3300013104 | Bacteria | 19382 |
| 351 | Ga0157370_10003562 | 3300013104 | Bacteria | 18230 |
| 352 | Ga0157370_10005747 | 3300013104 | Bacteria | 13872 |
| 353 | Ga0157370_10028456 | 3300013104 | Bacteria | 5497 |
| 354 | Ga0157370_10063234 | 3300013104 | Bacteria | 3507 |
| 355 | Ga0157370_10067492 | 3300013104 | Bacteria | 3381 |
| 356 | Ga0157370_10123676 | 3300013104 | Bacteria | 2415 |
| 357 | Ga0157370_10181136 | 3300013104 | Bacteria | 1958 |
| 358 | Ga0157370_10396757 | 3300013104 | Bacteria | 1270 |
| 359 | Ga0157370_10544307 | 3300013104 | Bacteria | 1064 |
| 360 | Ga0157370_11460098 | 3300013104 | Bacteria | 615 |
| 361 | Ga0157369_10002007 | 3300013105 | Bacteria | 24526 |
| 362 | Ga0157369_10010610 | 3300013105 | Bacteria | 10485 |
| 363 | Ga0157369_10016298 | 3300013105 | Bacteria | 8365 |
| 364 | Ga0157369_10024085 | 3300013105 | Bacteria | 6774 |
| 365 | Ga0157369_10650919 | 3300013105 | Bacteria | 1087 |
| 366 | Ga0157374_10002106 | 3300013296 | Bacteria | 16738 |
| 367 | Ga0157374_11778966 | 3300013296 | Bacteria | 641 |
| 368 | Ga0163162_10071042 | 3300013306 | Bacteria | 3533 |
| 369 | Ga0163162_10071964 | 3300013306 | Bacteria | 3512 |
| 370 | Ga0163162_10140414 | 3300013306 | Bacteria | 2529 |
| 371 | Ga0163162_10259980 | 3300013306 | Bacteria | 1868 |
| 372 | Ga0157372_10001630 | 3300013307 | Bacteria | 24355 |
| 373 | Ga0157372_10001655 | 3300013307 | Bacteria | 24172 |
| 374 | Ga0157372_10001723 | 3300013307 | Bacteria | 23725 |
| 375 | Ga0157372_10003992 | 3300013307 | Bacteria | 15837 |
| 376 | Ga0157372_10025560 | 3300013307 | Bacteria | 6423 |
| 377 | Ga0157372_10056434 | 3300013307 | Bacteria | 4388 |
| 378 | Ga0157372_10057183 | 3300013307 | Bacteria | 4359 |
| 379 | Ga0157372_10117318 | 3300013307 | Bacteria | 3053 |
| 380 | Ga0157372_10157175 | 3300013307 | Bacteria | 2626 |
| 381 | Ga0157372_10457502 | 3300013307 | Bacteria | 1487 |
| 382 | Ga0157372_10496574 | 3300013307 | Bacteria | 1423 |
| 383 | Ga0157375_11572794 | 3300013308 | Bacteria | 777 |
| 384 | Ga0182008_10000877 | 3300014497 | Bacteria | 20906 |
| 385 | Ga0182008_10001330 | 3300014497 | Bacteria | 16858 |
| 386 | Ga0182008_10005352 | 3300014497 | Bacteria | 7328 |
| 387 | Ga0182008_10009021 | 3300014497 | Bacteria | 5403 |
| 388 | Ga0182008_10012011 | 3300014497 | Bacteria | 4585 |
| 389 | Ga0182008_10081751 | 3300014497 | Bacteria | 1590 |
| 390 | Ga0182008_10310770 | 3300014497 | Bacteria | 827 |
| 391 | Ga0157379_10003242 | 3300014968 | Bacteria | 13800 |
| 392 | Ga0157376_11058796 | 3300014969 | Bacteria | 836 |
| 393 | Ga0182006_1000022 | 3300015261 | Bacteria | 275350 |
| 394 | Ga0182006_1039514 | 3300015261 | Bacteria | 1861 |
| 395 | Ga0182006_1045596 | 3300015261 | Bacteria | 1705 |
| 396 | Ga0182006_1049881 | 3300015261 | Bacteria | 1614 |
| 397 | Ga0182006_1050636 | 3300015261 | Bacteria | 1600 |
| 398 | Ga0182006_1109871 | 3300015261 | Bacteria | 969 |
| 399 | Ga0182007_10003487 | 3300015262 | Bacteria | 7404 |
| 400 | Ga0182007_10016771 | 3300015262 | Bacteria | 2692 |
| 401 | Ga0182005_1000075 | 3300015265 | Bacteria | 79711 |
| 402 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 403 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 404 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 405 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 406 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 407 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 408 | Ga0163161_10019762 | 3300017792 | Bacteria | 4725 |
| 409 | Ga0163161_10040757 | 3300017792 | Bacteria | 3336 |
| 410 | Ga0163161_10055207 | 3300017792 | Bacteria | 2883 |
| 411 | Ga0206356_10036066 | 3300020070 | Bacteria | 6683 |
| 412 | Ga0206354_11653555 | 3300020081 | Bacteria | 2241 |
| 413 | Ga0206353_11505629 | 3300020082 | Bacteria | 1523 |
| 414 | Ga0154015_1259153 | 3300020610 | Bacteria | 1238 |
| 415 | Ga0213874_10372997 | 3300021377 | Bacteria | 551 |
| 416 | Ga0213876_10000086 | 3300021384 | Bacteria | 106079 |
| 417 | Ga0209760_100004 | 3300025207 | Bacteria | 254650 |
| 418 | Ga0209760_101358 | 3300025207 | Bacteria | 2628 |
| 419 | Ga0209436_101095 | 3300025208 | Bacteria | 10137 |
| 420 | Ga0209436_103393 | 3300025208 | Bacteria | 4259 |
| 421 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 422 | Ga0209784_100071 | 3300025224 | Bacteria | 151400 |
| 423 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 424 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 425 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 426 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 427 | Ga0209672_100319 | 3300025228 | Bacteria | 31820 |
| 428 | Ga0209147_101404 | 3300025229 | Bacteria | 8838 |
| 429 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 430 | Ga0209563_100104 | 3300025230 | Bacteria | 151400 |
| 431 | Ga0207427_100012 | 3300025231 | Bacteria | 585657 |
| 432 | Ga0207427_100308 | 3300025231 | Bacteria | 33981 |
| 433 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 434 | Ga0209437_100035 | 3300025233 | Bacteria | 481110 |
| 435 | Ga0209437_100158 | 3300025233 | Bacteria | 151400 |
| 436 | Ga0209258_100154 | 3300025242 | Bacteria | 158235 |
| 437 | Ga0207425_1000215 | 3300025245 | Bacteria | 45771 |
| 438 | Ga0207425_1002841 | 3300025245 | Bacteria | 5827 |
| 439 | Ga0207425_1004676 | 3300025245 | Bacteria | 4046 |
| 440 | Ga0207425_1013759 | 3300025245 | Bacteria | 1858 |
| 441 | Ga0207425_1024413 | 3300025245 | Bacteria | 1256 |
| 442 | Ga0207425_1026374 | 3300025245 | Bacteria | 1192 |
| 443 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 444 | Ga0209677_100064 | 3300025253 | Bacteria | 151400 |
| 445 | Ga0209677_112773 | 3300025253 | Bacteria | 1227 |
| 446 | Ga0209148_1000145 | 3300025254 | Bacteria | 161352 |
| 447 | Ga0209129_1000018 | 3300025258 | Bacteria | 469298 |
| 448 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 449 | Ga0209129_1000103 | 3300025258 | Bacteria | 161305 |
| 450 | Ga0209129_1009530 | 3300025258 | Bacteria | 2543 |
| 451 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 452 | Ga0209233_1001009 | 3300025261 | Bacteria | 12019 |
| 453 | Ga0209565_1000086 | 3300025263 | Bacteria | 152204 |
| 454 | Ga0209565_1000317 | 3300025263 | Bacteria | 44071 |
| 455 | Ga0209565_1001154 | 3300025263 | Bacteria | 12731 |
| 456 | Ga0209565_1003106 | 3300025263 | Bacteria | 5572 |
| 457 | Ga0209565_1005158 | 3300025263 | Bacteria | 3840 |
| 458 | Ga0209455_1000399 | 3300025272 | Bacteria | 36942 |
| 459 | Ga0209673_1000168 | 3300025273 | Bacteria | 135126 |
| 460 | Ga0209673_1001793 | 3300025273 | Bacteria | 17739 |
| 461 | Ga0209673_1009768 | 3300025273 | Bacteria | 4116 |
| 462 | Ga0209130_1000206 | 3300025284 | Bacteria | 79198 |
| 463 | Ga0209130_1001133 | 3300025284 | Bacteria | 19524 |
| 464 | Ga0209130_1001531 | 3300025284 | Bacteria | 14805 |
| 465 | Ga0209130_1001936 | 3300025284 | Bacteria | 11521 |
| 466 | Ga0209130_1013485 | 3300025284 | Bacteria | 2090 |
| 467 | Ga0209675_1000193 | 3300025291 | Bacteria | 66563 |
| 468 | Ga0209675_1000548 | 3300025291 | Bacteria | 27388 |
| 469 | Ga0209675_1002487 | 3300025291 | Bacteria | 9442 |
| 470 | Ga0209675_1002730 | 3300025291 | Bacteria | 8841 |
| 471 | Ga0209675_1005202 | 3300025291 | Bacteria | 5514 |
| 472 | Ga0209675_1005551 | 3300025291 | Bacteria | 5256 |
| 473 | Ga0209675_1019667 | 3300025291 | Bacteria | 1850 |
| 474 | Ga0209676_1000053 | 3300025292 | Bacteria | 370111 |
| 475 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 476 | Ga0209676_1000290 | 3300025292 | Bacteria | 103000 |
| 477 | Ga0209676_1004587 | 3300025292 | Bacteria | 7631 |
| 478 | Ga0209676_1004993 | 3300025292 | Bacteria | 7110 |
| 479 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 480 | Ga0209025_1000034 | 3300025294 | Bacteria | 413205 |
| 481 | Ga0209025_1000059 | 3300025294 | Bacteria | 305480 |
| 482 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 483 | Ga0209025_1000093 | 3300025294 | Bacteria | 241788 |
| 484 | Ga0209025_1000201 | 3300025294 | Bacteria | 145890 |
| 485 | Ga0209025_1003493 | 3300025294 | Bacteria | 14805 |
| 486 | Ga0209025_1023935 | 3300025294 | Bacteria | 3173 |
| 487 | Ga0209025_1035232 | 3300025294 | Bacteria | 2265 |
| 488 | Ga0209025_1038171 | 3300025294 | Bacteria | 2117 |
| 489 | Ga0209025_1062942 | 3300025294 | Bacteria | 1372 |
| 490 | Ga0209564_1000301 | 3300025295 | Bacteria | 97869 |
| 491 | Ga0209564_1000408 | 3300025295 | Bacteria | 76528 |
| 492 | Ga0209564_1001285 | 3300025295 | Bacteria | 27486 |
| 493 | Ga0209564_1003017 | 3300025295 | Bacteria | 12029 |
| 494 | Ga0209564_1004316 | 3300025295 | Bacteria | 8786 |
| 495 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 496 | Ga0209758_1011927 | 3300025297 | Bacteria | 4947 |
| 497 | Ga0209758_1034934 | 3300025297 | Bacteria | 1989 |
| 498 | Ga0209758_1052022 | 3300025297 | Bacteria | 1420 |
| 499 | Ga0209758_1114102 | 3300025297 | Bacteria | 742 |
| 500 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 501 | Ga0209050_1001244 | 3300025298 | Bacteria | 29472 |
| 502 | Ga0209050_1007544 | 3300025298 | Bacteria | 6063 |
| 503 | Ga0209050_1009167 | 3300025298 | Bacteria | 5116 |
| 504 | Ga0209256_1000066 | 3300025299 | Bacteria | 247534 |
| 505 | Ga0209256_1000086 | 3300025299 | Bacteria | 218837 |
| 506 | Ga0209256_1001063 | 3300025299 | Bacteria | 31840 |
| 507 | Ga0209256_1003254 | 3300025299 | Bacteria | 11683 |
| 508 | Ga0209256_1085940 | 3300025299 | Bacteria | 678 |
| 509 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 510 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 511 | Ga0207426_1000156 | 3300025302 | Bacteria | 178646 |
| 512 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 513 | Ga0209051_1000141 | 3300025303 | Bacteria | 135837 |
| 514 | Ga0209051_1001450 | 3300025303 | Bacteria | 20110 |
| 515 | Ga0209051_1001589 | 3300025303 | Bacteria | 18632 |
| 516 | Ga0209051_1002728 | 3300025303 | Bacteria | 12254 |
| 517 | Ga0209051_1053241 | 3300025303 | Bacteria | 1331 |
| 518 | Ga0209051_1067377 | 3300025303 | Bacteria | 1095 |
| 519 | Ga0209051_1075533 | 3300025303 | Bacteria | 994 |
| 520 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 521 | Ga0209257_1003493 | 3300025304 | Bacteria | 13388 |
| 522 | Ga0209257_1015612 | 3300025304 | Bacteria | 3146 |
| 523 | Ga0207656_10004218 | 3300025321 | Bacteria | 5000 |
| 524 | Ga0207656_10017790 | 3300025321 | Bacteria | 2789 |
| 525 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 526 | Ga0207696_1000070 | 3300025711 | Bacteria | 227242 |
| 527 | Ga0207696_1000099 | 3300025711 | Bacteria | 173329 |
| 528 | Ga0207696_1000170 | 3300025711 | Bacteria | 102852 |
| 529 | Ga0207696_1000537 | 3300025711 | Bacteria | 30749 |
| 530 | Ga0207696_1001040 | 3300025711 | Bacteria | 16508 |
| 531 | Ga0207696_1002538 | 3300025711 | Bacteria | 8897 |
| 532 | Ga0207696_1004683 | 3300025711 | Bacteria | 5844 |
| 533 | Ga0207696_1007450 | 3300025711 | Bacteria | 4283 |
| 534 | Ga0207696_1010764 | 3300025711 | Bacteria | 3336 |
| 535 | Ga0207696_1012417 | 3300025711 | Bacteria | 3011 |
| 536 | Ga0207696_1039647 | 3300025711 | Bacteria | 1384 |
| 537 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 538 | Ga0207655_1000009 | 3300025728 | Bacteria | 664676 |
| 539 | Ga0207655_1000046 | 3300025728 | Bacteria | 309474 |
| 540 | Ga0207655_1000071 | 3300025728 | Bacteria | 237394 |
| 541 | Ga0207655_1000089 | 3300025728 | Bacteria | 204720 |
| 542 | Ga0207655_1000215 | 3300025728 | Bacteria | 100334 |
| 543 | Ga0207655_1000363 | 3300025728 | Bacteria | 64519 |
| 544 | Ga0207655_1000506 | 3300025728 | Bacteria | 49895 |
| 545 | Ga0207655_1000763 | 3300025728 | Bacteria | 36016 |
| 546 | Ga0207655_1006208 | 3300025728 | Bacteria | 7957 |
| 547 | Ga0207655_1015575 | 3300025728 | Bacteria | 4215 |
| 548 | Ga0207655_1043112 | 3300025728 | Bacteria | 1913 |
| 549 | Ga0207655_1060447 | 3300025728 | Bacteria | 1469 |
| 550 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 551 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 552 | Ga0207713_1000018 | 3300025735 | Bacteria | 362635 |
| 553 | Ga0207713_1000120 | 3300025735 | Bacteria | 123766 |
| 554 | Ga0207713_1002665 | 3300025735 | Bacteria | 12798 |
| 555 | Ga0207713_1004886 | 3300025735 | Bacteria | 8583 |
| 556 | Ga0207713_1018235 | 3300025735 | Bacteria | 3481 |
| 557 | Ga0207713_1018975 | 3300025735 | Bacteria | 3385 |
| 558 | Ga0207713_1030329 | 3300025735 | Bacteria | 2409 |
| 559 | Ga0207713_1035127 | 3300025735 | Bacteria | 2167 |
| 560 | Ga0207713_1035833 | 3300025735 | Bacteria | 2136 |
| 561 | Ga0207713_1071665 | 3300025735 | Bacteria | 1278 |
| 562 | Ga0207713_1089201 | 3300025735 | Bacteria | 1088 |
| 563 | Ga0207710_10000233 | 3300025900 | Bacteria | 48055 |
| 564 | Ga0207710_10081304 | 3300025900 | Bacteria | 1503 |
| 565 | Ga0207680_10011667 | 3300025903 | Bacteria | 4448 |
| 566 | Ga0207647_10003226 | 3300025904 | Bacteria | 12238 |
| 567 | Ga0207705_10000029 | 3300025909 | Bacteria | 239897 |
| 568 | Ga0207705_10000755 | 3300025909 | Bacteria | 26682 |
| 569 | Ga0207705_10056150 | 3300025909 | Bacteria | 2839 |
| 570 | Ga0207705_10958300 | 3300025909 | Bacteria | 662 |
| 571 | Ga0207654_10000004 | 3300025911 | Bacteria | 902334 |
| 572 | Ga0207654_10115476 | 3300025911 | Bacteria | 1677 |
| 573 | Ga0207707_10000042 | 3300025912 | Bacteria | 126050 |
| 574 | Ga0207707_10000144 | 3300025912 | Bacteria | 73715 |
| 575 | Ga0207707_10001056 | 3300025912 | Bacteria | 26434 |
| 576 | Ga0207707_10008129 | 3300025912 | Bacteria | 9110 |
| 577 | Ga0207707_10206830 | 3300025912 | Bacteria | 1710 |
| 578 | Ga0207695_10002071 | 3300025913 | Bacteria | 30574 |
| 579 | Ga0207695_10010137 | 3300025913 | Bacteria | 11561 |
| 580 | Ga0207695_10084151 | 3300025913 | Bacteria | 3212 |
| 581 | Ga0207695_10367416 | 3300025913 | Bacteria | 1325 |
| 582 | Ga0207671_10026936 | 3300025914 | Bacteria | 4301 |
| 583 | Ga0207660_10000413 | 3300025917 | Bacteria | 28242 |
| 584 | Ga0207662_10099146 | 3300025918 | Bacteria | 1803 |
| 585 | Ga0207657_10592936 | 3300025919 | Bacteria | 865 |
| 586 | Ga0207649_10007256 | 3300025920 | Bacteria | 6025 |
| 587 | Ga0207649_10015548 | 3300025920 | Bacteria | 4275 |
| 588 | Ga0207649_10519784 | 3300025920 | Bacteria | 907 |
| 589 | Ga0207649_10566197 | 3300025920 | Bacteria | 871 |
| 590 | Ga0207652_10000082 | 3300025921 | Bacteria | 103057 |
| 591 | Ga0207652_10000808 | 3300025921 | Bacteria | 29892 |
| 592 | Ga0207652_10001430 | 3300025921 | Bacteria | 21150 |
| 593 | Ga0207652_10345918 | 3300025921 | Bacteria | 1342 |
| 594 | Ga0207681_10011213 | 3300025923 | Bacteria | 5505 |
| 595 | Ga0207694_10021179 | 3300025924 | Bacteria | 4924 |
| 596 | Ga0207694_10974166 | 3300025924 | Bacteria | 717 |
| 597 | Ga0207650_10811942 | 3300025925 | Bacteria | 793 |
| 598 | Ga0207644_10298919 | 3300025931 | Bacteria | 1297 |
| 599 | Ga0207690_10004125 | 3300025932 | Bacteria | 8581 |
| 600 | Ga0207690_10008721 | 3300025932 | Bacteria | 6016 |
| 601 | Ga0207690_10298468 | 3300025932 | Bacteria | 1260 |
| 602 | Ga0207706_10011328 | 3300025933 | Bacteria | 8125 |
| 603 | Ga0207706_10174918 | 3300025933 | Bacteria | 1886 |
| 604 | Ga0207686_10001018 | 3300025934 | Bacteria | 16599 |
| 605 | Ga0207686_10240383 | 3300025934 | Bacteria | 1318 |
| 606 | Ga0207686_10534495 | 3300025934 | Bacteria | 914 |
| 607 | Ga0207709_10001503 | 3300025935 | Bacteria | 16107 |
| 608 | Ga0207669_10027614 | 3300025937 | Bacteria | 3111 |
| 609 | Ga0207691_10545460 | 3300025940 | Bacteria | 983 |
| 610 | Ga0207711_10633536 | 3300025941 | Bacteria | 997 |
| 611 | Ga0207661_10015030 | 3300025944 | Bacteria | 5685 |
| 612 | Ga0207661_11268292 | 3300025944 | Bacteria | 677 |
| 613 | Ga0207679_10077418 | 3300025945 | Bacteria | 2530 |
| 614 | Ga0207679_10080577 | 3300025945 | Bacteria | 2486 |
| 615 | Ga0207667_10000075 | 3300025949 | Bacteria | 169836 |
| 616 | Ga0207667_10005022 | 3300025949 | Bacteria | 16175 |
| 617 | Ga0207667_10007273 | 3300025949 | Bacteria | 13352 |
| 618 | Ga0207667_10161254 | 3300025949 | Bacteria | 2306 |
| 619 | Ga0207667_10385112 | 3300025949 | Bacteria | 1428 |
| 620 | Ga0207651_10180586 | 3300025960 | Bacteria | 1674 |
| 621 | Ga0207712_10961464 | 3300025961 | Bacteria | 757 |
| 622 | Ga0207712_11548013 | 3300025961 | Bacteria | 594 |
| 623 | Ga0207668_10007961 | 3300025972 | Bacteria | 6305 |
| 624 | Ga0207668_10470819 | 3300025972 | Bacteria | 1076 |
| 625 | Ga0207640_10010766 | 3300025981 | Bacteria | 5161 |
| 626 | Ga0207640_10016893 | 3300025981 | Bacteria | 4256 |
| 627 | Ga0207640_10022260 | 3300025981 | Bacteria | 3790 |
| 628 | Ga0207640_10390751 | 3300025981 | Bacteria | 1130 |
| 629 | Ga0207658_10205254 | 3300025986 | Bacteria | 1648 |
| 630 | Ga0207658_10329316 | 3300025986 | Bacteria | 1324 |
| 631 | Ga0207658_10566998 | 3300025986 | Bacteria | 1017 |
| 632 | Ga0207658_11591886 | 3300025986 | Bacteria | 597 |
| 633 | Ga0207639_10001297 | 3300026041 | Bacteria | 16886 |
| 634 | Ga0207639_10007637 | 3300026041 | Bacteria | 7377 |
| 635 | Ga0207639_10047674 | 3300026041 | Bacteria | 3239 |
| 636 | Ga0207639_10155920 | 3300026041 | Bacteria | 1918 |
| 637 | Ga0207678_10001891 | 3300026067 | Bacteria | 19106 |
| 638 | Ga0207678_10005658 | 3300026067 | Bacteria | 11170 |
| 639 | Ga0207678_10052250 | 3300026067 | Bacteria | 3526 |
| 640 | Ga0207702_10031604 | 3300026078 | Bacteria | 4412 |
| 641 | Ga0207641_10161201 | 3300026088 | Bacteria | 2039 |
| 642 | Ga0207674_10000712 | 3300026116 | Bacteria | 43462 |
| 643 | Ga0207674_10003998 | 3300026116 | Bacteria | 17911 |
| 644 | Ga0207674_10059041 | 3300026116 | Bacteria | 3884 |
| 645 | Ga0207674_10353568 | 3300026116 | Bacteria | 1420 |
| 646 | Ga0207675_100198346 | 3300026118 | Bacteria | 1927 |
| 647 | Ga0207683_10014368 | 3300026121 | Bacteria | 6744 |
| 648 | Ga0207683_10049183 | 3300026121 | Bacteria | 3690 |
| 649 | Ga0207683_10484361 | 3300026121 | Bacteria | 1142 |
| 650 | Ga0207683_11617527 | 3300026121 | Bacteria | 597 |
| 651 | Ga0207698_10000358 | 3300026142 | Bacteria | 26861 |
| 652 | Ga0207698_10313763 | 3300026142 | Bacteria | 1465 |
| 653 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 654 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 655 | Ga0209281_1000114 | 3300027111 | Bacteria | 210536 |
| 656 | Ga0209281_1000180 | 3300027111 | Bacteria | 147099 |
| 657 | Ga0209281_1000229 | 3300027111 | Bacteria | 118957 |
| 658 | Ga0209281_1000267 | 3300027111 | Bacteria | 100564 |
| 659 | Ga0209281_1000288 | 3300027111 | Bacteria | 93347 |
| 660 | Ga0209281_1000383 | 3300027111 | Bacteria | 70062 |
| 661 | Ga0209281_1000722 | 3300027111 | Bacteria | 32788 |
| 662 | Ga0209281_1001917 | 3300027111 | Bacteria | 9885 |
| 663 | Ga0209281_1002477 | 3300027111 | Bacteria | 7347 |
| 664 | Ga0209973_1037991 | 3300027252 | Bacteria | 698 |
| 665 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 666 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 667 | Ga0209371_1000020 | 3300027312 | Bacteria | 556282 |
| 668 | Ga0209371_1000081 | 3300027312 | Bacteria | 185440 |
| 669 | Ga0209371_1000085 | 3300027312 | Bacteria | 179586 |
| 670 | Ga0209371_1000086 | 3300027312 | Bacteria | 175099 |
| 671 | Ga0209371_1000167 | 3300027312 | Bacteria | 98922 |
| 672 | Ga0209371_1000321 | 3300027312 | Bacteria | 52619 |
| 673 | Ga0209371_1000349 | 3300027312 | Bacteria | 50349 |
| 674 | Ga0209371_1000616 | 3300027312 | Bacteria | 31750 |
| 675 | Ga0209371_1000809 | 3300027312 | Bacteria | 25834 |
| 676 | Ga0209371_1001073 | 3300027312 | Bacteria | 20478 |
| 677 | Ga0209371_1002095 | 3300027312 | Bacteria | 11843 |
| 678 | Ga0209371_1002126 | 3300027312 | Bacteria | 11691 |
| 679 | Ga0209371_1002299 | 3300027312 | Bacteria | 10904 |
| 680 | Ga0209371_1002407 | 3300027312 | Bacteria | 10512 |
| 681 | Ga0209371_1002837 | 3300027312 | Bacteria | 9192 |
| 682 | Ga0209371_1003155 | 3300027312 | Bacteria | 8368 |
| 683 | Ga0209371_1003489 | 3300027312 | Bacteria | 7600 |
| 684 | Ga0209371_1003616 | 3300027312 | Bacteria | 7380 |
| 685 | Ga0209371_1021256 | 3300027312 | Bacteria | 1578 |
| 686 | Ga0209371_1046577 | 3300027312 | Bacteria | 851 |
| 687 | Ga0209371_1047234 | 3300027312 | Bacteria | 843 |
| 688 | Ga0209371_1062786 | 3300027312 | Bacteria | 678 |
| 689 | Ga0209999_1043668 | 3300027543 | Bacteria | 842 |
| 690 | Ga0210002_1020944 | 3300027617 | Bacteria | 1055 |
| 691 | Ga0209282_1000043 | 3300027666 | Bacteria | 119260 |
| 692 | Ga0209971_1001163 | 3300027682 | Bacteria | 6629 |
| 693 | Ga0209971_1169283 | 3300027682 | Bacteria | 539 |
| 694 | Ga0209974_10010341 | 3300027876 | Bacteria | 3148 |
| 695 | Ga0268266_10000282 | 3300028379 | Bacteria | 83781 |
| 696 | Ga0268266_10025201 | 3300028379 | Bacteria | 5062 |
| 697 | Ga0268266_10180251 | 3300028379 | Bacteria | 1923 |
| 698 | Ga0268266_11456353 | 3300028379 | Bacteria | 660 |
| 699 | Ga0268265_10139443 | 3300028380 | Bacteria | 2028 |
| 700 | Ga0268264_10304937 | 3300028381 | Bacteria | 1500 |
| 701 | Ga0265323_10010795 | 3300028653 | Bacteria | 3698 |
| 702 | Ga0307515_10000626 | 3300028794 | Bacteria | 82165 |
| 703 | Ga0307515_10001303 | 3300028794 | Bacteria | 56637 |
| 704 | Ga0307515_10032622 | 3300028794 | Bacteria | 8617 |
| 705 | Ga0265324_10056153 | 3300029957 | Bacteria | 1349 |
| 706 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 707 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 708 | Ga0268256_1000048 | 3300030500 | Bacteria | 312298 |
| 709 | Ga0268256_1000092 | 3300030500 | Bacteria | 144061 |
| 710 | Ga0268256_1000114 | 3300030500 | Bacteria | 117092 |
| 711 | Ga0268256_1000124 | 3300030500 | Bacteria | 111181 |
| 712 | Ga0268256_1000175 | 3300030500 | Bacteria | 76497 |
| 713 | Ga0268256_1000532 | 3300030500 | Bacteria | 31413 |
| 714 | Ga0268256_1000920 | 3300030500 | Bacteria | 20333 |
| 715 | Ga0268256_1001027 | 3300030500 | Bacteria | 18776 |
| 716 | Ga0268256_1001435 | 3300030500 | Bacteria | 14374 |
| 717 | Ga0268256_1001749 | 3300030500 | Bacteria | 12267 |
| 718 | Ga0268256_1002069 | 3300030500 | Bacteria | 10802 |
| 719 | Ga0268256_1002830 | 3300030500 | Bacteria | 8368 |
| 720 | Ga0268256_1003160 | 3300030500 | Bacteria | 7667 |
| 721 | Ga0268256_1004676 | 3300030500 | Bacteria | 5591 |
| 722 | Ga0268256_1007695 | 3300030500 | Bacteria | 3800 |
| 723 | Ga0268256_1017912 | 3300030500 | Bacteria | 1983 |
| 724 | Ga0268256_1018423 | 3300030500 | Bacteria | 1937 |
| 725 | Ga0268256_1023884 | 3300030500 | Bacteria | 1578 |
| 726 | Ga0268256_1052542 | 3300030500 | Bacteria | 851 |
| 727 | Ga0316177_1037186 | 3300030731 | Bacteria | 9370 |
| 728 | Ga0316176_1061113 | 3300030732 | Bacteria | 4189 |
| 729 | Ga0314311_1031728 | 3300030733 | Bacteria | 7577 |
| 730 | Ga0316179_1098736 | 3300030734 | Bacteria | 3497 |
| 731 | Ga0316178_1015612 | 3300030735 | Bacteria | 4295 |
| 732 | Ga0316180_1126976 | 3300030736 | Bacteria | 746 |
| 733 | Ga0316183_1122932 | 3300030742 | Bacteria | 7560 |
| 734 | Ga0316181_1114225 | 3300030744 | Bacteria | 2386 |
| 735 | Ga0316182_1103194 | 3300030745 | Bacteria | 5077 |
| 736 | Ga0265330_10004252 | 3300031235 | Bacteria | 7298 |
| 737 | Ga0265332_10019389 | 3300031238 | Bacteria | 3002 |
| 738 | Ga0265328_10327217 | 3300031239 | Bacteria | 594 |
| 739 | Ga0265331_10003913 | 3300031250 | Bacteria | 9413 |
| 740 | Ga0265331_10105558 | 3300031250 | Bacteria | 1294 |
| 741 | Ga0265327_10000133 | 3300031251 | Bacteria | 163887 |
| 742 | Ga0265327_10002852 | 3300031251 | Bacteria | 17418 |
| 743 | Ga0265327_10015025 | 3300031251 | Bacteria | 5031 |
| 744 | Ga0265327_10024914 | 3300031251 | Bacteria | 3500 |
| 745 | Ga0265327_10025409 | 3300031251 | Bacteria | 3453 |
| 746 | Ga0265327_10393824 | 3300031251 | Bacteria | 602 |
| 747 | Ga0265316_10147424 | 3300031344 | Bacteria | 1764 |
| 748 | Ga0307408_100009699 | 3300031548 | Bacteria | 6346 |
| 749 | Ga0307408_100014538 | 3300031548 | Bacteria | 5230 |
| 750 | Ga0307408_100033660 | 3300031548 | Bacteria | 3582 |
| 751 | Ga0307408_100161444 | 3300031548 | Bacteria | 1780 |
| 752 | Ga0307408_100323091 | 3300031548 | Bacteria | 1300 |
| 753 | Ga0307514_10000711 | 3300031649 | Bacteria | 57628 |
| 754 | Ga0307514_10173650 | 3300031649 | Bacteria | 1402 |
| 755 | Ga0316575_10024298 | 3300031665 | Bacteria | 2346 |
| 756 | Ga0316579_10046342 | 3300031691 | Bacteria | 2028 |
| 757 | Ga0265314_10008686 | 3300031711 | Bacteria | 8689 |
| 758 | Ga0316576_10557731 | 3300031727 | Bacteria | 839 |
| 759 | Ga0316578_10079152 | 3300031728 | Bacteria | 1954 |
| 760 | Ga0316578_10118438 | 3300031728 | Bacteria | 1591 |
| 761 | Ga0307405_10058452 | 3300031731 | Bacteria | 2426 |
| 762 | Ga0307405_10144393 | 3300031731 | Bacteria | 1664 |
| 763 | Ga0307405_10180638 | 3300031731 | Bacteria | 1514 |
| 764 | Ga0307405_10310911 | 3300031731 | Bacteria | 1199 |
| 765 | Ga0307405_10321329 | 3300031731 | Bacteria | 1182 |
| 766 | Ga0307405_10362857 | 3300031731 | Bacteria | 1121 |
| 767 | Ga0307405_10427102 | 3300031731 | Bacteria | 1044 |
| 768 | Ga0307405_10874541 | 3300031731 | Bacteria | 758 |
| 769 | Ga0307405_10897101 | 3300031731 | Bacteria | 749 |
| 770 | Ga0316577_10041516 | 3300031733 | Bacteria | 2574 |
| 771 | Ga0316577_10057099 | 3300031733 | Bacteria | 2179 |
| 772 | Ga0316577_10062977 | 3300031733 | Bacteria | 2071 |
| 773 | Ga0307413_10082572 | 3300031824 | Bacteria | 2065 |
| 774 | Ga0307413_10347186 | 3300031824 | Bacteria | 1144 |
| 775 | Ga0307406_10003334 | 3300031901 | Bacteria | 8755 |
| 776 | Ga0307406_10007375 | 3300031901 | Bacteria | 6097 |
| 777 | Ga0307406_10029379 | 3300031901 | Bacteria | 3329 |
| 778 | Ga0307406_10109880 | 3300031901 | Bacteria | 1896 |
| 779 | Ga0307406_10319528 | 3300031901 | Bacteria | 1200 |
| 780 | Ga0307406_11635513 | 3300031901 | Bacteria | 569 |
| 781 | Ga0307412_10019109 | 3300031911 | Bacteria | 4140 |
| 782 | Ga0307412_10128246 | 3300031911 | Bacteria | 1838 |
| 783 | Ga0307412_10242227 | 3300031911 | Bacteria | 1395 |
| 784 | Ga0307412_10423382 | 3300031911 | Bacteria | 1090 |
| 785 | Ga0307412_12210232 | 3300031911 | Bacteria | 512 |
| 786 | Ga0307409_100887652 | 3300031995 | Bacteria | 904 |
| 787 | Ga0307416_100408334 | 3300032002 | Bacteria | 1398 |
| 788 | Ga0307416_100431182 | 3300032002 | Bacteria | 1365 |
| 789 | Ga0307416_101951500 | 3300032002 | Bacteria | 690 |
| 790 | Ga0307416_102284103 | 3300032002 | Bacteria | 641 |
| 791 | Ga0307416_102326572 | 3300032002 | Bacteria | 636 |
| 792 | Ga0307414_10177984 | 3300032004 | Bacteria | 1707 |
| 793 | Ga0307414_10339772 | 3300032004 | Bacteria | 1285 |
| 794 | Ga0307414_10553731 | 3300032004 | Bacteria | 1025 |
| 795 | Ga0307414_11822512 | 3300032004 | Bacteria | 568 |
| 796 | Ga0307411_10019468 | 3300032005 | Bacteria | 3922 |
| 797 | Ga0307411_10201421 | 3300032005 | Bacteria | 1529 |
| 798 | Ga0307411_10261224 | 3300032005 | Bacteria | 1367 |
| 799 | Ga0316580_10045072 | 3300032139 | Bacteria | 1360 |
| 800 | Ga0316580_10237488 | 3300032139 | Bacteria | 563 |
| 801 | Ga0307510_10232500 | 3300033180 | Bacteria | 1345 |
| 802 | Ga0316587_1000878 | 3300033529 | Bacteria | 3407 |
| 803 | Ga0316574_0019624 | 3300035398 | Bacteria | 3990 |
| 804 | Ga0316574_0212159 | 3300035398 | Bacteria | 1242 |
| 805 | Ga0316582_0012653 | 3300036647 | Bacteria | 4718 |
| 806 | Ga0316582_0139520 | 3300036647 | Bacteria | 1633 |
| 807 | Ga0316582_0207199 | 3300036647 | Bacteria | 1339 |
| 808 | Ga0316582_0254001 | 3300036647 | Bacteria | 1205 |
| 809 | Ga0316584_0003227 | 3300036712 | Bacteria | 10555 |
| 810 | Ga0316584_0007399 | 3300036712 | Bacteria | 7505 |
| 811 | Ga0316584_0058252 | 3300036712 | Bacteria | 2892 |
| 812 | Ga0316584_0137779 | 3300036712 | Bacteria | 1821 |
| 813 | Ga0395900_0067131 | 3300037418 | Bacteria | 3684 |
| 814 | Ga0395900_0359565 | 3300037418 | Bacteria | 1427 |
| 815 | Ga0395898_0167266 | 3300037466 | Bacteria | 2102 |
| 816 | Ga0395898_0368686 | 3300037466 | Bacteria | 1369 |
| 817 | Ga0395905_0229337 | 3300037471 | Bacteria | 1737 |
| 818 | Ga0316581_0035288 | 3300037588 | Bacteria | 1515 |
| 819 | Ga0395901_0642429 | 3300038443 | Bacteria | 1065 |
| 820 | Ga0395901_1003615 | 3300038443 | Bacteria | 810 |
| 821 | Ga0395901_1886488 | 3300038443 | Bacteria | 545 |
| 822 | Ga0436365_1037676 | 3300039437 | Bacteria | 170132 |
| 823 | Ga0436361_0079908 | 3300039447 | Bacteria | 734 |
| 824 | Ga0436361_1010587 | 3300039447 | Bacteria | 1135 |
| 825 | Ga0436363_0982124 | 3300039450 | Bacteria | 763 |
| 826 | Ga0439436_0000336 | 3300041404 | Bacteria | 11576 |
| 827 | Ga0439436_0002994 | 3300041404 | Bacteria | 5123 |
| 828 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 829 | Ga0439438_001188 | 3300041405 | Bacteria | 11568 |
| 830 | Ga0439438_001930 | 3300041405 | Bacteria | 9046 |
| 831 | Ga0439438_008658 | 3300041405 | Bacteria | 3351 |
| 832 | Ga0439438_034767 | 3300041405 | Bacteria | 1326 |
| 833 | Ga0439439_0003042 | 3300041406 | Bacteria | 3653 |
| 834 | Ga0439439_0014282 | 3300041406 | Bacteria | 1933 |
| 835 | Ga0439447_004155 | 3300041407 | Bacteria | 5030 |
| 836 | Ga0439447_005376 | 3300041407 | Bacteria | 4267 |
| 837 | Ga0439447_028060 | 3300041407 | Bacteria | 1432 |
| 838 | Ga0439461_0065771 | 3300041410 | Bacteria | 831 |
| 839 | Ga0439466_0000003 | 3300041411 | Bacteria | 486229 |
| 840 | Ga0439466_0058052 | 3300041411 | Bacteria | 1252 |
| 841 | Ga0439466_0218156 | 3300041411 | Bacteria | 579 |
| 842 | Ga0439465_0000517 | 3300041413 | Bacteria | 11531 |
| 843 | Ga0451791_0103488 | 3300041451 | Bacteria | 558 |
| 844 | Ga0451791_0972312 | 3300041451 | Bacteria | 1330 |
| 845 | Ga0451793_1583412 | 3300041452 | Bacteria | 765 |
| 846 | Ga0451795_0579443 | 3300041456 | Bacteria | 879 |
| 847 | Ga0451802_0881816 | 3300041460 | Bacteria | 593 |
| 848 | Ga0451805_033409 | 3300041461 | Bacteria | 697 |
| 849 | Ga0451847_0790351 | 3300041503 | Bacteria | 938 |
| 850 | Ga0451853_2599509 | 3300041512 | Bacteria | 1805 |
| 851 | Ga0451853_3098869 | 3300041512 | Bacteria | 957 |
| 852 | Ga0439431_0002606 | 3300041997 | Bacteria | 3980 |
| 853 | Ga0439431_0276272 | 3300041997 | Bacteria | 502 |
| 854 | Ga0439433_0024432 | 3300041999 | Bacteria | 1361 |
| 855 | Ga0439433_0038479 | 3300041999 | Bacteria | 1109 |
| 856 | Ga0439442_002961 | 3300042002 | Bacteria | 3345 |
| 857 | Ga0439445_0000347 | 3300042004 | Bacteria | 9147 |
| 858 | Ga0439445_0003104 | 3300042004 | Bacteria | 3723 |
| 859 | Ga0439445_0200499 | 3300042004 | Bacteria | 589 |
| 860 | Ga0439448_0244134 | 3300042005 | Bacteria | 633 |
| 861 | Ga0439432_000662 | 3300042006 | Bacteria | 12859 |
| 862 | Ga0439432_008144 | 3300042006 | Bacteria | 3689 |
| 863 | Ga0439432_010037 | 3300042006 | Bacteria | 3292 |
| 864 | Ga0439432_010592 | 3300042006 | Bacteria | 3187 |
| 865 | Ga0439432_014689 | 3300042006 | Bacteria | 2649 |
| 866 | Ga0439432_125770 | 3300042006 | Bacteria | 758 |
| 867 | Ga0439432_201852 | 3300042006 | Bacteria | 576 |
| 868 | Ga0439449_0000838 | 3300042007 | Bacteria | 11916 |
| 869 | Ga0439449_0009132 | 3300042007 | Bacteria | 3758 |
| 870 | Ga0439449_0184117 | 3300042007 | Bacteria | 781 |
| 871 | Ga0439451_047755 | 3300042009 | Bacteria | 857 |
| 872 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 873 | Ga0439452_000003 | 3300042010 | Bacteria | 942815 |
| 874 | Ga0439452_000006 | 3300042010 | Bacteria | 645083 |
| 875 | Ga0439452_000008 | 3300042010 | Bacteria | 569877 |
| 876 | Ga0439452_000161 | 3300042010 | Bacteria | 49828 |
| 877 | Ga0439452_000216 | 3300042010 | Bacteria | 40719 |
| 878 | Ga0439452_000949 | 3300042010 | Bacteria | 13024 |
| 879 | Ga0439452_002479 | 3300042010 | Bacteria | 6788 |
| 880 | Ga0439457_011278 | 3300042014 | Bacteria | 2036 |
| 881 | Ga0439462_0000328 | 3300042015 | Bacteria | 8874 |
| 882 | Ga0439462_0002574 | 3300042015 | Bacteria | 4232 |
| 883 | Ga0439463_006410 | 3300042016 | Bacteria | 2920 |
| 884 | Ga0450911_000124 | 3300042115 | Bacteria | 30673 |
| 885 | Ga0450922_001261 | 3300042124 | Bacteria | 2509 |
| 886 | Ga0450922_004419 | 3300042124 | Bacteria | 1291 |
| 887 | Ga0450923_000221 | 3300042125 | Bacteria | 5506 |
| 888 | Ga0450923_013904 | 3300042125 | Bacteria | 1485 |
| 889 | Ga0450890_007058 | 3300042127 | Bacteria | 1432 |
| 890 | Ga0450894_010619 | 3300042131 | Bacteria | 1195 |
| 891 | Ga0450898_012816 | 3300042134 | Bacteria | 1390 |
| 892 | Ga0450900_017373 | 3300042136 | Bacteria | 981 |
| 893 | Ga0450902_019005 | 3300042137 | Bacteria | 1129 |
| 894 | Ga0450907_000329 | 3300042146 | Bacteria | 15006 |
| 895 | Ga0439446_0014658 | 3300042156 | Bacteria | 2166 |
| 896 | Ga0439446_0176825 | 3300042156 | Bacteria | 712 |
| 897 | Ga0450909_012251 | 3300042185 | Bacteria | 1257 |
| 898 | Ga0450909_015394 | 3300042185 | Bacteria | 1129 |
| 899 | Ga0439434_0002221 | 3300042435 | Bacteria | 5634 |
| 900 | Ga0439434_0086096 | 3300042435 | Bacteria | 1001 |
| 901 | Ga0439464_0000625 | 3300042439 | Bacteria | 7504 |
| 902 | Ga0439464_0003541 | 3300042439 | Bacteria | 3949 |
| 903 | Ga0439464_0019306 | 3300042439 | Bacteria | 1860 |
| 904 | Ga0439464_0044551 | 3300042439 | Bacteria | 1271 |
| 905 | Ga0450893_0003283 | 3300042532 | Bacteria | 2545 |
| 906 | Ga0450893_0004785 | 3300042532 | Bacteria | 2161 |
| 907 | Ga0450893_0039760 | 3300042532 | Bacteria | 859 |
| 908 | Ga0451577_0014209 | 3300042876 | Bacteria | 7423 |
| 909 | Ga0451577_0025812 | 3300042876 | Bacteria | 5327 |
| 910 | Ga0451577_0118887 | 3300042876 | Bacteria | 2367 |
| 911 | Ga0451577_1176457 | 3300042876 | Unclassified | 684 |
| 912 | Ga0466977_0000007 | 3300044666 | Bacteria | 32886 |
| 913 | Ga0466981_0000016 | 3300044669 | Bacteria | 100013 |
| 914 | Ga0453683_0504451 | 3300044673 | Bacteria | 785 |
| 915 | Ga0466961_0023977 | 3300044693 | Bacteria | 3925 |
| 916 | Ga0453684_0000917 | 3300044712 | Bacteria | 97990 |
| 917 | Ga0453684_0014200 | 3300044712 | Bacteria | 12785 |
| 918 | Ga0453684_0693932 | 3300044712 | Bacteria | 1107 |
| 919 | Ga0453684_1211732 | 3300044712 | Bacteria | 792 |
| 920 | Ga0466970_0209074 | 3300044765 | Bacteria | 1087 |
| 921 | Ga0466960_0037103 | 3300044901 | Bacteria | 2285 |
| 922 | Ga0451576_0252121 | 3300045051 | Bacteria | 1845 |
| 923 | Ga0495617_012114 | 3300046452 | Bacteria | 2940 |
| 924 | Ga0495617_031455 | 3300046452 | Bacteria | 1782 |
| 925 | Ga0495627_000027 | 3300046453 | Bacteria | 236960 |
| 926 | Ga0495627_073184 | 3300046453 | Bacteria | 999 |
| 927 | Ga0495627_162336 | 3300046453 | Bacteria | 621 |
| 928 | Ga0495592_0016839 | 3300046454 | Bacteria | 5551 |
| 929 | Ga0495592_0206827 | 3300046454 | Bacteria | 1321 |
| 930 | Ga0495591_000014 | 3300046458 | Bacteria | 254281 |
| 931 | Ga0495591_000238 | 3300046458 | Bacteria | 52890 |
| 932 | Ga0495591_002770 | 3300046458 | Bacteria | 9466 |
| 933 | Ga0495591_005174 | 3300046458 | Bacteria | 6112 |
| 934 | Ga0495591_084621 | 3300046458 | Bacteria | 804 |
| 935 | Ga0495638_0002381 | 3300046460 | Bacteria | 15407 |
| 936 | Ga0495638_0013990 | 3300046460 | Bacteria | 5441 |
| 937 | Ga0495651_0005777 | 3300046462 | Bacteria | 9440 |
| 938 | Ga0495651_0414476 | 3300046462 | Bacteria | 877 |
| 939 | Ga0495653_0198914 | 3300046463 | Bacteria | 1361 |
| 940 | Ga0495650_0000002 | 3300046471 | Bacteria | 1057165 |
| 941 | Ga0495650_0000021 | 3300046471 | Bacteria | 531242 |
| 942 | Ga0495650_0000032 | 3300046471 | Bacteria | 425389 |
| 943 | Ga0495650_0000396 | 3300046471 | Bacteria | 73012 |
| 944 | Ga0495650_0000478 | 3300046471 | Bacteria | 61296 |
| 945 | Ga0495605_0004250 | 3300046474 | Bacteria | 8440 |
| 946 | Ga0495605_0004747 | 3300046474 | Bacteria | 7945 |
| 947 | Ga0495605_0033547 | 3300046474 | Bacteria | 2604 |
| 948 | Ga0495605_0073615 | 3300046474 | Bacteria | 1609 |
| 949 | Ga0495605_0127430 | 3300046474 | Bacteria | 1150 |
| 950 | Ga0495639_0006891 | 3300046475 | Bacteria | 4880 |
| 951 | Ga0495584_0006445 | 3300046491 | Bacteria | 6141 |
| 952 | Ga0495584_0034114 | 3300046491 | Bacteria | 2575 |
| 953 | Ga0495585_0004620 | 3300046492 | Bacteria | 8890 |
| 954 | Ga0495594_0007426 | 3300046499 | Bacteria | 5639 |
| 955 | Ga0495596_0000001 | 3300046500 | Bacteria | 501331 |
| 956 | Ga0495596_0000366 | 3300046500 | Bacteria | 29053 |
| 957 | Ga0495596_0045021 | 3300046500 | Bacteria | 1735 |
| 958 | Ga0495607_0000175 | 3300046501 | Bacteria | 68131 |
| 959 | Ga0495607_0007488 | 3300046501 | Bacteria | 7547 |
| 960 | Ga0495607_0009243 | 3300046501 | Bacteria | 6695 |
| 961 | Ga0495607_0178868 | 3300046501 | Bacteria | 1065 |
| 962 | Ga0495606_0001314 | 3300046507 | Bacteria | 34190 |
| 963 | Ga0495606_0231995 | 3300046507 | Bacteria | 1034 |
| 964 | Ga0495608_0006970 | 3300046511 | Bacteria | 7999 |
| 965 | Ga0495610_0000002 | 3300046512 | Bacteria | 1282131 |
| 966 | Ga0495610_0001226 | 3300046512 | Bacteria | 23065 |
| 967 | Ga0495610_0029233 | 3300046512 | Bacteria | 2905 |
| 968 | Ga0495616_0001943 | 3300046513 | Bacteria | 13903 |
| 969 | Ga0495616_0002001 | 3300046513 | Bacteria | 13713 |
| 970 | Ga0495616_0086880 | 3300046513 | Bacteria | 1487 |
| 971 | Ga0495618_0012760 | 3300046514 | Bacteria | 5107 |
| 972 | Ga0495618_0028883 | 3300046514 | Bacteria | 3458 |
| 973 | Ga0495618_0106009 | 3300046514 | Bacteria | 1799 |
| 974 | Ga0495620_0003066 | 3300046515 | Bacteria | 9591 |
| 975 | Ga0495620_0141600 | 3300046515 | Bacteria | 940 |
| 976 | Ga0495620_0145922 | 3300046515 | Bacteria | 924 |
| 977 | Ga0495620_0147396 | 3300046515 | Bacteria | 918 |
| 978 | Ga0495628_0000059 | 3300046516 | Bacteria | 87291 |
| 979 | Ga0495628_0006630 | 3300046516 | Bacteria | 10098 |
| 980 | Ga0495628_0295816 | 3300046516 | Bacteria | 1199 |
| 981 | Ga0495628_0548866 | 3300046516 | Bacteria | 830 |
| 982 | Ga0495630_0123685 | 3300046517 | Bacteria | 1963 |
| 983 | Ga0495631_0000414 | 3300046518 | Bacteria | 29474 |
| 984 | Ga0495632_0007880 | 3300046519 | Bacteria | 6619 |
| 985 | Ga0495632_0011349 | 3300046519 | Bacteria | 5201 |
| 986 | Ga0495632_0131606 | 3300046519 | Bacteria | 1164 |
| 987 | Ga0495632_0354786 | 3300046519 | Bacteria | 644 |
| 988 | Ga0495637_0000005 | 3300046520 | Bacteria | 447799 |
| 989 | Ga0495637_0031616 | 3300046520 | Bacteria | 2339 |
| 990 | Ga0495643_0000002 | 3300046522 | Bacteria | 1131278 |
| 991 | Ga0495643_0019114 | 3300046522 | Bacteria | 3967 |
| 992 | Ga0495643_0022631 | 3300046522 | Bacteria | 3584 |
| 993 | Ga0495643_0025319 | 3300046522 | Bacteria | 3358 |
| 994 | Ga0495643_0028334 | 3300046522 | Bacteria | 3141 |
| 995 | Ga0495643_0081546 | 3300046522 | Bacteria | 1682 |
| 996 | Ga0495644_0002242 | 3300046523 | Bacteria | 7732 |
| 997 | Ga0495648_0000299 | 3300046524 | Bacteria | 55022 |
| 998 | Ga0495648_0006462 | 3300046524 | Bacteria | 9563 |
| 999 | Ga0495648_0021944 | 3300046524 | Bacteria | 4410 |
| 1000 | Ga0495663_0142351 | 3300046525 | Bacteria | 814 |
| 1001 | Ga0495666_0001981 | 3300046526 | Bacteria | 10110 |
| 1002 | Ga0495666_0035617 | 3300046526 | Bacteria | 2426 |
| 1003 | Ga0495666_0499409 | 3300046526 | Bacteria | 544 |
| 1004 | Ga0495652_0004625 | 3300046529 | Bacteria | 13120 |
| 1005 | Ga0495652_0035985 | 3300046529 | Bacteria | 4306 |
| 1006 | Ga0495654_0000019 | 3300046530 | Bacteria | 289483 |
| 1007 | Ga0495654_0001152 | 3300046530 | Bacteria | 18924 |
| 1008 | Ga0495654_0002661 | 3300046530 | Bacteria | 11346 |
| 1009 | Ga0495654_0008751 | 3300046530 | Bacteria | 5572 |
| 1010 | Ga0495654_0011360 | 3300046530 | Bacteria | 4821 |
| 1011 | Ga0495654_0053428 | 3300046530 | Bacteria | 1963 |
| 1012 | Ga0495654_0054888 | 3300046530 | Bacteria | 1930 |
| 1013 | Ga0495654_0082084 | 3300046530 | Bacteria | 1509 |
| 1014 | Ga0495654_0183630 | 3300046530 | Bacteria | 904 |
| 1015 | Ga0495586_0097772 | 3300046535 | Bacteria | 1627 |
| 1016 | Ga0495587_0823400 | 3300046536 | Bacteria | 506 |
| 1017 | Ga0495609_0010849 | 3300046538 | Bacteria | 4352 |
| 1018 | Ga0495621_0004439 | 3300046539 | Bacteria | 3945 |
| 1019 | Ga0495597_0000015 | 3300046542 | Bacteria | 172952 |
| 1020 | Ga0495597_0000720 | 3300046542 | Bacteria | 26410 |
| 1021 | Ga0495597_0001359 | 3300046542 | Bacteria | 17738 |
| 1022 | Ga0495597_0020433 | 3300046542 | Bacteria | 3085 |
| 1023 | Ga0495645_0054792 | 3300046543 | Bacteria | 2896 |
| 1024 | Ga0495645_0181366 | 3300046543 | Bacteria | 1442 |
| 1025 | Ga0495622_0013458 | 3300046557 | Bacteria | 3795 |
| 1026 | Ga0495656_0005434 | 3300046615 | Bacteria | 4401 |
| 1027 | Ga0495656_0007291 | 3300046615 | Bacteria | 3903 |
| 1028 | Ga0495668_0053240 | 3300046616 | Bacteria | 2238 |
| 1029 | Ga0495634_0069678 | 3300046642 | Bacteria | 2320 |
| 1030 | Ga0495611_0035919 | 3300046648 | Bacteria | 2197 |
| 1031 | Ga0495611_0401145 | 3300046648 | Bacteria | 627 |
| 1032 | Ga0495625_0004458 | 3300046660 | Bacteria | 13233 |
| 1033 | Ga0495625_0005285 | 3300046660 | Bacteria | 11849 |
| 1034 | Ga0495625_0014435 | 3300046660 | Bacteria | 6304 |
| 1035 | Ga0495635_0083588 | 3300046663 | Bacteria | 2185 |
| 1036 | Ga0495635_0172144 | 3300046663 | Bacteria | 1472 |
| 1037 | Ga0495661_0009993 | 3300046665 | Bacteria | 6487 |
| 1038 | Ga0495588_0000437 | 3300046674 | Bacteria | 21337 |
| 1039 | Ga0495657_0043991 | 3300046675 | Bacteria | 3041 |
| 1040 | Ga0495599_0003585 | 3300046678 | Bacteria | 9102 |
| 1041 | Ga0495623_0003538 | 3300046679 | Bacteria | 10338 |
| 1042 | Ga0495646_0002246 | 3300046680 | Bacteria | 11800 |
| 1043 | Ga0495646_0014471 | 3300046680 | Bacteria | 5017 |
| 1044 | Ga0495646_0441126 | 3300046680 | Bacteria | 673 |
| 1045 | Ga0495647_0067036 | 3300046681 | Bacteria | 1429 |
| 1046 | Ga0495658_0042769 | 3300046683 | Bacteria | 2531 |
| 1047 | Ga0495669_0147709 | 3300046684 | Bacteria | 1112 |
| 1048 | Ga0495613_0714846 | 3300046689 | Bacteria | 659 |
| 1049 | Ga0495624_0008986 | 3300046690 | Bacteria | 6944 |
| 1050 | Ga0495624_0020855 | 3300046690 | Bacteria | 4354 |
| 1051 | Ga0495624_0255279 | 3300046690 | Bacteria | 1060 |
| 1052 | Ga0495670_0016534 | 3300046691 | Bacteria | 3627 |
| 1053 | Ga0495670_0016868 | 3300046691 | Bacteria | 3590 |
| 1054 | Ga0495671_0001044 | 3300046692 | Bacteria | 19266 |
| 1055 | Ga0495671_0001269 | 3300046692 | Bacteria | 17216 |
| 1056 | Ga0495671_0008856 | 3300046692 | Bacteria | 5651 |
| 1057 | Ga0495671_0258152 | 3300046692 | Bacteria | 841 |
| 1058 | Ga0495649_0013339 | 3300046694 | Bacteria | 4742 |
| 1059 | Ga0495649_0014855 | 3300046694 | Bacteria | 4449 |
| 1060 | Ga0495649_0042287 | 3300046694 | Bacteria | 2490 |
| 1061 | Ga0495649_0107137 | 3300046694 | Bacteria | 1483 |
| 1062 | Ga0495589_0000001 | 3300046794 | Bacteria | 888100 |
| 1063 | Ga0495589_0039635 | 3300046794 | Bacteria | 2354 |
| 1064 | Ga0495589_0052967 | 3300046794 | Bacteria | 2003 |
| 1065 | Ga0495600_0003774 | 3300046809 | Bacteria | 8965 |
| 1066 | Ga0495600_0511904 | 3300046809 | Bacteria | 736 |
| 1067 | Ga0495600_0682364 | 3300046809 | Bacteria | 619 |
| 1068 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 1069 | Ga0495660_0000021 | 3300046810 | Bacteria | 293250 |
| 1070 | Ga0495660_0006528 | 3300046810 | Bacteria | 6890 |
| 1071 | Ga0495660_0037106 | 3300046810 | Bacteria | 2716 |
| 1072 | Ga0495604_0001830 | 3300047317 | Bacteria | 17320 |
| 1073 | Ga0495604_0014340 | 3300047317 | Bacteria | 6321 |
| 1074 | Ga0495604_0391285 | 3300047317 | Bacteria | 917 |
| 1075 | Ga0495636_0010570 | 3300047318 | Bacteria | 3647 |
| 1076 | Ga0495672_0000002 | 3300047320 | Bacteria | 740116 |
| 1077 | Ga0495672_0000012 | 3300047320 | Bacteria | 519975 |
| 1078 | Ga0495672_0000020 | 3300047320 | Bacteria | 432845 |
| 1079 | Ga0495672_0024648 | 3300047320 | Bacteria | 3871 |
| 1080 | Ga0495672_0215417 | 3300047320 | Bacteria | 951 |
| 1081 | Ga0495676_0008592 | 3300047321 | Bacteria | 9354 |
| 1082 | Ga0495683_0020678 | 3300047323 | Bacteria | 3393 |
| 1083 | Ga0495677_0413493 | 3300047445 | Bacteria | 534 |
| 1084 | Ga0495679_000020 | 3300047446 | Bacteria | 228413 |
| 1085 | Ga0495679_002132 | 3300047446 | Bacteria | 10405 |
| 1086 | Ga0495679_002328 | 3300047446 | Bacteria | 9757 |
| 1087 | Ga0495679_047995 | 3300047446 | Bacteria | 1293 |
| 1088 | Ga0495685_004966 | 3300047447 | Bacteria | 4325 |
| 1089 | Ga0495673_0000065 | 3300047469 | Bacteria | 222481 |
| 1090 | Ga0495673_0000081 | 3300047469 | Bacteria | 199943 |
| 1091 | Ga0495681_0000088 | 3300047470 | Bacteria | 79878 |
| 1092 | Ga0495681_0000426 | 3300047470 | Bacteria | 32387 |
| 1093 | Ga0495686_0060309 | 3300047472 | Bacteria | 2358 |
| 1094 | Ga0495593_0034149 | 3300047673 | Bacteria | 2767 |
| 1095 | Ga0495593_0487597 | 3300047673 | Bacteria | 618 |
| 1096 | Ga0495602_0012279 | 3300048088 | Bacteria | 8815 |
| 1097 | Ga0495602_0147112 | 3300048088 | Bacteria | 1857 |
| 1098 | Ga0495602_0375023 | 3300048088 | Bacteria | 1020 |
| 1099 | Ga0495614_0004433 | 3300048089 | Bacteria | 6329 |
| 1100 | Ga0495626_0000001 | 3300048091 | Bacteria | 1077129 |
| 1101 | Ga0496100_0006740 | 3300048903 | Bacteria | 6288 |
| 1102 | Ga0496100_0013256 | 3300048903 | Bacteria | 4747 |
| 1103 | Ga0496100_0028570 | 3300048903 | Bacteria | 3441 |
| 1104 | Ga0496100_0125278 | 3300048903 | Bacteria | 1802 |
| 1105 | Ga0496100_1483057 | 3300048903 | Bacteria | 536 |
| 1106 | Ga0496101_0000314 | 3300048904 | Bacteria | 33586 |
| 1107 | Ga0496101_0025960 | 3300048904 | Bacteria | 4069 |
| 1108 | Ga0496101_0203711 | 3300048904 | Bacteria | 1530 |
| 1109 | Ga0496101_0383973 | 3300048904 | Bacteria | 1105 |
| 1110 | Ga0496101_0592517 | 3300048904 | Bacteria | 876 |
| 1111 | Ga0496101_0927755 | 3300048904 | Bacteria | 685 |
| 1112 | Ga0496101_1288540 | 3300048904 | Bacteria | 571 |
| 1113 | Ga0496102_0005511 | 3300048905 | Bacteria | 10747 |
| 1114 | Ga0496102_0108549 | 3300048905 | Bacteria | 2585 |
| 1115 | Ga0496102_0266586 | 3300048905 | Bacteria | 1615 |
| 1116 | Ga0496102_0493239 | 3300048905 | Bacteria | 1146 |
| 1117 | Ga0496103_0092134 | 3300048906 | Bacteria | 1913 |
| 1118 | Ga0496103_0172794 | 3300048906 | Bacteria | 1388 |
| 1119 | Ga0496103_0646170 | 3300048906 | Bacteria | 672 |
| 1120 | Ga0496104_0000893 | 3300048907 | Bacteria | 25662 |
| 1121 | Ga0496104_0001151 | 3300048907 | Bacteria | 22641 |
| 1122 | Ga0496104_0452682 | 3300048907 | Bacteria | 1195 |
| 1123 | Ga0496104_1047988 | 3300048907 | Bacteria | 719 |
| 1124 | Ga0496104_1632241 | 3300048907 | Bacteria | 547 |
| 1125 | Ga0496105_0001685 | 3300048908 | Bacteria | 15768 |
| 1126 | Ga0496105_0019956 | 3300048908 | Bacteria | 5409 |
| 1127 | Ga0496105_0118704 | 3300048908 | Bacteria | 2182 |
| 1128 | Ga0496105_0157490 | 3300048908 | Bacteria | 1865 |
| 1129 | Ga0496106_0048665 | 3300048909 | Bacteria | 3193 |
| 1130 | Ga0496106_1184926 | 3300048909 | Bacteria | 596 |
| 1131 | Ga0496107_0257645 | 3300048910 | Bacteria | 1298 |
| 1132 | Ga0496107_0700337 | 3300048910 | Bacteria | 745 |
| 1133 | Ga0496108_0059934 | 3300048911 | Bacteria | 3201 |
| 1134 | Ga0496109_0078498 | 3300048912 | Bacteria | 3040 |
| 1135 | Ga0496110_0306314 | 3300048913 | Bacteria | 1447 |
| 1136 | Ga0496110_1212553 | 3300048913 | Bacteria | 663 |
| 1137 | Ga0496110_1303227 | 3300048913 | Bacteria | 635 |
| 1138 | Ga0496113_0110179 | 3300048916 | Bacteria | 2142 |
| 1139 | Ga0496113_0182493 | 3300048916 | Bacteria | 1664 |
| 1140 | Ga0496113_0747444 | 3300048916 | Bacteria | 779 |
| 1141 | Ga0496114_0634583 | 3300048917 | Bacteria | 940 |
| 1142 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 1143 | Ga0496116_0000094 | 3300048919 | Bacteria | 205588 |
| 1144 | Ga0496116_0000261 | 3300048919 | Bacteria | 92108 |
| 1145 | Ga0496116_0000431 | 3300048919 | Bacteria | 58709 |
| 1146 | Ga0496116_0000679 | 3300048919 | Bacteria | 44214 |
| 1147 | Ga0496116_0000738 | 3300048919 | Bacteria | 41713 |
| 1148 | Ga0496116_0000930 | 3300048919 | Bacteria | 36114 |
| 1149 | Ga0496116_0002175 | 3300048919 | Bacteria | 20873 |
| 1150 | Ga0496116_0005086 | 3300048919 | Bacteria | 12360 |
| 1151 | Ga0496116_0007904 | 3300048919 | Bacteria | 9324 |
| 1152 | Ga0496116_0011708 | 3300048919 | Bacteria | 7228 |
| 1153 | Ga0496116_0015751 | 3300048919 | Bacteria | 5958 |
| 1154 | Ga0496116_0017298 | 3300048919 | Bacteria | 5603 |
| 1155 | Ga0496116_0018592 | 3300048919 | Bacteria | 5349 |
| 1156 | Ga0496116_0023072 | 3300048919 | Bacteria | 4643 |
| 1157 | Ga0496116_0035310 | 3300048919 | Bacteria | 3512 |
| 1158 | Ga0496116_0084036 | 3300048919 | Bacteria | 1962 |
| 1159 | Ga0496116_0088658 | 3300048919 | Bacteria | 1889 |
| 1160 | Ga0496116_0125206 | 3300048919 | Bacteria | 1477 |
| 1161 | Ga0496116_0166367 | 3300048919 | Bacteria | 1202 |
| 1162 | Ga0496116_0270833 | 3300048919 | Bacteria | 830 |
| 1163 | Ga0496117_0000004 | 3300048920 | Bacteria | 877131 |
| 1164 | Ga0496117_0000213 | 3300048920 | Bacteria | 111751 |
| 1165 | Ga0496117_0001414 | 3300048920 | Bacteria | 34795 |
| 1166 | Ga0496117_0002234 | 3300048920 | Bacteria | 24995 |
| 1167 | Ga0496117_0002320 | 3300048920 | Bacteria | 24384 |
| 1168 | Ga0496117_0003205 | 3300048920 | Bacteria | 19351 |
| 1169 | Ga0496117_0007415 | 3300048920 | Bacteria | 10724 |
| 1170 | Ga0496117_0008133 | 3300048920 | Bacteria | 10024 |
| 1171 | Ga0496117_0009227 | 3300048920 | Bacteria | 9224 |
| 1172 | Ga0496117_0010043 | 3300048920 | Bacteria | 8696 |
| 1173 | Ga0496117_0012413 | 3300048920 | Bacteria | 7511 |
| 1174 | Ga0496117_0015407 | 3300048920 | Bacteria | 6520 |
| 1175 | Ga0496117_0035442 | 3300048920 | Bacteria | 3745 |
| 1176 | Ga0496117_0035885 | 3300048920 | Bacteria | 3716 |
| 1177 | Ga0496117_0039172 | 3300048920 | Bacteria | 3501 |
| 1178 | Ga0496117_0044550 | 3300048920 | Bacteria | 3213 |
| 1179 | Ga0496117_0046718 | 3300048920 | Bacteria | 3112 |
| 1180 | Ga0496117_0063088 | 3300048920 | Bacteria | 2534 |
| 1181 | Ga0496117_0086922 | 3300048920 | Bacteria | 2029 |
| 1182 | Ga0496117_0124537 | 3300048920 | Bacteria | 1576 |
| 1183 | Ga0496117_0147540 | 3300048920 | Bacteria | 1397 |
| 1184 | Ga0496118_0000072 | 3300048921 | Bacteria | 201387 |
| 1185 | Ga0496118_0000137 | 3300048921 | Bacteria | 129477 |
| 1186 | Ga0496118_0001157 | 3300048921 | Bacteria | 40657 |
| 1187 | Ga0496118_0002508 | 3300048921 | Bacteria | 24634 |
| 1188 | Ga0496118_0003626 | 3300048921 | Bacteria | 19165 |
| 1189 | Ga0496118_0003664 | 3300048921 | Bacteria | 19077 |
| 1190 | Ga0496118_0008346 | 3300048921 | Bacteria | 10724 |
| 1191 | Ga0496118_0008657 | 3300048921 | Bacteria | 10466 |
| 1192 | Ga0496118_0022858 | 3300048921 | Bacteria | 5452 |
| 1193 | Ga0496118_0023065 | 3300048921 | Bacteria | 5418 |
| 1194 | Ga0496118_0031286 | 3300048921 | Bacteria | 4414 |
| 1195 | Ga0496118_0031499 | 3300048921 | Bacteria | 4394 |
| 1196 | Ga0496118_0045544 | 3300048921 | Bacteria | 3422 |
| 1197 | Ga0496118_0117588 | 3300048921 | Bacteria | 1743 |
| 1198 | Ga0496118_0236351 | 3300048921 | Bacteria | 1050 |
| 1199 | Ga0496118_0330465 | 3300048921 | Bacteria | 822 |
| 1200 | Ga0496119_0000008 | 3300048922 | Bacteria | 446822 |
| 1201 | Ga0496119_0000080 | 3300048922 | Bacteria | 139962 |
| 1202 | Ga0496119_0000156 | 3300048922 | Bacteria | 94640 |
| 1203 | Ga0496119_0000677 | 3300048922 | Bacteria | 45578 |
| 1204 | Ga0496119_0002331 | 3300048922 | Bacteria | 20914 |
| 1205 | Ga0496119_0002686 | 3300048922 | Bacteria | 19209 |
| 1206 | Ga0496119_0004122 | 3300048922 | Bacteria | 14639 |
| 1207 | Ga0496119_0004498 | 3300048922 | Bacteria | 13851 |
| 1208 | Ga0496119_0005466 | 3300048922 | Bacteria | 12159 |
| 1209 | Ga0496119_0007741 | 3300048922 | Bacteria | 9594 |
| 1210 | Ga0496119_0019148 | 3300048922 | Bacteria | 5057 |
| 1211 | Ga0496119_0019675 | 3300048922 | Bacteria | 4958 |
| 1212 | Ga0496119_0034475 | 3300048922 | Bacteria | 3332 |
| 1213 | Ga0496119_0242819 | 3300048922 | Bacteria | 911 |
| 1214 | Ga0496119_0246500 | 3300048922 | Bacteria | 903 |
| 1215 | Ga0496120_0000035 | 3300048923 | Bacteria | 213992 |
| 1216 | Ga0496120_0000040 | 3300048923 | Bacteria | 201554 |
| 1217 | Ga0496120_0000075 | 3300048923 | Bacteria | 163540 |
| 1218 | Ga0496120_0000128 | 3300048923 | Bacteria | 127855 |
| 1219 | Ga0496120_0000302 | 3300048923 | Bacteria | 82387 |
| 1220 | Ga0496120_0000477 | 3300048923 | Bacteria | 62911 |
| 1221 | Ga0496120_0002786 | 3300048923 | Bacteria | 16967 |
| 1222 | Ga0496120_0003693 | 3300048923 | Bacteria | 13654 |
| 1223 | Ga0496120_0003747 | 3300048923 | Bacteria | 13471 |
| 1224 | Ga0496120_0003837 | 3300048923 | Bacteria | 13206 |
| 1225 | Ga0496120_0005107 | 3300048923 | Bacteria | 10610 |
| 1226 | Ga0496120_0006986 | 3300048923 | Bacteria | 8500 |
| 1227 | Ga0496120_0035747 | 3300048923 | Bacteria | 2963 |
| 1228 | Ga0496120_0043456 | 3300048923 | Bacteria | 2617 |
| 1229 | Ga0496120_0073631 | 3300048923 | Bacteria | 1868 |
| 1230 | Ga0496121_0000047 | 3300048924 | Bacteria | 335768 |
| 1231 | Ga0496121_0000124 | 3300048924 | Bacteria | 170427 |
| 1232 | Ga0496121_0001134 | 3300048924 | Bacteria | 46801 |
| 1233 | Ga0496121_0002661 | 3300048924 | Bacteria | 26786 |
| 1234 | Ga0496121_0002930 | 3300048924 | Bacteria | 24980 |
| 1235 | Ga0496121_0003880 | 3300048924 | Bacteria | 20785 |
| 1236 | Ga0496121_0007669 | 3300048924 | Bacteria | 12962 |
| 1237 | Ga0496121_0010355 | 3300048924 | Bacteria | 10532 |
| 1238 | Ga0496121_0015160 | 3300048924 | Bacteria | 8106 |
| 1239 | Ga0496121_0015971 | 3300048924 | Bacteria | 7790 |
| 1240 | Ga0496121_0035885 | 3300048924 | Bacteria | 4430 |
| 1241 | Ga0496121_0038890 | 3300048924 | Bacteria | 4202 |
| 1242 | Ga0496121_0041514 | 3300048924 | Bacteria | 4019 |
| 1243 | Ga0496121_0052914 | 3300048924 | Bacteria | 3404 |
| 1244 | Ga0496121_0056690 | 3300048924 | Bacteria | 3252 |
| 1245 | Ga0496122_0000007 | 3300048925 | Bacteria | 606493 |
| 1246 | Ga0496122_0000033 | 3300048925 | Bacteria | 324104 |
| 1247 | Ga0496122_0000130 | 3300048925 | Bacteria | 173330 |
| 1248 | Ga0496122_0000356 | 3300048925 | Bacteria | 98548 |
| 1249 | Ga0496122_0001024 | 3300048925 | Bacteria | 49397 |
| 1250 | Ga0496122_0001367 | 3300048925 | Bacteria | 39674 |
| 1251 | Ga0496122_0001535 | 3300048925 | Bacteria | 36726 |
| 1252 | Ga0496122_0004005 | 3300048925 | Bacteria | 18773 |
| 1253 | Ga0496122_0004980 | 3300048925 | Bacteria | 16068 |
| 1254 | Ga0496122_0006622 | 3300048925 | Bacteria | 13213 |
| 1255 | Ga0496122_0007333 | 3300048925 | Bacteria | 12306 |
| 1256 | Ga0496122_0012310 | 3300048925 | Bacteria | 8538 |
| 1257 | Ga0496122_0018241 | 3300048925 | Bacteria | 6498 |
| 1258 | Ga0496122_0035075 | 3300048925 | Bacteria | 4092 |
| 1259 | Ga0496122_0052511 | 3300048925 | Bacteria | 3084 |
| 1260 | Ga0496122_0053063 | 3300048925 | Bacteria | 3060 |
| 1261 | Ga0496122_0063042 | 3300048925 | Bacteria | 2709 |
| 1262 | Ga0496122_0067614 | 3300048925 | Bacteria | 2572 |
| 1263 | Ga0496122_0067953 | 3300048925 | Bacteria | 2562 |
| 1264 | Ga0496122_0085176 | 3300048925 | Bacteria | 2182 |
| 1265 | Ga0496122_0089083 | 3300048925 | Bacteria | 2111 |
| 1266 | Ga0496122_0126517 | 3300048925 | Bacteria | 1634 |
| 1267 | Ga0496122_0137705 | 3300048925 | Bacteria | 1534 |
| 1268 | Ga0496122_0142086 | 3300048925 | Bacteria | 1499 |
| 1269 | Ga0496122_0248225 | 3300048925 | Bacteria | 997 |
| 1270 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 1271 | Ga0496123_0000064 | 3300048926 | Bacteria | 212668 |
| 1272 | Ga0496123_0000248 | 3300048926 | Bacteria | 109122 |
| 1273 | Ga0496123_0000263 | 3300048926 | Bacteria | 105886 |
| 1274 | Ga0496123_0000309 | 3300048926 | Bacteria | 94366 |
| 1275 | Ga0496123_0000827 | 3300048926 | Bacteria | 49725 |
| 1276 | Ga0496123_0001080 | 3300048926 | Bacteria | 41095 |
| 1277 | Ga0496123_0002455 | 3300048926 | Bacteria | 22975 |
| 1278 | Ga0496123_0003432 | 3300048926 | Bacteria | 17794 |
| 1279 | Ga0496123_0003815 | 3300048926 | Bacteria | 16453 |
| 1280 | Ga0496123_0005121 | 3300048926 | Bacteria | 13378 |
| 1281 | Ga0496123_0006692 | 3300048926 | Bacteria | 11104 |
| 1282 | Ga0496123_0008295 | 3300048926 | Bacteria | 9566 |
| 1283 | Ga0496123_0012224 | 3300048926 | Bacteria | 7342 |
| 1284 | Ga0496123_0031257 | 3300048926 | Bacteria | 3876 |
| 1285 | Ga0496123_0031549 | 3300048926 | Bacteria | 3853 |
| 1286 | Ga0496123_0037990 | 3300048926 | Bacteria | 3391 |
| 1287 | Ga0496123_0048163 | 3300048926 | Bacteria | 2870 |
| 1288 | Ga0496123_0080653 | 3300048926 | Bacteria | 1981 |
| 1289 | Ga0496123_0107980 | 3300048926 | Bacteria | 1599 |
| 1290 | Ga0496123_0135435 | 3300048926 | Bacteria | 1356 |
| 1291 | Ga0496123_0186925 | 3300048926 | Bacteria | 1075 |
| 1292 | Ga0496123_0231341 | 3300048926 | Bacteria | 924 |
| 1293 | Ga0496123_0382431 | 3300048926 | Bacteria | 645 |
| 1294 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 1295 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 1296 | Ga0496124_0000025 | 3300048927 | Bacteria | 405471 |
| 1297 | Ga0496124_0000097 | 3300048927 | Bacteria | 183703 |
| 1298 | Ga0496124_0000180 | 3300048927 | Bacteria | 125291 |
| 1299 | Ga0496124_0000659 | 3300048927 | Bacteria | 56974 |
| 1300 | Ga0496124_0001108 | 3300048927 | Bacteria | 42354 |
| 1301 | Ga0496124_0001496 | 3300048927 | Bacteria | 34238 |
| 1302 | Ga0496124_0005507 | 3300048927 | Bacteria | 14213 |
| 1303 | Ga0496124_0006593 | 3300048927 | Bacteria | 12607 |
| 1304 | Ga0496124_0011293 | 3300048927 | Bacteria | 8941 |
| 1305 | Ga0496124_0012761 | 3300048927 | Bacteria | 8260 |
| 1306 | Ga0496124_0018225 | 3300048927 | Bacteria | 6583 |
| 1307 | Ga0496124_0025818 | 3300048927 | Bacteria | 5310 |
| 1308 | Ga0496124_0028216 | 3300048927 | Bacteria | 5024 |
| 1309 | Ga0496124_0043725 | 3300048927 | Bacteria | 3848 |
| 1310 | Ga0496124_0050738 | 3300048927 | Bacteria | 3533 |
| 1311 | Ga0496124_0092781 | 3300048927 | Bacteria | 2459 |
| 1312 | Ga0496124_0102126 | 3300048927 | Bacteria | 2321 |
| 1313 | Ga0496124_0110891 | 3300048927 | Bacteria | 2208 |
| 1314 | Ga0496124_0114707 | 3300048927 | Bacteria | 2163 |
| 1315 | Ga0496124_0121468 | 3300048927 | Bacteria | 2087 |
| 1316 | Ga0496124_0126256 | 3300048927 | Bacteria | 2037 |
| 1317 | Ga0496124_0140729 | 3300048927 | Bacteria | 1904 |
| 1318 | Ga0496124_0275538 | 3300048927 | Bacteria | 1229 |
| 1319 | Ga0496124_0289900 | 3300048927 | Bacteria | 1188 |
| 1320 | Ga0496124_0396997 | 3300048927 | Bacteria | 958 |
| 1321 | Ga0496124_0417766 | 3300048927 | Bacteria | 925 |
| 1322 | Ga0496124_0498316 | 3300048927 | Bacteria | 817 |
| 1323 | Ga0496124_0963776 | 3300048927 | Bacteria | 511 |
| 1324 | Ga0496125_0000013 | 3300048928 | Bacteria | 628761 |
| 1325 | Ga0496125_0000055 | 3300048928 | Bacteria | 278140 |
| 1326 | Ga0496125_0003192 | 3300048928 | Bacteria | 20252 |
| 1327 | Ga0496125_0004562 | 3300048928 | Bacteria | 15883 |
| 1328 | Ga0496125_0011417 | 3300048928 | Bacteria | 8886 |
| 1329 | Ga0496125_0012992 | 3300048928 | Bacteria | 8221 |
| 1330 | Ga0496125_0019540 | 3300048928 | Bacteria | 6384 |
| 1331 | Ga0496125_0031099 | 3300048928 | Bacteria | 4764 |
| 1332 | Ga0496125_0031681 | 3300048928 | Bacteria | 4708 |
| 1333 | Ga0496125_0033541 | 3300048928 | Bacteria | 4541 |
| 1334 | Ga0496125_0051081 | 3300048928 | Bacteria | 3414 |
| 1335 | Ga0496125_0056246 | 3300048928 | Bacteria | 3196 |
| 1336 | Ga0496125_0065514 | 3300048928 | Bacteria | 2877 |
| 1337 | Ga0496125_0101308 | 3300048928 | Bacteria | 2120 |
| 1338 | Ga0496125_0102529 | 3300048928 | Bacteria | 2102 |
| 1339 | Ga0496125_0125272 | 3300048928 | Bacteria | 1822 |
| 1340 | Ga0496125_0172485 | 3300048928 | Bacteria | 1452 |
| 1341 | Ga0496126_0000524 | 3300048929 | Bacteria | 74800 |
| 1342 | Ga0496126_0001242 | 3300048929 | Bacteria | 41379 |
| 1343 | Ga0496126_0001275 | 3300048929 | Bacteria | 40477 |
| 1344 | Ga0496126_0002571 | 3300048929 | Bacteria | 24231 |
| 1345 | Ga0496126_0004513 | 3300048929 | Bacteria | 16581 |
| 1346 | Ga0496126_0005838 | 3300048929 | Bacteria | 13913 |
| 1347 | Ga0496126_0012055 | 3300048929 | Bacteria | 8883 |
| 1348 | Ga0496126_0026056 | 3300048929 | Bacteria | 5613 |
| 1349 | Ga0496126_0095925 | 3300048929 | Bacteria | 2600 |
| 1350 | Ga0496126_0102516 | 3300048929 | Bacteria | 2502 |
| 1351 | Ga0496126_0113215 | 3300048929 | Bacteria | 2362 |
| 1352 | Ga0496126_0138297 | 3300048929 | Bacteria | 2098 |
| 1353 | Ga0496126_0140140 | 3300048929 | Bacteria | 2082 |
| 1354 | Ga0496126_0221148 | 3300048929 | Bacteria | 1590 |
| 1355 | Ga0496126_0421096 | 3300048929 | Bacteria | 1079 |
| 1356 | Ga0501306_044815 | 3300049127 | Bacteria | 695 |
| 1357 | Ga0495678_000817 | 3300049459 | Bacteria | 27883 |
| 1358 | Ga0495678_002620 | 3300049459 | Bacteria | 11999 |
| 1359 | Ga0495678_040935 | 3300049459 | Bacteria | 1858 |
| 1360 | Ga0495682_0000015 | 3300049460 | Bacteria | 235048 |
| 1361 | Ga0501290_021491 | 3300049513 | Bacteria | 885 |
| 1362 | Ga0501314_040360 | 3300049530 | Bacteria | 543 |
| 1363 | Ga0501315_101563 | 3300049531 | Bacteria | 509 |
| 1364 | Ga0501031_0009408 | 3300049568 | Bacteria | 6349 |
| 1365 | Ga0501033_0005448 | 3300049570 | Bacteria | 10084 |
| 1366 | Ga0501034_0000194 | 3300049571 | Bacteria | 114531 |
| 1367 | Ga0501034_0067693 | 3300049571 | Bacteria | 3583 |
| 1368 | Ga0501034_0098941 | 3300049571 | Bacteria | 2912 |
| 1369 | Ga0501034_0450921 | 3300049571 | Bacteria | 1204 |
| 1370 | Ga0501037_0442852 | 3300049573 | Bacteria | 887 |
| 1371 | Ga0501043_0906553 | 3300049579 | Bacteria | 632 |
| 1372 | Ga0501043_1195240 | 3300049579 | Bacteria | 534 |
| 1373 | Ga0501047_0022639 | 3300049581 | Bacteria | 6033 |
| 1374 | Ga0501047_0026369 | 3300049581 | Bacteria | 5592 |
| 1375 | Ga0501048_0259736 | 3300049582 | Bacteria | 1234 |
| 1376 | Ga0501069_0003956 | 3300049585 | Bacteria | 7644 |
| 1377 | Ga0501069_0092482 | 3300049585 | Bacteria | 1711 |
| 1378 | Ga0501070_0008196 | 3300049586 | Bacteria | 8836 |
| 1379 | Ga0501073_0004370 | 3300049589 | Bacteria | 10615 |
| 1380 | Ga0501074_0045353 | 3300049590 | Bacteria | 3181 |
| 1381 | Ga0501074_0145039 | 3300049590 | Bacteria | 1698 |
| 1382 | Ga0501076_0358287 | 3300049592 | Bacteria | 1198 |
| 1383 | Ga0501077_0023480 | 3300049593 | Bacteria | 3911 |
| 1384 | Ga0501223_013447 | 3300049663 | Bacteria | 1630 |
| 1385 | Ga0501228_006460 | 3300049666 | Bacteria | 1071 |
| 1386 | Ga0501238_010976 | 3300049671 | Bacteria | 1214 |
| 1387 | Ga0501249_006469 | 3300049679 | Bacteria | 2409 |
| 1388 | Ga0501252_039108 | 3300049682 | Bacteria | 682 |
| 1389 | Ga0501257_049098 | 3300049686 | Bacteria | 1050 |
| 1390 | Ga0501225_0012633 | 3300049705 | Bacteria | 2370 |
| 1391 | Ga0501080_0045132 | 3300049742 | Bacteria | 4102 |
| 1392 | Ga0501080_0176550 | 3300049742 | Bacteria | 1967 |
| 1393 | Ga0501083_0083127 | 3300049744 | Bacteria | 2121 |
| 1394 | Ga0501241_019985 | 3300049758 | Bacteria | 1231 |
| 1395 | Ga0501262_000217 | 3300049759 | Bacteria | 7100 |
| 1396 | Ga0501266_018967 | 3300049763 | Bacteria | 928 |
| 1397 | Ga0501279_026092 | 3300049775 | Bacteria | 851 |
| 1398 | Ga0501035_0008452 | 3300049822 | Bacteria | 9589 |
| 1399 | Ga0501035_0022942 | 3300049822 | Bacteria | 5729 |
| 1400 | Ga0501035_0030616 | 3300049822 | Bacteria | 4905 |
| 1401 | Ga0501035_0383862 | 3300049822 | Bacteria | 1171 |
| 1402 | Ga0501044_0000126 | 3300049823 | Bacteria | 92879 |
| 1403 | Ga0501044_0030902 | 3300049823 | Bacteria | 5640 |
| 1404 | nmdc:mga03683_15867_c1 | 3300050489 | Bacteria | 2820 |
| 1405 | nmdc:mga03683_539_c1 | 3300050489 | Bacteria | 10090 |
| 1406 | nmdc:mga03n38_13224_c1 | 3300050490 | Bacteria | 3128 |
| 1407 | nmdc:mga03n38_14629_c1 | 3300050490 | Bacteria | 3012 |
| 1408 | nmdc:mga00v17_146343_c1 | 3300050491 | Bacteria | 1516 |
| 1409 | nmdc:mga00v17_151655_c1 | 3300050491 | Bacteria | 938 |
| 1410 | nmdc:mga00v17_18093_c1 | 3300050491 | Bacteria | 3999 |
| 1411 | nmdc:mga00v17_210738_c1 | 3300050491 | Bacteria | 1257 |
| 1412 | nmdc:mga00v17_223241_c1 | 3300050491 | Bacteria | 1220 |
| 1413 | nmdc:mga00v17_223343_c1 | 3300050491 | Bacteria | 1220 |
| 1414 | nmdc:mga00v17_320026_c1 | 3300050491 | Bacteria | 1008 |
| 1415 | nmdc:mga00v17_50007_c1 | 3300050491 | Bacteria | 2538 |
| 1416 | nmdc:mga00v17_629_c1 | 3300050491 | Bacteria | 19512 |
| 1417 | nmdc:mga0k408_441955_c1 | 3300050493 | Bacteria | 773 |
| 1418 | nmdc:mga0k408_546176_c1 | 3300050493 | Bacteria | 685 |
| 1419 | nmdc:mga0k408_648838_c1 | 3300050493 | Bacteria | 621 |
| 1420 | nmdc:mga07m45_122425_c1 | 3300050496 | Bacteria | 1503 |
| 1421 | nmdc:mga07m45_1446_c1 | 3300050496 | Bacteria | 10887 |
| 1422 | nmdc:mga07m45_297849_c1 | 3300050496 | Bacteria | 938 |
| 1423 | nmdc:mga07m45_42155_c1 | 3300050496 | Bacteria | 2558 |
| 1424 | nmdc:mga0qj67_683617_c1 | 3300050509 | Bacteria | 817 |
| 1425 | nmdc:mga0a205_524229_c1 | 3300050515 | Bacteria | 1041 |
| 1426 | nmdc:mga0sz30_116214_c1 | 3300050516 | Bacteria | 1174 |
| 1427 | Ga0495601_0056834 | 3300053077 | Bacteria | 2478 |
| 1428 | Ga0495655_0116484 | 3300053083 | Bacteria | 809 |
| 1429 | Ga0495619_0318180 | 3300053085 | Bacteria | 1077 |
| 1430 | Ga0500643_015944 | 3300053087 | Bacteria | 2562 |
| 1431 | Ga0500644_0006005 | 3300053088 | Bacteria | 3092 |
| 1432 | Ga0500644_0051178 | 3300053088 | Bacteria | 1417 |
| 1433 | Ga0500646_0019586 | 3300053090 | Bacteria | 1791 |
| 1434 | Ga0500647_0257671 | 3300053091 | Bacteria | 764 |
| 1435 | Ga0500647_0353846 | 3300053091 | Bacteria | 610 |
| 1436 | Ga0500651_0000054 | 3300053093 | Bacteria | 74519 |
| 1437 | Ga0500566_0042353 | 3300053094 | Bacteria | 2627 |
| 1438 | Ga0500641_0120823 | 3300053096 | Bacteria | 1129 |
| 1439 | Ga0500562_007562 | 3300053108 | Bacteria | 2741 |
| 1440 | Ga0500562_120711 | 3300053108 | Bacteria | 714 |
| 1441 | Ga0500571_000005 | 3300053110 | Bacteria | 109625 |
| 1442 | Ga0500572_116828 | 3300053111 | Bacteria | 862 |
| 1443 | Ga0500592_003168 | 3300053116 | Bacteria | 2630 |
| 1444 | Ga0500593_002899 | 3300053117 | Bacteria | 6373 |
| 1445 | Ga0500594_0000763 | 3300053118 | Bacteria | 6854 |
| 1446 | Ga0500595_001889 | 3300053119 | Bacteria | 10795 |
| 1447 | Ga0500595_118460 | 3300053119 | Bacteria | 749 |
| 1448 | Ga0500597_253803 | 3300053120 | Bacteria | 718 |
| 1449 | Ga0500607_036794 | 3300053121 | Bacteria | 2671 |
| 1450 | Ga0500607_038837 | 3300053121 | Bacteria | 2589 |
| 1451 | Ga0500608_024725 | 3300053122 | Bacteria | 2807 |
| 1452 | Ga0500614_118936 | 3300053123 | Bacteria | 776 |
| 1453 | Ga0500618_014532 | 3300053125 | Bacteria | 2008 |
| 1454 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 1455 | Ga0500655_000895 | 3300053133 | Bacteria | 5782 |
| 1456 | Ga0500559_0001788 | 3300053136 | Bacteria | 11804 |
| 1457 | Ga0500559_0084954 | 3300053136 | Bacteria | 1443 |
| 1458 | Ga0500559_0258511 | 3300053136 | Bacteria | 820 |
| 1459 | Ga0500561_0016276 | 3300053137 | Bacteria | 1666 |
| 1460 | Ga0500564_005575 | 3300053138 | Bacteria | 5158 |
| 1461 | Ga0500568_0002238 | 3300053139 | Bacteria | 11589 |
| 1462 | Ga0500573_0029700 | 3300053140 | Bacteria | 3151 |
| 1463 | Ga0500574_000299 | 3300053141 | Bacteria | 6083 |
| 1464 | Ga0500574_001599 | 3300053141 | Bacteria | 3438 |
| 1465 | Ga0500604_0054108 | 3300053151 | Bacteria | 1246 |
| 1466 | Ga0500616_0047830 | 3300053153 | Bacteria | 2269 |
| 1467 | Ga0500619_000249 | 3300053154 | Bacteria | 11573 |
| 1468 | Ga0500622_0125928 | 3300053156 | Bacteria | 1237 |
| 1469 | Ga0500624_004622 | 3300053157 | Bacteria | 1817 |
| 1470 | Ga0500624_070879 | 3300053157 | Bacteria | 681 |
| 1471 | Ga0500634_0025168 | 3300053161 | Bacteria | 3239 |
| 1472 | Ga0500634_0036031 | 3300053161 | Bacteria | 2694 |
| 1473 | Ga0500634_0107998 | 3300053161 | Bacteria | 1379 |
| 1474 | Ga0500638_004055 | 3300053162 | Bacteria | 5560 |
| 1475 | Ga0500636_0000053 | 3300053177 | Bacteria | 55579 |
| 1476 | Ga0500625_026945 | 3300053729 | Bacteria | 2724 |
| 1477 | Ga0500645_011458 | 3300053730 | Bacteria | 2895 |
| 1478 | Ga0500645_049388 | 3300053730 | Bacteria | 1230 |
| 1479 | Ga0500661_002371 | 3300055283 | Bacteria | 3552 |
| 1480 | Ga0501082_0077867 | 3300060353 | Bacteria | 2859 |
| 1481 | 2506579128 | 2506520007 | Bacteria | 5442880 |
| 1482 | 2506584267 | 2506520008 | Bacteria | 5443009 |
| 1483 | 2508853017 | 2508501071 | Bacteria | 5454741 |
| 1484 | 2511245910 | 2511231002 | Bacteria | 5042903 |
| 1485 | 2511378986 | 2511231025 | Bacteria | 5324661 |
| 1486 | 2511433251 | 2511231035 | Bacteria | 5341610 |
| 1487 | 2513953457 | 2513237150 | Bacteria | 6553639 |
| 1488 | 2514042766 | 2513237165 | Bacteria | 6771773 |
| 1489 | 2526213809 | 2526164512 | Bacteria | 4025691 |
| 1490 | 2538425916 | 2537561728 | Bacteria | 5149301 |
| 1491 | 2547694988 | 2547132181 | Bacteria | 4945084 |
| 1492 | 2547698141 | 2547132181 | Bacteria | 4945084 |
| 1493 | 2548501264 | 2547132374 | Bacteria | 5530232 |
| 1494 | 2548648031 | 2547132416 | Bacteria | 4633861 |
| 1495 | 2562463995 | 2561511199 | Bacteria | 5155034 |
| 1496 | 2562467013 | 2561511199 | Bacteria | 5155034 |
| 1497 | 2585829188 | 2585427591 | Bacteria | 5482980 |
| 1498 | 2585834100 | 2585427592 | Bacteria | 5370892 |
| 1499 | 2599623235 | 2599185214 | Bacteria | 8209958 |
| 1500 | 2599675547 | 2599185226 | Bacteria | 8233575 |
| 1501 | 2599680840 | 2599185227 | Bacteria | 8246414 |
| 1502 | 2599692855 | 2599185229 | Bacteria | 8216126 |
| 1503 | 2599907762 | 2599185292 | Bacteria | 6290804 |
| 1504 | 2599927576 | 2599185299 | Bacteria | 4854625 |
| 1505 | 2601533231 | 2600255256 | Bacteria | 5597742 |
| 1506 | 2601535065 | 2600255256 | Bacteria | 5597742 |
| 1507 | 2601538595 | 2600255257 | Bacteria | 5597196 |
| 1508 | 2601541454 | 2600255257 | Bacteria | 5597196 |
| 1509 | 2601756944 | 2600255310 | Bacteria | 5600903 |
| 1510 | 2601758247 | 2600255310 | Bacteria | 5600903 |
| 1511 | 2601761601 | 2600255311 | Bacteria | 5598766 |
| 1512 | 2601764356 | 2600255311 | Bacteria | 5598766 |
| 1513 | 2603638382 | 2602042046 | Bacteria | 5483348 |
| 1514 | 2603641220 | 2602042046 | Bacteria | 5483348 |
| 1515 | 2603642877 | 2602042047 | Bacteria | 4697674 |
| 1516 | 2603698078 | 2602042066 | Bacteria | 4423871 |
| 1517 | 2603703483 | 2602042067 | Bacteria | 4863713 |
| 1518 | 2603867553 | 2602042109 | Bacteria | 5152801 |
| 1519 | 2608669024 | 2608642108 | Bacteria | 4104624 |
| 1520 | 2609910071 | 2609459761 | Bacteria | 5513740 |
| 1521 | 2643863186 | 2643221569 | Bacteria | 6064337 |
| 1522 | 2643868496 | 2643221570 | Bacteria | 5103772 |
| 1523 | 2643978592 | 2643221594 | Bacteria | 5811388 |
| 1524 | 2643994603 | 2643221596 | Bacteria | 5006805 |
| 1525 | 2644061652 | 2643221609 | Bacteria | 6756331 |
| 1526 | 2644075184 | 2643221611 | Bacteria | 6820941 |
| 1527 | 2644121712 | 2643221621 | Bacteria | 6212786 |
| 1528 | 2644295448 | 2643221652 | Bacteria | 5140275 |
| 1529 | 2644467160 | 2643221683 | Bacteria | 5749203 |
| 1530 | 2644649192 | 2643221717 | Bacteria | 5676132 |
| 1531 | 2650897820 | 2648501693 | Bacteria | 5069560 |
| 1532 | 2656280085 | 2654587920 | Bacteria | 5475511 |
| 1533 | 2671103420 | 2667528172 | Bacteria | 5170840 |
| 1534 | 2671108783 | 2667528173 | Bacteria | 5375747 |
| 1535 | 2671587306 | 2671180115 | Bacteria | 5353919 |
| 1536 | 2681997451 | 2681812866 | Bacteria | 4552357 |
| 1537 | 2682007045 | 2681812869 | Bacteria | 5014465 |
| 1538 | 2686352920 | 2684622997 | Bacteria | 4624240 |
| 1539 | 2689445585 | 2687453601 | Bacteria | 5546041 |
| 1540 | 2707098652 | 2706794495 | Bacteria | 4536932 |
| 1541 | 2712470160 | 2711768156 | Bacteria | 4471618 |
| 1542 | 2723879825 | 2721755763 | Bacteria | 4464185 |
| 1543 | 2738721246 | 2738541277 | Bacteria | 7458140 |
| 1544 | 2738882743 | 2738541307 | Bacteria | 8606193 |
| 1545 | 2739243349 | 2738543012 | Bacteria | 7115078 |
| 1546 | 2739250546 | 2738543013 | Bacteria | 5618633 |
| 1547 | 2739280445 | 2738543019 | Bacteria | 7459457 |
| 1548 | 2753855531 | 2751185917 | Bacteria | 4551186 |
| 1549 | 2765588508 | 2765235842 | Bacteria | 4799256 |
| 1550 | 2772439547 | 2772190666 | Bacteria | 5117644 |
| 1551 | 2775542322 | 2775506706 | Bacteria | 4873073 |
| 1552 | 2791925875 | 2791354903 | Bacteria | 4937680 |
| 1553 | 2792311507 | 2791355010 | Bacteria | 4864581 |
| 1554 | 2793405912 | 2791355275 | Bacteria | 4429597 |
| 1555 | 2807180778 | 2806310673 | Bacteria | 4801221 |
| 1556 | 2809036651 | 2808606395 | Bacteria | 6020352 |
| 1557 | 2809126989 | 2808606414 | Bacteria | 4917181 |
| 1558 | 2813727434 | 2811995292 | Bacteria | 5303342 |
| 1559 | 2813729433 | 2811995292 | Bacteria | 5303342 |
| 1560 | 2814694966 | 2814123068 | Bacteria | 5687681 |
| 1561 | 2814696928 | 2814123068 | Bacteria | 5687681 |
| 1562 | 2816473927 | 2816332133 | Bacteria | 7249298 |
| 1563 | 2819544803 | 2818991436 | Bacteria | 5376622 |
| 1564 | 2819600370 | 2818991446 | Bacteria | 7757362 |
| 1565 | 2821119337 | 2821118458 | Bacteria | 4714306 |
| 1566 | 2823374294 | 2823373977 | Bacteria | 4779415 |
| 1567 | 2831271836 | 2831265667 | Bacteria | 7184833 |
| 1568 | 2834645087 | 2834641062 | Bacteria | 5559922 |
| 1569 | 2838059674 | 2838054893 | Bacteria | 7451788 |
| 1570 | 2842679834 | 2842677519 | Bacteria | 5615038 |
| 1571 | 2842721934 | 2842718218 | Bacteria | 4560148 |
| 1572 | 2842735768 | 2842733646 | Bacteria | 5716726 |
| 1573 | 2842750921 | 2842747753 | Bacteria | 5578255 |
| 1574 | 2844427075 | 2844425489 | Bacteria | 4854065 |
| 1575 | 2844530485 | 2844528606 | Bacteria | 4733806 |
| 1576 | 2846541790 | 2846540461 | Bacteria | 5471451 |
| 1577 | 2847088103 | 2847085930 | Bacteria | 5070450 |
| 1578 | 2847800402 | 2847797336 | Bacteria | 5176640 |
| 1579 | 2852107623 | 2852103415 | Bacteria | 5193810 |
| 1580 | 2854601991 | 2854601825 | Bacteria | 4797592 |
| 1581 | 2855197066 | 2855195626 | Bacteria | 4927512 |
| 1582 | 2855731415 | 2855730933 | Bacteria | 7047938 |
| 1583 | 2855768121 | 2855767633 | Bacteria | 7049357 |
| 1584 | 2857542680 | 2857537821 | Bacteria | 5248181 |
| 1585 | 2857545856 | 2857542790 | Bacteria | 5326616 |
| 1586 | 2858469096 | 2858466076 | Bacteria | 4722413 |
| 1587 | 2858691088 | 2858688981 | Bacteria | 8184122 |
| 1588 | 2858954805 | 2858950400 | Bacteria | 6783797 |
| 1589 | 2865015573 | 2865014394 | Bacteria | 4764573 |
| 1590 | 2869555030 | 2869551831 | Bacteria | 5474685 |
| 1591 | 2871275628 | 2871272651 | Bacteria | 5042015 |
| 1592 | 2871285420 | 2871282230 | Bacteria | 4917173 |
| 1593 | 2876601983 | 2876601092 | Bacteria | 5114497 |
| 1594 | 2881413712 | 2881412998 | Bacteria | 6492157 |
| 1595 | 2881612390 | 2881609920 | Bacteria | 4405319 |
| 1596 | 2884089421 | 2884086401 | Bacteria | 5005459 |
| 1597 | 2885198062 | 2885192300 | Bacteria | 5882526 |
| 1598 | 2885198672 | 2885198086 | Bacteria | 7212419 |
| 1599 | 2885211948 | 2885211737 | Bacteria | 7212420 |
| 1600 | 2888369610 | 2888366609 | Bacteria | 5155009 |
| 1601 | 2891672676 | 2891670763 | Bacteria | 4967099 |
| 1602 | 2899928459 | 2899924645 | Bacteria | 7487985 |
| 1603 | 2900052857 | 2900051742 | Bacteria | 4985156 |
| 1604 | 2901304334 | 2901300506 | Bacteria | 8463898 |
| 1605 | 2904452436 | 2904449895 | Bacteria | 6927402 |
| 1606 | 2904460965 | 2904456579 | Bacteria | 6819253 |
| 1607 | 2904475471 | 2904474040 | Bacteria | 5504324 |
| 1608 | 2904548220 | 2904541872 | Bacteria | 8915136 |
| 1609 | 2919154316 | 2919150387 | Bacteria | 5500879 |
| 1610 | 2919463932 | 2919462493 | Bacteria | 5817112 |
| 1611 | 2923638964 | 2923634449 | Bacteria | 4753480 |
| 1612 | 2927144309 | 2927143783 | Bacteria | 5504251 |
| 1613 | 2927834546 | 2927833300 | Bacteria | 4923934 |
| 1614 | 2928041380 | 2928037797 | Bacteria | 7273642 |
| 1615 | 2928048222 | 2928044640 | Bacteria | 7271509 |
| 1616 | 2928056064 | 2928051484 | Bacteria | 7773759 |
| 1617 | 2928066454 | 2928064002 | Bacteria | 7419480 |
| 1618 | 2928077402 | 2928070936 | Bacteria | 8062541 |
| 1619 | 2928087701 | 2928084124 | Bacteria | 7159212 |
| 1620 | 2929163210 | 2929160207 | Bacteria | 9075316 |
| 1621 | 2929522948 | 2929520902 | Bacteria | 6765052 |
| 1622 | 2932408756 | 2932406140 | Bacteria | 5134491 |
| 1623 | 2935627103 | 2935625433 | Bacteria | 5042964 |
| 1624 | 2935629095 | 2935625433 | Bacteria | 5042964 |
| 1625 | 2937543247 | 2937539931 | Bacteria | 4639830 |
| 1626 | 2937968184 | 2937967321 | Bacteria | 5094075 |
| 1627 | 2939568727 | 2939568625 | Bacteria | 4542555 |
| 1628 | 2939574239 | 2939573065 | Bacteria | 4926053 |
| 1629 | 2939580452 | 2939577877 | Bacteria | 5132791 |
| 1630 | 2939603654 | 2939602548 | Bacteria | 4950493 |
| 1631 | 2939607919 | 2939607340 | Bacteria | 4719256 |
| 1632 | 2939619108 | 2939617950 | Bacteria | 4820956 |
| 1633 | 2939621866 | 2939617950 | Bacteria | 4820956 |
| 1634 | 2939644228 | 2939642701 | Bacteria | 4475280 |
| 1635 | 2941481035 | |||
| 1636 | 2945877271 | 2945874760 | Bacteria | 5527237 |
| 1637 | 2945946068 | 2945945610 | Bacteria | 5951079 |
| 1638 | 2945953465 | 2945951305 | Bacteria | 4918162 |
| 1639 | 2945975667 | 2945972063 | Bacteria | 6086495 |
| 1640 | 2954768890 | 2954767861 | Bacteria | 5535784 |
| 1641 | 2974312571 | 2974310843 | Bacteria | 4947816 |
| 1642 | 2974321964 | 2974320154 | Bacteria | 4571377 |
| 1643 | 2974437978 | 2974435778 | Bacteria | 4876478 |
| 1644 | 2974439772 | 2974435778 | Bacteria | 4876478 |
| 1645 | 2978975957 | 2978975091 | Bacteria | 4704313 |
| 1646 | 2978978014 | 2978975091 | Bacteria | 4704313 |
| 1647 | 2984496150 | 2984494565 | Bacteria | 5000175 |
| 1648 | 2990262827 | 2990261002 | Bacteria | 4919493 |
| 1649 | 2990715533 | 2990710928 | Bacteria | 5002431 |
| 1650 | 3000376946 | 3000376612 | Bacteria | 4705565 |
| 1651 | 640938510 | 640753048 | Bacteria | 5495657 |
| 1652 | 644750334 | 644736347 | Bacteria | 6476522 |
| 1653 | 8003405317 | 8003400568 | Bacteria | 5535898 |
| 1654 | 8004596810 | 8004592986 | Bacteria | 5122074 |
| 1655 | 8015398332 | 8015394850 | Bacteria | 5064660 |
| 1656 | 8016736360 | 8016733728 | Bacteria | 5274317 |
| 1657 | 8018224609 | 8018221730 | Bacteria | 4616064 |
| 1658 | 8018408625 | 8018405270 | Bacteria | 4978981 |
| 1659 | 8019503032 | 8019499862 | Bacteria | 5169538 |
| 1660 | 8019505992 | 8019504834 | Bacteria | 4819156 |
| 1661 | 8019509242 | 8019504834 | Bacteria | 4819156 |
| 1662 | 8054846254 | 8054844752 | Bacteria | 4450330 |
| 1663 | 8054850454 | 8054849141 | Bacteria | 5232694 |
| 1664 | 8055088534 | 8055087960 | Bacteria | 4784273 |
| 1665 | 8055094229 | 8055092621 | Bacteria | 4873875 |
| 1666 | 8055099647 | 8055097453 | Bacteria | 4865496 |
| 1667 | 8055696620 | 8055693939 | Bacteria | 4772047 |
| 1668 | 8057161335 | 8057160832 | Bacteria | 3268302 |
| 1669 | 8057309059 | 8057304971 | Bacteria | 4649742 |
| 1670 | Ga0182007_10006154 | |||
| 1671 | SwRhRL2b_contig_1532308 | |||
| 1672 | SwRhRL2b_contig_1817389 | |||
| 1673 | SwRhRL2b_contig_211812 | |||
| 1674 | SwRhRL2b_contig_3815225 | |||
| 1675 | SwRhRL2b_contig_648880 | |||
| 1676 | SwRhRL2b_contig_811231 | |||
| 1677 | JGI24741J21665_1002439 | |||
| 1678 | JGI24740J21852_10001465 | |||
| 1679 | JGI24740J21852_10005400 | |||
| 1680 | JGI24740J21852_10108564 | |||
| 1681 | JGI24739J22299_10000528 | |||
| 1682 | JGI24739J22299_10019327 | |||
| 1683 | JGI25162J39368_1000019 | |||
| 1684 | JGI25162J39368_1000139 | |||
| 1685 | JGI25162J39368_1004044 | |||
| 1686 | JGI25158J39367_1004522 | |||
| 1687 | JGI25158J39367_1014677 | |||
| 1688 | JGI25163J39215_1000008 | |||
| 1689 | JGI25163J39215_1000036 | |||
| 1690 | JGI25163J39215_1001578 | |||
| 1691 | JGI25164J39214_1000011 | |||
| 1692 | JGI25152J39213_1000725 | |||
| 1693 | JGI25152J39213_1001419 | |||
| 1694 | JGI25152J39213_1001623 | |||
| 1695 | JGI25152J39213_1008926 | |||
| 1696 | JGI25150J39212_1001793 | |||
| 1697 | JGI25150J39212_1009982 | |||
| 1698 | JGI25159J45721_1000435 | |||
| 1699 | JGI25159J45721_1001336 | |||
| 1700 | Ga0006759J45824_1061774 | |||
| 1701 | JGI25151J46595_10000198 | |||
| 1702 | JGI25151J46595_10000666 | |||
| 1703 | JGI25151J46595_10000713 | |||
| 1704 | JGI25151J46595_10000957 | |||
| 1705 | JGI25151J46595_10002229 | |||
| 1706 | JGI25151J46595_10011933 | |||
| 1707 | JGI25151J46595_10015566 | |||
| 1708 | JGI25151J46595_10018492 | |||
| 1709 | JGI25151J46595_10064364 | |||
| 1710 | JGI25165J46597_1000227 | |||
| 1711 | JGI25153J46596_10002586 | |||
| 1712 | JGI25153J46596_10027801 | |||
| 1713 | rootH2_10001915 | |||
| 1714 | rootH2_10011746 | |||
| 1715 | rootL2_10010810 | |||
| 1716 | rootL2_10038684 | |||
| 1717 | rootH1_10022702 | |||
| 1718 | JGI25160J50197_1000093 | |||
| 1719 | JGI25160J50197_1001793 | |||
| 1720 | JGI25160J50197_1002516 | |||
| 1721 | JGI25161J50226_1000443 | |||
| 1722 | JGI25161J50226_1001737 | |||
| 1723 | JGI25161J50226_1006112 | |||
| 1724 | Ga0007410J51695_1038845 | |||
| 1725 | Ga0007409J51694_1018424 | |||
| 1726 | Ga0007416J51690_1050216 | |||
| 1727 | Ga0006562J51391_1020559 | |||
| 1728 | Ga0032354_1047181 | |||
| 1729 | Ga0055538_1000021 | |||
| 1730 | Ga0055538_1000089 | |||
| 1731 | Ga0055539_1000026 | |||
| 1732 | Ga0055539_1000133 | |||
| 1733 | Ga0055533_1000035 | |||
| 1734 | Ga0055533_1000136 | |||
| 1735 | Ga0055532_1008571 | |||
| 1736 | Ga0055525_1000045 | |||
| 1737 | Ga0055525_1000181 | |||
| 1738 | Ga0055527_1015720 | |||
| 1739 | Ga0055535_1000128 | |||
| 1740 | Ga0055542_1000062 | |||
| 1741 | Ga0055526_1003281 | |||
| 1742 | Ga0055526_1004616 | |||
| 1743 | Ga0055526_1025264 | |||
| 1744 | Ga0055537_1001084 | |||
| 1745 | Ga0055537_1001152 | |||
| 1746 | Ga0055537_1005883 | |||
| 1747 | Ga0055537_1030973 | |||
| 1748 | Ga0055524_1002106 | |||
| 1749 | Ga0055524_1002148 | |||
| 1750 | Ga0055524_1003128 | |||
| 1751 | Ga0055524_1009474 | |||
| 1752 | Ga0055524_1064653 | |||
| 1753 | Ga0055536_1000045 | |||
| 1754 | Ga0055536_1001927 | |||
| 1755 | Ga0055536_1008144 | |||
| 1756 | Ga0055536_1029855 | |||
| 1757 | Ga0055534_1000607 | |||
| 1758 | Ga0055534_1000680 | |||
| 1759 | Ga0055534_1000948 | |||
| 1760 | Ga0055534_1001053 | |||
| 1761 | Ga0055534_1026656 | |||
| 1762 | Ga0055534_1030244 | |||
| 1763 | Ga0055528_1001880 | |||
| 1764 | Ga0055528_1012891 | |||
| 1765 | Ga0055530_10001484 | |||
| 1766 | Ga0055530_10036030 | |||
| 1767 | Ga0055540_1002723 | |||
| 1768 | Ga0055540_1003970 | |||
| 1769 | Ga0055540_1004043 | |||
| 1770 | Ga0055540_1010254 | |||
| 1771 | Ga0055531_10002613 | |||
| 1772 | Ga0055531_10042539 | |||
| 1773 | Ga0055541_1000020 | |||
| 1774 | Ga0055541_1000088 | |||
| 1775 | Ga0058692_1000058 | |||
| 1776 | Ga0058692_1000127 | |||
| 1777 | Ga0058692_1000356 | |||
| 1778 | Ga0058692_1000889 | |||
| 1779 | Ga0058692_1001028 | |||
| 1780 | Ga0058692_1003139 | |||
| 1781 | Ga0058692_1005468 | |||
| 1782 | Ga0058692_1006611 | |||
| 1783 | Ga0058692_1008376 | |||
| 1784 | Ga0058692_1008738 | |||
| 1785 | Ga0058692_1009721 | |||
| 1786 | Ga0058692_1016142 | |||
| 1787 | Ga0058692_1036964 | |||
| 1788 | Ga0055543_1001728 | |||
| 1789 | Ga0055543_1002173 | |||
| 1790 | Ga0058861_10505237 | |||
| 1791 | Ga0065165_1003326 | |||
| 1792 | Ga0065165_1005438 | |||
| 1793 | Ga0065165_1010696 | |||
| 1794 | Ga0065165_1116696 | |||
| 1795 | Ga0065165_1131492 | |||
| 1796 | Ga0065703_1020318 | |||
| 1797 | Ga0065714_10166784 | |||
| 1798 | Ga0065704_10000333 | |||
| 1799 | Ga0065704_10000631 | |||
| 1800 | Ga0065704_10001218 | |||
| 1801 | Ga0065704_10003968 | |||
| 1802 | Ga0065704_10071586 | |||
| 1803 | Ga0065704_10086036 | |||
| 1804 | Ga0065704_10086235 | |||
| 1805 | Ga0065704_10129206 | |||
| 1806 | Ga0065704_10141574 | |||
| 1807 | Ga0070658_10070073 | |||
| 1808 | Ga0070658_10148408 | |||
| 1809 | Ga0070658_10243894 | |||
| 1810 | Ga0070658_10557291 | |||
| 1811 | Ga0070676_10065117 | |||
| 1812 | Ga0070670_100679234 | |||
| 1813 | Ga0070677_10324179 | |||
| 1814 | Ga0070680_100022363 | |||
| 1815 | Ga0070680_100495764 | |||
| 1816 | Ga0070682_100010205 | |||
| 1817 | Ga0070682_101235099 | |||
| 1818 | Ga0068868_102001739 | |||
| 1819 | Ga0070660_100907056 | |||
| 1820 | Ga0070691_10006226 | |||
| 1821 | Ga0070691_10036380 | |||
| 1822 | Ga0070691_10198210 | |||
| 1823 | Ga0070687_100056664 | |||
| 1824 | Ga0070661_100015748 | |||
| 1825 | Ga0070661_100398030 | |||
| 1826 | Ga0070661_100546966 | |||
| 1827 | Ga0070692_10041561 | |||
| 1828 | Ga0070692_10064627 | |||
| 1829 | Ga0070668_100017378 | |||
| 1830 | Ga0070668_100239409 | |||
| 1831 | Ga0070668_101124166 | |||
| 1832 | Ga0070669_100006871 | |||
| 1833 | Ga0070674_100027809 | |||
| 1834 | Ga0070673_100319045 | |||
| 1835 | Ga0070659_100282356 | |||
| 1836 | Ga0070659_100518883 | |||
| 1837 | Ga0070667_100013220 | |||
| 1838 | Ga0070667_100051123 | |||
| 1839 | Ga0070667_100133305 | |||
| 1840 | Ga0070663_100005681 | |||
| 1841 | Ga0070663_100023732 | |||
| 1842 | Ga0070678_100417589 | |||
| 1843 | Ga0070678_101657403 | |||
| 1844 | Ga0070662_100017220 | |||
| 1845 | Ga0070662_100235146 | |||
| 1846 | Ga0070681_10000088 | |||
| 1847 | Ga0070681_10002015 | |||
| 1848 | Ga0070681_10984032 | |||
| 1849 | Ga0070679_100000061 | |||
| 1850 | Ga0070679_100287609 | |||
| 1851 | Ga0068853_100001354 | |||
| 1852 | Ga0068853_100047998 | |||
| 1853 | Ga0068853_100302849 | |||
| 1854 | Ga0068853_100355525 | |||
| 1855 | Ga0070696_100015635 | |||
| 1856 | Ga0070696_100024095 | |||
| 1857 | Ga0070693_100008374 | |||
| 1858 | Ga0070665_100000262 | |||
| 1859 | Ga0070665_100010362 | |||
| 1860 | Ga0070665_100070998 | |||
| 1861 | Ga0070665_100775281 | |||
| 1862 | Ga0070665_100833059 | |||
| 1863 | Ga0070665_101682702 | |||
| 1864 | Ga0068855_100010497 | |||
| 1865 | Ga0068855_100224695 | |||
| 1866 | Ga0070664_100099825 | |||
| 1867 | Ga0068857_100000082 | |||
| 1868 | Ga0068857_100036973 | |||
| 1869 | Ga0068857_100650963 | |||
| 1870 | Ga0068857_101000606 | |||
| 1871 | Ga0068854_100061734 | |||
| 1872 | Ga0068852_100320257 | |||
| 1873 | Ga0068852_100805233 | |||
| 1874 | Ga0068859_100135523 | |||
| 1875 | Ga0068851_10001818 | |||
| 1876 | Ga0068851_10012101 | |||
| 1877 | Ga0068870_11119288 | |||
| 1878 | Ga0068863_100031760 | |||
| 1879 | Ga0068860_100301337 | |||
| 1880 | Ga0081539_10075937 | |||
| 1881 | Ga0075365_10093978 | |||
| 1882 | Ga0075363_100698181 | |||
| 1883 | Ga0075364_10004261 | |||
| 1884 | Ga0075364_10019925 | |||
| 1885 | Ga0075364_10039524 | |||
| 1886 | Ga0075364_10090303 | |||
| 1887 | Ga0075364_10122334 | |||
| 1888 | Ga0075364_10139974 | |||
| 1889 | Ga0075364_10141236 | |||
| 1890 | Ga0075364_10229103 | |||
| 1891 | Ga0075364_10252742 | |||
| 1892 | Ga0075364_10669159 | |||
| 1893 | Ga0075432_10045356 | |||
| 1894 | Ga0075362_10000528 | |||
| 1895 | Ga0075362_10002538 | |||
| 1896 | Ga0075362_10017911 | |||
| 1897 | Ga0075369_10155822 | |||
| 1898 | Ga0075369_10203553 | |||
| 1899 | Ga0075366_10036012 | |||
| 1900 | Ga0075366_10255351 | |||
| 1901 | Ga0075370_10004045 | |||
| 1902 | Ga0075370_10016704 | |||
| 1903 | Ga0075370_10019421 | |||
| 1904 | Ga0075370_10367422 | |||
| 1905 | Ga0075430_100079155 | |||
| 1906 | Ga0075433_10254037 | |||
| 1907 | Ga0097620_100135524 | |||
| 1908 | Ga0079104_1000035 | |||
| 1909 | Ga0079104_1000274 | |||
| 1910 | Ga0079104_1000343 | |||
| 1911 | Ga0079104_1000464 | |||
| 1912 | Ga0079104_1000819 | |||
| 1913 | Ga0079104_1001653 | |||
| 1914 | Ga0079104_1001797 | |||
| 1915 | Ga0079104_1003555 | |||
| 1916 | Ga0079104_1015838 | |||
| 1917 | Ga0079104_1022141 | |||
| 1918 | Ga0079104_1022902 | |||
| 1919 | Ga0079104_1024210 | |||
| 1920 | Ga0079104_1051905 | |||
| 1921 | Ga0079104_1066673 | |||
| 1922 | Ga0099826_10000013 | |||
| 1923 | Ga0099826_10139907 | |||
| 1924 | Ga0099826_10481446 | |||
| 1925 | Ga0105251_10002660 | |||
| 1926 | Ga0105251_10002718 | |||
| 1927 | Ga0105251_10002876 | |||
| 1928 | Ga0105251_10007342 | |||
| 1929 | Ga0105251_10008589 | |||
| 1930 | Ga0105251_10011774 | |||
| 1931 | Ga0105251_10025606 | |||
| 1932 | Ga0105251_10027110 | |||
| 1933 | Ga0105251_10035985 | |||
| 1934 | Ga0105251_10079343 | |||
| 1935 | Ga0105251_10098773 | |||
| 1936 | Ga0105251_10110569 | |||
| 1937 | Ga0105251_10213105 | |||
| 1938 | Ga0105244_10000117 | |||
| 1939 | Ga0105244_10000123 | |||
| 1940 | Ga0105244_10000491 | |||
| 1941 | Ga0105244_10001091 | |||
| 1942 | Ga0105244_10001372 | |||
| 1943 | Ga0105244_10002148 | |||
| 1944 | Ga0105244_10002204 | |||
| 1945 | Ga0105244_10003085 | |||
| 1946 | Ga0105244_10014092 | |||
| 1947 | Ga0105244_10025906 | |||
| 1948 | Ga0105244_10038004 | |||
| 1949 | Ga0105244_10065064 | |||
| 1950 | Ga0105244_10124884 | |||
| 1951 | Ga0105244_10144566 | |||
| 1952 | Ga0105244_10206087 | |||
| 1953 | Ga0105250_10000037 | |||
| 1954 | Ga0105250_10000414 | |||
| 1955 | Ga0105250_10000650 | |||
| 1956 | Ga0105250_10000917 | |||
| 1957 | Ga0105250_10001186 | |||
| 1958 | Ga0105250_10002778 | |||
| 1959 | Ga0105250_10002792 | |||
| 1960 | Ga0105250_10004534 | |||
| 1961 | Ga0105250_10065924 | |||
| 1962 | Ga0105250_10067681 | |||
| 1963 | Ga0105250_10077887 | |||
| 1964 | Ga0105250_10272096 | |||
| 1965 | Ga0105240_10062558 | |||
| 1966 | Ga0105240_10273746 | |||
| 1967 | Ga0105240_10335586 | |||
| 1968 | Ga0105240_10498509 | |||
| 1969 | Ga0105240_11260892 | |||
| 1970 | Ga0105240_11310510 | |||
| 1971 | Ga0105247_10000086 | |||
| 1972 | Ga0105243_10003849 | |||
| 1973 | Ga0105243_10092126 | |||
| 1974 | Ga0105243_12744318 | |||
| 1975 | Ga0105241_10000001 | |||
| 1976 | Ga0105241_10130865 | |||
| 1977 | Ga0105241_12690589 | |||
| 1978 | Ga0105242_10002597 | |||
| 1979 | Ga0105242_10068733 | |||
| 1980 | Ga0105242_11474481 | |||
| 1981 | Ga0105242_11525997 | |||
| 1982 | Ga0105248_10253265 | |||
| 1983 | Ga0105237_10011495 | |||
| 1984 | Ga0105237_10150560 | |||
| 1985 | Ga0105237_10395502 | |||
| 1986 | Ga0105238_10001283 | |||
| 1987 | Ga0105238_10634030 | |||
| 1988 | Ga0105249_10340702 | |||
| 1989 | Ga0105239_10013831 | |||
| 1990 | Ga0105246_10073988 | |||
| 1991 | Ga0105246_10155285 | |||
| 1992 | Ga0105246_10493964 | |||
| 1993 | Ga0105246_11291391 | |||
| 1994 | Ga0157347_1033606 | |||
| 1995 | Ga0157373_10000200 | |||
| 1996 | Ga0157373_10005859 | |||
| 1997 | Ga0157373_10018164 | |||
| 1998 | Ga0157373_10029150 | |||
| 1999 | Ga0157373_10031860 | |||
| 2000 | Ga0157373_10040095 | |||
| 2001 | Ga0157373_10046256 | |||
| 2002 | Ga0157373_10137322 | |||
| 2003 | Ga0157373_10174876 | |||
| 2004 | Ga0157373_10258326 | |||
| 2005 | Ga0157371_10000067 | |||
| 2006 | Ga0157371_10000156 | |||
| 2007 | Ga0157371_10003023 | |||
| 2008 | Ga0157371_10006525 | |||
| 2009 | Ga0157371_10016466 | |||
| 2010 | Ga0157371_10028186 | |||
| 2011 | Ga0157371_10049077 | |||
| 2012 | Ga0157371_10146989 | |||
| 2013 | Ga0157371_10149671 | |||
| 2014 | Ga0157371_10381989 | |||
| 2015 | Ga0157371_10474916 | |||
| 2016 | Ga0157371_10503224 | |||
| 2017 | Ga0157371_11187912 | |||
| 2018 | Ga0157370_10000814 | |||
| 2019 | Ga0157370_10003193 | |||
| 2020 | Ga0157370_10003562 | |||
| 2021 | Ga0157370_10005747 | |||
| 2022 | Ga0157370_10028456 | |||
| 2023 | Ga0157370_10063234 | |||
| 2024 | Ga0157370_10067492 | |||
| 2025 | Ga0157370_10123676 | |||
| 2026 | Ga0157370_10181136 | |||
| 2027 | Ga0157370_10396757 | |||
| 2028 | Ga0157370_10544307 | |||
| 2029 | Ga0157370_11460098 | |||
| 2030 | Ga0157369_10002007 | |||
| 2031 | Ga0157369_10010610 | |||
| 2032 | Ga0157369_10016298 | |||
| 2033 | Ga0157369_10024085 | |||
| 2034 | Ga0157369_10650919 | |||
| 2035 | Ga0157374_10002106 | |||
| 2036 | Ga0157374_11778966 | |||
| 2037 | Ga0163162_10071042 | |||
| 2038 | Ga0163162_10071964 | |||
| 2039 | Ga0163162_10140414 | |||
| 2040 | Ga0163162_10259980 | |||
| 2041 | Ga0157372_10001630 | |||
| 2042 | Ga0157372_10001655 | |||
| 2043 | Ga0157372_10001723 | |||
| 2044 | Ga0157372_10003992 | |||
| 2045 | Ga0157372_10025560 | |||
| 2046 | Ga0157372_10056434 | |||
| 2047 | Ga0157372_10057183 | |||
| 2048 | Ga0157372_10117318 | |||
| 2049 | Ga0157372_10157175 | |||
| 2050 | Ga0157372_10457502 | |||
| 2051 | Ga0157372_10496574 | |||
| 2052 | Ga0157375_11572794 | |||
| 2053 | Ga0182008_10000877 | |||
| 2054 | Ga0182008_10001330 | |||
| 2055 | Ga0182008_10005352 | |||
| 2056 | Ga0182008_10009021 | |||
| 2057 | Ga0182008_10012011 | |||
| 2058 | Ga0182008_10081751 | |||
| 2059 | Ga0182008_10310770 | |||
| 2060 | Ga0157379_10003242 | |||
| 2061 | Ga0157376_11058796 | |||
| 2062 | Ga0182006_1000022 | |||
| 2063 | Ga0182006_1039514 | |||
| 2064 | Ga0182006_1045596 | |||
| 2065 | Ga0182006_1049881 | |||
| 2066 | Ga0182006_1050636 | |||
| 2067 | Ga0182006_1109871 | |||
| 2068 | Ga0182007_10003487 | |||
| 2069 | Ga0182007_10016771 | |||
| 2070 | Ga0182005_1000075 | |||
| 2071 | Ga0183366_1001 | |||
| 2072 | Ga0183370_1001 | |||
| 2073 | Ga0183362_10001 | |||
| 2074 | Ga0183369_1001 | |||
| 2075 | Ga0183368_1001 | |||
| 2076 | Ga0163161_10000001 | |||
| 2077 | Ga0163161_10019762 | |||
| 2078 | Ga0163161_10040757 | |||
| 2079 | Ga0163161_10055207 | |||
| 2080 | Ga0206356_10036066 | |||
| 2081 | Ga0206354_11653555 | |||
| 2082 | Ga0206353_11505629 | |||
| 2083 | Ga0154015_1259153 | |||
| 2084 | Ga0213874_10372997 | |||
| 2085 | Ga0213876_10000086 | |||
| 2086 | Ga0209760_100004 | |||
| 2087 | Ga0209760_101358 | |||
| 2088 | Ga0209436_101095 | |||
| 2089 | Ga0209436_103393 | |||
| 2090 | Ga0209784_100001 | |||
| 2091 | Ga0209784_100071 | |||
| 2092 | Ga0209566_100001 | |||
| 2093 | Ga0209566_100004 | |||
| 2094 | Ga0209674_100002 | |||
| 2095 | Ga0209674_100006 | |||
| 2096 | Ga0209672_100319 | |||
| 2097 | Ga0209147_101404 | |||
| 2098 | Ga0209563_100002 | |||
| 2099 | Ga0209563_100104 | |||
| 2100 | Ga0207427_100012 | |||
| 2101 | Ga0207427_100308 | |||
| 2102 | Ga0209437_100001 | |||
| 2103 | Ga0209437_100035 | |||
| 2104 | Ga0209437_100158 | |||
| 2105 | Ga0209258_100154 | |||
| 2106 | Ga0207425_1000215 | |||
| 2107 | Ga0207425_1002841 | |||
| 2108 | Ga0207425_1004676 | |||
| 2109 | Ga0207425_1013759 | |||
| 2110 | Ga0207425_1024413 | |||
| 2111 | Ga0207425_1026374 | |||
| 2112 | Ga0209677_100002 | |||
| 2113 | Ga0209677_100064 | |||
| 2114 | Ga0209677_112773 | |||
| 2115 | Ga0209148_1000145 | |||
| 2116 | Ga0209129_1000018 | |||
| 2117 | Ga0209129_1000054 | |||
| 2118 | Ga0209129_1000103 | |||
| 2119 | Ga0209129_1009530 | |||
| 2120 | Ga0209233_1000005 | |||
| 2121 | Ga0209233_1001009 | |||
| 2122 | Ga0209565_1000086 | |||
| 2123 | Ga0209565_1000317 | |||
| 2124 | Ga0209565_1001154 | |||
| 2125 | Ga0209565_1003106 | |||
| 2126 | Ga0209565_1005158 | |||
| 2127 | Ga0209455_1000399 | |||
| 2128 | Ga0209673_1000168 | |||
| 2129 | Ga0209673_1001793 | |||
| 2130 | Ga0209673_1009768 | |||
| 2131 | Ga0209130_1000206 | |||
| 2132 | Ga0209130_1001133 | |||
| 2133 | Ga0209130_1001531 | |||
| 2134 | Ga0209130_1001936 | |||
| 2135 | Ga0209130_1013485 | |||
| 2136 | Ga0209675_1000193 | |||
| 2137 | Ga0209675_1000548 | |||
| 2138 | Ga0209675_1002487 | |||
| 2139 | Ga0209675_1002730 | |||
| 2140 | Ga0209675_1005202 | |||
| 2141 | Ga0209675_1005551 | |||
| 2142 | Ga0209675_1019667 | |||
| 2143 | Ga0209676_1000053 | |||
| 2144 | Ga0209676_1000103 | |||
| 2145 | Ga0209676_1000290 | |||
| 2146 | Ga0209676_1004587 | |||
| 2147 | Ga0209676_1004993 | |||
| 2148 | Ga0209025_1000018 | |||
| 2149 | Ga0209025_1000034 | |||
| 2150 | Ga0209025_1000059 | |||
| 2151 | Ga0209025_1000073 | |||
| 2152 | Ga0209025_1000093 | |||
| 2153 | Ga0209025_1000201 | |||
| 2154 | Ga0209025_1003493 | |||
| 2155 | Ga0209025_1023935 | |||
| 2156 | Ga0209025_1035232 | |||
| 2157 | Ga0209025_1038171 | |||
| 2158 | Ga0209025_1062942 | |||
| 2159 | Ga0209564_1000301 | |||
| 2160 | Ga0209564_1000408 | |||
| 2161 | Ga0209564_1001285 | |||
| 2162 | Ga0209564_1003017 | |||
| 2163 | Ga0209564_1004316 | |||
| 2164 | Ga0209758_1000034 | |||
| 2165 | Ga0209758_1011927 | |||
| 2166 | Ga0209758_1034934 | |||
| 2167 | Ga0209758_1052022 | |||
| 2168 | Ga0209758_1114102 | |||
| 2169 | Ga0209050_1000012 | |||
| 2170 | Ga0209050_1001244 | |||
| 2171 | Ga0209050_1007544 | |||
| 2172 | Ga0209050_1009167 | |||
| 2173 | Ga0209256_1000066 | |||
| 2174 | Ga0209256_1000086 | |||
| 2175 | Ga0209256_1001063 | |||
| 2176 | Ga0209256_1003254 | |||
| 2177 | Ga0209256_1085940 | |||
| 2178 | Ga0207426_1000058 | |||
| 2179 | Ga0207426_1000067 | |||
| 2180 | Ga0207426_1000156 | |||
| 2181 | Ga0209051_1000019 | |||
| 2182 | Ga0209051_1000141 | |||
| 2183 | Ga0209051_1001450 | |||
| 2184 | Ga0209051_1001589 | |||
| 2185 | Ga0209051_1002728 | |||
| 2186 | Ga0209051_1053241 | |||
| 2187 | Ga0209051_1067377 | |||
| 2188 | Ga0209051_1075533 | |||
| 2189 | Ga0209257_1000024 | |||
| 2190 | Ga0209257_1003493 | |||
| 2191 | Ga0209257_1015612 | |||
| 2192 | Ga0207656_10004218 | |||
| 2193 | Ga0207656_10017790 | |||
| 2194 | Ga0207696_1000001 | |||
| 2195 | Ga0207696_1000070 | |||
| 2196 | Ga0207696_1000099 | |||
| 2197 | Ga0207696_1000170 | |||
| 2198 | Ga0207696_1000537 | |||
| 2199 | Ga0207696_1001040 | |||
| 2200 | Ga0207696_1002538 | |||
| 2201 | Ga0207696_1004683 | |||
| 2202 | Ga0207696_1007450 | |||
| 2203 | Ga0207696_1010764 | |||
| 2204 | Ga0207696_1012417 | |||
| 2205 | Ga0207696_1039647 | |||
| 2206 | Ga0207655_1000001 | |||
| 2207 | Ga0207655_1000009 | |||
| 2208 | Ga0207655_1000046 | |||
| 2209 | Ga0207655_1000071 | |||
| 2210 | Ga0207655_1000089 | |||
| 2211 | Ga0207655_1000215 | |||
| 2212 | Ga0207655_1000363 | |||
| 2213 | Ga0207655_1000506 | |||
| 2214 | Ga0207655_1000763 | |||
| 2215 | Ga0207655_1006208 | |||
| 2216 | Ga0207655_1015575 | |||
| 2217 | Ga0207655_1043112 | |||
| 2218 | Ga0207655_1060447 | |||
| 2219 | Ga0207713_1000001 | |||
| 2220 | Ga0207713_1000004 | |||
| 2221 | Ga0207713_1000018 | |||
| 2222 | Ga0207713_1000120 | |||
| 2223 | Ga0207713_1002665 | |||
| 2224 | Ga0207713_1004886 | |||
| 2225 | Ga0207713_1018235 | |||
| 2226 | Ga0207713_1018975 | |||
| 2227 | Ga0207713_1030329 | |||
| 2228 | Ga0207713_1035127 | |||
| 2229 | Ga0207713_1035833 | |||
| 2230 | Ga0207713_1071665 | |||
| 2231 | Ga0207713_1089201 | |||
| 2232 | Ga0207710_10000233 | |||
| 2233 | Ga0207710_10081304 | |||
| 2234 | Ga0207680_10011667 | |||
| 2235 | Ga0207647_10003226 | |||
| 2236 | Ga0207705_10000029 | |||
| 2237 | Ga0207705_10000755 | |||
| 2238 | Ga0207705_10056150 | |||
| 2239 | Ga0207705_10958300 | |||
| 2240 | Ga0207654_10000004 | |||
| 2241 | Ga0207654_10115476 | |||
| 2242 | Ga0207707_10000042 | |||
| 2243 | Ga0207707_10000144 | |||
| 2244 | Ga0207707_10001056 | |||
| 2245 | Ga0207707_10008129 | |||
| 2246 | Ga0207707_10206830 | |||
| 2247 | Ga0207695_10002071 | |||
| 2248 | Ga0207695_10010137 | |||
| 2249 | Ga0207695_10084151 | |||
| 2250 | Ga0207695_10367416 | |||
| 2251 | Ga0207671_10026936 | |||
| 2252 | Ga0207660_10000413 | |||
| 2253 | Ga0207662_10099146 | |||
| 2254 | Ga0207657_10592936 | |||
| 2255 | Ga0207649_10007256 | |||
| 2256 | Ga0207649_10015548 | |||
| 2257 | Ga0207649_10519784 | |||
| 2258 | Ga0207649_10566197 | |||
| 2259 | Ga0207652_10000082 | |||
| 2260 | Ga0207652_10000808 | |||
| 2261 | Ga0207652_10001430 | |||
| 2262 | Ga0207652_10345918 | |||
| 2263 | Ga0207681_10011213 | |||
| 2264 | Ga0207694_10021179 | |||
| 2265 | Ga0207694_10974166 | |||
| 2266 | Ga0207650_10811942 | |||
| 2267 | Ga0207644_10298919 | |||
| 2268 | Ga0207690_10004125 | |||
| 2269 | Ga0207690_10008721 | |||
| 2270 | Ga0207690_10298468 | |||
| 2271 | Ga0207706_10011328 | |||
| 2272 | Ga0207706_10174918 | |||
| 2273 | Ga0207686_10001018 | |||
| 2274 | Ga0207686_10240383 | |||
| 2275 | Ga0207686_10534495 | |||
| 2276 | Ga0207709_10001503 | |||
| 2277 | Ga0207669_10027614 | |||
| 2278 | Ga0207691_10545460 | |||
| 2279 | Ga0207711_10633536 | |||
| 2280 | Ga0207661_10015030 | |||
| 2281 | Ga0207661_11268292 | |||
| 2282 | Ga0207679_10077418 | |||
| 2283 | Ga0207679_10080577 | |||
| 2284 | Ga0207667_10000075 | |||
| 2285 | Ga0207667_10005022 | |||
| 2286 | Ga0207667_10007273 | |||
| 2287 | Ga0207667_10161254 | |||
| 2288 | Ga0207667_10385112 | |||
| 2289 | Ga0207651_10180586 | |||
| 2290 | Ga0207712_10961464 | |||
| 2291 | Ga0207712_11548013 | |||
| 2292 | Ga0207668_10007961 | |||
| 2293 | Ga0207668_10470819 | |||
| 2294 | Ga0207640_10010766 | |||
| 2295 | Ga0207640_10016893 | |||
| 2296 | Ga0207640_10022260 | |||
| 2297 | Ga0207640_10390751 | |||
| 2298 | Ga0207658_10205254 | |||
| 2299 | Ga0207658_10329316 | |||
| 2300 | Ga0207658_10566998 | |||
| 2301 | Ga0207658_11591886 | |||
| 2302 | Ga0207639_10001297 | |||
| 2303 | Ga0207639_10007637 | |||
| 2304 | Ga0207639_10047674 | |||
| 2305 | Ga0207639_10155920 | |||
| 2306 | Ga0207678_10001891 | |||
| 2307 | Ga0207678_10005658 | |||
| 2308 | Ga0207678_10052250 | |||
| 2309 | Ga0207702_10031604 | |||
| 2310 | Ga0207641_10161201 | |||
| 2311 | Ga0207674_10000712 | |||
| 2312 | Ga0207674_10003998 | |||
| 2313 | Ga0207674_10059041 | |||
| 2314 | Ga0207674_10353568 | |||
| 2315 | Ga0207675_100198346 | |||
| 2316 | Ga0207683_10014368 | |||
| 2317 | Ga0207683_10049183 | |||
| 2318 | Ga0207683_10484361 | |||
| 2319 | Ga0207683_11617527 | |||
| 2320 | Ga0207698_10000358 | |||
| 2321 | Ga0207698_10313763 | |||
| 2322 | Ga0209281_1000001 | |||
| 2323 | Ga0209281_1000003 | |||
| 2324 | Ga0209281_1000114 | |||
| 2325 | Ga0209281_1000180 | |||
| 2326 | Ga0209281_1000229 | |||
| 2327 | Ga0209281_1000267 | |||
| 2328 | Ga0209281_1000288 | |||
| 2329 | Ga0209281_1000383 | |||
| 2330 | Ga0209281_1000722 | |||
| 2331 | Ga0209281_1001917 | |||
| 2332 | Ga0209281_1002477 | |||
| 2333 | Ga0209973_1037991 | |||
| 2334 | Ga0209371_1000001 | |||
| 2335 | Ga0209371_1000010 | |||
| 2336 | Ga0209371_1000020 | |||
| 2337 | Ga0209371_1000081 | |||
| 2338 | Ga0209371_1000085 | |||
| 2339 | Ga0209371_1000086 | |||
| 2340 | Ga0209371_1000167 | |||
| 2341 | Ga0209371_1000321 | |||
| 2342 | Ga0209371_1000349 | |||
| 2343 | Ga0209371_1000616 | |||
| 2344 | Ga0209371_1000809 | |||
| 2345 | Ga0209371_1001073 | |||
| 2346 | Ga0209371_1002095 | |||
| 2347 | Ga0209371_1002126 | |||
| 2348 | Ga0209371_1002299 | |||
| 2349 | Ga0209371_1002407 | |||
| 2350 | Ga0209371_1002837 | |||
| 2351 | Ga0209371_1003155 | |||
| 2352 | Ga0209371_1003489 | |||
| 2353 | Ga0209371_1003616 | |||
| 2354 | Ga0209371_1021256 | |||
| 2355 | Ga0209371_1046577 | |||
| 2356 | Ga0209371_1047234 | |||
| 2357 | Ga0209371_1062786 | |||
| 2358 | Ga0209999_1043668 | |||
| 2359 | Ga0210002_1020944 | |||
| 2360 | Ga0209282_1000043 | |||
| 2361 | Ga0209971_1001163 | |||
| 2362 | Ga0209971_1169283 | |||
| 2363 | Ga0209974_10010341 | |||
| 2364 | Ga0268266_10000282 | |||
| 2365 | Ga0268266_10025201 | |||
| 2366 | Ga0268266_10180251 | |||
| 2367 | Ga0268266_11456353 | |||
| 2368 | Ga0268265_10139443 | |||
| 2369 | Ga0268264_10304937 | |||
| 2370 | Ga0265323_10010795 | |||
| 2371 | Ga0307515_10000626 | |||
| 2372 | Ga0307515_10001303 | |||
| 2373 | Ga0307515_10032622 | |||
| 2374 | Ga0265324_10056153 | |||
| 2375 | Ga0268256_1000001 | |||
| 2376 | Ga0268256_1000003 | |||
| 2377 | Ga0268256_1000048 | |||
| 2378 | Ga0268256_1000092 | |||
| 2379 | Ga0268256_1000114 | |||
| 2380 | Ga0268256_1000124 | |||
| 2381 | Ga0268256_1000175 | |||
| 2382 | Ga0268256_1000532 | |||
| 2383 | Ga0268256_1000920 | |||
| 2384 | Ga0268256_1001027 | |||
| 2385 | Ga0268256_1001435 | |||
| 2386 | Ga0268256_1001749 | |||
| 2387 | Ga0268256_1002069 | |||
| 2388 | Ga0268256_1002830 | |||
| 2389 | Ga0268256_1003160 | |||
| 2390 | Ga0268256_1004676 | |||
| 2391 | Ga0268256_1007695 | |||
| 2392 | Ga0268256_1017912 | |||
| 2393 | Ga0268256_1018423 | |||
| 2394 | Ga0268256_1023884 | |||
| 2395 | Ga0268256_1052542 | |||
| 2396 | Ga0316177_1037186 | |||
| 2397 | Ga0316176_1061113 | |||
| 2398 | Ga0314311_1031728 | |||
| 2399 | Ga0316179_1098736 | |||
| 2400 | Ga0316178_1015612 | |||
| 2401 | Ga0316180_1126976 | |||
| 2402 | Ga0316183_1122932 | |||
| 2403 | Ga0316181_1114225 | |||
| 2404 | Ga0316182_1103194 | |||
| 2405 | Ga0265330_10004252 | |||
| 2406 | Ga0265332_10019389 | |||
| 2407 | Ga0265328_10327217 | |||
| 2408 | Ga0265331_10003913 | |||
| 2409 | Ga0265331_10105558 | |||
| 2410 | Ga0265327_10000133 | |||
| 2411 | Ga0265327_10002852 | |||
| 2412 | Ga0265327_10015025 | |||
| 2413 | Ga0265327_10024914 | |||
| 2414 | Ga0265327_10025409 | |||
| 2415 | Ga0265327_10393824 | |||
| 2416 | Ga0265316_10147424 | |||
| 2417 | Ga0307408_100009699 | |||
| 2418 | Ga0307408_100014538 | |||
| 2419 | Ga0307408_100033660 | |||
| 2420 | Ga0307408_100161444 | |||
| 2421 | Ga0307408_100323091 | |||
| 2422 | Ga0307514_10000711 | |||
| 2423 | Ga0307514_10173650 | |||
| 2424 | Ga0316575_10024298 | |||
| 2425 | Ga0316579_10046342 | |||
| 2426 | Ga0265314_10008686 | |||
| 2427 | Ga0316576_10557731 | |||
| 2428 | Ga0316578_10079152 | |||
| 2429 | Ga0316578_10118438 | |||
| 2430 | Ga0307405_10058452 | |||
| 2431 | Ga0307405_10144393 | |||
| 2432 | Ga0307405_10180638 | |||
| 2433 | Ga0307405_10310911 | |||
| 2434 | Ga0307405_10321329 | |||
| 2435 | Ga0307405_10362857 | |||
| 2436 | Ga0307405_10427102 | |||
| 2437 | Ga0307405_10874541 | |||
| 2438 | Ga0307405_10897101 | |||
| 2439 | Ga0316577_10041516 | |||
| 2440 | Ga0316577_10057099 | |||
| 2441 | Ga0316577_10062977 | |||
| 2442 | Ga0307413_10082572 | |||
| 2443 | Ga0307413_10347186 | |||
| 2444 | Ga0307406_10003334 | |||
| 2445 | Ga0307406_10007375 | |||
| 2446 | Ga0307406_10029379 | |||
| 2447 | Ga0307406_10109880 | |||
| 2448 | Ga0307406_10319528 | |||
| 2449 | Ga0307406_11635513 | |||
| 2450 | Ga0307412_10019109 | |||
| 2451 | Ga0307412_10128246 | |||
| 2452 | Ga0307412_10242227 | |||
| 2453 | Ga0307412_10423382 | |||
| 2454 | Ga0307412_12210232 | |||
| 2455 | Ga0307409_100887652 | |||
| 2456 | Ga0307416_100408334 | |||
| 2457 | Ga0307416_100431182 | |||
| 2458 | Ga0307416_101951500 | |||
| 2459 | Ga0307416_102284103 | |||
| 2460 | Ga0307416_102326572 | |||
| 2461 | Ga0307414_10177984 | |||
| 2462 | Ga0307414_10339772 | |||
| 2463 | Ga0307414_10553731 | |||
| 2464 | Ga0307414_11822512 | |||
| 2465 | Ga0307411_10019468 | |||
| 2466 | Ga0307411_10201421 | |||
| 2467 | Ga0307411_10261224 | |||
| 2468 | Ga0316580_10045072 | |||
| 2469 | Ga0316580_10237488 | |||
| 2470 | Ga0307510_10232500 | |||
| 2471 | Ga0316587_1000878 | |||
| 2472 | Ga0316574_0019624 | |||
| 2473 | Ga0316574_0212159 | |||
| 2474 | Ga0316582_0012653 | |||
| 2475 | Ga0316582_0139520 | |||
| 2476 | Ga0316582_0207199 | |||
| 2477 | Ga0316582_0254001 | |||
| 2478 | Ga0316584_0003227 | |||
| 2479 | Ga0316584_0007399 | |||
| 2480 | Ga0316584_0058252 | |||
| 2481 | Ga0316584_0137779 | |||
| 2482 | Ga0395900_0067131 | |||
| 2483 | Ga0395900_0359565 | |||
| 2484 | Ga0395898_0167266 | |||
| 2485 | Ga0395898_0368686 | |||
| 2486 | Ga0395905_0229337 | |||
| 2487 | Ga0316581_0035288 | |||
| 2488 | Ga0395901_0642429 | |||
| 2489 | Ga0395901_1003615 | |||
| 2490 | Ga0395901_1886488 | |||
| 2491 | Ga0436365_1037676 | |||
| 2492 | Ga0436361_0079908 | |||
| 2493 | Ga0436361_1010587 | |||
| 2494 | Ga0436363_0982124 | |||
| 2495 | Ga0439436_0000336 | |||
| 2496 | Ga0439436_0002994 | |||
| 2497 | Ga0439438_000001 | |||
| 2498 | Ga0439438_001188 | |||
| 2499 | Ga0439438_001930 | |||
| 2500 | Ga0439438_008658 | |||
| 2501 | Ga0439438_034767 | |||
| 2502 | Ga0439439_0003042 | |||
| 2503 | Ga0439439_0014282 | |||
| 2504 | Ga0439447_004155 | |||
| 2505 | Ga0439447_005376 | |||
| 2506 | Ga0439447_028060 | |||
| 2507 | Ga0439461_0065771 | |||
| 2508 | Ga0439466_0000003 | |||
| 2509 | Ga0439466_0058052 | |||
| 2510 | Ga0439466_0218156 | |||
| 2511 | Ga0439465_0000517 | |||
| 2512 | Ga0451791_0103488 | |||
| 2513 | Ga0451791_0972312 | |||
| 2514 | Ga0451793_1583412 | |||
| 2515 | Ga0451795_0579443 | |||
| 2516 | Ga0451802_0881816 | |||
| 2517 | Ga0451805_033409 | |||
| 2518 | Ga0451847_0790351 | |||
| 2519 | Ga0451853_2599509 | |||
| 2520 | Ga0451853_3098869 | |||
| 2521 | Ga0439431_0002606 | |||
| 2522 | Ga0439431_0276272 | |||
| 2523 | Ga0439433_0024432 | |||
| 2524 | Ga0439433_0038479 | |||
| 2525 | Ga0439442_002961 | |||
| 2526 | Ga0439445_0000347 | |||
| 2527 | Ga0439445_0003104 | |||
| 2528 | Ga0439445_0200499 | |||
| 2529 | Ga0439448_0244134 | |||
| 2530 | Ga0439432_000662 | |||
| 2531 | Ga0439432_008144 | |||
| 2532 | Ga0439432_010037 | |||
| 2533 | Ga0439432_010592 | |||
| 2534 | Ga0439432_014689 | |||
| 2535 | Ga0439432_125770 | |||
| 2536 | Ga0439432_201852 | |||
| 2537 | Ga0439449_0000838 | |||
| 2538 | Ga0439449_0009132 | |||
| 2539 | Ga0439449_0184117 | |||
| 2540 | Ga0439451_047755 | |||
| 2541 | Ga0439452_000001 | |||
| 2542 | Ga0439452_000003 | |||
| 2543 | Ga0439452_000006 | |||
| 2544 | Ga0439452_000008 | |||
| 2545 | Ga0439452_000161 | |||
| 2546 | Ga0439452_000216 | |||
| 2547 | Ga0439452_000949 | |||
| 2548 | Ga0439452_002479 | |||
| 2549 | Ga0439457_011278 | |||
| 2550 | Ga0439462_0000328 | |||
| 2551 | Ga0439462_0002574 | |||
| 2552 | Ga0439463_006410 | |||
| 2553 | Ga0450911_000124 | |||
| 2554 | Ga0450922_001261 | |||
| 2555 | Ga0450922_004419 | |||
| 2556 | Ga0450923_000221 | |||
| 2557 | Ga0450923_013904 | |||
| 2558 | Ga0450890_007058 | |||
| 2559 | Ga0450894_010619 | |||
| 2560 | Ga0450898_012816 | |||
| 2561 | Ga0450900_017373 | |||
| 2562 | Ga0450902_019005 | |||
| 2563 | Ga0450907_000329 | |||
| 2564 | Ga0439446_0014658 | |||
| 2565 | Ga0439446_0176825 | |||
| 2566 | Ga0450909_012251 | |||
| 2567 | Ga0450909_015394 | |||
| 2568 | Ga0439434_0002221 | |||
| 2569 | Ga0439434_0086096 | |||
| 2570 | Ga0439464_0000625 | |||
| 2571 | Ga0439464_0003541 | |||
| 2572 | Ga0439464_0019306 | |||
| 2573 | Ga0439464_0044551 | |||
| 2574 | Ga0450893_0003283 | |||
| 2575 | Ga0450893_0004785 | |||
| 2576 | Ga0450893_0039760 | |||
| 2577 | Ga0451577_0014209 | |||
| 2578 | Ga0451577_0025812 | |||
| 2579 | Ga0451577_0118887 | |||
| 2580 | Ga0451577_1176457 | |||
| 2581 | Ga0466977_0000007 | |||
| 2582 | Ga0466981_0000016 | |||
| 2583 | Ga0453683_0504451 | |||
| 2584 | Ga0466961_0023977 | |||
| 2585 | Ga0453684_0000917 | |||
| 2586 | Ga0453684_0014200 | |||
| 2587 | Ga0453684_0693932 | |||
| 2588 | Ga0453684_1211732 | |||
| 2589 | Ga0466970_0209074 | |||
| 2590 | Ga0466960_0037103 | |||
| 2591 | Ga0451576_0252121 | |||
| 2592 | Ga0495617_012114 | |||
| 2593 | Ga0495617_031455 | |||
| 2594 | Ga0495627_000027 | |||
| 2595 | Ga0495627_073184 | |||
| 2596 | Ga0495627_162336 | |||
| 2597 | Ga0495592_0016839 | |||
| 2598 | Ga0495592_0206827 | |||
| 2599 | Ga0495591_000014 | |||
| 2600 | Ga0495591_000238 | |||
| 2601 | Ga0495591_002770 | |||
| 2602 | Ga0495591_005174 | |||
| 2603 | Ga0495591_084621 | |||
| 2604 | Ga0495638_0002381 | |||
| 2605 | Ga0495638_0013990 | |||
| 2606 | Ga0495651_0005777 | |||
| 2607 | Ga0495651_0414476 | |||
| 2608 | Ga0495653_0198914 | |||
| 2609 | Ga0495650_0000002 | |||
| 2610 | Ga0495650_0000021 | |||
| 2611 | Ga0495650_0000032 | |||
| 2612 | Ga0495650_0000396 | |||
| 2613 | Ga0495650_0000478 | |||
| 2614 | Ga0495605_0004250 | |||
| 2615 | Ga0495605_0004747 | |||
| 2616 | Ga0495605_0033547 | |||
| 2617 | Ga0495605_0073615 | |||
| 2618 | Ga0495605_0127430 | |||
| 2619 | Ga0495639_0006891 | |||
| 2620 | Ga0495584_0006445 | |||
| 2621 | Ga0495584_0034114 | |||
| 2622 | Ga0495585_0004620 | |||
| 2623 | Ga0495594_0007426 | |||
| 2624 | Ga0495596_0000001 | |||
| 2625 | Ga0495596_0000366 | |||
| 2626 | Ga0495596_0045021 | |||
| 2627 | Ga0495607_0000175 | |||
| 2628 | Ga0495607_0007488 | |||
| 2629 | Ga0495607_0009243 | |||
| 2630 | Ga0495607_0178868 | |||
| 2631 | Ga0495606_0001314 | |||
| 2632 | Ga0495606_0231995 | |||
| 2633 | Ga0495608_0006970 | |||
| 2634 | Ga0495610_0000002 | |||
| 2635 | Ga0495610_0001226 | |||
| 2636 | Ga0495610_0029233 | |||
| 2637 | Ga0495616_0001943 | |||
| 2638 | Ga0495616_0002001 | |||
| 2639 | Ga0495616_0086880 | |||
| 2640 | Ga0495618_0012760 | |||
| 2641 | Ga0495618_0028883 | |||
| 2642 | Ga0495618_0106009 | |||
| 2643 | Ga0495620_0003066 | |||
| 2644 | Ga0495620_0141600 | |||
| 2645 | Ga0495620_0145922 | |||
| 2646 | Ga0495620_0147396 | |||
| 2647 | Ga0495628_0000059 | |||
| 2648 | Ga0495628_0006630 | |||
| 2649 | Ga0495628_0295816 | |||
| 2650 | Ga0495628_0548866 | |||
| 2651 | Ga0495630_0123685 | |||
| 2652 | Ga0495631_0000414 | |||
| 2653 | Ga0495632_0007880 | |||
| 2654 | Ga0495632_0011349 | |||
| 2655 | Ga0495632_0131606 | |||
| 2656 | Ga0495632_0354786 | |||
| 2657 | Ga0495637_0000005 | |||
| 2658 | Ga0495637_0031616 | |||
| 2659 | Ga0495643_0000002 | |||
| 2660 | Ga0495643_0019114 | |||
| 2661 | Ga0495643_0022631 | |||
| 2662 | Ga0495643_0025319 | |||
| 2663 | Ga0495643_0028334 | |||
| 2664 | Ga0495643_0081546 | |||
| 2665 | Ga0495644_0002242 | |||
| 2666 | Ga0495648_0000299 | |||
| 2667 | Ga0495648_0006462 | |||
| 2668 | Ga0495648_0021944 | |||
| 2669 | Ga0495663_0142351 | |||
| 2670 | Ga0495666_0001981 | |||
| 2671 | Ga0495666_0035617 | |||
| 2672 | Ga0495666_0499409 | |||
| 2673 | Ga0495652_0004625 | |||
| 2674 | Ga0495652_0035985 | |||
| 2675 | Ga0495654_0000019 | |||
| 2676 | Ga0495654_0001152 | |||
| 2677 | Ga0495654_0002661 | |||
| 2678 | Ga0495654_0008751 | |||
| 2679 | Ga0495654_0011360 | |||
| 2680 | Ga0495654_0053428 | |||
| 2681 | Ga0495654_0054888 | |||
| 2682 | Ga0495654_0082084 | |||
| 2683 | Ga0495654_0183630 | |||
| 2684 | Ga0495586_0097772 | |||
| 2685 | Ga0495587_0823400 | |||
| 2686 | Ga0495609_0010849 | |||
| 2687 | Ga0495621_0004439 | |||
| 2688 | Ga0495597_0000015 | |||
| 2689 | Ga0495597_0000720 | |||
| 2690 | Ga0495597_0001359 | |||
| 2691 | Ga0495597_0020433 | |||
| 2692 | Ga0495645_0054792 | |||
| 2693 | Ga0495645_0181366 | |||
| 2694 | Ga0495622_0013458 | |||
| 2695 | Ga0495656_0005434 | |||
| 2696 | Ga0495656_0007291 | |||
| 2697 | Ga0495668_0053240 | |||
| 2698 | Ga0495634_0069678 | |||
| 2699 | Ga0495611_0035919 | |||
| 2700 | Ga0495611_0401145 | |||
| 2701 | Ga0495625_0004458 | |||
| 2702 | Ga0495625_0005285 | |||
| 2703 | Ga0495625_0014435 | |||
| 2704 | Ga0495635_0083588 | |||
| 2705 | Ga0495635_0172144 | |||
| 2706 | Ga0495661_0009993 | |||
| 2707 | Ga0495588_0000437 | |||
| 2708 | Ga0495657_0043991 | |||
| 2709 | Ga0495599_0003585 | |||
| 2710 | Ga0495623_0003538 | |||
| 2711 | Ga0495646_0002246 | |||
| 2712 | Ga0495646_0014471 | |||
| 2713 | Ga0495646_0441126 | |||
| 2714 | Ga0495647_0067036 | |||
| 2715 | Ga0495658_0042769 | |||
| 2716 | Ga0495669_0147709 | |||
| 2717 | Ga0495613_0714846 | |||
| 2718 | Ga0495624_0008986 | |||
| 2719 | Ga0495624_0020855 | |||
| 2720 | Ga0495624_0255279 | |||
| 2721 | Ga0495670_0016534 | |||
| 2722 | Ga0495670_0016868 | |||
| 2723 | Ga0495671_0001044 | |||
| 2724 | Ga0495671_0001269 | |||
| 2725 | Ga0495671_0008856 | |||
| 2726 | Ga0495671_0258152 | |||
| 2727 | Ga0495649_0013339 | |||
| 2728 | Ga0495649_0014855 | |||
| 2729 | Ga0495649_0042287 | |||
| 2730 | Ga0495649_0107137 | |||
| 2731 | Ga0495589_0000001 | |||
| 2732 | Ga0495589_0039635 | |||
| 2733 | Ga0495589_0052967 | |||
| 2734 | Ga0495600_0003774 | |||
| 2735 | Ga0495600_0511904 | |||
| 2736 | Ga0495600_0682364 | |||
| 2737 | Ga0495660_0000004 | |||
| 2738 | Ga0495660_0000021 | |||
| 2739 | Ga0495660_0006528 | |||
| 2740 | Ga0495660_0037106 | |||
| 2741 | Ga0495604_0001830 | |||
| 2742 | Ga0495604_0014340 | |||
| 2743 | Ga0495604_0391285 | |||
| 2744 | Ga0495636_0010570 | |||
| 2745 | Ga0495672_0000002 | |||
| 2746 | Ga0495672_0000012 | |||
| 2747 | Ga0495672_0000020 | |||
| 2748 | Ga0495672_0024648 | |||
| 2749 | Ga0495672_0215417 | |||
| 2750 | Ga0495676_0008592 | |||
| 2751 | Ga0495683_0020678 | |||
| 2752 | Ga0495677_0413493 | |||
| 2753 | Ga0495679_000020 | |||
| 2754 | Ga0495679_002132 | |||
| 2755 | Ga0495679_002328 | |||
| 2756 | Ga0495679_047995 | |||
| 2757 | Ga0495685_004966 | |||
| 2758 | Ga0495673_0000065 | |||
| 2759 | Ga0495673_0000081 | |||
| 2760 | Ga0495681_0000088 | |||
| 2761 | Ga0495681_0000426 | |||
| 2762 | Ga0495686_0060309 | |||
| 2763 | Ga0495593_0034149 | |||
| 2764 | Ga0495593_0487597 | |||
| 2765 | Ga0495602_0012279 | |||
| 2766 | Ga0495602_0147112 | |||
| 2767 | Ga0495602_0375023 | |||
| 2768 | Ga0495614_0004433 | |||
| 2769 | Ga0495626_0000001 | |||
| 2770 | Ga0496100_0006740 | |||
| 2771 | Ga0496100_0013256 | |||
| 2772 | Ga0496100_0028570 | |||
| 2773 | Ga0496100_0125278 | |||
| 2774 | Ga0496100_1483057 | |||
| 2775 | Ga0496101_0000314 | |||
| 2776 | Ga0496101_0025960 | |||
| 2777 | Ga0496101_0203711 | |||
| 2778 | Ga0496101_0383973 | |||
| 2779 | Ga0496101_0592517 | |||
| 2780 | Ga0496101_0927755 | |||
| 2781 | Ga0496101_1288540 | |||
| 2782 | Ga0496102_0005511 | |||
| 2783 | Ga0496102_0108549 | |||
| 2784 | Ga0496102_0266586 | |||
| 2785 | Ga0496102_0493239 | |||
| 2786 | Ga0496103_0092134 | |||
| 2787 | Ga0496103_0172794 | |||
| 2788 | Ga0496103_0646170 | |||
| 2789 | Ga0496104_0000893 | |||
| 2790 | Ga0496104_0001151 | |||
| 2791 | Ga0496104_0452682 | |||
| 2792 | Ga0496104_1047988 | |||
| 2793 | Ga0496104_1632241 | |||
| 2794 | Ga0496105_0001685 | |||
| 2795 | Ga0496105_0019956 | |||
| 2796 | Ga0496105_0118704 | |||
| 2797 | Ga0496105_0157490 | |||
| 2798 | Ga0496106_0048665 | |||
| 2799 | Ga0496106_1184926 | |||
| 2800 | Ga0496107_0257645 | |||
| 2801 | Ga0496107_0700337 | |||
| 2802 | Ga0496108_0059934 | |||
| 2803 | Ga0496109_0078498 | |||
| 2804 | Ga0496110_0306314 | |||
| 2805 | Ga0496110_1212553 | |||
| 2806 | Ga0496110_1303227 | |||
| 2807 | Ga0496113_0110179 | |||
| 2808 | Ga0496113_0182493 | |||
| 2809 | Ga0496113_0747444 | |||
| 2810 | Ga0496114_0634583 | |||
| 2811 | Ga0496116_0000001 | |||
| 2812 | Ga0496116_0000094 | |||
| 2813 | Ga0496116_0000261 | |||
| 2814 | Ga0496116_0000431 | |||
| 2815 | Ga0496116_0000679 | |||
| 2816 | Ga0496116_0000738 | |||
| 2817 | Ga0496116_0000930 | |||
| 2818 | Ga0496116_0002175 | |||
| 2819 | Ga0496116_0005086 | |||
| 2820 | Ga0496116_0007904 | |||
| 2821 | Ga0496116_0011708 | |||
| 2822 | Ga0496116_0015751 | |||
| 2823 | Ga0496116_0017298 | |||
| 2824 | Ga0496116_0018592 | |||
| 2825 | Ga0496116_0023072 | |||
| 2826 | Ga0496116_0035310 | |||
| 2827 | Ga0496116_0084036 | |||
| 2828 | Ga0496116_0088658 | |||
| 2829 | Ga0496116_0125206 | |||
| 2830 | Ga0496116_0166367 | |||
| 2831 | Ga0496116_0270833 | |||
| 2832 | Ga0496117_0000004 | |||
| 2833 | Ga0496117_0000213 | |||
| 2834 | Ga0496117_0001414 | |||
| 2835 | Ga0496117_0002234 | |||
| 2836 | Ga0496117_0002320 | |||
| 2837 | Ga0496117_0003205 | |||
| 2838 | Ga0496117_0007415 | |||
| 2839 | Ga0496117_0008133 | |||
| 2840 | Ga0496117_0009227 | |||
| 2841 | Ga0496117_0010043 | |||
| 2842 | Ga0496117_0012413 | |||
| 2843 | Ga0496117_0015407 | |||
| 2844 | Ga0496117_0035442 | |||
| 2845 | Ga0496117_0035885 | |||
| 2846 | Ga0496117_0039172 | |||
| 2847 | Ga0496117_0044550 | |||
| 2848 | Ga0496117_0046718 | |||
| 2849 | Ga0496117_0063088 | |||
| 2850 | Ga0496117_0086922 | |||
| 2851 | Ga0496117_0124537 | |||
| 2852 | Ga0496117_0147540 | |||
| 2853 | Ga0496118_0000072 | |||
| 2854 | Ga0496118_0000137 | |||
| 2855 | Ga0496118_0001157 | |||
| 2856 | Ga0496118_0002508 | |||
| 2857 | Ga0496118_0003626 | |||
| 2858 | Ga0496118_0003664 | |||
| 2859 | Ga0496118_0008346 | |||
| 2860 | Ga0496118_0008657 | |||
| 2861 | Ga0496118_0022858 | |||
| 2862 | Ga0496118_0023065 | |||
| 2863 | Ga0496118_0031286 | |||
| 2864 | Ga0496118_0031499 | |||
| 2865 | Ga0496118_0045544 | |||
| 2866 | Ga0496118_0117588 | |||
| 2867 | Ga0496118_0236351 | |||
| 2868 | Ga0496118_0330465 | |||
| 2869 | Ga0496119_0000008 | |||
| 2870 | Ga0496119_0000080 | |||
| 2871 | Ga0496119_0000156 | |||
| 2872 | Ga0496119_0000677 | |||
| 2873 | Ga0496119_0002331 | |||
| 2874 | Ga0496119_0002686 | |||
| 2875 | Ga0496119_0004122 | |||
| 2876 | Ga0496119_0004498 | |||
| 2877 | Ga0496119_0005466 | |||
| 2878 | Ga0496119_0007741 | |||
| 2879 | Ga0496119_0019148 | |||
| 2880 | Ga0496119_0019675 | |||
| 2881 | Ga0496119_0034475 | |||
| 2882 | Ga0496119_0242819 | |||
| 2883 | Ga0496119_0246500 | |||
| 2884 | Ga0496120_0000035 | |||
| 2885 | Ga0496120_0000040 | |||
| 2886 | Ga0496120_0000075 | |||
| 2887 | Ga0496120_0000128 | |||
| 2888 | Ga0496120_0000302 | |||
| 2889 | Ga0496120_0000477 | |||
| 2890 | Ga0496120_0002786 | |||
| 2891 | Ga0496120_0003693 | |||
| 2892 | Ga0496120_0003747 | |||
| 2893 | Ga0496120_0003837 | |||
| 2894 | Ga0496120_0005107 | |||
| 2895 | Ga0496120_0006986 | |||
| 2896 | Ga0496120_0035747 | |||
| 2897 | Ga0496120_0043456 | |||
| 2898 | Ga0496120_0073631 | |||
| 2899 | Ga0496121_0000047 | |||
| 2900 | Ga0496121_0000124 | |||
| 2901 | Ga0496121_0001134 | |||
| 2902 | Ga0496121_0002661 | |||
| 2903 | Ga0496121_0002930 | |||
| 2904 | Ga0496121_0003880 | |||
| 2905 | Ga0496121_0007669 | |||
| 2906 | Ga0496121_0010355 | |||
| 2907 | Ga0496121_0015160 | |||
| 2908 | Ga0496121_0015971 | |||
| 2909 | Ga0496121_0035885 | |||
| 2910 | Ga0496121_0038890 | |||
| 2911 | Ga0496121_0041514 | |||
| 2912 | Ga0496121_0052914 | |||
| 2913 | Ga0496121_0056690 | |||
| 2914 | Ga0496122_0000007 | |||
| 2915 | Ga0496122_0000033 | |||
| 2916 | Ga0496122_0000130 | |||
| 2917 | Ga0496122_0000356 | |||
| 2918 | Ga0496122_0001024 | |||
| 2919 | Ga0496122_0001367 | |||
| 2920 | Ga0496122_0001535 | |||
| 2921 | Ga0496122_0004005 | |||
| 2922 | Ga0496122_0004980 | |||
| 2923 | Ga0496122_0006622 | |||
| 2924 | Ga0496122_0007333 | |||
| 2925 | Ga0496122_0012310 | |||
| 2926 | Ga0496122_0018241 | |||
| 2927 | Ga0496122_0035075 | |||
| 2928 | Ga0496122_0052511 | |||
| 2929 | Ga0496122_0053063 | |||
| 2930 | Ga0496122_0063042 | |||
| 2931 | Ga0496122_0067614 | |||
| 2932 | Ga0496122_0067953 | |||
| 2933 | Ga0496122_0085176 | |||
| 2934 | Ga0496122_0089083 | |||
| 2935 | Ga0496122_0126517 | |||
| 2936 | Ga0496122_0137705 | |||
| 2937 | Ga0496122_0142086 | |||
| 2938 | Ga0496122_0248225 | |||
| 2939 | Ga0496123_0000004 | |||
| 2940 | Ga0496123_0000064 | |||
| 2941 | Ga0496123_0000248 | |||
| 2942 | Ga0496123_0000263 | |||
| 2943 | Ga0496123_0000309 | |||
| 2944 | Ga0496123_0000827 | |||
| 2945 | Ga0496123_0001080 | |||
| 2946 | Ga0496123_0002455 | |||
| 2947 | Ga0496123_0003432 | |||
| 2948 | Ga0496123_0003815 | |||
| 2949 | Ga0496123_0005121 | |||
| 2950 | Ga0496123_0006692 | |||
| 2951 | Ga0496123_0008295 | |||
| 2952 | Ga0496123_0012224 | |||
| 2953 | Ga0496123_0031257 | |||
| 2954 | Ga0496123_0031549 | |||
| 2955 | Ga0496123_0037990 | |||
| 2956 | Ga0496123_0048163 | |||
| 2957 | Ga0496123_0080653 | |||
| 2958 | Ga0496123_0107980 | |||
| 2959 | Ga0496123_0135435 | |||
| 2960 | Ga0496123_0186925 | |||
| 2961 | Ga0496123_0231341 | |||
| 2962 | Ga0496123_0382431 | |||
| 2963 | Ga0496124_0000004 | |||
| 2964 | Ga0496124_0000008 | |||
| 2965 | Ga0496124_0000025 | |||
| 2966 | Ga0496124_0000097 | |||
| 2967 | Ga0496124_0000180 | |||
| 2968 | Ga0496124_0000659 | |||
| 2969 | Ga0496124_0001108 | |||
| 2970 | Ga0496124_0001496 | |||
| 2971 | Ga0496124_0005507 | |||
| 2972 | Ga0496124_0006593 | |||
| 2973 | Ga0496124_0011293 | |||
| 2974 | Ga0496124_0012761 | |||
| 2975 | Ga0496124_0018225 | |||
| 2976 | Ga0496124_0025818 | |||
| 2977 | Ga0496124_0028216 | |||
| 2978 | Ga0496124_0043725 | |||
| 2979 | Ga0496124_0050738 | |||
| 2980 | Ga0496124_0092781 | |||
| 2981 | Ga0496124_0102126 | |||
| 2982 | Ga0496124_0110891 | |||
| 2983 | Ga0496124_0114707 | |||
| 2984 | Ga0496124_0121468 | |||
| 2985 | Ga0496124_0126256 | |||
| 2986 | Ga0496124_0140729 | |||
| 2987 | Ga0496124_0275538 | |||
| 2988 | Ga0496124_0289900 | |||
| 2989 | Ga0496124_0396997 | |||
| 2990 | Ga0496124_0417766 | |||
| 2991 | Ga0496124_0498316 | |||
| 2992 | Ga0496124_0963776 | |||
| 2993 | Ga0496125_0000013 | |||
| 2994 | Ga0496125_0000055 | |||
| 2995 | Ga0496125_0003192 | |||
| 2996 | Ga0496125_0004562 | |||
| 2997 | Ga0496125_0011417 | |||
| 2998 | Ga0496125_0012992 | |||
| 2999 | Ga0496125_0019540 | |||
| 3000 | Ga0496125_0031099 | |||
| 3001 | Ga0496125_0031681 | |||
| 3002 | Ga0496125_0033541 | |||
| 3003 | Ga0496125_0051081 | |||
| 3004 | Ga0496125_0056246 | |||
| 3005 | Ga0496125_0065514 | |||
| 3006 | Ga0496125_0101308 | |||
| 3007 | Ga0496125_0102529 | |||
| 3008 | Ga0496125_0125272 | |||
| 3009 | Ga0496125_0172485 | |||
| 3010 | Ga0496126_0000524 | |||
| 3011 | Ga0496126_0001242 | |||
| 3012 | Ga0496126_0001275 | |||
| 3013 | Ga0496126_0002571 | |||
| 3014 | Ga0496126_0004513 | |||
| 3015 | Ga0496126_0005838 | |||
| 3016 | Ga0496126_0012055 | |||
| 3017 | Ga0496126_0026056 | |||
| 3018 | Ga0496126_0095925 | |||
| 3019 | Ga0496126_0102516 | |||
| 3020 | Ga0496126_0113215 | |||
| 3021 | Ga0496126_0138297 | |||
| 3022 | Ga0496126_0140140 | |||
| 3023 | Ga0496126_0221148 | |||
| 3024 | Ga0496126_0421096 | |||
| 3025 | Ga0501306_044815 | |||
| 3026 | Ga0495678_000817 | |||
| 3027 | Ga0495678_002620 | |||
| 3028 | Ga0495678_040935 | |||
| 3029 | Ga0495682_0000015 | |||
| 3030 | Ga0501290_021491 | |||
| 3031 | Ga0501314_040360 | |||
| 3032 | Ga0501315_101563 | |||
| 3033 | Ga0501031_0009408 | |||
| 3034 | Ga0501033_0005448 | |||
| 3035 | Ga0501034_0000194 | |||
| 3036 | Ga0501034_0067693 | |||
| 3037 | Ga0501034_0098941 | |||
| 3038 | Ga0501034_0450921 | |||
| 3039 | Ga0501037_0442852 | |||
| 3040 | Ga0501043_0906553 | |||
| 3041 | Ga0501043_1195240 | |||
| 3042 | Ga0501047_0022639 | |||
| 3043 | Ga0501047_0026369 | |||
| 3044 | Ga0501048_0259736 | |||
| 3045 | Ga0501069_0003956 | |||
| 3046 | Ga0501069_0092482 | |||
| 3047 | Ga0501070_0008196 | |||
| 3048 | Ga0501073_0004370 | |||
| 3049 | Ga0501074_0045353 | |||
| 3050 | Ga0501074_0145039 | |||
| 3051 | Ga0501076_0358287 | |||
| 3052 | Ga0501077_0023480 | |||
| 3053 | Ga0501223_013447 | |||
| 3054 | Ga0501228_006460 | |||
| 3055 | Ga0501238_010976 | |||
| 3056 | Ga0501249_006469 | |||
| 3057 | Ga0501252_039108 | |||
| 3058 | Ga0501257_049098 | |||
| 3059 | Ga0501225_0012633 | |||
| 3060 | Ga0501080_0045132 | |||
| 3061 | Ga0501080_0176550 | |||
| 3062 | Ga0501083_0083127 | |||
| 3063 | Ga0501241_019985 | |||
| 3064 | Ga0501262_000217 | |||
| 3065 | Ga0501266_018967 | |||
| 3066 | Ga0501279_026092 | |||
| 3067 | Ga0501035_0008452 | |||
| 3068 | Ga0501035_0022942 | |||
| 3069 | Ga0501035_0030616 | |||
| 3070 | Ga0501035_0383862 | |||
| 3071 | Ga0501044_0000126 | |||
| 3072 | Ga0501044_0030902 | |||
| 3073 | nmdc:mga03683_15867_c1 | |||
| 3074 | nmdc:mga03683_539_c1 | |||
| 3075 | nmdc:mga03n38_13224_c1 | |||
| 3076 | nmdc:mga03n38_14629_c1 | |||
| 3077 | nmdc:mga00v17_146343_c1 | |||
| 3078 | nmdc:mga00v17_151655_c1 | |||
| 3079 | nmdc:mga00v17_18093_c1 | |||
| 3080 | nmdc:mga00v17_210738_c1 | |||
| 3081 | nmdc:mga00v17_223241_c1 | |||
| 3082 | nmdc:mga00v17_223343_c1 | |||
| 3083 | nmdc:mga00v17_320026_c1 | |||
| 3084 | nmdc:mga00v17_50007_c1 | |||
| 3085 | nmdc:mga00v17_629_c1 | |||
| 3086 | nmdc:mga0k408_441955_c1 | |||
| 3087 | nmdc:mga0k408_546176_c1 | |||
| 3088 | nmdc:mga0k408_648838_c1 | |||
| 3089 | nmdc:mga07m45_122425_c1 | |||
| 3090 | nmdc:mga07m45_1446_c1 | |||
| 3091 | nmdc:mga07m45_297849_c1 | |||
| 3092 | nmdc:mga07m45_42155_c1 | |||
| 3093 | nmdc:mga0qj67_683617_c1 | |||
| 3094 | nmdc:mga0a205_524229_c1 | |||
| 3095 | nmdc:mga0sz30_116214_c1 | |||
| 3096 | Ga0495601_0056834 | |||
| 3097 | Ga0495655_0116484 | |||
| 3098 | Ga0495619_0318180 | |||
| 3099 | Ga0500643_015944 | |||
| 3100 | Ga0500644_0006005 | |||
| 3101 | Ga0500644_0051178 | |||
| 3102 | Ga0500646_0019586 | |||
| 3103 | Ga0500647_0257671 | |||
| 3104 | Ga0500647_0353846 | |||
| 3105 | Ga0500651_0000054 | |||
| 3106 | Ga0500566_0042353 | |||
| 3107 | Ga0500641_0120823 | |||
| 3108 | Ga0500562_007562 | |||
| 3109 | Ga0500562_120711 | |||
| 3110 | Ga0500571_000005 | |||
| 3111 | Ga0500572_116828 | |||
| 3112 | Ga0500592_003168 | |||
| 3113 | Ga0500593_002899 | |||
| 3114 | Ga0500594_0000763 | |||
| 3115 | Ga0500595_001889 | |||
| 3116 | Ga0500595_118460 | |||
| 3117 | Ga0500597_253803 | |||
| 3118 | Ga0500607_036794 | |||
| 3119 | Ga0500607_038837 | |||
| 3120 | Ga0500608_024725 | |||
| 3121 | Ga0500614_118936 | |||
| 3122 | Ga0500618_014532 | |||
| 3123 | Ga0500621_000001 | |||
| 3124 | Ga0500655_000895 | |||
| 3125 | Ga0500559_0001788 | |||
| 3126 | Ga0500559_0084954 | |||
| 3127 | Ga0500559_0258511 | |||
| 3128 | Ga0500561_0016276 | |||
| 3129 | Ga0500564_005575 | |||
| 3130 | Ga0500568_0002238 | |||
| 3131 | Ga0500573_0029700 | |||
| 3132 | Ga0500574_000299 | |||
| 3133 | Ga0500574_001599 | |||
| 3134 | Ga0500604_0054108 | |||
| 3135 | Ga0500616_0047830 | |||
| 3136 | Ga0500619_000249 | |||
| 3137 | Ga0500622_0125928 | |||
| 3138 | Ga0500624_004622 | |||
| 3139 | Ga0500624_070879 | |||
| 3140 | Ga0500634_0025168 | |||
| 3141 | Ga0500634_0036031 | |||
| 3142 | Ga0500634_0107998 | |||
| 3143 | Ga0500638_004055 | |||
| 3144 | Ga0500636_0000053 | |||
| 3145 | Ga0500625_026945 | |||
| 3146 | Ga0500645_011458 | |||
| 3147 | Ga0500645_049388 | |||
| 3148 | Ga0500661_002371 | |||
| 3149 | Ga0501082_0077867 | |||
| 3150 | 2506579128 | |||
| 3151 | 2506584267 | |||
| 3152 | 2508853017 | |||
| 3153 | 2511245910 | |||
| 3154 | 2511378986 | |||
| 3155 | 2511433251 | |||
| 3156 | 2513953457 | |||
| 3157 | 2514042766 | |||
| 3158 | 2526213809 | |||
| 3159 | 2538425916 | |||
| 3160 | 2547694988 | |||
| 3161 | 2547698141 | |||
| 3162 | 2548501264 | |||
| 3163 | 2548648031 | |||
| 3164 | 2562463995 | |||
| 3165 | 2562467013 | |||
| 3166 | 2585829188 | |||
| 3167 | 2585834100 | |||
| 3168 | 2599623235 | |||
| 3169 | 2599675547 | |||
| 3170 | 2599680840 | |||
| 3171 | 2599692855 | |||
| 3172 | 2599907762 | |||
| 3173 | 2599927576 | |||
| 3174 | 2601533231 | |||
| 3175 | 2601535065 | |||
| 3176 | 2601538595 | |||
| 3177 | 2601541454 | |||
| 3178 | 2601756944 | |||
| 3179 | 2601758247 | |||
| 3180 | 2601761601 | |||
| 3181 | 2601764356 | |||
| 3182 | 2603638382 | |||
| 3183 | 2603641220 | |||
| 3184 | 2603642877 | |||
| 3185 | 2603698078 | |||
| 3186 | 2603703483 | |||
| 3187 | 2603867553 | |||
| 3188 | 2608669024 | |||
| 3189 | 2609910071 | |||
| 3190 | 2643863186 | |||
| 3191 | 2643868496 | |||
| 3192 | 2643978592 | |||
| 3193 | 2643994603 | |||
| 3194 | 2644061652 | |||
| 3195 | 2644075184 | |||
| 3196 | 2644121712 | |||
| 3197 | 2644295448 | |||
| 3198 | 2644467160 | |||
| 3199 | 2644649192 | |||
| 3200 | 2650897820 | |||
| 3201 | 2656280085 | |||
| 3202 | 2671103420 | |||
| 3203 | 2671108783 | |||
| 3204 | 2671587306 | |||
| 3205 | 2681997451 | |||
| 3206 | 2682007045 | |||
| 3207 | 2686352920 | |||
| 3208 | 2689445585 | |||
| 3209 | 2707098652 | |||
| 3210 | 2712470160 | |||
| 3211 | 2723879825 | |||
| 3212 | 2738721246 | |||
| 3213 | 2738882743 | |||
| 3214 | 2739243349 | |||
| 3215 | 2739250546 | |||
| 3216 | 2739280445 | |||
| 3217 | 2753855531 | |||
| 3218 | 2765588508 | |||
| 3219 | 2772439547 | |||
| 3220 | 2775542322 | |||
| 3221 | 2791925875 | |||
| 3222 | 2792311507 | |||
| 3223 | 2793405912 | |||
| 3224 | 2807180778 | |||
| 3225 | 2809036651 | |||
| 3226 | 2809126989 | |||
| 3227 | 2813727434 | |||
| 3228 | 2813729433 | |||
| 3229 | 2814694966 | |||
| 3230 | 2814696928 | |||
| 3231 | 2816473927 | |||
| 3232 | 2819544803 | |||
| 3233 | 2819600370 | |||
| 3234 | 2821119337 | |||
| 3235 | 2823374294 | |||
| 3236 | 2831271836 | |||
| 3237 | 2834645087 | |||
| 3238 | 2838059674 | |||
| 3239 | 2842679834 | |||
| 3240 | 2842721934 | |||
| 3241 | 2842735768 | |||
| 3242 | 2842750921 | |||
| 3243 | 2844427075 | |||
| 3244 | 2844530485 | |||
| 3245 | 2846541790 | |||
| 3246 | 2847088103 | |||
| 3247 | 2847800402 | |||
| 3248 | 2852107623 | |||
| 3249 | 2854601991 | |||
| 3250 | 2855197066 | |||
| 3251 | 2855731415 | |||
| 3252 | 2855768121 | |||
| 3253 | 2857542680 | |||
| 3254 | 2857545856 | |||
| 3255 | 2858469096 | |||
| 3256 | 2858691088 | |||
| 3257 | 2858954805 | |||
| 3258 | 2865015573 | |||
| 3259 | 2869555030 | |||
| 3260 | 2871275628 | |||
| 3261 | 2871285420 | |||
| 3262 | 2876601983 | |||
| 3263 | 2881413712 | |||
| 3264 | 2881612390 | |||
| 3265 | 2884089421 | |||
| 3266 | 2885198062 | |||
| 3267 | 2885198672 | |||
| 3268 | 2885211948 | |||
| 3269 | 2888369610 | |||
| 3270 | 2891672676 | |||
| 3271 | 2899928459 | |||
| 3272 | 2900052857 | |||
| 3273 | 2901304334 | |||
| 3274 | 2904452436 | |||
| 3275 | 2904460965 | |||
| 3276 | 2904475471 | |||
| 3277 | 2904548220 | |||
| 3278 | 2919154316 | |||
| 3279 | 2919463932 | |||
| 3280 | 2923638964 | |||
| 3281 | 2927144309 | |||
| 3282 | 2927834546 | |||
| 3283 | 2928041380 | |||
| 3284 | 2928048222 | |||
| 3285 | 2928056064 | |||
| 3286 | 2928066454 | |||
| 3287 | 2928077402 | |||
| 3288 | 2928087701 | |||
| 3289 | 2929163210 | |||
| 3290 | 2929522948 | |||
| 3291 | 2932408756 | |||
| 3292 | 2935627103 | |||
| 3293 | 2935629095 | |||
| 3294 | 2937543247 | |||
| 3295 | 2937968184 | |||
| 3296 | 2939568727 | |||
| 3297 | 2939574239 | |||
| 3298 | 2939580452 | |||
| 3299 | 2939603654 | |||
| 3300 | 2939607919 | |||
| 3301 | 2939619108 | |||
| 3302 | 2939621866 | |||
| 3303 | 2939644228 | |||
| 3304 | 2941481035 | |||
| 3305 | 2945877271 | |||
| 3306 | 2945946068 | |||
| 3307 | 2945953465 | |||
| 3308 | 2945975667 | |||
| 3309 | 2954768890 | |||
| 3310 | 2974312571 | |||
| 3311 | 2974321964 | |||
| 3312 | 2974437978 | |||
| 3313 | 2974439772 | |||
| 3314 | 2978975957 | |||
| 3315 | 2978978014 | |||
| 3316 | 2984496150 | |||
| 3317 | 2990262827 | |||
| 3318 | 2990715533 | |||
| 3319 | 3000376946 | |||
| 3320 | 640938510 | |||
| 3321 | 644750334 | |||
| 3322 | 8003405317 | |||
| 3323 | 8004596810 | |||
| 3324 | 8015398332 | |||
| 3325 | 8016736360 | |||
| 3326 | 8018224609 | |||
| 3327 | 8018408625 | |||
| 3328 | 8019503032 | |||
| 3329 | 8019505992 | |||
| 3330 | 8019509242 | |||
| 3331 | 8054846254 | |||
| 3332 | 8054850454 | |||
| 3333 | 8055088534 | |||
| 3334 | 8055094229 | |||
| 3335 | 8055099647 | |||
| 3336 | 8055696620 | |||
| 3337 | 8057161335 | |||
| 3338 | 8057309059 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cg0-assembly1.cif.gz_p | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.9386 | 2 | 130 |
| 7nvg-assembly1.cif.gz_V2 | salmonella flagellar basal body refined in c1 map | 0.9291 | 1 | 132 |
| 7cg0-assembly1.cif.gz_h | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.9271 | 2 | 128 |
| 7cg0-assembly1.cif.gz_i | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.9244 | 2 | 130 |
| 7nvg-assembly1.cif.gz_V2 | salmonella flagellar basal body refined in c1 map | 0.9224 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q13023_1080_1194_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9185 | 93 | 128 | 1.20.58.60 |
| af_E9Q9K8_1077_1190_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9066 | 93 | 128 | 1.20.58.60 |
| af_Q9VMH8_1_121_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6726 | 70 | 129 | 1.10.287.370 |
| af_Q9M1G8_208_399_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.6204 | 38 | 67 | 3.40.50.880 |
| af_Q94K88_191_391_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.6011 | 12 | 132 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F5NSX4-F1-model_v4 | Flagellar basal-body rod protein flgC | 0.9958 | 2 | 68 |
GO:0009288
|
| AF-A0A6D0ENN2-F1-model_v4 | deleted | 0.9867 | 2 | 110 |
|
| AF-A0A656YGU4-F1-model_v4 | deleted | 0.9792 | 2 | 63 |
|
| AF-A0A376UBU8-F1-model_v4 | Flagellar basal-body rod protein FlgC | 0.977 | 2 | 128 |
GO:0030694
GO:0044781 GO:0071978 |
| AF-A0A1I7F3P2-F1-model_v4 | Flagellar basal-body rod protein FlgC | 0.9684 | 2 | 132 |
GO:0030694
GO:0071978 |