F495276

General Info

Members Datasets Scaffolds Average Seq Length
1669 686 3338 135

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10006154|Ga0182007_100061548
Length 142
Sequence MSSSNVSMNIFDVAGSAMSAQSQRMNVTASNLANADSVSGPDGQPYRAKQVVFAVAAGDQQDGAAAVGGVQVTGVVEDQSPLRMVYNPKHPLADASGYVTMPNVNVVEEMVNMISASRSYQANVEVLNTAKTMMLKTLTIGQ

Samples

Sample ID Description Type Environment
1 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
46 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
47 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
132 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
133 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
134 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
135 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
218 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
223 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
233 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
234 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
235 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
238 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
239 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
240 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
250 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
253 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
267 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
268 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
278 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
279 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
280 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
281 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
286 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
287 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
288 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
289 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
290 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
291 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
292 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
293 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
294 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
295 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
296 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
297 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
298 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
299 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
300 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
301 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
302 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
303 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
304 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
305 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
306 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
307 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
308 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
309 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
310 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
311 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
312 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
313 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
314 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
315 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
316 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
319 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
320 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
327 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
346 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
350 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
351 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
352 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
353 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
358 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
362 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
403 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
430 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
431 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
432 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
442 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
445 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
446 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
447 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
448 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
449 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
450 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
451 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
452 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
453 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
457 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
458 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
459 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
466 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
471 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
477 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
478 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
479 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
480 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
481 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
482 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
483 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
484 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
488 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
489 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
490 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
491 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
492 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
493 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
496 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
497 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
498 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
499 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
500 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
503 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
504 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
505 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
506 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
507 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
508 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
509 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
510 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
511 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
512 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
513 2506520008 Serratia plymuthica AS12 Isolate Unclassified
514 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
515 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
516 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
517 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
518 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
519 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
520 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
521 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
522 2547132181 Kosakonia sacchari SP1 Isolate Stem
523 2547132374 Acidovorax radicis N35 Isolate Unclassified
524 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
525 2561511199 Enterobacter sp. R4-368 Isolate Nodule
526 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
527 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
528 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
529 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
530 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
531 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
532 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
533 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
534 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
535 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
536 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
537 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
538 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
539 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
540 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
541 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
542 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
543 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
544 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
545 2643221569 Achromobacter sp. Root565 Isolate Unclassified
546 2643221570 Acidovorax sp. Root568 Isolate Unclassified
547 2643221594 Achromobacter sp. Root170 Isolate Unclassified
548 2643221596 Acidovorax sp. Root70 Isolate Unclassified
549 2643221609 Acidovorax sp. Root217 Isolate Unclassified
550 2643221611 Acidovorax sp. Root219 Isolate Unclassified
551 2643221621 Achromobacter sp. Root83 Isolate Unclassified
552 2643221652 Acidovorax sp. Root402 Isolate Unclassified
553 2643221683 Variovorax sp. Root473 Isolate Unclassified
554 2643221717 Acidovorax sp. Root267 Isolate Unclassified
555 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
556 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
557 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
558 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
559 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
560 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
561 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
562 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
563 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
564 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
565 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
566 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
567 2738541277 Variovorax sp. GV051 Isolate Unclassified
568 2738541307 Variovorax sp. GV008 Isolate Unclassified
569 2738543012 Acidovorax sp. CF301 Isolate Unclassified
570 2738543013 Variovorax sp. BT01 Isolate Unclassified
571 2738543019 Variovorax sp. GV040 Isolate Unclassified
572 2751185917 Enterobacter sp. HK169 Isolate Unclassified
573 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
574 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
575 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
576 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
577 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
578 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
579 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
580 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
581 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
582 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
583 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
584 2816332133 Acidovorax radicis 2721A Isolate Unclassified
585 2818991436 Collimonas arenae 515 Isolate Unclassified
586 2818991446 Variovorax sp. 1180 Isolate Unclassified
587 2821118458 Enterobacter asburiae 609 Isolate Unclassified
588 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
589 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
590 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
591 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
592 2842677519 Variovorax sp. R-72495 Isolate Unclassified
593 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
594 2842733646 Variovorax sp. R-72446 Isolate Unclassified
595 2842747753 Variovorax sp. R-72060 Isolate Unclassified
596 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
597 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
598 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
599 2847085930 Erwinia persicina B64 Isolate Bulb
600 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
601 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
602 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
603 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
604 2855730933 Achromobacter sp. HZ28 Isolate Nodule
605 2855767633 Achromobacter sp. HZ34 Isolate Nodule
606 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
607 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
608 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
609 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
610 2858950400 Achromobacter sp. K91 Isolate Unclassified
611 2865014394 Pantoea sp. R-71966 Isolate Unclassified
612 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
613 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
614 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
615 2876601092 Pantoea endophytica 596 Isolate Unclassified
616 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
617 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
618 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
619 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
620 2885198086 Variovorax sp. 679 Isolate Unclassified
621 2885211737 Variovorax sp. 553 Isolate Unclassified
622 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
623 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
624 2899924645 Variovorax sp. 369 Isolate Unclassified
625 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
626 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
627 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
628 2904456579 Variovorax sp. 2002 Isolate Unclassified
629 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
630 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
631 2919150387 Rahnella aceris 1817 Isolate Unclassified
632 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
633 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
634 2927143783 Rahnella sp. 2050 Isolate Unclassified
635 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
636 2928037797 Variovorax sp. 1126 Isolate Unclassified
637 2928044640 Variovorax sp. 1128 Isolate Unclassified
638 2928051484 Variovorax sp. 1133 Isolate Unclassified
639 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
640 2928070936 Variovorax gossypii 1167 Isolate Unclassified
641 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
642 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
643 2929520902 Variovorax beijingensis 502 Isolate Unclassified
644 2932406140 Serratia sp. 2723 Isolate Rhizosphere
645 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
646 2937539931 Pantoea sp. LS15 Isolate Unclassified
647 2937967321 Serratia sp. YC16 Isolate Unclassified
648 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
649 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
650 2939577877 Serratia sp. 509 Isolate Rhizosphere
651 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
652 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
653 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
654 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
655 2941479691
656 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
657 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
658 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
659 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
660 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
661 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
662 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
663 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
664 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
665 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
666 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
667 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
668 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
669 640753048 Serratia proteamaculans 568 Isolate Endosphere
670 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
671 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
672 8004592986 Serratia sp. S119 Isolate Unclassified
673 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
674 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
675 8018221730 Enterobacter sp. CM29 Isolate Unclassified
676 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
677 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
678 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
679 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
680 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
681 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
682 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
683 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
684 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
685 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
686 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0.96
Isolates 11.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0.06
Endosphere 17.38
Nodule 2.22
Rhizoplane 4.55
Rhizosphere 56.5
Stem 0.12
Stem Tuber 0.36
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182007_10006154 3300015262 Bacteria 5180
2 SwRhRL2b_contig_1532308 2162886007 Bacteria 4061
3 SwRhRL2b_contig_1817389 2162886007 Bacteria 3884
4 SwRhRL2b_contig_211812 2162886007 Bacteria 3566
5 SwRhRL2b_contig_3815225 2162886007 Bacteria 1537
6 SwRhRL2b_contig_648880 2162886007 Bacteria 991
7 SwRhRL2b_contig_811231 2162886007 Bacteria 3323
8 JGI24741J21665_1002439 3300001915 Bacteria 4831
9 JGI24740J21852_10001465 3300001979 Bacteria 10823
10 JGI24740J21852_10005400 3300001979 Bacteria 5412
11 JGI24740J21852_10108564 3300001979 Bacteria 701
12 JGI24739J22299_10000528 3300001989 Bacteria 13630
13 JGI24739J22299_10019327 3300001989 Bacteria 2439
14 JGI25162J39368_1000019 3300002737 Bacteria 262053
15 JGI25162J39368_1000139 3300002737 Bacteria 78439
16 JGI25162J39368_1004044 3300002737 Bacteria 3670
17 JGI25158J39367_1004522 3300002739 Bacteria 2085
18 JGI25158J39367_1014677 3300002739 Bacteria 1009
19 JGI25163J39215_1000008 3300002771 Bacteria 109086
20 JGI25163J39215_1000036 3300002771 Bacteria 61837
21 JGI25163J39215_1001578 3300002771 Bacteria 3464
22 JGI25164J39214_1000011 3300002772 Bacteria 262057
23 JGI25152J39213_1000725 3300002773 Bacteria 16934
24 JGI25152J39213_1001419 3300002773 Bacteria 10372
25 JGI25152J39213_1001623 3300002773 Bacteria 9388
26 JGI25152J39213_1008926 3300002773 Bacteria 2432
27 JGI25150J39212_1001793 3300002774 Bacteria 5716
28 JGI25150J39212_1009982 3300002774 Bacteria 1785
29 JGI25159J45721_1000435 3300002987 Bacteria 19303
30 JGI25159J45721_1001336 3300002987 Bacteria 10374
31 Ga0006759J45824_1061774 3300003163 Bacteria 2780
32 JGI25151J46595_10000198 3300003187 Bacteria 73969
33 JGI25151J46595_10000666 3300003187 Bacteria 29207
34 JGI25151J46595_10000713 3300003187 Bacteria 27800
35 JGI25151J46595_10000957 3300003187 Bacteria 22074
36 JGI25151J46595_10002229 3300003187 Bacteria 11962
37 JGI25151J46595_10011933 3300003187 Bacteria 3970
38 JGI25151J46595_10015566 3300003187 Bacteria 3347
39 JGI25151J46595_10018492 3300003187 Bacteria 2989
40 JGI25151J46595_10064364 3300003187 Bacteria 1148
41 JGI25165J46597_1000227 3300003214 Bacteria 78439
42 JGI25153J46596_10002586 3300003215 Bacteria 10372
43 JGI25153J46596_10027801 3300003215 Bacteria 1974
44 rootH2_10001915 3300003320 Bacteria 32137
45 rootH2_10011746 3300003320 Bacteria 2643
46 rootL2_10010810 3300003322 Bacteria 8638
47 rootL2_10038684 3300003322 Bacteria 7153
48 rootH1_10022702 3300003323 Bacteria 3321
49 JGI25160J50197_1000093 3300003354 Bacteria 89962
50 JGI25160J50197_1001793 3300003354 Bacteria 10374
51 JGI25160J50197_1002516 3300003354 Bacteria 8502
52 JGI25161J50226_1000443 3300003374 Bacteria 19496
53 JGI25161J50226_1001737 3300003374 Bacteria 6161
54 JGI25161J50226_1006112 3300003374 Bacteria 2225
55 Ga0007410J51695_1038845 3300003574 Bacteria 3771
56 Ga0007409J51694_1018424 3300003575 Bacteria 3742
57 Ga0007416J51690_1050216 3300003577 Bacteria 1207
58 Ga0006562J51391_1020559 3300003578 Bacteria 4830
59 Ga0032354_1047181 3300003693 Bacteria 3724
60 Ga0055538_1000021 3300003751 Bacteria 262057
61 Ga0055538_1000089 3300003751 Bacteria 78439
62 Ga0055539_1000026 3300003752 Bacteria 262057
63 Ga0055539_1000133 3300003752 Bacteria 78439
64 Ga0055533_1000035 3300003756 Bacteria 262057
65 Ga0055533_1000136 3300003756 Bacteria 78439
66 Ga0055532_1008571 3300003758 Bacteria 1272
67 Ga0055525_1000045 3300003759 Bacteria 262057
68 Ga0055525_1000181 3300003759 Bacteria 78439
69 Ga0055527_1015720 3300003760 Bacteria 823
70 Ga0055535_1000128 3300003761 Bacteria 80324
71 Ga0055542_1000062 3300003762 Bacteria 161494
72 Ga0055526_1003281 3300003771 Bacteria 10374
73 Ga0055526_1004616 3300003771 Bacteria 8207
74 Ga0055526_1025264 3300003771 Bacteria 1910
75 Ga0055537_1001084 3300003773 Bacteria 11962
76 Ga0055537_1001152 3300003773 Bacteria 11308
77 Ga0055537_1005883 3300003773 Bacteria 3208
78 Ga0055537_1030973 3300003773 Bacteria 688
79 Ga0055524_1002106 3300003775 Bacteria 10514
80 Ga0055524_1002148 3300003775 Bacteria 10374
81 Ga0055524_1003128 3300003775 Bacteria 8167
82 Ga0055524_1009474 3300003775 Bacteria 3956
83 Ga0055524_1064653 3300003775 Bacteria 737
84 Ga0055536_1000045 3300003781 Bacteria 120495
85 Ga0055536_1001927 3300003781 Bacteria 12006
86 Ga0055536_1008144 3300003781 Bacteria 4563
87 Ga0055536_1029855 3300003781 Bacteria 1455
88 Ga0055534_1000607 3300003784 Bacteria 18537
89 Ga0055534_1000680 3300003784 Bacteria 16840
90 Ga0055534_1000948 3300003784 Bacteria 12920
91 Ga0055534_1001053 3300003784 Bacteria 11964
92 Ga0055534_1026656 3300003784 Bacteria 917
93 Ga0055534_1030244 3300003784 Bacteria 838
94 Ga0055528_1001880 3300003790 Bacteria 11962
95 Ga0055528_1012891 3300003790 Bacteria 3208
96 Ga0055530_10001484 3300003791 Bacteria 17030
97 Ga0055530_10036030 3300003791 Bacteria 1248
98 Ga0055540_1002723 3300003792 Bacteria 9092
99 Ga0055540_1003970 3300003792 Bacteria 6892
100 Ga0055540_1004043 3300003792 Bacteria 6819
101 Ga0055540_1010254 3300003792 Bacteria 3131
102 Ga0055531_10002613 3300003794 Bacteria 11930
103 Ga0055531_10042539 3300003794 Bacteria 1297
104 Ga0055541_1000020 3300003841 Bacteria 262057
105 Ga0055541_1000088 3300003841 Bacteria 78439
106 Ga0058692_1000058 3300003856 Bacteria 99195
107 Ga0058692_1000127 3300003856 Bacteria 48125
108 Ga0058692_1000356 3300003856 Bacteria 22204
109 Ga0058692_1000889 3300003856 Bacteria 11763
110 Ga0058692_1001028 3300003856 Bacteria 10963
111 Ga0058692_1003139 3300003856 Bacteria 5239
112 Ga0058692_1005468 3300003856 Bacteria 3620
113 Ga0058692_1006611 3300003856 Bacteria 3158
114 Ga0058692_1008376 3300003856 Bacteria 2669
115 Ga0058692_1008738 3300003856 Bacteria 2599
116 Ga0058692_1009721 3300003856 Bacteria 2410
117 Ga0058692_1016142 3300003856 Bacteria 1667
118 Ga0058692_1036964 3300003856 Bacteria 880
119 Ga0055543_1001728 3300004625 Bacteria 8190
120 Ga0055543_1002173 3300004625 Bacteria 6747
121 Ga0058861_10505237 3300004800 Bacteria 2053
122 Ga0065165_1003326 3300005262 Bacteria 11487
123 Ga0065165_1005438 3300005262 Bacteria 7159
124 Ga0065165_1010696 3300005262 Bacteria 3926
125 Ga0065165_1116696 3300005262 Bacteria 651
126 Ga0065165_1131492 3300005262 Bacteria 598
127 Ga0065703_1020318 3300005272 Bacteria 1878
128 Ga0065714_10166784 3300005288 Bacteria 1024
129 Ga0065704_10000333 3300005289 Bacteria 49423
130 Ga0065704_10000631 3300005289 Bacteria 14774
131 Ga0065704_10001218 3300005289 Bacteria 18433
132 Ga0065704_10003968 3300005289 Bacteria 10032
133 Ga0065704_10071586 3300005289 Bacteria 10614
134 Ga0065704_10086036 3300005289 Bacteria 3162
135 Ga0065704_10086235 3300005289 Bacteria 3141
136 Ga0065704_10129206 3300005289 Bacteria 1651
137 Ga0065704_10141574 3300005289 Bacteria 1512
138 Ga0070658_10070073 3300005327 Bacteria 2870
139 Ga0070658_10148408 3300005327 Bacteria 1962
140 Ga0070658_10243894 3300005327 Bacteria 1523
141 Ga0070658_10557291 3300005327 Bacteria 992
142 Ga0070676_10065117 3300005328 Bacteria 2175
143 Ga0070670_100679234 3300005331 Bacteria 925
144 Ga0070677_10324179 3300005333 Bacteria 790
145 Ga0070680_100022363 3300005336 Bacteria 5037
146 Ga0070680_100495764 3300005336 Bacteria 1045
147 Ga0070682_100010205 3300005337 Bacteria 5325
148 Ga0070682_101235099 3300005337 Bacteria 632
149 Ga0068868_102001739 3300005338 Bacteria 550
150 Ga0070660_100907056 3300005339 Bacteria 743
151 Ga0070691_10006226 3300005341 Bacteria 5445
152 Ga0070691_10036380 3300005341 Bacteria 2320
153 Ga0070691_10198210 3300005341 Bacteria 1053
154 Ga0070687_100056664 3300005343 Bacteria 2051
155 Ga0070661_100015748 3300005344 Bacteria 5337
156 Ga0070661_100398030 3300005344 Bacteria 1088
157 Ga0070661_100546966 3300005344 Bacteria 931
158 Ga0070692_10041561 3300005345 Bacteria 2356
159 Ga0070692_10064627 3300005345 Bacteria 1935
160 Ga0070668_100017378 3300005347 Bacteria 5387
161 Ga0070668_100239409 3300005347 Bacteria 1503
162 Ga0070668_101124166 3300005347 Bacteria 710
163 Ga0070669_100006871 3300005353 Bacteria 8179
164 Ga0070674_100027809 3300005356 Bacteria 3709
165 Ga0070673_100319045 3300005364 Bacteria 1372
166 Ga0070659_100282356 3300005366 Bacteria 1381
167 Ga0070659_100518883 3300005366 Bacteria 1017
168 Ga0070667_100013220 3300005367 Bacteria 6821
169 Ga0070667_100051123 3300005367 Bacteria 3484
170 Ga0070667_100133305 3300005367 Bacteria 2170
171 Ga0070663_100005681 3300005455 Bacteria 7432
172 Ga0070663_100023732 3300005455 Bacteria 4116
173 Ga0070678_100417589 3300005456 Bacteria 1169
174 Ga0070678_101657403 3300005456 Bacteria 601
175 Ga0070662_100017220 3300005457 Bacteria 4866
176 Ga0070662_100235146 3300005457 Bacteria 1467
177 Ga0070681_10000088 3300005458 Bacteria 69295
178 Ga0070681_10002015 3300005458 Bacteria 18385
179 Ga0070681_10984032 3300005458 Bacteria 763
180 Ga0070679_100000061 3300005530 Bacteria 80570
181 Ga0070679_100287609 3300005530 Bacteria 1595
182 Ga0068853_100001354 3300005539 Bacteria 17657
183 Ga0068853_100047998 3300005539 Bacteria 3665
184 Ga0068853_100302849 3300005539 Bacteria 1478
185 Ga0068853_100355525 3300005539 Bacteria 1363
186 Ga0070696_100015635 3300005546 Bacteria 5099
187 Ga0070696_100024095 3300005546 Bacteria 4136
188 Ga0070693_100008374 3300005547 Bacteria 5095
189 Ga0070665_100000262 3300005548 Bacteria 86632
190 Ga0070665_100010362 3300005548 Bacteria 9432
191 Ga0070665_100070998 3300005548 Bacteria 3489
192 Ga0070665_100775281 3300005548 Bacteria 972
193 Ga0070665_100833059 3300005548 Bacteria 936
194 Ga0070665_101682702 3300005548 Bacteria 642
195 Ga0068855_100010497 3300005563 Bacteria 11173
196 Ga0068855_100224695 3300005563 Bacteria 2104
197 Ga0070664_100099825 3300005564 Bacteria 2523
198 Ga0068857_100000082 3300005577 Bacteria 55308
199 Ga0068857_100036973 3300005577 Bacteria 4324
200 Ga0068857_100650963 3300005577 Bacteria 999
201 Ga0068857_101000606 3300005577 Bacteria 805
202 Ga0068854_100061734 3300005578 Bacteria 2715
203 Ga0068852_100320257 3300005616 Bacteria 1506
204 Ga0068852_100805233 3300005616 Bacteria 954
205 Ga0068859_100135523 3300005617 Bacteria 2535
206 Ga0068851_10001818 3300005834 Bacteria 9333
207 Ga0068851_10012101 3300005834 Bacteria 4062
208 Ga0068870_11119288 3300005840 Bacteria 567
209 Ga0068863_100031760 3300005841 Bacteria 5038
210 Ga0068860_100301337 3300005843 Bacteria 1570
211 Ga0081539_10075937 3300005985 Bacteria 1782
212 Ga0075365_10093978 3300006038 Bacteria 2046
213 Ga0075363_100698181 3300006048 Bacteria 613
214 Ga0075364_10004261 3300006051 Bacteria 8212
215 Ga0075364_10019925 3300006051 Bacteria 4214
216 Ga0075364_10039524 3300006051 Bacteria 3058
217 Ga0075364_10090303 3300006051 Bacteria 2032
218 Ga0075364_10122334 3300006051 Bacteria 1743
219 Ga0075364_10139974 3300006051 Bacteria 1627
220 Ga0075364_10141236 3300006051 Bacteria 1620
221 Ga0075364_10229103 3300006051 Bacteria 1262
222 Ga0075364_10252742 3300006051 Bacteria 1198
223 Ga0075364_10669159 3300006051 Bacteria 709
224 Ga0075432_10045356 3300006058 Bacteria 1542
225 Ga0075362_10000528 3300006177 Bacteria 11099
226 Ga0075362_10002538 3300006177 Bacteria 6156
227 Ga0075362_10017911 3300006177 Bacteria 2924
228 Ga0075369_10155822 3300006186 Bacteria 1045
229 Ga0075369_10203553 3300006186 Bacteria 914
230 Ga0075366_10036012 3300006195 Bacteria 2917
231 Ga0075366_10255351 3300006195 Bacteria 1069
232 Ga0075370_10004045 3300006353 Bacteria 7049
233 Ga0075370_10016704 3300006353 Bacteria 3951
234 Ga0075370_10019421 3300006353 Bacteria 3701
235 Ga0075370_10367422 3300006353 Bacteria 861
236 Ga0075430_100079155 3300006846 Bacteria 2755
237 Ga0075433_10254037 3300006852 Bacteria 1559
238 Ga0097620_100135524 3300006931 Bacteria 2535
239 Ga0079104_1000035 3300006946 Bacteria 198709
240 Ga0079104_1000274 3300006946 Bacteria 67264
241 Ga0079104_1000343 3300006946 Bacteria 56060
242 Ga0079104_1000464 3300006946 Bacteria 45595
243 Ga0079104_1000819 3300006946 Bacteria 25996
244 Ga0079104_1001653 3300006946 Bacteria 14405
245 Ga0079104_1001797 3300006946 Bacteria 13307
246 Ga0079104_1003555 3300006946 Bacteria 7168
247 Ga0079104_1015838 3300006946 Bacteria 2221
248 Ga0079104_1022141 3300006946 Bacteria 1716
249 Ga0079104_1022902 3300006946 Bacteria 1671
250 Ga0079104_1024210 3300006946 Bacteria 1602
251 Ga0079104_1051905 3300006946 Bacteria 911
252 Ga0079104_1066673 3300006946 Bacteria 763
253 Ga0099826_10000013 3300006948 Bacteria 265459
254 Ga0099826_10139907 3300006948 Bacteria 1400
255 Ga0099826_10481446 3300006948 Bacteria 584
256 Ga0105251_10002660 3300009011 Bacteria 13773
257 Ga0105251_10002718 3300009011 Bacteria 13563
258 Ga0105251_10002876 3300009011 Bacteria 12987
259 Ga0105251_10007342 3300009011 Bacteria 6810
260 Ga0105251_10008589 3300009011 Bacteria 6129
261 Ga0105251_10011774 3300009011 Bacteria 4980
262 Ga0105251_10025606 3300009011 Bacteria 3015
263 Ga0105251_10027110 3300009011 Bacteria 2909
264 Ga0105251_10035985 3300009011 Bacteria 2439
265 Ga0105251_10079343 3300009011 Bacteria 1519
266 Ga0105251_10098773 3300009011 Bacteria 1335
267 Ga0105251_10110569 3300009011 Bacteria 1252
268 Ga0105251_10213105 3300009011 Bacteria 869
269 Ga0105244_10000117 3300009036 Bacteria 83982
270 Ga0105244_10000123 3300009036 Bacteria 79547
271 Ga0105244_10000491 3300009036 Bacteria 35705
272 Ga0105244_10001091 3300009036 Bacteria 22607
273 Ga0105244_10001372 3300009036 Bacteria 19788
274 Ga0105244_10002148 3300009036 Bacteria 15132
275 Ga0105244_10002204 3300009036 Bacteria 14884
276 Ga0105244_10003085 3300009036 Bacteria 12193
277 Ga0105244_10014092 3300009036 Bacteria 4639
278 Ga0105244_10025906 3300009036 Bacteria 3180
279 Ga0105244_10038004 3300009036 Bacteria 2513
280 Ga0105244_10065064 3300009036 Bacteria 1827
281 Ga0105244_10124884 3300009036 Bacteria 1244
282 Ga0105244_10144566 3300009036 Bacteria 1142
283 Ga0105244_10206087 3300009036 Bacteria 926
284 Ga0105250_10000037 3300009092 Bacteria 143923
285 Ga0105250_10000414 3300009092 Bacteria 31316
286 Ga0105250_10000650 3300009092 Bacteria 22037
287 Ga0105250_10000917 3300009092 Bacteria 17339
288 Ga0105250_10001186 3300009092 Bacteria 14627
289 Ga0105250_10002778 3300009092 Bacteria 8595
290 Ga0105250_10002792 3300009092 Bacteria 8567
291 Ga0105250_10004534 3300009092 Bacteria 6375
292 Ga0105250_10065924 3300009092 Bacteria 1460
293 Ga0105250_10067681 3300009092 Bacteria 1441
294 Ga0105250_10077887 3300009092 Bacteria 1342
295 Ga0105250_10272096 3300009092 Bacteria 727
296 Ga0105240_10062558 3300009093 Bacteria 4633
297 Ga0105240_10273746 3300009093 Bacteria 1943
298 Ga0105240_10335586 3300009093 Bacteria 1718
299 Ga0105240_10498509 3300009093 Bacteria 1354
300 Ga0105240_11260892 3300009093 Bacteria 781
301 Ga0105240_11310510 3300009093 Bacteria 764
302 Ga0105247_10000086 3300009101 Bacteria 99603
303 Ga0105243_10003849 3300009148 Bacteria 11994
304 Ga0105243_10092126 3300009148 Bacteria 2498
305 Ga0105243_12744318 3300009148 Bacteria 533
306 Ga0105241_10000001 3300009174 Bacteria 879793
307 Ga0105241_10130865 3300009174 Bacteria 2031
308 Ga0105241_12690589 3300009174 Bacteria 501
309 Ga0105242_10002597 3300009176 Bacteria 14150
310 Ga0105242_10068733 3300009176 Bacteria 2931
311 Ga0105242_11474481 3300009176 Bacteria 710
312 Ga0105242_11525997 3300009176 Bacteria 700
313 Ga0105248_10253265 3300009177 Bacteria 1981
314 Ga0105237_10011495 3300009545 Bacteria 9366
315 Ga0105237_10150560 3300009545 Bacteria 2323
316 Ga0105237_10395502 3300009545 Bacteria 1387
317 Ga0105238_10001283 3300009551 Bacteria 25225
318 Ga0105238_10634030 3300009551 Bacteria 1078
319 Ga0105249_10340702 3300009553 Bacteria 1516
320 Ga0105239_10013831 3300010375 Bacteria 8956
321 Ga0105246_10073988 3300011119 Bacteria 2407
322 Ga0105246_10155285 3300011119 Bacteria 1737
323 Ga0105246_10493964 3300011119 Bacteria 1038
324 Ga0105246_11291391 3300011119 Bacteria 676
325 Ga0157347_1033606 3300012502 Bacteria 652
326 Ga0157373_10000200 3300013100 Bacteria 49401
327 Ga0157373_10005859 3300013100 Bacteria 9193
328 Ga0157373_10018164 3300013100 Bacteria 5122
329 Ga0157373_10029150 3300013100 Bacteria 3979
330 Ga0157373_10031860 3300013100 Bacteria 3796
331 Ga0157373_10040095 3300013100 Bacteria 3352
332 Ga0157373_10046256 3300013100 Bacteria 3105
333 Ga0157373_10137322 3300013100 Bacteria 1719
334 Ga0157373_10174876 3300013100 Bacteria 1511
335 Ga0157373_10258326 3300013100 Bacteria 1232
336 Ga0157371_10000067 3300013102 Bacteria 168242
337 Ga0157371_10000156 3300013102 Bacteria 100191
338 Ga0157371_10003023 3300013102 Bacteria 15617
339 Ga0157371_10006525 3300013102 Bacteria 9599
340 Ga0157371_10016466 3300013102 Bacteria 5517
341 Ga0157371_10028186 3300013102 Bacteria 4069
342 Ga0157371_10049077 3300013102 Bacteria 2999
343 Ga0157371_10146989 3300013102 Bacteria 1680
344 Ga0157371_10149671 3300013102 Bacteria 1664
345 Ga0157371_10381989 3300013102 Bacteria 1028
346 Ga0157371_10474916 3300013102 Bacteria 921
347 Ga0157371_10503224 3300013102 Bacteria 895
348 Ga0157371_11187912 3300013102 Bacteria 587
349 Ga0157370_10000814 3300013104 Bacteria 39443
350 Ga0157370_10003193 3300013104 Bacteria 19382
351 Ga0157370_10003562 3300013104 Bacteria 18230
352 Ga0157370_10005747 3300013104 Bacteria 13872
353 Ga0157370_10028456 3300013104 Bacteria 5497
354 Ga0157370_10063234 3300013104 Bacteria 3507
355 Ga0157370_10067492 3300013104 Bacteria 3381
356 Ga0157370_10123676 3300013104 Bacteria 2415
357 Ga0157370_10181136 3300013104 Bacteria 1958
358 Ga0157370_10396757 3300013104 Bacteria 1270
359 Ga0157370_10544307 3300013104 Bacteria 1064
360 Ga0157370_11460098 3300013104 Bacteria 615
361 Ga0157369_10002007 3300013105 Bacteria 24526
362 Ga0157369_10010610 3300013105 Bacteria 10485
363 Ga0157369_10016298 3300013105 Bacteria 8365
364 Ga0157369_10024085 3300013105 Bacteria 6774
365 Ga0157369_10650919 3300013105 Bacteria 1087
366 Ga0157374_10002106 3300013296 Bacteria 16738
367 Ga0157374_11778966 3300013296 Bacteria 641
368 Ga0163162_10071042 3300013306 Bacteria 3533
369 Ga0163162_10071964 3300013306 Bacteria 3512
370 Ga0163162_10140414 3300013306 Bacteria 2529
371 Ga0163162_10259980 3300013306 Bacteria 1868
372 Ga0157372_10001630 3300013307 Bacteria 24355
373 Ga0157372_10001655 3300013307 Bacteria 24172
374 Ga0157372_10001723 3300013307 Bacteria 23725
375 Ga0157372_10003992 3300013307 Bacteria 15837
376 Ga0157372_10025560 3300013307 Bacteria 6423
377 Ga0157372_10056434 3300013307 Bacteria 4388
378 Ga0157372_10057183 3300013307 Bacteria 4359
379 Ga0157372_10117318 3300013307 Bacteria 3053
380 Ga0157372_10157175 3300013307 Bacteria 2626
381 Ga0157372_10457502 3300013307 Bacteria 1487
382 Ga0157372_10496574 3300013307 Bacteria 1423
383 Ga0157375_11572794 3300013308 Bacteria 777
384 Ga0182008_10000877 3300014497 Bacteria 20906
385 Ga0182008_10001330 3300014497 Bacteria 16858
386 Ga0182008_10005352 3300014497 Bacteria 7328
387 Ga0182008_10009021 3300014497 Bacteria 5403
388 Ga0182008_10012011 3300014497 Bacteria 4585
389 Ga0182008_10081751 3300014497 Bacteria 1590
390 Ga0182008_10310770 3300014497 Bacteria 827
391 Ga0157379_10003242 3300014968 Bacteria 13800
392 Ga0157376_11058796 3300014969 Bacteria 836
393 Ga0182006_1000022 3300015261 Bacteria 275350
394 Ga0182006_1039514 3300015261 Bacteria 1861
395 Ga0182006_1045596 3300015261 Bacteria 1705
396 Ga0182006_1049881 3300015261 Bacteria 1614
397 Ga0182006_1050636 3300015261 Bacteria 1600
398 Ga0182006_1109871 3300015261 Bacteria 969
399 Ga0182007_10003487 3300015262 Bacteria 7404
400 Ga0182007_10016771 3300015262 Bacteria 2692
401 Ga0182005_1000075 3300015265 Bacteria 79711
402 Ga0183366_1001 3300015679 Bacteria 2743932
403 Ga0183370_1001 3300015680 Bacteria 2743932
404 Ga0183362_10001 3300015683 Bacteria 2046624
405 Ga0183369_1001 3300015685 Bacteria 2743932
406 Ga0183368_1001 3300015687 Bacteria 2743932
407 Ga0163161_10000001 3300017792 Bacteria 2041488
408 Ga0163161_10019762 3300017792 Bacteria 4725
409 Ga0163161_10040757 3300017792 Bacteria 3336
410 Ga0163161_10055207 3300017792 Bacteria 2883
411 Ga0206356_10036066 3300020070 Bacteria 6683
412 Ga0206354_11653555 3300020081 Bacteria 2241
413 Ga0206353_11505629 3300020082 Bacteria 1523
414 Ga0154015_1259153 3300020610 Bacteria 1238
415 Ga0213874_10372997 3300021377 Bacteria 551
416 Ga0213876_10000086 3300021384 Bacteria 106079
417 Ga0209760_100004 3300025207 Bacteria 254650
418 Ga0209760_101358 3300025207 Bacteria 2628
419 Ga0209436_101095 3300025208 Bacteria 10137
420 Ga0209436_103393 3300025208 Bacteria 4259
421 Ga0209784_100001 3300025224 Bacteria 3600592
422 Ga0209784_100071 3300025224 Bacteria 151400
423 Ga0209566_100001 3300025225 Bacteria 3600765
424 Ga0209566_100004 3300025225 Bacteria 1531866
425 Ga0209674_100002 3300025226 Bacteria 3600592
426 Ga0209674_100006 3300025226 Bacteria 1531866
427 Ga0209672_100319 3300025228 Bacteria 31820
428 Ga0209147_101404 3300025229 Bacteria 8838
429 Ga0209563_100002 3300025230 Bacteria 2045675
430 Ga0209563_100104 3300025230 Bacteria 151400
431 Ga0207427_100012 3300025231 Bacteria 585657
432 Ga0207427_100308 3300025231 Bacteria 33981
433 Ga0209437_100001 3300025233 Bacteria 2045675
434 Ga0209437_100035 3300025233 Bacteria 481110
435 Ga0209437_100158 3300025233 Bacteria 151400
436 Ga0209258_100154 3300025242 Bacteria 158235
437 Ga0207425_1000215 3300025245 Bacteria 45771
438 Ga0207425_1002841 3300025245 Bacteria 5827
439 Ga0207425_1004676 3300025245 Bacteria 4046
440 Ga0207425_1013759 3300025245 Bacteria 1858
441 Ga0207425_1024413 3300025245 Bacteria 1256
442 Ga0207425_1026374 3300025245 Bacteria 1192
443 Ga0209677_100002 3300025253 Bacteria 2045675
444 Ga0209677_100064 3300025253 Bacteria 151400
445 Ga0209677_112773 3300025253 Bacteria 1227
446 Ga0209148_1000145 3300025254 Bacteria 161352
447 Ga0209129_1000018 3300025258 Bacteria 469298
448 Ga0209129_1000054 3300025258 Bacteria 261997
449 Ga0209129_1000103 3300025258 Bacteria 161305
450 Ga0209129_1009530 3300025258 Bacteria 2543
451 Ga0209233_1000005 3300025261 Bacteria 1531866
452 Ga0209233_1001009 3300025261 Bacteria 12019
453 Ga0209565_1000086 3300025263 Bacteria 152204
454 Ga0209565_1000317 3300025263 Bacteria 44071
455 Ga0209565_1001154 3300025263 Bacteria 12731
456 Ga0209565_1003106 3300025263 Bacteria 5572
457 Ga0209565_1005158 3300025263 Bacteria 3840
458 Ga0209455_1000399 3300025272 Bacteria 36942
459 Ga0209673_1000168 3300025273 Bacteria 135126
460 Ga0209673_1001793 3300025273 Bacteria 17739
461 Ga0209673_1009768 3300025273 Bacteria 4116
462 Ga0209130_1000206 3300025284 Bacteria 79198
463 Ga0209130_1001133 3300025284 Bacteria 19524
464 Ga0209130_1001531 3300025284 Bacteria 14805
465 Ga0209130_1001936 3300025284 Bacteria 11521
466 Ga0209130_1013485 3300025284 Bacteria 2090
467 Ga0209675_1000193 3300025291 Bacteria 66563
468 Ga0209675_1000548 3300025291 Bacteria 27388
469 Ga0209675_1002487 3300025291 Bacteria 9442
470 Ga0209675_1002730 3300025291 Bacteria 8841
471 Ga0209675_1005202 3300025291 Bacteria 5514
472 Ga0209675_1005551 3300025291 Bacteria 5256
473 Ga0209675_1019667 3300025291 Bacteria 1850
474 Ga0209676_1000053 3300025292 Bacteria 370111
475 Ga0209676_1000103 3300025292 Bacteria 226908
476 Ga0209676_1000290 3300025292 Bacteria 103000
477 Ga0209676_1004587 3300025292 Bacteria 7631
478 Ga0209676_1004993 3300025292 Bacteria 7110
479 Ga0209025_1000018 3300025294 Bacteria 686898
480 Ga0209025_1000034 3300025294 Bacteria 413205
481 Ga0209025_1000059 3300025294 Bacteria 305480
482 Ga0209025_1000073 3300025294 Bacteria 282133
483 Ga0209025_1000093 3300025294 Bacteria 241788
484 Ga0209025_1000201 3300025294 Bacteria 145890
485 Ga0209025_1003493 3300025294 Bacteria 14805
486 Ga0209025_1023935 3300025294 Bacteria 3173
487 Ga0209025_1035232 3300025294 Bacteria 2265
488 Ga0209025_1038171 3300025294 Bacteria 2117
489 Ga0209025_1062942 3300025294 Bacteria 1372
490 Ga0209564_1000301 3300025295 Bacteria 97869
491 Ga0209564_1000408 3300025295 Bacteria 76528
492 Ga0209564_1001285 3300025295 Bacteria 27486
493 Ga0209564_1003017 3300025295 Bacteria 12029
494 Ga0209564_1004316 3300025295 Bacteria 8786
495 Ga0209758_1000034 3300025297 Bacteria 467637
496 Ga0209758_1011927 3300025297 Bacteria 4947
497 Ga0209758_1034934 3300025297 Bacteria 1989
498 Ga0209758_1052022 3300025297 Bacteria 1420
499 Ga0209758_1114102 3300025297 Bacteria 742
500 Ga0209050_1000012 3300025298 Bacteria 813717
501 Ga0209050_1001244 3300025298 Bacteria 29472
502 Ga0209050_1007544 3300025298 Bacteria 6063
503 Ga0209050_1009167 3300025298 Bacteria 5116
504 Ga0209256_1000066 3300025299 Bacteria 247534
505 Ga0209256_1000086 3300025299 Bacteria 218837
506 Ga0209256_1001063 3300025299 Bacteria 31840
507 Ga0209256_1003254 3300025299 Bacteria 11683
508 Ga0209256_1085940 3300025299 Bacteria 678
509 Ga0207426_1000058 3300025302 Bacteria 363857
510 Ga0207426_1000067 3300025302 Bacteria 342108
511 Ga0207426_1000156 3300025302 Bacteria 178646
512 Ga0209051_1000019 3300025303 Bacteria 511268
513 Ga0209051_1000141 3300025303 Bacteria 135837
514 Ga0209051_1001450 3300025303 Bacteria 20110
515 Ga0209051_1001589 3300025303 Bacteria 18632
516 Ga0209051_1002728 3300025303 Bacteria 12254
517 Ga0209051_1053241 3300025303 Bacteria 1331
518 Ga0209051_1067377 3300025303 Bacteria 1095
519 Ga0209051_1075533 3300025303 Bacteria 994
520 Ga0209257_1000024 3300025304 Bacteria 726068
521 Ga0209257_1003493 3300025304 Bacteria 13388
522 Ga0209257_1015612 3300025304 Bacteria 3146
523 Ga0207656_10004218 3300025321 Bacteria 5000
524 Ga0207656_10017790 3300025321 Bacteria 2789
525 Ga0207696_1000001 3300025711 Bacteria 2579611
526 Ga0207696_1000070 3300025711 Bacteria 227242
527 Ga0207696_1000099 3300025711 Bacteria 173329
528 Ga0207696_1000170 3300025711 Bacteria 102852
529 Ga0207696_1000537 3300025711 Bacteria 30749
530 Ga0207696_1001040 3300025711 Bacteria 16508
531 Ga0207696_1002538 3300025711 Bacteria 8897
532 Ga0207696_1004683 3300025711 Bacteria 5844
533 Ga0207696_1007450 3300025711 Bacteria 4283
534 Ga0207696_1010764 3300025711 Bacteria 3336
535 Ga0207696_1012417 3300025711 Bacteria 3011
536 Ga0207696_1039647 3300025711 Bacteria 1384
537 Ga0207655_1000001 3300025728 Bacteria 1866413
538 Ga0207655_1000009 3300025728 Bacteria 664676
539 Ga0207655_1000046 3300025728 Bacteria 309474
540 Ga0207655_1000071 3300025728 Bacteria 237394
541 Ga0207655_1000089 3300025728 Bacteria 204720
542 Ga0207655_1000215 3300025728 Bacteria 100334
543 Ga0207655_1000363 3300025728 Bacteria 64519
544 Ga0207655_1000506 3300025728 Bacteria 49895
545 Ga0207655_1000763 3300025728 Bacteria 36016
546 Ga0207655_1006208 3300025728 Bacteria 7957
547 Ga0207655_1015575 3300025728 Bacteria 4215
548 Ga0207655_1043112 3300025728 Bacteria 1913
549 Ga0207655_1060447 3300025728 Bacteria 1469
550 Ga0207713_1000001 3300025735 Bacteria 2295391
551 Ga0207713_1000004 3300025735 Bacteria 702781
552 Ga0207713_1000018 3300025735 Bacteria 362635
553 Ga0207713_1000120 3300025735 Bacteria 123766
554 Ga0207713_1002665 3300025735 Bacteria 12798
555 Ga0207713_1004886 3300025735 Bacteria 8583
556 Ga0207713_1018235 3300025735 Bacteria 3481
557 Ga0207713_1018975 3300025735 Bacteria 3385
558 Ga0207713_1030329 3300025735 Bacteria 2409
559 Ga0207713_1035127 3300025735 Bacteria 2167
560 Ga0207713_1035833 3300025735 Bacteria 2136
561 Ga0207713_1071665 3300025735 Bacteria 1278
562 Ga0207713_1089201 3300025735 Bacteria 1088
563 Ga0207710_10000233 3300025900 Bacteria 48055
564 Ga0207710_10081304 3300025900 Bacteria 1503
565 Ga0207680_10011667 3300025903 Bacteria 4448
566 Ga0207647_10003226 3300025904 Bacteria 12238
567 Ga0207705_10000029 3300025909 Bacteria 239897
568 Ga0207705_10000755 3300025909 Bacteria 26682
569 Ga0207705_10056150 3300025909 Bacteria 2839
570 Ga0207705_10958300 3300025909 Bacteria 662
571 Ga0207654_10000004 3300025911 Bacteria 902334
572 Ga0207654_10115476 3300025911 Bacteria 1677
573 Ga0207707_10000042 3300025912 Bacteria 126050
574 Ga0207707_10000144 3300025912 Bacteria 73715
575 Ga0207707_10001056 3300025912 Bacteria 26434
576 Ga0207707_10008129 3300025912 Bacteria 9110
577 Ga0207707_10206830 3300025912 Bacteria 1710
578 Ga0207695_10002071 3300025913 Bacteria 30574
579 Ga0207695_10010137 3300025913 Bacteria 11561
580 Ga0207695_10084151 3300025913 Bacteria 3212
581 Ga0207695_10367416 3300025913 Bacteria 1325
582 Ga0207671_10026936 3300025914 Bacteria 4301
583 Ga0207660_10000413 3300025917 Bacteria 28242
584 Ga0207662_10099146 3300025918 Bacteria 1803
585 Ga0207657_10592936 3300025919 Bacteria 865
586 Ga0207649_10007256 3300025920 Bacteria 6025
587 Ga0207649_10015548 3300025920 Bacteria 4275
588 Ga0207649_10519784 3300025920 Bacteria 907
589 Ga0207649_10566197 3300025920 Bacteria 871
590 Ga0207652_10000082 3300025921 Bacteria 103057
591 Ga0207652_10000808 3300025921 Bacteria 29892
592 Ga0207652_10001430 3300025921 Bacteria 21150
593 Ga0207652_10345918 3300025921 Bacteria 1342
594 Ga0207681_10011213 3300025923 Bacteria 5505
595 Ga0207694_10021179 3300025924 Bacteria 4924
596 Ga0207694_10974166 3300025924 Bacteria 717
597 Ga0207650_10811942 3300025925 Bacteria 793
598 Ga0207644_10298919 3300025931 Bacteria 1297
599 Ga0207690_10004125 3300025932 Bacteria 8581
600 Ga0207690_10008721 3300025932 Bacteria 6016
601 Ga0207690_10298468 3300025932 Bacteria 1260
602 Ga0207706_10011328 3300025933 Bacteria 8125
603 Ga0207706_10174918 3300025933 Bacteria 1886
604 Ga0207686_10001018 3300025934 Bacteria 16599
605 Ga0207686_10240383 3300025934 Bacteria 1318
606 Ga0207686_10534495 3300025934 Bacteria 914
607 Ga0207709_10001503 3300025935 Bacteria 16107
608 Ga0207669_10027614 3300025937 Bacteria 3111
609 Ga0207691_10545460 3300025940 Bacteria 983
610 Ga0207711_10633536 3300025941 Bacteria 997
611 Ga0207661_10015030 3300025944 Bacteria 5685
612 Ga0207661_11268292 3300025944 Bacteria 677
613 Ga0207679_10077418 3300025945 Bacteria 2530
614 Ga0207679_10080577 3300025945 Bacteria 2486
615 Ga0207667_10000075 3300025949 Bacteria 169836
616 Ga0207667_10005022 3300025949 Bacteria 16175
617 Ga0207667_10007273 3300025949 Bacteria 13352
618 Ga0207667_10161254 3300025949 Bacteria 2306
619 Ga0207667_10385112 3300025949 Bacteria 1428
620 Ga0207651_10180586 3300025960 Bacteria 1674
621 Ga0207712_10961464 3300025961 Bacteria 757
622 Ga0207712_11548013 3300025961 Bacteria 594
623 Ga0207668_10007961 3300025972 Bacteria 6305
624 Ga0207668_10470819 3300025972 Bacteria 1076
625 Ga0207640_10010766 3300025981 Bacteria 5161
626 Ga0207640_10016893 3300025981 Bacteria 4256
627 Ga0207640_10022260 3300025981 Bacteria 3790
628 Ga0207640_10390751 3300025981 Bacteria 1130
629 Ga0207658_10205254 3300025986 Bacteria 1648
630 Ga0207658_10329316 3300025986 Bacteria 1324
631 Ga0207658_10566998 3300025986 Bacteria 1017
632 Ga0207658_11591886 3300025986 Bacteria 597
633 Ga0207639_10001297 3300026041 Bacteria 16886
634 Ga0207639_10007637 3300026041 Bacteria 7377
635 Ga0207639_10047674 3300026041 Bacteria 3239
636 Ga0207639_10155920 3300026041 Bacteria 1918
637 Ga0207678_10001891 3300026067 Bacteria 19106
638 Ga0207678_10005658 3300026067 Bacteria 11170
639 Ga0207678_10052250 3300026067 Bacteria 3526
640 Ga0207702_10031604 3300026078 Bacteria 4412
641 Ga0207641_10161201 3300026088 Bacteria 2039
642 Ga0207674_10000712 3300026116 Bacteria 43462
643 Ga0207674_10003998 3300026116 Bacteria 17911
644 Ga0207674_10059041 3300026116 Bacteria 3884
645 Ga0207674_10353568 3300026116 Bacteria 1420
646 Ga0207675_100198346 3300026118 Bacteria 1927
647 Ga0207683_10014368 3300026121 Bacteria 6744
648 Ga0207683_10049183 3300026121 Bacteria 3690
649 Ga0207683_10484361 3300026121 Bacteria 1142
650 Ga0207683_11617527 3300026121 Bacteria 597
651 Ga0207698_10000358 3300026142 Bacteria 26861
652 Ga0207698_10313763 3300026142 Bacteria 1465
653 Ga0209281_1000001 3300027111 Bacteria 1933496
654 Ga0209281_1000003 3300027111 Bacteria 1260089
655 Ga0209281_1000114 3300027111 Bacteria 210536
656 Ga0209281_1000180 3300027111 Bacteria 147099
657 Ga0209281_1000229 3300027111 Bacteria 118957
658 Ga0209281_1000267 3300027111 Bacteria 100564
659 Ga0209281_1000288 3300027111 Bacteria 93347
660 Ga0209281_1000383 3300027111 Bacteria 70062
661 Ga0209281_1000722 3300027111 Bacteria 32788
662 Ga0209281_1001917 3300027111 Bacteria 9885
663 Ga0209281_1002477 3300027111 Bacteria 7347
664 Ga0209973_1037991 3300027252 Bacteria 698
665 Ga0209371_1000001 3300027312 Bacteria 2771503
666 Ga0209371_1000010 3300027312 Bacteria 922021
667 Ga0209371_1000020 3300027312 Bacteria 556282
668 Ga0209371_1000081 3300027312 Bacteria 185440
669 Ga0209371_1000085 3300027312 Bacteria 179586
670 Ga0209371_1000086 3300027312 Bacteria 175099
671 Ga0209371_1000167 3300027312 Bacteria 98922
672 Ga0209371_1000321 3300027312 Bacteria 52619
673 Ga0209371_1000349 3300027312 Bacteria 50349
674 Ga0209371_1000616 3300027312 Bacteria 31750
675 Ga0209371_1000809 3300027312 Bacteria 25834
676 Ga0209371_1001073 3300027312 Bacteria 20478
677 Ga0209371_1002095 3300027312 Bacteria 11843
678 Ga0209371_1002126 3300027312 Bacteria 11691
679 Ga0209371_1002299 3300027312 Bacteria 10904
680 Ga0209371_1002407 3300027312 Bacteria 10512
681 Ga0209371_1002837 3300027312 Bacteria 9192
682 Ga0209371_1003155 3300027312 Bacteria 8368
683 Ga0209371_1003489 3300027312 Bacteria 7600
684 Ga0209371_1003616 3300027312 Bacteria 7380
685 Ga0209371_1021256 3300027312 Bacteria 1578
686 Ga0209371_1046577 3300027312 Bacteria 851
687 Ga0209371_1047234 3300027312 Bacteria 843
688 Ga0209371_1062786 3300027312 Bacteria 678
689 Ga0209999_1043668 3300027543 Bacteria 842
690 Ga0210002_1020944 3300027617 Bacteria 1055
691 Ga0209282_1000043 3300027666 Bacteria 119260
692 Ga0209971_1001163 3300027682 Bacteria 6629
693 Ga0209971_1169283 3300027682 Bacteria 539
694 Ga0209974_10010341 3300027876 Bacteria 3148
695 Ga0268266_10000282 3300028379 Bacteria 83781
696 Ga0268266_10025201 3300028379 Bacteria 5062
697 Ga0268266_10180251 3300028379 Bacteria 1923
698 Ga0268266_11456353 3300028379 Bacteria 660
699 Ga0268265_10139443 3300028380 Bacteria 2028
700 Ga0268264_10304937 3300028381 Bacteria 1500
701 Ga0265323_10010795 3300028653 Bacteria 3698
702 Ga0307515_10000626 3300028794 Bacteria 82165
703 Ga0307515_10001303 3300028794 Bacteria 56637
704 Ga0307515_10032622 3300028794 Bacteria 8617
705 Ga0265324_10056153 3300029957 Bacteria 1349
706 Ga0268256_1000001 3300030500 Bacteria 2771065
707 Ga0268256_1000003 3300030500 Bacteria 1289401
708 Ga0268256_1000048 3300030500 Bacteria 312298
709 Ga0268256_1000092 3300030500 Bacteria 144061
710 Ga0268256_1000114 3300030500 Bacteria 117092
711 Ga0268256_1000124 3300030500 Bacteria 111181
712 Ga0268256_1000175 3300030500 Bacteria 76497
713 Ga0268256_1000532 3300030500 Bacteria 31413
714 Ga0268256_1000920 3300030500 Bacteria 20333
715 Ga0268256_1001027 3300030500 Bacteria 18776
716 Ga0268256_1001435 3300030500 Bacteria 14374
717 Ga0268256_1001749 3300030500 Bacteria 12267
718 Ga0268256_1002069 3300030500 Bacteria 10802
719 Ga0268256_1002830 3300030500 Bacteria 8368
720 Ga0268256_1003160 3300030500 Bacteria 7667
721 Ga0268256_1004676 3300030500 Bacteria 5591
722 Ga0268256_1007695 3300030500 Bacteria 3800
723 Ga0268256_1017912 3300030500 Bacteria 1983
724 Ga0268256_1018423 3300030500 Bacteria 1937
725 Ga0268256_1023884 3300030500 Bacteria 1578
726 Ga0268256_1052542 3300030500 Bacteria 851
727 Ga0316177_1037186 3300030731 Bacteria 9370
728 Ga0316176_1061113 3300030732 Bacteria 4189
729 Ga0314311_1031728 3300030733 Bacteria 7577
730 Ga0316179_1098736 3300030734 Bacteria 3497
731 Ga0316178_1015612 3300030735 Bacteria 4295
732 Ga0316180_1126976 3300030736 Bacteria 746
733 Ga0316183_1122932 3300030742 Bacteria 7560
734 Ga0316181_1114225 3300030744 Bacteria 2386
735 Ga0316182_1103194 3300030745 Bacteria 5077
736 Ga0265330_10004252 3300031235 Bacteria 7298
737 Ga0265332_10019389 3300031238 Bacteria 3002
738 Ga0265328_10327217 3300031239 Bacteria 594
739 Ga0265331_10003913 3300031250 Bacteria 9413
740 Ga0265331_10105558 3300031250 Bacteria 1294
741 Ga0265327_10000133 3300031251 Bacteria 163887
742 Ga0265327_10002852 3300031251 Bacteria 17418
743 Ga0265327_10015025 3300031251 Bacteria 5031
744 Ga0265327_10024914 3300031251 Bacteria 3500
745 Ga0265327_10025409 3300031251 Bacteria 3453
746 Ga0265327_10393824 3300031251 Bacteria 602
747 Ga0265316_10147424 3300031344 Bacteria 1764
748 Ga0307408_100009699 3300031548 Bacteria 6346
749 Ga0307408_100014538 3300031548 Bacteria 5230
750 Ga0307408_100033660 3300031548 Bacteria 3582
751 Ga0307408_100161444 3300031548 Bacteria 1780
752 Ga0307408_100323091 3300031548 Bacteria 1300
753 Ga0307514_10000711 3300031649 Bacteria 57628
754 Ga0307514_10173650 3300031649 Bacteria 1402
755 Ga0316575_10024298 3300031665 Bacteria 2346
756 Ga0316579_10046342 3300031691 Bacteria 2028
757 Ga0265314_10008686 3300031711 Bacteria 8689
758 Ga0316576_10557731 3300031727 Bacteria 839
759 Ga0316578_10079152 3300031728 Bacteria 1954
760 Ga0316578_10118438 3300031728 Bacteria 1591
761 Ga0307405_10058452 3300031731 Bacteria 2426
762 Ga0307405_10144393 3300031731 Bacteria 1664
763 Ga0307405_10180638 3300031731 Bacteria 1514
764 Ga0307405_10310911 3300031731 Bacteria 1199
765 Ga0307405_10321329 3300031731 Bacteria 1182
766 Ga0307405_10362857 3300031731 Bacteria 1121
767 Ga0307405_10427102 3300031731 Bacteria 1044
768 Ga0307405_10874541 3300031731 Bacteria 758
769 Ga0307405_10897101 3300031731 Bacteria 749
770 Ga0316577_10041516 3300031733 Bacteria 2574
771 Ga0316577_10057099 3300031733 Bacteria 2179
772 Ga0316577_10062977 3300031733 Bacteria 2071
773 Ga0307413_10082572 3300031824 Bacteria 2065
774 Ga0307413_10347186 3300031824 Bacteria 1144
775 Ga0307406_10003334 3300031901 Bacteria 8755
776 Ga0307406_10007375 3300031901 Bacteria 6097
777 Ga0307406_10029379 3300031901 Bacteria 3329
778 Ga0307406_10109880 3300031901 Bacteria 1896
779 Ga0307406_10319528 3300031901 Bacteria 1200
780 Ga0307406_11635513 3300031901 Bacteria 569
781 Ga0307412_10019109 3300031911 Bacteria 4140
782 Ga0307412_10128246 3300031911 Bacteria 1838
783 Ga0307412_10242227 3300031911 Bacteria 1395
784 Ga0307412_10423382 3300031911 Bacteria 1090
785 Ga0307412_12210232 3300031911 Bacteria 512
786 Ga0307409_100887652 3300031995 Bacteria 904
787 Ga0307416_100408334 3300032002 Bacteria 1398
788 Ga0307416_100431182 3300032002 Bacteria 1365
789 Ga0307416_101951500 3300032002 Bacteria 690
790 Ga0307416_102284103 3300032002 Bacteria 641
791 Ga0307416_102326572 3300032002 Bacteria 636
792 Ga0307414_10177984 3300032004 Bacteria 1707
793 Ga0307414_10339772 3300032004 Bacteria 1285
794 Ga0307414_10553731 3300032004 Bacteria 1025
795 Ga0307414_11822512 3300032004 Bacteria 568
796 Ga0307411_10019468 3300032005 Bacteria 3922
797 Ga0307411_10201421 3300032005 Bacteria 1529
798 Ga0307411_10261224 3300032005 Bacteria 1367
799 Ga0316580_10045072 3300032139 Bacteria 1360
800 Ga0316580_10237488 3300032139 Bacteria 563
801 Ga0307510_10232500 3300033180 Bacteria 1345
802 Ga0316587_1000878 3300033529 Bacteria 3407
803 Ga0316574_0019624 3300035398 Bacteria 3990
804 Ga0316574_0212159 3300035398 Bacteria 1242
805 Ga0316582_0012653 3300036647 Bacteria 4718
806 Ga0316582_0139520 3300036647 Bacteria 1633
807 Ga0316582_0207199 3300036647 Bacteria 1339
808 Ga0316582_0254001 3300036647 Bacteria 1205
809 Ga0316584_0003227 3300036712 Bacteria 10555
810 Ga0316584_0007399 3300036712 Bacteria 7505
811 Ga0316584_0058252 3300036712 Bacteria 2892
812 Ga0316584_0137779 3300036712 Bacteria 1821
813 Ga0395900_0067131 3300037418 Bacteria 3684
814 Ga0395900_0359565 3300037418 Bacteria 1427
815 Ga0395898_0167266 3300037466 Bacteria 2102
816 Ga0395898_0368686 3300037466 Bacteria 1369
817 Ga0395905_0229337 3300037471 Bacteria 1737
818 Ga0316581_0035288 3300037588 Bacteria 1515
819 Ga0395901_0642429 3300038443 Bacteria 1065
820 Ga0395901_1003615 3300038443 Bacteria 810
821 Ga0395901_1886488 3300038443 Bacteria 545
822 Ga0436365_1037676 3300039437 Bacteria 170132
823 Ga0436361_0079908 3300039447 Bacteria 734
824 Ga0436361_1010587 3300039447 Bacteria 1135
825 Ga0436363_0982124 3300039450 Bacteria 763
826 Ga0439436_0000336 3300041404 Bacteria 11576
827 Ga0439436_0002994 3300041404 Bacteria 5123
828 Ga0439438_000001 3300041405 Bacteria 1263568
829 Ga0439438_001188 3300041405 Bacteria 11568
830 Ga0439438_001930 3300041405 Bacteria 9046
831 Ga0439438_008658 3300041405 Bacteria 3351
832 Ga0439438_034767 3300041405 Bacteria 1326
833 Ga0439439_0003042 3300041406 Bacteria 3653
834 Ga0439439_0014282 3300041406 Bacteria 1933
835 Ga0439447_004155 3300041407 Bacteria 5030
836 Ga0439447_005376 3300041407 Bacteria 4267
837 Ga0439447_028060 3300041407 Bacteria 1432
838 Ga0439461_0065771 3300041410 Bacteria 831
839 Ga0439466_0000003 3300041411 Bacteria 486229
840 Ga0439466_0058052 3300041411 Bacteria 1252
841 Ga0439466_0218156 3300041411 Bacteria 579
842 Ga0439465_0000517 3300041413 Bacteria 11531
843 Ga0451791_0103488 3300041451 Bacteria 558
844 Ga0451791_0972312 3300041451 Bacteria 1330
845 Ga0451793_1583412 3300041452 Bacteria 765
846 Ga0451795_0579443 3300041456 Bacteria 879
847 Ga0451802_0881816 3300041460 Bacteria 593
848 Ga0451805_033409 3300041461 Bacteria 697
849 Ga0451847_0790351 3300041503 Bacteria 938
850 Ga0451853_2599509 3300041512 Bacteria 1805
851 Ga0451853_3098869 3300041512 Bacteria 957
852 Ga0439431_0002606 3300041997 Bacteria 3980
853 Ga0439431_0276272 3300041997 Bacteria 502
854 Ga0439433_0024432 3300041999 Bacteria 1361
855 Ga0439433_0038479 3300041999 Bacteria 1109
856 Ga0439442_002961 3300042002 Bacteria 3345
857 Ga0439445_0000347 3300042004 Bacteria 9147
858 Ga0439445_0003104 3300042004 Bacteria 3723
859 Ga0439445_0200499 3300042004 Bacteria 589
860 Ga0439448_0244134 3300042005 Bacteria 633
861 Ga0439432_000662 3300042006 Bacteria 12859
862 Ga0439432_008144 3300042006 Bacteria 3689
863 Ga0439432_010037 3300042006 Bacteria 3292
864 Ga0439432_010592 3300042006 Bacteria 3187
865 Ga0439432_014689 3300042006 Bacteria 2649
866 Ga0439432_125770 3300042006 Bacteria 758
867 Ga0439432_201852 3300042006 Bacteria 576
868 Ga0439449_0000838 3300042007 Bacteria 11916
869 Ga0439449_0009132 3300042007 Bacteria 3758
870 Ga0439449_0184117 3300042007 Bacteria 781
871 Ga0439451_047755 3300042009 Bacteria 857
872 Ga0439452_000001 3300042010 Bacteria 1725439
873 Ga0439452_000003 3300042010 Bacteria 942815
874 Ga0439452_000006 3300042010 Bacteria 645083
875 Ga0439452_000008 3300042010 Bacteria 569877
876 Ga0439452_000161 3300042010 Bacteria 49828
877 Ga0439452_000216 3300042010 Bacteria 40719
878 Ga0439452_000949 3300042010 Bacteria 13024
879 Ga0439452_002479 3300042010 Bacteria 6788
880 Ga0439457_011278 3300042014 Bacteria 2036
881 Ga0439462_0000328 3300042015 Bacteria 8874
882 Ga0439462_0002574 3300042015 Bacteria 4232
883 Ga0439463_006410 3300042016 Bacteria 2920
884 Ga0450911_000124 3300042115 Bacteria 30673
885 Ga0450922_001261 3300042124 Bacteria 2509
886 Ga0450922_004419 3300042124 Bacteria 1291
887 Ga0450923_000221 3300042125 Bacteria 5506
888 Ga0450923_013904 3300042125 Bacteria 1485
889 Ga0450890_007058 3300042127 Bacteria 1432
890 Ga0450894_010619 3300042131 Bacteria 1195
891 Ga0450898_012816 3300042134 Bacteria 1390
892 Ga0450900_017373 3300042136 Bacteria 981
893 Ga0450902_019005 3300042137 Bacteria 1129
894 Ga0450907_000329 3300042146 Bacteria 15006
895 Ga0439446_0014658 3300042156 Bacteria 2166
896 Ga0439446_0176825 3300042156 Bacteria 712
897 Ga0450909_012251 3300042185 Bacteria 1257
898 Ga0450909_015394 3300042185 Bacteria 1129
899 Ga0439434_0002221 3300042435 Bacteria 5634
900 Ga0439434_0086096 3300042435 Bacteria 1001
901 Ga0439464_0000625 3300042439 Bacteria 7504
902 Ga0439464_0003541 3300042439 Bacteria 3949
903 Ga0439464_0019306 3300042439 Bacteria 1860
904 Ga0439464_0044551 3300042439 Bacteria 1271
905 Ga0450893_0003283 3300042532 Bacteria 2545
906 Ga0450893_0004785 3300042532 Bacteria 2161
907 Ga0450893_0039760 3300042532 Bacteria 859
908 Ga0451577_0014209 3300042876 Bacteria 7423
909 Ga0451577_0025812 3300042876 Bacteria 5327
910 Ga0451577_0118887 3300042876 Bacteria 2367
911 Ga0451577_1176457 3300042876 Unclassified 684
912 Ga0466977_0000007 3300044666 Bacteria 32886
913 Ga0466981_0000016 3300044669 Bacteria 100013
914 Ga0453683_0504451 3300044673 Bacteria 785
915 Ga0466961_0023977 3300044693 Bacteria 3925
916 Ga0453684_0000917 3300044712 Bacteria 97990
917 Ga0453684_0014200 3300044712 Bacteria 12785
918 Ga0453684_0693932 3300044712 Bacteria 1107
919 Ga0453684_1211732 3300044712 Bacteria 792
920 Ga0466970_0209074 3300044765 Bacteria 1087
921 Ga0466960_0037103 3300044901 Bacteria 2285
922 Ga0451576_0252121 3300045051 Bacteria 1845
923 Ga0495617_012114 3300046452 Bacteria 2940
924 Ga0495617_031455 3300046452 Bacteria 1782
925 Ga0495627_000027 3300046453 Bacteria 236960
926 Ga0495627_073184 3300046453 Bacteria 999
927 Ga0495627_162336 3300046453 Bacteria 621
928 Ga0495592_0016839 3300046454 Bacteria 5551
929 Ga0495592_0206827 3300046454 Bacteria 1321
930 Ga0495591_000014 3300046458 Bacteria 254281
931 Ga0495591_000238 3300046458 Bacteria 52890
932 Ga0495591_002770 3300046458 Bacteria 9466
933 Ga0495591_005174 3300046458 Bacteria 6112
934 Ga0495591_084621 3300046458 Bacteria 804
935 Ga0495638_0002381 3300046460 Bacteria 15407
936 Ga0495638_0013990 3300046460 Bacteria 5441
937 Ga0495651_0005777 3300046462 Bacteria 9440
938 Ga0495651_0414476 3300046462 Bacteria 877
939 Ga0495653_0198914 3300046463 Bacteria 1361
940 Ga0495650_0000002 3300046471 Bacteria 1057165
941 Ga0495650_0000021 3300046471 Bacteria 531242
942 Ga0495650_0000032 3300046471 Bacteria 425389
943 Ga0495650_0000396 3300046471 Bacteria 73012
944 Ga0495650_0000478 3300046471 Bacteria 61296
945 Ga0495605_0004250 3300046474 Bacteria 8440
946 Ga0495605_0004747 3300046474 Bacteria 7945
947 Ga0495605_0033547 3300046474 Bacteria 2604
948 Ga0495605_0073615 3300046474 Bacteria 1609
949 Ga0495605_0127430 3300046474 Bacteria 1150
950 Ga0495639_0006891 3300046475 Bacteria 4880
951 Ga0495584_0006445 3300046491 Bacteria 6141
952 Ga0495584_0034114 3300046491 Bacteria 2575
953 Ga0495585_0004620 3300046492 Bacteria 8890
954 Ga0495594_0007426 3300046499 Bacteria 5639
955 Ga0495596_0000001 3300046500 Bacteria 501331
956 Ga0495596_0000366 3300046500 Bacteria 29053
957 Ga0495596_0045021 3300046500 Bacteria 1735
958 Ga0495607_0000175 3300046501 Bacteria 68131
959 Ga0495607_0007488 3300046501 Bacteria 7547
960 Ga0495607_0009243 3300046501 Bacteria 6695
961 Ga0495607_0178868 3300046501 Bacteria 1065
962 Ga0495606_0001314 3300046507 Bacteria 34190
963 Ga0495606_0231995 3300046507 Bacteria 1034
964 Ga0495608_0006970 3300046511 Bacteria 7999
965 Ga0495610_0000002 3300046512 Bacteria 1282131
966 Ga0495610_0001226 3300046512 Bacteria 23065
967 Ga0495610_0029233 3300046512 Bacteria 2905
968 Ga0495616_0001943 3300046513 Bacteria 13903
969 Ga0495616_0002001 3300046513 Bacteria 13713
970 Ga0495616_0086880 3300046513 Bacteria 1487
971 Ga0495618_0012760 3300046514 Bacteria 5107
972 Ga0495618_0028883 3300046514 Bacteria 3458
973 Ga0495618_0106009 3300046514 Bacteria 1799
974 Ga0495620_0003066 3300046515 Bacteria 9591
975 Ga0495620_0141600 3300046515 Bacteria 940
976 Ga0495620_0145922 3300046515 Bacteria 924
977 Ga0495620_0147396 3300046515 Bacteria 918
978 Ga0495628_0000059 3300046516 Bacteria 87291
979 Ga0495628_0006630 3300046516 Bacteria 10098
980 Ga0495628_0295816 3300046516 Bacteria 1199
981 Ga0495628_0548866 3300046516 Bacteria 830
982 Ga0495630_0123685 3300046517 Bacteria 1963
983 Ga0495631_0000414 3300046518 Bacteria 29474
984 Ga0495632_0007880 3300046519 Bacteria 6619
985 Ga0495632_0011349 3300046519 Bacteria 5201
986 Ga0495632_0131606 3300046519 Bacteria 1164
987 Ga0495632_0354786 3300046519 Bacteria 644
988 Ga0495637_0000005 3300046520 Bacteria 447799
989 Ga0495637_0031616 3300046520 Bacteria 2339
990 Ga0495643_0000002 3300046522 Bacteria 1131278
991 Ga0495643_0019114 3300046522 Bacteria 3967
992 Ga0495643_0022631 3300046522 Bacteria 3584
993 Ga0495643_0025319 3300046522 Bacteria 3358
994 Ga0495643_0028334 3300046522 Bacteria 3141
995 Ga0495643_0081546 3300046522 Bacteria 1682
996 Ga0495644_0002242 3300046523 Bacteria 7732
997 Ga0495648_0000299 3300046524 Bacteria 55022
998 Ga0495648_0006462 3300046524 Bacteria 9563
999 Ga0495648_0021944 3300046524 Bacteria 4410
1000 Ga0495663_0142351 3300046525 Bacteria 814
1001 Ga0495666_0001981 3300046526 Bacteria 10110
1002 Ga0495666_0035617 3300046526 Bacteria 2426
1003 Ga0495666_0499409 3300046526 Bacteria 544
1004 Ga0495652_0004625 3300046529 Bacteria 13120
1005 Ga0495652_0035985 3300046529 Bacteria 4306
1006 Ga0495654_0000019 3300046530 Bacteria 289483
1007 Ga0495654_0001152 3300046530 Bacteria 18924
1008 Ga0495654_0002661 3300046530 Bacteria 11346
1009 Ga0495654_0008751 3300046530 Bacteria 5572
1010 Ga0495654_0011360 3300046530 Bacteria 4821
1011 Ga0495654_0053428 3300046530 Bacteria 1963
1012 Ga0495654_0054888 3300046530 Bacteria 1930
1013 Ga0495654_0082084 3300046530 Bacteria 1509
1014 Ga0495654_0183630 3300046530 Bacteria 904
1015 Ga0495586_0097772 3300046535 Bacteria 1627
1016 Ga0495587_0823400 3300046536 Bacteria 506
1017 Ga0495609_0010849 3300046538 Bacteria 4352
1018 Ga0495621_0004439 3300046539 Bacteria 3945
1019 Ga0495597_0000015 3300046542 Bacteria 172952
1020 Ga0495597_0000720 3300046542 Bacteria 26410
1021 Ga0495597_0001359 3300046542 Bacteria 17738
1022 Ga0495597_0020433 3300046542 Bacteria 3085
1023 Ga0495645_0054792 3300046543 Bacteria 2896
1024 Ga0495645_0181366 3300046543 Bacteria 1442
1025 Ga0495622_0013458 3300046557 Bacteria 3795
1026 Ga0495656_0005434 3300046615 Bacteria 4401
1027 Ga0495656_0007291 3300046615 Bacteria 3903
1028 Ga0495668_0053240 3300046616 Bacteria 2238
1029 Ga0495634_0069678 3300046642 Bacteria 2320
1030 Ga0495611_0035919 3300046648 Bacteria 2197
1031 Ga0495611_0401145 3300046648 Bacteria 627
1032 Ga0495625_0004458 3300046660 Bacteria 13233
1033 Ga0495625_0005285 3300046660 Bacteria 11849
1034 Ga0495625_0014435 3300046660 Bacteria 6304
1035 Ga0495635_0083588 3300046663 Bacteria 2185
1036 Ga0495635_0172144 3300046663 Bacteria 1472
1037 Ga0495661_0009993 3300046665 Bacteria 6487
1038 Ga0495588_0000437 3300046674 Bacteria 21337
1039 Ga0495657_0043991 3300046675 Bacteria 3041
1040 Ga0495599_0003585 3300046678 Bacteria 9102
1041 Ga0495623_0003538 3300046679 Bacteria 10338
1042 Ga0495646_0002246 3300046680 Bacteria 11800
1043 Ga0495646_0014471 3300046680 Bacteria 5017
1044 Ga0495646_0441126 3300046680 Bacteria 673
1045 Ga0495647_0067036 3300046681 Bacteria 1429
1046 Ga0495658_0042769 3300046683 Bacteria 2531
1047 Ga0495669_0147709 3300046684 Bacteria 1112
1048 Ga0495613_0714846 3300046689 Bacteria 659
1049 Ga0495624_0008986 3300046690 Bacteria 6944
1050 Ga0495624_0020855 3300046690 Bacteria 4354
1051 Ga0495624_0255279 3300046690 Bacteria 1060
1052 Ga0495670_0016534 3300046691 Bacteria 3627
1053 Ga0495670_0016868 3300046691 Bacteria 3590
1054 Ga0495671_0001044 3300046692 Bacteria 19266
1055 Ga0495671_0001269 3300046692 Bacteria 17216
1056 Ga0495671_0008856 3300046692 Bacteria 5651
1057 Ga0495671_0258152 3300046692 Bacteria 841
1058 Ga0495649_0013339 3300046694 Bacteria 4742
1059 Ga0495649_0014855 3300046694 Bacteria 4449
1060 Ga0495649_0042287 3300046694 Bacteria 2490
1061 Ga0495649_0107137 3300046694 Bacteria 1483
1062 Ga0495589_0000001 3300046794 Bacteria 888100
1063 Ga0495589_0039635 3300046794 Bacteria 2354
1064 Ga0495589_0052967 3300046794 Bacteria 2003
1065 Ga0495600_0003774 3300046809 Bacteria 8965
1066 Ga0495600_0511904 3300046809 Bacteria 736
1067 Ga0495600_0682364 3300046809 Bacteria 619
1068 Ga0495660_0000004 3300046810 Bacteria 1003183
1069 Ga0495660_0000021 3300046810 Bacteria 293250
1070 Ga0495660_0006528 3300046810 Bacteria 6890
1071 Ga0495660_0037106 3300046810 Bacteria 2716
1072 Ga0495604_0001830 3300047317 Bacteria 17320
1073 Ga0495604_0014340 3300047317 Bacteria 6321
1074 Ga0495604_0391285 3300047317 Bacteria 917
1075 Ga0495636_0010570 3300047318 Bacteria 3647
1076 Ga0495672_0000002 3300047320 Bacteria 740116
1077 Ga0495672_0000012 3300047320 Bacteria 519975
1078 Ga0495672_0000020 3300047320 Bacteria 432845
1079 Ga0495672_0024648 3300047320 Bacteria 3871
1080 Ga0495672_0215417 3300047320 Bacteria 951
1081 Ga0495676_0008592 3300047321 Bacteria 9354
1082 Ga0495683_0020678 3300047323 Bacteria 3393
1083 Ga0495677_0413493 3300047445 Bacteria 534
1084 Ga0495679_000020 3300047446 Bacteria 228413
1085 Ga0495679_002132 3300047446 Bacteria 10405
1086 Ga0495679_002328 3300047446 Bacteria 9757
1087 Ga0495679_047995 3300047446 Bacteria 1293
1088 Ga0495685_004966 3300047447 Bacteria 4325
1089 Ga0495673_0000065 3300047469 Bacteria 222481
1090 Ga0495673_0000081 3300047469 Bacteria 199943
1091 Ga0495681_0000088 3300047470 Bacteria 79878
1092 Ga0495681_0000426 3300047470 Bacteria 32387
1093 Ga0495686_0060309 3300047472 Bacteria 2358
1094 Ga0495593_0034149 3300047673 Bacteria 2767
1095 Ga0495593_0487597 3300047673 Bacteria 618
1096 Ga0495602_0012279 3300048088 Bacteria 8815
1097 Ga0495602_0147112 3300048088 Bacteria 1857
1098 Ga0495602_0375023 3300048088 Bacteria 1020
1099 Ga0495614_0004433 3300048089 Bacteria 6329
1100 Ga0495626_0000001 3300048091 Bacteria 1077129
1101 Ga0496100_0006740 3300048903 Bacteria 6288
1102 Ga0496100_0013256 3300048903 Bacteria 4747
1103 Ga0496100_0028570 3300048903 Bacteria 3441
1104 Ga0496100_0125278 3300048903 Bacteria 1802
1105 Ga0496100_1483057 3300048903 Bacteria 536
1106 Ga0496101_0000314 3300048904 Bacteria 33586
1107 Ga0496101_0025960 3300048904 Bacteria 4069
1108 Ga0496101_0203711 3300048904 Bacteria 1530
1109 Ga0496101_0383973 3300048904 Bacteria 1105
1110 Ga0496101_0592517 3300048904 Bacteria 876
1111 Ga0496101_0927755 3300048904 Bacteria 685
1112 Ga0496101_1288540 3300048904 Bacteria 571
1113 Ga0496102_0005511 3300048905 Bacteria 10747
1114 Ga0496102_0108549 3300048905 Bacteria 2585
1115 Ga0496102_0266586 3300048905 Bacteria 1615
1116 Ga0496102_0493239 3300048905 Bacteria 1146
1117 Ga0496103_0092134 3300048906 Bacteria 1913
1118 Ga0496103_0172794 3300048906 Bacteria 1388
1119 Ga0496103_0646170 3300048906 Bacteria 672
1120 Ga0496104_0000893 3300048907 Bacteria 25662
1121 Ga0496104_0001151 3300048907 Bacteria 22641
1122 Ga0496104_0452682 3300048907 Bacteria 1195
1123 Ga0496104_1047988 3300048907 Bacteria 719
1124 Ga0496104_1632241 3300048907 Bacteria 547
1125 Ga0496105_0001685 3300048908 Bacteria 15768
1126 Ga0496105_0019956 3300048908 Bacteria 5409
1127 Ga0496105_0118704 3300048908 Bacteria 2182
1128 Ga0496105_0157490 3300048908 Bacteria 1865
1129 Ga0496106_0048665 3300048909 Bacteria 3193
1130 Ga0496106_1184926 3300048909 Bacteria 596
1131 Ga0496107_0257645 3300048910 Bacteria 1298
1132 Ga0496107_0700337 3300048910 Bacteria 745
1133 Ga0496108_0059934 3300048911 Bacteria 3201
1134 Ga0496109_0078498 3300048912 Bacteria 3040
1135 Ga0496110_0306314 3300048913 Bacteria 1447
1136 Ga0496110_1212553 3300048913 Bacteria 663
1137 Ga0496110_1303227 3300048913 Bacteria 635
1138 Ga0496113_0110179 3300048916 Bacteria 2142
1139 Ga0496113_0182493 3300048916 Bacteria 1664
1140 Ga0496113_0747444 3300048916 Bacteria 779
1141 Ga0496114_0634583 3300048917 Bacteria 940
1142 Ga0496116_0000001 3300048919 Bacteria 1501681
1143 Ga0496116_0000094 3300048919 Bacteria 205588
1144 Ga0496116_0000261 3300048919 Bacteria 92108
1145 Ga0496116_0000431 3300048919 Bacteria 58709
1146 Ga0496116_0000679 3300048919 Bacteria 44214
1147 Ga0496116_0000738 3300048919 Bacteria 41713
1148 Ga0496116_0000930 3300048919 Bacteria 36114
1149 Ga0496116_0002175 3300048919 Bacteria 20873
1150 Ga0496116_0005086 3300048919 Bacteria 12360
1151 Ga0496116_0007904 3300048919 Bacteria 9324
1152 Ga0496116_0011708 3300048919 Bacteria 7228
1153 Ga0496116_0015751 3300048919 Bacteria 5958
1154 Ga0496116_0017298 3300048919 Bacteria 5603
1155 Ga0496116_0018592 3300048919 Bacteria 5349
1156 Ga0496116_0023072 3300048919 Bacteria 4643
1157 Ga0496116_0035310 3300048919 Bacteria 3512
1158 Ga0496116_0084036 3300048919 Bacteria 1962
1159 Ga0496116_0088658 3300048919 Bacteria 1889
1160 Ga0496116_0125206 3300048919 Bacteria 1477
1161 Ga0496116_0166367 3300048919 Bacteria 1202
1162 Ga0496116_0270833 3300048919 Bacteria 830
1163 Ga0496117_0000004 3300048920 Bacteria 877131
1164 Ga0496117_0000213 3300048920 Bacteria 111751
1165 Ga0496117_0001414 3300048920 Bacteria 34795
1166 Ga0496117_0002234 3300048920 Bacteria 24995
1167 Ga0496117_0002320 3300048920 Bacteria 24384
1168 Ga0496117_0003205 3300048920 Bacteria 19351
1169 Ga0496117_0007415 3300048920 Bacteria 10724
1170 Ga0496117_0008133 3300048920 Bacteria 10024
1171 Ga0496117_0009227 3300048920 Bacteria 9224
1172 Ga0496117_0010043 3300048920 Bacteria 8696
1173 Ga0496117_0012413 3300048920 Bacteria 7511
1174 Ga0496117_0015407 3300048920 Bacteria 6520
1175 Ga0496117_0035442 3300048920 Bacteria 3745
1176 Ga0496117_0035885 3300048920 Bacteria 3716
1177 Ga0496117_0039172 3300048920 Bacteria 3501
1178 Ga0496117_0044550 3300048920 Bacteria 3213
1179 Ga0496117_0046718 3300048920 Bacteria 3112
1180 Ga0496117_0063088 3300048920 Bacteria 2534
1181 Ga0496117_0086922 3300048920 Bacteria 2029
1182 Ga0496117_0124537 3300048920 Bacteria 1576
1183 Ga0496117_0147540 3300048920 Bacteria 1397
1184 Ga0496118_0000072 3300048921 Bacteria 201387
1185 Ga0496118_0000137 3300048921 Bacteria 129477
1186 Ga0496118_0001157 3300048921 Bacteria 40657
1187 Ga0496118_0002508 3300048921 Bacteria 24634
1188 Ga0496118_0003626 3300048921 Bacteria 19165
1189 Ga0496118_0003664 3300048921 Bacteria 19077
1190 Ga0496118_0008346 3300048921 Bacteria 10724
1191 Ga0496118_0008657 3300048921 Bacteria 10466
1192 Ga0496118_0022858 3300048921 Bacteria 5452
1193 Ga0496118_0023065 3300048921 Bacteria 5418
1194 Ga0496118_0031286 3300048921 Bacteria 4414
1195 Ga0496118_0031499 3300048921 Bacteria 4394
1196 Ga0496118_0045544 3300048921 Bacteria 3422
1197 Ga0496118_0117588 3300048921 Bacteria 1743
1198 Ga0496118_0236351 3300048921 Bacteria 1050
1199 Ga0496118_0330465 3300048921 Bacteria 822
1200 Ga0496119_0000008 3300048922 Bacteria 446822
1201 Ga0496119_0000080 3300048922 Bacteria 139962
1202 Ga0496119_0000156 3300048922 Bacteria 94640
1203 Ga0496119_0000677 3300048922 Bacteria 45578
1204 Ga0496119_0002331 3300048922 Bacteria 20914
1205 Ga0496119_0002686 3300048922 Bacteria 19209
1206 Ga0496119_0004122 3300048922 Bacteria 14639
1207 Ga0496119_0004498 3300048922 Bacteria 13851
1208 Ga0496119_0005466 3300048922 Bacteria 12159
1209 Ga0496119_0007741 3300048922 Bacteria 9594
1210 Ga0496119_0019148 3300048922 Bacteria 5057
1211 Ga0496119_0019675 3300048922 Bacteria 4958
1212 Ga0496119_0034475 3300048922 Bacteria 3332
1213 Ga0496119_0242819 3300048922 Bacteria 911
1214 Ga0496119_0246500 3300048922 Bacteria 903
1215 Ga0496120_0000035 3300048923 Bacteria 213992
1216 Ga0496120_0000040 3300048923 Bacteria 201554
1217 Ga0496120_0000075 3300048923 Bacteria 163540
1218 Ga0496120_0000128 3300048923 Bacteria 127855
1219 Ga0496120_0000302 3300048923 Bacteria 82387
1220 Ga0496120_0000477 3300048923 Bacteria 62911
1221 Ga0496120_0002786 3300048923 Bacteria 16967
1222 Ga0496120_0003693 3300048923 Bacteria 13654
1223 Ga0496120_0003747 3300048923 Bacteria 13471
1224 Ga0496120_0003837 3300048923 Bacteria 13206
1225 Ga0496120_0005107 3300048923 Bacteria 10610
1226 Ga0496120_0006986 3300048923 Bacteria 8500
1227 Ga0496120_0035747 3300048923 Bacteria 2963
1228 Ga0496120_0043456 3300048923 Bacteria 2617
1229 Ga0496120_0073631 3300048923 Bacteria 1868
1230 Ga0496121_0000047 3300048924 Bacteria 335768
1231 Ga0496121_0000124 3300048924 Bacteria 170427
1232 Ga0496121_0001134 3300048924 Bacteria 46801
1233 Ga0496121_0002661 3300048924 Bacteria 26786
1234 Ga0496121_0002930 3300048924 Bacteria 24980
1235 Ga0496121_0003880 3300048924 Bacteria 20785
1236 Ga0496121_0007669 3300048924 Bacteria 12962
1237 Ga0496121_0010355 3300048924 Bacteria 10532
1238 Ga0496121_0015160 3300048924 Bacteria 8106
1239 Ga0496121_0015971 3300048924 Bacteria 7790
1240 Ga0496121_0035885 3300048924 Bacteria 4430
1241 Ga0496121_0038890 3300048924 Bacteria 4202
1242 Ga0496121_0041514 3300048924 Bacteria 4019
1243 Ga0496121_0052914 3300048924 Bacteria 3404
1244 Ga0496121_0056690 3300048924 Bacteria 3252
1245 Ga0496122_0000007 3300048925 Bacteria 606493
1246 Ga0496122_0000033 3300048925 Bacteria 324104
1247 Ga0496122_0000130 3300048925 Bacteria 173330
1248 Ga0496122_0000356 3300048925 Bacteria 98548
1249 Ga0496122_0001024 3300048925 Bacteria 49397
1250 Ga0496122_0001367 3300048925 Bacteria 39674
1251 Ga0496122_0001535 3300048925 Bacteria 36726
1252 Ga0496122_0004005 3300048925 Bacteria 18773
1253 Ga0496122_0004980 3300048925 Bacteria 16068
1254 Ga0496122_0006622 3300048925 Bacteria 13213
1255 Ga0496122_0007333 3300048925 Bacteria 12306
1256 Ga0496122_0012310 3300048925 Bacteria 8538
1257 Ga0496122_0018241 3300048925 Bacteria 6498
1258 Ga0496122_0035075 3300048925 Bacteria 4092
1259 Ga0496122_0052511 3300048925 Bacteria 3084
1260 Ga0496122_0053063 3300048925 Bacteria 3060
1261 Ga0496122_0063042 3300048925 Bacteria 2709
1262 Ga0496122_0067614 3300048925 Bacteria 2572
1263 Ga0496122_0067953 3300048925 Bacteria 2562
1264 Ga0496122_0085176 3300048925 Bacteria 2182
1265 Ga0496122_0089083 3300048925 Bacteria 2111
1266 Ga0496122_0126517 3300048925 Bacteria 1634
1267 Ga0496122_0137705 3300048925 Bacteria 1534
1268 Ga0496122_0142086 3300048925 Bacteria 1499
1269 Ga0496122_0248225 3300048925 Bacteria 997
1270 Ga0496123_0000004 3300048926 Bacteria 777230
1271 Ga0496123_0000064 3300048926 Bacteria 212668
1272 Ga0496123_0000248 3300048926 Bacteria 109122
1273 Ga0496123_0000263 3300048926 Bacteria 105886
1274 Ga0496123_0000309 3300048926 Bacteria 94366
1275 Ga0496123_0000827 3300048926 Bacteria 49725
1276 Ga0496123_0001080 3300048926 Bacteria 41095
1277 Ga0496123_0002455 3300048926 Bacteria 22975
1278 Ga0496123_0003432 3300048926 Bacteria 17794
1279 Ga0496123_0003815 3300048926 Bacteria 16453
1280 Ga0496123_0005121 3300048926 Bacteria 13378
1281 Ga0496123_0006692 3300048926 Bacteria 11104
1282 Ga0496123_0008295 3300048926 Bacteria 9566
1283 Ga0496123_0012224 3300048926 Bacteria 7342
1284 Ga0496123_0031257 3300048926 Bacteria 3876
1285 Ga0496123_0031549 3300048926 Bacteria 3853
1286 Ga0496123_0037990 3300048926 Bacteria 3391
1287 Ga0496123_0048163 3300048926 Bacteria 2870
1288 Ga0496123_0080653 3300048926 Bacteria 1981
1289 Ga0496123_0107980 3300048926 Bacteria 1599
1290 Ga0496123_0135435 3300048926 Bacteria 1356
1291 Ga0496123_0186925 3300048926 Bacteria 1075
1292 Ga0496123_0231341 3300048926 Bacteria 924
1293 Ga0496123_0382431 3300048926 Bacteria 645
1294 Ga0496124_0000004 3300048927 Bacteria 976131
1295 Ga0496124_0000008 3300048927 Bacteria 864372
1296 Ga0496124_0000025 3300048927 Bacteria 405471
1297 Ga0496124_0000097 3300048927 Bacteria 183703
1298 Ga0496124_0000180 3300048927 Bacteria 125291
1299 Ga0496124_0000659 3300048927 Bacteria 56974
1300 Ga0496124_0001108 3300048927 Bacteria 42354
1301 Ga0496124_0001496 3300048927 Bacteria 34238
1302 Ga0496124_0005507 3300048927 Bacteria 14213
1303 Ga0496124_0006593 3300048927 Bacteria 12607
1304 Ga0496124_0011293 3300048927 Bacteria 8941
1305 Ga0496124_0012761 3300048927 Bacteria 8260
1306 Ga0496124_0018225 3300048927 Bacteria 6583
1307 Ga0496124_0025818 3300048927 Bacteria 5310
1308 Ga0496124_0028216 3300048927 Bacteria 5024
1309 Ga0496124_0043725 3300048927 Bacteria 3848
1310 Ga0496124_0050738 3300048927 Bacteria 3533
1311 Ga0496124_0092781 3300048927 Bacteria 2459
1312 Ga0496124_0102126 3300048927 Bacteria 2321
1313 Ga0496124_0110891 3300048927 Bacteria 2208
1314 Ga0496124_0114707 3300048927 Bacteria 2163
1315 Ga0496124_0121468 3300048927 Bacteria 2087
1316 Ga0496124_0126256 3300048927 Bacteria 2037
1317 Ga0496124_0140729 3300048927 Bacteria 1904
1318 Ga0496124_0275538 3300048927 Bacteria 1229
1319 Ga0496124_0289900 3300048927 Bacteria 1188
1320 Ga0496124_0396997 3300048927 Bacteria 958
1321 Ga0496124_0417766 3300048927 Bacteria 925
1322 Ga0496124_0498316 3300048927 Bacteria 817
1323 Ga0496124_0963776 3300048927 Bacteria 511
1324 Ga0496125_0000013 3300048928 Bacteria 628761
1325 Ga0496125_0000055 3300048928 Bacteria 278140
1326 Ga0496125_0003192 3300048928 Bacteria 20252
1327 Ga0496125_0004562 3300048928 Bacteria 15883
1328 Ga0496125_0011417 3300048928 Bacteria 8886
1329 Ga0496125_0012992 3300048928 Bacteria 8221
1330 Ga0496125_0019540 3300048928 Bacteria 6384
1331 Ga0496125_0031099 3300048928 Bacteria 4764
1332 Ga0496125_0031681 3300048928 Bacteria 4708
1333 Ga0496125_0033541 3300048928 Bacteria 4541
1334 Ga0496125_0051081 3300048928 Bacteria 3414
1335 Ga0496125_0056246 3300048928 Bacteria 3196
1336 Ga0496125_0065514 3300048928 Bacteria 2877
1337 Ga0496125_0101308 3300048928 Bacteria 2120
1338 Ga0496125_0102529 3300048928 Bacteria 2102
1339 Ga0496125_0125272 3300048928 Bacteria 1822
1340 Ga0496125_0172485 3300048928 Bacteria 1452
1341 Ga0496126_0000524 3300048929 Bacteria 74800
1342 Ga0496126_0001242 3300048929 Bacteria 41379
1343 Ga0496126_0001275 3300048929 Bacteria 40477
1344 Ga0496126_0002571 3300048929 Bacteria 24231
1345 Ga0496126_0004513 3300048929 Bacteria 16581
1346 Ga0496126_0005838 3300048929 Bacteria 13913
1347 Ga0496126_0012055 3300048929 Bacteria 8883
1348 Ga0496126_0026056 3300048929 Bacteria 5613
1349 Ga0496126_0095925 3300048929 Bacteria 2600
1350 Ga0496126_0102516 3300048929 Bacteria 2502
1351 Ga0496126_0113215 3300048929 Bacteria 2362
1352 Ga0496126_0138297 3300048929 Bacteria 2098
1353 Ga0496126_0140140 3300048929 Bacteria 2082
1354 Ga0496126_0221148 3300048929 Bacteria 1590
1355 Ga0496126_0421096 3300048929 Bacteria 1079
1356 Ga0501306_044815 3300049127 Bacteria 695
1357 Ga0495678_000817 3300049459 Bacteria 27883
1358 Ga0495678_002620 3300049459 Bacteria 11999
1359 Ga0495678_040935 3300049459 Bacteria 1858
1360 Ga0495682_0000015 3300049460 Bacteria 235048
1361 Ga0501290_021491 3300049513 Bacteria 885
1362 Ga0501314_040360 3300049530 Bacteria 543
1363 Ga0501315_101563 3300049531 Bacteria 509
1364 Ga0501031_0009408 3300049568 Bacteria 6349
1365 Ga0501033_0005448 3300049570 Bacteria 10084
1366 Ga0501034_0000194 3300049571 Bacteria 114531
1367 Ga0501034_0067693 3300049571 Bacteria 3583
1368 Ga0501034_0098941 3300049571 Bacteria 2912
1369 Ga0501034_0450921 3300049571 Bacteria 1204
1370 Ga0501037_0442852 3300049573 Bacteria 887
1371 Ga0501043_0906553 3300049579 Bacteria 632
1372 Ga0501043_1195240 3300049579 Bacteria 534
1373 Ga0501047_0022639 3300049581 Bacteria 6033
1374 Ga0501047_0026369 3300049581 Bacteria 5592
1375 Ga0501048_0259736 3300049582 Bacteria 1234
1376 Ga0501069_0003956 3300049585 Bacteria 7644
1377 Ga0501069_0092482 3300049585 Bacteria 1711
1378 Ga0501070_0008196 3300049586 Bacteria 8836
1379 Ga0501073_0004370 3300049589 Bacteria 10615
1380 Ga0501074_0045353 3300049590 Bacteria 3181
1381 Ga0501074_0145039 3300049590 Bacteria 1698
1382 Ga0501076_0358287 3300049592 Bacteria 1198
1383 Ga0501077_0023480 3300049593 Bacteria 3911
1384 Ga0501223_013447 3300049663 Bacteria 1630
1385 Ga0501228_006460 3300049666 Bacteria 1071
1386 Ga0501238_010976 3300049671 Bacteria 1214
1387 Ga0501249_006469 3300049679 Bacteria 2409
1388 Ga0501252_039108 3300049682 Bacteria 682
1389 Ga0501257_049098 3300049686 Bacteria 1050
1390 Ga0501225_0012633 3300049705 Bacteria 2370
1391 Ga0501080_0045132 3300049742 Bacteria 4102
1392 Ga0501080_0176550 3300049742 Bacteria 1967
1393 Ga0501083_0083127 3300049744 Bacteria 2121
1394 Ga0501241_019985 3300049758 Bacteria 1231
1395 Ga0501262_000217 3300049759 Bacteria 7100
1396 Ga0501266_018967 3300049763 Bacteria 928
1397 Ga0501279_026092 3300049775 Bacteria 851
1398 Ga0501035_0008452 3300049822 Bacteria 9589
1399 Ga0501035_0022942 3300049822 Bacteria 5729
1400 Ga0501035_0030616 3300049822 Bacteria 4905
1401 Ga0501035_0383862 3300049822 Bacteria 1171
1402 Ga0501044_0000126 3300049823 Bacteria 92879
1403 Ga0501044_0030902 3300049823 Bacteria 5640
1404 nmdc:mga03683_15867_c1 3300050489 Bacteria 2820
1405 nmdc:mga03683_539_c1 3300050489 Bacteria 10090
1406 nmdc:mga03n38_13224_c1 3300050490 Bacteria 3128
1407 nmdc:mga03n38_14629_c1 3300050490 Bacteria 3012
1408 nmdc:mga00v17_146343_c1 3300050491 Bacteria 1516
1409 nmdc:mga00v17_151655_c1 3300050491 Bacteria 938
1410 nmdc:mga00v17_18093_c1 3300050491 Bacteria 3999
1411 nmdc:mga00v17_210738_c1 3300050491 Bacteria 1257
1412 nmdc:mga00v17_223241_c1 3300050491 Bacteria 1220
1413 nmdc:mga00v17_223343_c1 3300050491 Bacteria 1220
1414 nmdc:mga00v17_320026_c1 3300050491 Bacteria 1008
1415 nmdc:mga00v17_50007_c1 3300050491 Bacteria 2538
1416 nmdc:mga00v17_629_c1 3300050491 Bacteria 19512
1417 nmdc:mga0k408_441955_c1 3300050493 Bacteria 773
1418 nmdc:mga0k408_546176_c1 3300050493 Bacteria 685
1419 nmdc:mga0k408_648838_c1 3300050493 Bacteria 621
1420 nmdc:mga07m45_122425_c1 3300050496 Bacteria 1503
1421 nmdc:mga07m45_1446_c1 3300050496 Bacteria 10887
1422 nmdc:mga07m45_297849_c1 3300050496 Bacteria 938
1423 nmdc:mga07m45_42155_c1 3300050496 Bacteria 2558
1424 nmdc:mga0qj67_683617_c1 3300050509 Bacteria 817
1425 nmdc:mga0a205_524229_c1 3300050515 Bacteria 1041
1426 nmdc:mga0sz30_116214_c1 3300050516 Bacteria 1174
1427 Ga0495601_0056834 3300053077 Bacteria 2478
1428 Ga0495655_0116484 3300053083 Bacteria 809
1429 Ga0495619_0318180 3300053085 Bacteria 1077
1430 Ga0500643_015944 3300053087 Bacteria 2562
1431 Ga0500644_0006005 3300053088 Bacteria 3092
1432 Ga0500644_0051178 3300053088 Bacteria 1417
1433 Ga0500646_0019586 3300053090 Bacteria 1791
1434 Ga0500647_0257671 3300053091 Bacteria 764
1435 Ga0500647_0353846 3300053091 Bacteria 610
1436 Ga0500651_0000054 3300053093 Bacteria 74519
1437 Ga0500566_0042353 3300053094 Bacteria 2627
1438 Ga0500641_0120823 3300053096 Bacteria 1129
1439 Ga0500562_007562 3300053108 Bacteria 2741
1440 Ga0500562_120711 3300053108 Bacteria 714
1441 Ga0500571_000005 3300053110 Bacteria 109625
1442 Ga0500572_116828 3300053111 Bacteria 862
1443 Ga0500592_003168 3300053116 Bacteria 2630
1444 Ga0500593_002899 3300053117 Bacteria 6373
1445 Ga0500594_0000763 3300053118 Bacteria 6854
1446 Ga0500595_001889 3300053119 Bacteria 10795
1447 Ga0500595_118460 3300053119 Bacteria 749
1448 Ga0500597_253803 3300053120 Bacteria 718
1449 Ga0500607_036794 3300053121 Bacteria 2671
1450 Ga0500607_038837 3300053121 Bacteria 2589
1451 Ga0500608_024725 3300053122 Bacteria 2807
1452 Ga0500614_118936 3300053123 Bacteria 776
1453 Ga0500618_014532 3300053125 Bacteria 2008
1454 Ga0500621_000001 3300053126 Bacteria 1049698
1455 Ga0500655_000895 3300053133 Bacteria 5782
1456 Ga0500559_0001788 3300053136 Bacteria 11804
1457 Ga0500559_0084954 3300053136 Bacteria 1443
1458 Ga0500559_0258511 3300053136 Bacteria 820
1459 Ga0500561_0016276 3300053137 Bacteria 1666
1460 Ga0500564_005575 3300053138 Bacteria 5158
1461 Ga0500568_0002238 3300053139 Bacteria 11589
1462 Ga0500573_0029700 3300053140 Bacteria 3151
1463 Ga0500574_000299 3300053141 Bacteria 6083
1464 Ga0500574_001599 3300053141 Bacteria 3438
1465 Ga0500604_0054108 3300053151 Bacteria 1246
1466 Ga0500616_0047830 3300053153 Bacteria 2269
1467 Ga0500619_000249 3300053154 Bacteria 11573
1468 Ga0500622_0125928 3300053156 Bacteria 1237
1469 Ga0500624_004622 3300053157 Bacteria 1817
1470 Ga0500624_070879 3300053157 Bacteria 681
1471 Ga0500634_0025168 3300053161 Bacteria 3239
1472 Ga0500634_0036031 3300053161 Bacteria 2694
1473 Ga0500634_0107998 3300053161 Bacteria 1379
1474 Ga0500638_004055 3300053162 Bacteria 5560
1475 Ga0500636_0000053 3300053177 Bacteria 55579
1476 Ga0500625_026945 3300053729 Bacteria 2724
1477 Ga0500645_011458 3300053730 Bacteria 2895
1478 Ga0500645_049388 3300053730 Bacteria 1230
1479 Ga0500661_002371 3300055283 Bacteria 3552
1480 Ga0501082_0077867 3300060353 Bacteria 2859
1481 2506579128 2506520007 Bacteria 5442880
1482 2506584267 2506520008 Bacteria 5443009
1483 2508853017 2508501071 Bacteria 5454741
1484 2511245910 2511231002 Bacteria 5042903
1485 2511378986 2511231025 Bacteria 5324661
1486 2511433251 2511231035 Bacteria 5341610
1487 2513953457 2513237150 Bacteria 6553639
1488 2514042766 2513237165 Bacteria 6771773
1489 2526213809 2526164512 Bacteria 4025691
1490 2538425916 2537561728 Bacteria 5149301
1491 2547694988 2547132181 Bacteria 4945084
1492 2547698141 2547132181 Bacteria 4945084
1493 2548501264 2547132374 Bacteria 5530232
1494 2548648031 2547132416 Bacteria 4633861
1495 2562463995 2561511199 Bacteria 5155034
1496 2562467013 2561511199 Bacteria 5155034
1497 2585829188 2585427591 Bacteria 5482980
1498 2585834100 2585427592 Bacteria 5370892
1499 2599623235 2599185214 Bacteria 8209958
1500 2599675547 2599185226 Bacteria 8233575
1501 2599680840 2599185227 Bacteria 8246414
1502 2599692855 2599185229 Bacteria 8216126
1503 2599907762 2599185292 Bacteria 6290804
1504 2599927576 2599185299 Bacteria 4854625
1505 2601533231 2600255256 Bacteria 5597742
1506 2601535065 2600255256 Bacteria 5597742
1507 2601538595 2600255257 Bacteria 5597196
1508 2601541454 2600255257 Bacteria 5597196
1509 2601756944 2600255310 Bacteria 5600903
1510 2601758247 2600255310 Bacteria 5600903
1511 2601761601 2600255311 Bacteria 5598766
1512 2601764356 2600255311 Bacteria 5598766
1513 2603638382 2602042046 Bacteria 5483348
1514 2603641220 2602042046 Bacteria 5483348
1515 2603642877 2602042047 Bacteria 4697674
1516 2603698078 2602042066 Bacteria 4423871
1517 2603703483 2602042067 Bacteria 4863713
1518 2603867553 2602042109 Bacteria 5152801
1519 2608669024 2608642108 Bacteria 4104624
1520 2609910071 2609459761 Bacteria 5513740
1521 2643863186 2643221569 Bacteria 6064337
1522 2643868496 2643221570 Bacteria 5103772
1523 2643978592 2643221594 Bacteria 5811388
1524 2643994603 2643221596 Bacteria 5006805
1525 2644061652 2643221609 Bacteria 6756331
1526 2644075184 2643221611 Bacteria 6820941
1527 2644121712 2643221621 Bacteria 6212786
1528 2644295448 2643221652 Bacteria 5140275
1529 2644467160 2643221683 Bacteria 5749203
1530 2644649192 2643221717 Bacteria 5676132
1531 2650897820 2648501693 Bacteria 5069560
1532 2656280085 2654587920 Bacteria 5475511
1533 2671103420 2667528172 Bacteria 5170840
1534 2671108783 2667528173 Bacteria 5375747
1535 2671587306 2671180115 Bacteria 5353919
1536 2681997451 2681812866 Bacteria 4552357
1537 2682007045 2681812869 Bacteria 5014465
1538 2686352920 2684622997 Bacteria 4624240
1539 2689445585 2687453601 Bacteria 5546041
1540 2707098652 2706794495 Bacteria 4536932
1541 2712470160 2711768156 Bacteria 4471618
1542 2723879825 2721755763 Bacteria 4464185
1543 2738721246 2738541277 Bacteria 7458140
1544 2738882743 2738541307 Bacteria 8606193
1545 2739243349 2738543012 Bacteria 7115078
1546 2739250546 2738543013 Bacteria 5618633
1547 2739280445 2738543019 Bacteria 7459457
1548 2753855531 2751185917 Bacteria 4551186
1549 2765588508 2765235842 Bacteria 4799256
1550 2772439547 2772190666 Bacteria 5117644
1551 2775542322 2775506706 Bacteria 4873073
1552 2791925875 2791354903 Bacteria 4937680
1553 2792311507 2791355010 Bacteria 4864581
1554 2793405912 2791355275 Bacteria 4429597
1555 2807180778 2806310673 Bacteria 4801221
1556 2809036651 2808606395 Bacteria 6020352
1557 2809126989 2808606414 Bacteria 4917181
1558 2813727434 2811995292 Bacteria 5303342
1559 2813729433 2811995292 Bacteria 5303342
1560 2814694966 2814123068 Bacteria 5687681
1561 2814696928 2814123068 Bacteria 5687681
1562 2816473927 2816332133 Bacteria 7249298
1563 2819544803 2818991436 Bacteria 5376622
1564 2819600370 2818991446 Bacteria 7757362
1565 2821119337 2821118458 Bacteria 4714306
1566 2823374294 2823373977 Bacteria 4779415
1567 2831271836 2831265667 Bacteria 7184833
1568 2834645087 2834641062 Bacteria 5559922
1569 2838059674 2838054893 Bacteria 7451788
1570 2842679834 2842677519 Bacteria 5615038
1571 2842721934 2842718218 Bacteria 4560148
1572 2842735768 2842733646 Bacteria 5716726
1573 2842750921 2842747753 Bacteria 5578255
1574 2844427075 2844425489 Bacteria 4854065
1575 2844530485 2844528606 Bacteria 4733806
1576 2846541790 2846540461 Bacteria 5471451
1577 2847088103 2847085930 Bacteria 5070450
1578 2847800402 2847797336 Bacteria 5176640
1579 2852107623 2852103415 Bacteria 5193810
1580 2854601991 2854601825 Bacteria 4797592
1581 2855197066 2855195626 Bacteria 4927512
1582 2855731415 2855730933 Bacteria 7047938
1583 2855768121 2855767633 Bacteria 7049357
1584 2857542680 2857537821 Bacteria 5248181
1585 2857545856 2857542790 Bacteria 5326616
1586 2858469096 2858466076 Bacteria 4722413
1587 2858691088 2858688981 Bacteria 8184122
1588 2858954805 2858950400 Bacteria 6783797
1589 2865015573 2865014394 Bacteria 4764573
1590 2869555030 2869551831 Bacteria 5474685
1591 2871275628 2871272651 Bacteria 5042015
1592 2871285420 2871282230 Bacteria 4917173
1593 2876601983 2876601092 Bacteria 5114497
1594 2881413712 2881412998 Bacteria 6492157
1595 2881612390 2881609920 Bacteria 4405319
1596 2884089421 2884086401 Bacteria 5005459
1597 2885198062 2885192300 Bacteria 5882526
1598 2885198672 2885198086 Bacteria 7212419
1599 2885211948 2885211737 Bacteria 7212420
1600 2888369610 2888366609 Bacteria 5155009
1601 2891672676 2891670763 Bacteria 4967099
1602 2899928459 2899924645 Bacteria 7487985
1603 2900052857 2900051742 Bacteria 4985156
1604 2901304334 2901300506 Bacteria 8463898
1605 2904452436 2904449895 Bacteria 6927402
1606 2904460965 2904456579 Bacteria 6819253
1607 2904475471 2904474040 Bacteria 5504324
1608 2904548220 2904541872 Bacteria 8915136
1609 2919154316 2919150387 Bacteria 5500879
1610 2919463932 2919462493 Bacteria 5817112
1611 2923638964 2923634449 Bacteria 4753480
1612 2927144309 2927143783 Bacteria 5504251
1613 2927834546 2927833300 Bacteria 4923934
1614 2928041380 2928037797 Bacteria 7273642
1615 2928048222 2928044640 Bacteria 7271509
1616 2928056064 2928051484 Bacteria 7773759
1617 2928066454 2928064002 Bacteria 7419480
1618 2928077402 2928070936 Bacteria 8062541
1619 2928087701 2928084124 Bacteria 7159212
1620 2929163210 2929160207 Bacteria 9075316
1621 2929522948 2929520902 Bacteria 6765052
1622 2932408756 2932406140 Bacteria 5134491
1623 2935627103 2935625433 Bacteria 5042964
1624 2935629095 2935625433 Bacteria 5042964
1625 2937543247 2937539931 Bacteria 4639830
1626 2937968184 2937967321 Bacteria 5094075
1627 2939568727 2939568625 Bacteria 4542555
1628 2939574239 2939573065 Bacteria 4926053
1629 2939580452 2939577877 Bacteria 5132791
1630 2939603654 2939602548 Bacteria 4950493
1631 2939607919 2939607340 Bacteria 4719256
1632 2939619108 2939617950 Bacteria 4820956
1633 2939621866 2939617950 Bacteria 4820956
1634 2939644228 2939642701 Bacteria 4475280
1635 2941481035
1636 2945877271 2945874760 Bacteria 5527237
1637 2945946068 2945945610 Bacteria 5951079
1638 2945953465 2945951305 Bacteria 4918162
1639 2945975667 2945972063 Bacteria 6086495
1640 2954768890 2954767861 Bacteria 5535784
1641 2974312571 2974310843 Bacteria 4947816
1642 2974321964 2974320154 Bacteria 4571377
1643 2974437978 2974435778 Bacteria 4876478
1644 2974439772 2974435778 Bacteria 4876478
1645 2978975957 2978975091 Bacteria 4704313
1646 2978978014 2978975091 Bacteria 4704313
1647 2984496150 2984494565 Bacteria 5000175
1648 2990262827 2990261002 Bacteria 4919493
1649 2990715533 2990710928 Bacteria 5002431
1650 3000376946 3000376612 Bacteria 4705565
1651 640938510 640753048 Bacteria 5495657
1652 644750334 644736347 Bacteria 6476522
1653 8003405317 8003400568 Bacteria 5535898
1654 8004596810 8004592986 Bacteria 5122074
1655 8015398332 8015394850 Bacteria 5064660
1656 8016736360 8016733728 Bacteria 5274317
1657 8018224609 8018221730 Bacteria 4616064
1658 8018408625 8018405270 Bacteria 4978981
1659 8019503032 8019499862 Bacteria 5169538
1660 8019505992 8019504834 Bacteria 4819156
1661 8019509242 8019504834 Bacteria 4819156
1662 8054846254 8054844752 Bacteria 4450330
1663 8054850454 8054849141 Bacteria 5232694
1664 8055088534 8055087960 Bacteria 4784273
1665 8055094229 8055092621 Bacteria 4873875
1666 8055099647 8055097453 Bacteria 4865496
1667 8055696620 8055693939 Bacteria 4772047
1668 8057161335 8057160832 Bacteria 3268302
1669 8057309059 8057304971 Bacteria 4649742
1670 Ga0182007_10006154
1671 SwRhRL2b_contig_1532308
1672 SwRhRL2b_contig_1817389
1673 SwRhRL2b_contig_211812
1674 SwRhRL2b_contig_3815225
1675 SwRhRL2b_contig_648880
1676 SwRhRL2b_contig_811231
1677 JGI24741J21665_1002439
1678 JGI24740J21852_10001465
1679 JGI24740J21852_10005400
1680 JGI24740J21852_10108564
1681 JGI24739J22299_10000528
1682 JGI24739J22299_10019327
1683 JGI25162J39368_1000019
1684 JGI25162J39368_1000139
1685 JGI25162J39368_1004044
1686 JGI25158J39367_1004522
1687 JGI25158J39367_1014677
1688 JGI25163J39215_1000008
1689 JGI25163J39215_1000036
1690 JGI25163J39215_1001578
1691 JGI25164J39214_1000011
1692 JGI25152J39213_1000725
1693 JGI25152J39213_1001419
1694 JGI25152J39213_1001623
1695 JGI25152J39213_1008926
1696 JGI25150J39212_1001793
1697 JGI25150J39212_1009982
1698 JGI25159J45721_1000435
1699 JGI25159J45721_1001336
1700 Ga0006759J45824_1061774
1701 JGI25151J46595_10000198
1702 JGI25151J46595_10000666
1703 JGI25151J46595_10000713
1704 JGI25151J46595_10000957
1705 JGI25151J46595_10002229
1706 JGI25151J46595_10011933
1707 JGI25151J46595_10015566
1708 JGI25151J46595_10018492
1709 JGI25151J46595_10064364
1710 JGI25165J46597_1000227
1711 JGI25153J46596_10002586
1712 JGI25153J46596_10027801
1713 rootH2_10001915
1714 rootH2_10011746
1715 rootL2_10010810
1716 rootL2_10038684
1717 rootH1_10022702
1718 JGI25160J50197_1000093
1719 JGI25160J50197_1001793
1720 JGI25160J50197_1002516
1721 JGI25161J50226_1000443
1722 JGI25161J50226_1001737
1723 JGI25161J50226_1006112
1724 Ga0007410J51695_1038845
1725 Ga0007409J51694_1018424
1726 Ga0007416J51690_1050216
1727 Ga0006562J51391_1020559
1728 Ga0032354_1047181
1729 Ga0055538_1000021
1730 Ga0055538_1000089
1731 Ga0055539_1000026
1732 Ga0055539_1000133
1733 Ga0055533_1000035
1734 Ga0055533_1000136
1735 Ga0055532_1008571
1736 Ga0055525_1000045
1737 Ga0055525_1000181
1738 Ga0055527_1015720
1739 Ga0055535_1000128
1740 Ga0055542_1000062
1741 Ga0055526_1003281
1742 Ga0055526_1004616
1743 Ga0055526_1025264
1744 Ga0055537_1001084
1745 Ga0055537_1001152
1746 Ga0055537_1005883
1747 Ga0055537_1030973
1748 Ga0055524_1002106
1749 Ga0055524_1002148
1750 Ga0055524_1003128
1751 Ga0055524_1009474
1752 Ga0055524_1064653
1753 Ga0055536_1000045
1754 Ga0055536_1001927
1755 Ga0055536_1008144
1756 Ga0055536_1029855
1757 Ga0055534_1000607
1758 Ga0055534_1000680
1759 Ga0055534_1000948
1760 Ga0055534_1001053
1761 Ga0055534_1026656
1762 Ga0055534_1030244
1763 Ga0055528_1001880
1764 Ga0055528_1012891
1765 Ga0055530_10001484
1766 Ga0055530_10036030
1767 Ga0055540_1002723
1768 Ga0055540_1003970
1769 Ga0055540_1004043
1770 Ga0055540_1010254
1771 Ga0055531_10002613
1772 Ga0055531_10042539
1773 Ga0055541_1000020
1774 Ga0055541_1000088
1775 Ga0058692_1000058
1776 Ga0058692_1000127
1777 Ga0058692_1000356
1778 Ga0058692_1000889
1779 Ga0058692_1001028
1780 Ga0058692_1003139
1781 Ga0058692_1005468
1782 Ga0058692_1006611
1783 Ga0058692_1008376
1784 Ga0058692_1008738
1785 Ga0058692_1009721
1786 Ga0058692_1016142
1787 Ga0058692_1036964
1788 Ga0055543_1001728
1789 Ga0055543_1002173
1790 Ga0058861_10505237
1791 Ga0065165_1003326
1792 Ga0065165_1005438
1793 Ga0065165_1010696
1794 Ga0065165_1116696
1795 Ga0065165_1131492
1796 Ga0065703_1020318
1797 Ga0065714_10166784
1798 Ga0065704_10000333
1799 Ga0065704_10000631
1800 Ga0065704_10001218
1801 Ga0065704_10003968
1802 Ga0065704_10071586
1803 Ga0065704_10086036
1804 Ga0065704_10086235
1805 Ga0065704_10129206
1806 Ga0065704_10141574
1807 Ga0070658_10070073
1808 Ga0070658_10148408
1809 Ga0070658_10243894
1810 Ga0070658_10557291
1811 Ga0070676_10065117
1812 Ga0070670_100679234
1813 Ga0070677_10324179
1814 Ga0070680_100022363
1815 Ga0070680_100495764
1816 Ga0070682_100010205
1817 Ga0070682_101235099
1818 Ga0068868_102001739
1819 Ga0070660_100907056
1820 Ga0070691_10006226
1821 Ga0070691_10036380
1822 Ga0070691_10198210
1823 Ga0070687_100056664
1824 Ga0070661_100015748
1825 Ga0070661_100398030
1826 Ga0070661_100546966
1827 Ga0070692_10041561
1828 Ga0070692_10064627
1829 Ga0070668_100017378
1830 Ga0070668_100239409
1831 Ga0070668_101124166
1832 Ga0070669_100006871
1833 Ga0070674_100027809
1834 Ga0070673_100319045
1835 Ga0070659_100282356
1836 Ga0070659_100518883
1837 Ga0070667_100013220
1838 Ga0070667_100051123
1839 Ga0070667_100133305
1840 Ga0070663_100005681
1841 Ga0070663_100023732
1842 Ga0070678_100417589
1843 Ga0070678_101657403
1844 Ga0070662_100017220
1845 Ga0070662_100235146
1846 Ga0070681_10000088
1847 Ga0070681_10002015
1848 Ga0070681_10984032
1849 Ga0070679_100000061
1850 Ga0070679_100287609
1851 Ga0068853_100001354
1852 Ga0068853_100047998
1853 Ga0068853_100302849
1854 Ga0068853_100355525
1855 Ga0070696_100015635
1856 Ga0070696_100024095
1857 Ga0070693_100008374
1858 Ga0070665_100000262
1859 Ga0070665_100010362
1860 Ga0070665_100070998
1861 Ga0070665_100775281
1862 Ga0070665_100833059
1863 Ga0070665_101682702
1864 Ga0068855_100010497
1865 Ga0068855_100224695
1866 Ga0070664_100099825
1867 Ga0068857_100000082
1868 Ga0068857_100036973
1869 Ga0068857_100650963
1870 Ga0068857_101000606
1871 Ga0068854_100061734
1872 Ga0068852_100320257
1873 Ga0068852_100805233
1874 Ga0068859_100135523
1875 Ga0068851_10001818
1876 Ga0068851_10012101
1877 Ga0068870_11119288
1878 Ga0068863_100031760
1879 Ga0068860_100301337
1880 Ga0081539_10075937
1881 Ga0075365_10093978
1882 Ga0075363_100698181
1883 Ga0075364_10004261
1884 Ga0075364_10019925
1885 Ga0075364_10039524
1886 Ga0075364_10090303
1887 Ga0075364_10122334
1888 Ga0075364_10139974
1889 Ga0075364_10141236
1890 Ga0075364_10229103
1891 Ga0075364_10252742
1892 Ga0075364_10669159
1893 Ga0075432_10045356
1894 Ga0075362_10000528
1895 Ga0075362_10002538
1896 Ga0075362_10017911
1897 Ga0075369_10155822
1898 Ga0075369_10203553
1899 Ga0075366_10036012
1900 Ga0075366_10255351
1901 Ga0075370_10004045
1902 Ga0075370_10016704
1903 Ga0075370_10019421
1904 Ga0075370_10367422
1905 Ga0075430_100079155
1906 Ga0075433_10254037
1907 Ga0097620_100135524
1908 Ga0079104_1000035
1909 Ga0079104_1000274
1910 Ga0079104_1000343
1911 Ga0079104_1000464
1912 Ga0079104_1000819
1913 Ga0079104_1001653
1914 Ga0079104_1001797
1915 Ga0079104_1003555
1916 Ga0079104_1015838
1917 Ga0079104_1022141
1918 Ga0079104_1022902
1919 Ga0079104_1024210
1920 Ga0079104_1051905
1921 Ga0079104_1066673
1922 Ga0099826_10000013
1923 Ga0099826_10139907
1924 Ga0099826_10481446
1925 Ga0105251_10002660
1926 Ga0105251_10002718
1927 Ga0105251_10002876
1928 Ga0105251_10007342
1929 Ga0105251_10008589
1930 Ga0105251_10011774
1931 Ga0105251_10025606
1932 Ga0105251_10027110
1933 Ga0105251_10035985
1934 Ga0105251_10079343
1935 Ga0105251_10098773
1936 Ga0105251_10110569
1937 Ga0105251_10213105
1938 Ga0105244_10000117
1939 Ga0105244_10000123
1940 Ga0105244_10000491
1941 Ga0105244_10001091
1942 Ga0105244_10001372
1943 Ga0105244_10002148
1944 Ga0105244_10002204
1945 Ga0105244_10003085
1946 Ga0105244_10014092
1947 Ga0105244_10025906
1948 Ga0105244_10038004
1949 Ga0105244_10065064
1950 Ga0105244_10124884
1951 Ga0105244_10144566
1952 Ga0105244_10206087
1953 Ga0105250_10000037
1954 Ga0105250_10000414
1955 Ga0105250_10000650
1956 Ga0105250_10000917
1957 Ga0105250_10001186
1958 Ga0105250_10002778
1959 Ga0105250_10002792
1960 Ga0105250_10004534
1961 Ga0105250_10065924
1962 Ga0105250_10067681
1963 Ga0105250_10077887
1964 Ga0105250_10272096
1965 Ga0105240_10062558
1966 Ga0105240_10273746
1967 Ga0105240_10335586
1968 Ga0105240_10498509
1969 Ga0105240_11260892
1970 Ga0105240_11310510
1971 Ga0105247_10000086
1972 Ga0105243_10003849
1973 Ga0105243_10092126
1974 Ga0105243_12744318
1975 Ga0105241_10000001
1976 Ga0105241_10130865
1977 Ga0105241_12690589
1978 Ga0105242_10002597
1979 Ga0105242_10068733
1980 Ga0105242_11474481
1981 Ga0105242_11525997
1982 Ga0105248_10253265
1983 Ga0105237_10011495
1984 Ga0105237_10150560
1985 Ga0105237_10395502
1986 Ga0105238_10001283
1987 Ga0105238_10634030
1988 Ga0105249_10340702
1989 Ga0105239_10013831
1990 Ga0105246_10073988
1991 Ga0105246_10155285
1992 Ga0105246_10493964
1993 Ga0105246_11291391
1994 Ga0157347_1033606
1995 Ga0157373_10000200
1996 Ga0157373_10005859
1997 Ga0157373_10018164
1998 Ga0157373_10029150
1999 Ga0157373_10031860
2000 Ga0157373_10040095
2001 Ga0157373_10046256
2002 Ga0157373_10137322
2003 Ga0157373_10174876
2004 Ga0157373_10258326
2005 Ga0157371_10000067
2006 Ga0157371_10000156
2007 Ga0157371_10003023
2008 Ga0157371_10006525
2009 Ga0157371_10016466
2010 Ga0157371_10028186
2011 Ga0157371_10049077
2012 Ga0157371_10146989
2013 Ga0157371_10149671
2014 Ga0157371_10381989
2015 Ga0157371_10474916
2016 Ga0157371_10503224
2017 Ga0157371_11187912
2018 Ga0157370_10000814
2019 Ga0157370_10003193
2020 Ga0157370_10003562
2021 Ga0157370_10005747
2022 Ga0157370_10028456
2023 Ga0157370_10063234
2024 Ga0157370_10067492
2025 Ga0157370_10123676
2026 Ga0157370_10181136
2027 Ga0157370_10396757
2028 Ga0157370_10544307
2029 Ga0157370_11460098
2030 Ga0157369_10002007
2031 Ga0157369_10010610
2032 Ga0157369_10016298
2033 Ga0157369_10024085
2034 Ga0157369_10650919
2035 Ga0157374_10002106
2036 Ga0157374_11778966
2037 Ga0163162_10071042
2038 Ga0163162_10071964
2039 Ga0163162_10140414
2040 Ga0163162_10259980
2041 Ga0157372_10001630
2042 Ga0157372_10001655
2043 Ga0157372_10001723
2044 Ga0157372_10003992
2045 Ga0157372_10025560
2046 Ga0157372_10056434
2047 Ga0157372_10057183
2048 Ga0157372_10117318
2049 Ga0157372_10157175
2050 Ga0157372_10457502
2051 Ga0157372_10496574
2052 Ga0157375_11572794
2053 Ga0182008_10000877
2054 Ga0182008_10001330
2055 Ga0182008_10005352
2056 Ga0182008_10009021
2057 Ga0182008_10012011
2058 Ga0182008_10081751
2059 Ga0182008_10310770
2060 Ga0157379_10003242
2061 Ga0157376_11058796
2062 Ga0182006_1000022
2063 Ga0182006_1039514
2064 Ga0182006_1045596
2065 Ga0182006_1049881
2066 Ga0182006_1050636
2067 Ga0182006_1109871
2068 Ga0182007_10003487
2069 Ga0182007_10016771
2070 Ga0182005_1000075
2071 Ga0183366_1001
2072 Ga0183370_1001
2073 Ga0183362_10001
2074 Ga0183369_1001
2075 Ga0183368_1001
2076 Ga0163161_10000001
2077 Ga0163161_10019762
2078 Ga0163161_10040757
2079 Ga0163161_10055207
2080 Ga0206356_10036066
2081 Ga0206354_11653555
2082 Ga0206353_11505629
2083 Ga0154015_1259153
2084 Ga0213874_10372997
2085 Ga0213876_10000086
2086 Ga0209760_100004
2087 Ga0209760_101358
2088 Ga0209436_101095
2089 Ga0209436_103393
2090 Ga0209784_100001
2091 Ga0209784_100071
2092 Ga0209566_100001
2093 Ga0209566_100004
2094 Ga0209674_100002
2095 Ga0209674_100006
2096 Ga0209672_100319
2097 Ga0209147_101404
2098 Ga0209563_100002
2099 Ga0209563_100104
2100 Ga0207427_100012
2101 Ga0207427_100308
2102 Ga0209437_100001
2103 Ga0209437_100035
2104 Ga0209437_100158
2105 Ga0209258_100154
2106 Ga0207425_1000215
2107 Ga0207425_1002841
2108 Ga0207425_1004676
2109 Ga0207425_1013759
2110 Ga0207425_1024413
2111 Ga0207425_1026374
2112 Ga0209677_100002
2113 Ga0209677_100064
2114 Ga0209677_112773
2115 Ga0209148_1000145
2116 Ga0209129_1000018
2117 Ga0209129_1000054
2118 Ga0209129_1000103
2119 Ga0209129_1009530
2120 Ga0209233_1000005
2121 Ga0209233_1001009
2122 Ga0209565_1000086
2123 Ga0209565_1000317
2124 Ga0209565_1001154
2125 Ga0209565_1003106
2126 Ga0209565_1005158
2127 Ga0209455_1000399
2128 Ga0209673_1000168
2129 Ga0209673_1001793
2130 Ga0209673_1009768
2131 Ga0209130_1000206
2132 Ga0209130_1001133
2133 Ga0209130_1001531
2134 Ga0209130_1001936
2135 Ga0209130_1013485
2136 Ga0209675_1000193
2137 Ga0209675_1000548
2138 Ga0209675_1002487
2139 Ga0209675_1002730
2140 Ga0209675_1005202
2141 Ga0209675_1005551
2142 Ga0209675_1019667
2143 Ga0209676_1000053
2144 Ga0209676_1000103
2145 Ga0209676_1000290
2146 Ga0209676_1004587
2147 Ga0209676_1004993
2148 Ga0209025_1000018
2149 Ga0209025_1000034
2150 Ga0209025_1000059
2151 Ga0209025_1000073
2152 Ga0209025_1000093
2153 Ga0209025_1000201
2154 Ga0209025_1003493
2155 Ga0209025_1023935
2156 Ga0209025_1035232
2157 Ga0209025_1038171
2158 Ga0209025_1062942
2159 Ga0209564_1000301
2160 Ga0209564_1000408
2161 Ga0209564_1001285
2162 Ga0209564_1003017
2163 Ga0209564_1004316
2164 Ga0209758_1000034
2165 Ga0209758_1011927
2166 Ga0209758_1034934
2167 Ga0209758_1052022
2168 Ga0209758_1114102
2169 Ga0209050_1000012
2170 Ga0209050_1001244
2171 Ga0209050_1007544
2172 Ga0209050_1009167
2173 Ga0209256_1000066
2174 Ga0209256_1000086
2175 Ga0209256_1001063
2176 Ga0209256_1003254
2177 Ga0209256_1085940
2178 Ga0207426_1000058
2179 Ga0207426_1000067
2180 Ga0207426_1000156
2181 Ga0209051_1000019
2182 Ga0209051_1000141
2183 Ga0209051_1001450
2184 Ga0209051_1001589
2185 Ga0209051_1002728
2186 Ga0209051_1053241
2187 Ga0209051_1067377
2188 Ga0209051_1075533
2189 Ga0209257_1000024
2190 Ga0209257_1003493
2191 Ga0209257_1015612
2192 Ga0207656_10004218
2193 Ga0207656_10017790
2194 Ga0207696_1000001
2195 Ga0207696_1000070
2196 Ga0207696_1000099
2197 Ga0207696_1000170
2198 Ga0207696_1000537
2199 Ga0207696_1001040
2200 Ga0207696_1002538
2201 Ga0207696_1004683
2202 Ga0207696_1007450
2203 Ga0207696_1010764
2204 Ga0207696_1012417
2205 Ga0207696_1039647
2206 Ga0207655_1000001
2207 Ga0207655_1000009
2208 Ga0207655_1000046
2209 Ga0207655_1000071
2210 Ga0207655_1000089
2211 Ga0207655_1000215
2212 Ga0207655_1000363
2213 Ga0207655_1000506
2214 Ga0207655_1000763
2215 Ga0207655_1006208
2216 Ga0207655_1015575
2217 Ga0207655_1043112
2218 Ga0207655_1060447
2219 Ga0207713_1000001
2220 Ga0207713_1000004
2221 Ga0207713_1000018
2222 Ga0207713_1000120
2223 Ga0207713_1002665
2224 Ga0207713_1004886
2225 Ga0207713_1018235
2226 Ga0207713_1018975
2227 Ga0207713_1030329
2228 Ga0207713_1035127
2229 Ga0207713_1035833
2230 Ga0207713_1071665
2231 Ga0207713_1089201
2232 Ga0207710_10000233
2233 Ga0207710_10081304
2234 Ga0207680_10011667
2235 Ga0207647_10003226
2236 Ga0207705_10000029
2237 Ga0207705_10000755
2238 Ga0207705_10056150
2239 Ga0207705_10958300
2240 Ga0207654_10000004
2241 Ga0207654_10115476
2242 Ga0207707_10000042
2243 Ga0207707_10000144
2244 Ga0207707_10001056
2245 Ga0207707_10008129
2246 Ga0207707_10206830
2247 Ga0207695_10002071
2248 Ga0207695_10010137
2249 Ga0207695_10084151
2250 Ga0207695_10367416
2251 Ga0207671_10026936
2252 Ga0207660_10000413
2253 Ga0207662_10099146
2254 Ga0207657_10592936
2255 Ga0207649_10007256
2256 Ga0207649_10015548
2257 Ga0207649_10519784
2258 Ga0207649_10566197
2259 Ga0207652_10000082
2260 Ga0207652_10000808
2261 Ga0207652_10001430
2262 Ga0207652_10345918
2263 Ga0207681_10011213
2264 Ga0207694_10021179
2265 Ga0207694_10974166
2266 Ga0207650_10811942
2267 Ga0207644_10298919
2268 Ga0207690_10004125
2269 Ga0207690_10008721
2270 Ga0207690_10298468
2271 Ga0207706_10011328
2272 Ga0207706_10174918
2273 Ga0207686_10001018
2274 Ga0207686_10240383
2275 Ga0207686_10534495
2276 Ga0207709_10001503
2277 Ga0207669_10027614
2278 Ga0207691_10545460
2279 Ga0207711_10633536
2280 Ga0207661_10015030
2281 Ga0207661_11268292
2282 Ga0207679_10077418
2283 Ga0207679_10080577
2284 Ga0207667_10000075
2285 Ga0207667_10005022
2286 Ga0207667_10007273
2287 Ga0207667_10161254
2288 Ga0207667_10385112
2289 Ga0207651_10180586
2290 Ga0207712_10961464
2291 Ga0207712_11548013
2292 Ga0207668_10007961
2293 Ga0207668_10470819
2294 Ga0207640_10010766
2295 Ga0207640_10016893
2296 Ga0207640_10022260
2297 Ga0207640_10390751
2298 Ga0207658_10205254
2299 Ga0207658_10329316
2300 Ga0207658_10566998
2301 Ga0207658_11591886
2302 Ga0207639_10001297
2303 Ga0207639_10007637
2304 Ga0207639_10047674
2305 Ga0207639_10155920
2306 Ga0207678_10001891
2307 Ga0207678_10005658
2308 Ga0207678_10052250
2309 Ga0207702_10031604
2310 Ga0207641_10161201
2311 Ga0207674_10000712
2312 Ga0207674_10003998
2313 Ga0207674_10059041
2314 Ga0207674_10353568
2315 Ga0207675_100198346
2316 Ga0207683_10014368
2317 Ga0207683_10049183
2318 Ga0207683_10484361
2319 Ga0207683_11617527
2320 Ga0207698_10000358
2321 Ga0207698_10313763
2322 Ga0209281_1000001
2323 Ga0209281_1000003
2324 Ga0209281_1000114
2325 Ga0209281_1000180
2326 Ga0209281_1000229
2327 Ga0209281_1000267
2328 Ga0209281_1000288
2329 Ga0209281_1000383
2330 Ga0209281_1000722
2331 Ga0209281_1001917
2332 Ga0209281_1002477
2333 Ga0209973_1037991
2334 Ga0209371_1000001
2335 Ga0209371_1000010
2336 Ga0209371_1000020
2337 Ga0209371_1000081
2338 Ga0209371_1000085
2339 Ga0209371_1000086
2340 Ga0209371_1000167
2341 Ga0209371_1000321
2342 Ga0209371_1000349
2343 Ga0209371_1000616
2344 Ga0209371_1000809
2345 Ga0209371_1001073
2346 Ga0209371_1002095
2347 Ga0209371_1002126
2348 Ga0209371_1002299
2349 Ga0209371_1002407
2350 Ga0209371_1002837
2351 Ga0209371_1003155
2352 Ga0209371_1003489
2353 Ga0209371_1003616
2354 Ga0209371_1021256
2355 Ga0209371_1046577
2356 Ga0209371_1047234
2357 Ga0209371_1062786
2358 Ga0209999_1043668
2359 Ga0210002_1020944
2360 Ga0209282_1000043
2361 Ga0209971_1001163
2362 Ga0209971_1169283
2363 Ga0209974_10010341
2364 Ga0268266_10000282
2365 Ga0268266_10025201
2366 Ga0268266_10180251
2367 Ga0268266_11456353
2368 Ga0268265_10139443
2369 Ga0268264_10304937
2370 Ga0265323_10010795
2371 Ga0307515_10000626
2372 Ga0307515_10001303
2373 Ga0307515_10032622
2374 Ga0265324_10056153
2375 Ga0268256_1000001
2376 Ga0268256_1000003
2377 Ga0268256_1000048
2378 Ga0268256_1000092
2379 Ga0268256_1000114
2380 Ga0268256_1000124
2381 Ga0268256_1000175
2382 Ga0268256_1000532
2383 Ga0268256_1000920
2384 Ga0268256_1001027
2385 Ga0268256_1001435
2386 Ga0268256_1001749
2387 Ga0268256_1002069
2388 Ga0268256_1002830
2389 Ga0268256_1003160
2390 Ga0268256_1004676
2391 Ga0268256_1007695
2392 Ga0268256_1017912
2393 Ga0268256_1018423
2394 Ga0268256_1023884
2395 Ga0268256_1052542
2396 Ga0316177_1037186
2397 Ga0316176_1061113
2398 Ga0314311_1031728
2399 Ga0316179_1098736
2400 Ga0316178_1015612
2401 Ga0316180_1126976
2402 Ga0316183_1122932
2403 Ga0316181_1114225
2404 Ga0316182_1103194
2405 Ga0265330_10004252
2406 Ga0265332_10019389
2407 Ga0265328_10327217
2408 Ga0265331_10003913
2409 Ga0265331_10105558
2410 Ga0265327_10000133
2411 Ga0265327_10002852
2412 Ga0265327_10015025
2413 Ga0265327_10024914
2414 Ga0265327_10025409
2415 Ga0265327_10393824
2416 Ga0265316_10147424
2417 Ga0307408_100009699
2418 Ga0307408_100014538
2419 Ga0307408_100033660
2420 Ga0307408_100161444
2421 Ga0307408_100323091
2422 Ga0307514_10000711
2423 Ga0307514_10173650
2424 Ga0316575_10024298
2425 Ga0316579_10046342
2426 Ga0265314_10008686
2427 Ga0316576_10557731
2428 Ga0316578_10079152
2429 Ga0316578_10118438
2430 Ga0307405_10058452
2431 Ga0307405_10144393
2432 Ga0307405_10180638
2433 Ga0307405_10310911
2434 Ga0307405_10321329
2435 Ga0307405_10362857
2436 Ga0307405_10427102
2437 Ga0307405_10874541
2438 Ga0307405_10897101
2439 Ga0316577_10041516
2440 Ga0316577_10057099
2441 Ga0316577_10062977
2442 Ga0307413_10082572
2443 Ga0307413_10347186
2444 Ga0307406_10003334
2445 Ga0307406_10007375
2446 Ga0307406_10029379
2447 Ga0307406_10109880
2448 Ga0307406_10319528
2449 Ga0307406_11635513
2450 Ga0307412_10019109
2451 Ga0307412_10128246
2452 Ga0307412_10242227
2453 Ga0307412_10423382
2454 Ga0307412_12210232
2455 Ga0307409_100887652
2456 Ga0307416_100408334
2457 Ga0307416_100431182
2458 Ga0307416_101951500
2459 Ga0307416_102284103
2460 Ga0307416_102326572
2461 Ga0307414_10177984
2462 Ga0307414_10339772
2463 Ga0307414_10553731
2464 Ga0307414_11822512
2465 Ga0307411_10019468
2466 Ga0307411_10201421
2467 Ga0307411_10261224
2468 Ga0316580_10045072
2469 Ga0316580_10237488
2470 Ga0307510_10232500
2471 Ga0316587_1000878
2472 Ga0316574_0019624
2473 Ga0316574_0212159
2474 Ga0316582_0012653
2475 Ga0316582_0139520
2476 Ga0316582_0207199
2477 Ga0316582_0254001
2478 Ga0316584_0003227
2479 Ga0316584_0007399
2480 Ga0316584_0058252
2481 Ga0316584_0137779
2482 Ga0395900_0067131
2483 Ga0395900_0359565
2484 Ga0395898_0167266
2485 Ga0395898_0368686
2486 Ga0395905_0229337
2487 Ga0316581_0035288
2488 Ga0395901_0642429
2489 Ga0395901_1003615
2490 Ga0395901_1886488
2491 Ga0436365_1037676
2492 Ga0436361_0079908
2493 Ga0436361_1010587
2494 Ga0436363_0982124
2495 Ga0439436_0000336
2496 Ga0439436_0002994
2497 Ga0439438_000001
2498 Ga0439438_001188
2499 Ga0439438_001930
2500 Ga0439438_008658
2501 Ga0439438_034767
2502 Ga0439439_0003042
2503 Ga0439439_0014282
2504 Ga0439447_004155
2505 Ga0439447_005376
2506 Ga0439447_028060
2507 Ga0439461_0065771
2508 Ga0439466_0000003
2509 Ga0439466_0058052
2510 Ga0439466_0218156
2511 Ga0439465_0000517
2512 Ga0451791_0103488
2513 Ga0451791_0972312
2514 Ga0451793_1583412
2515 Ga0451795_0579443
2516 Ga0451802_0881816
2517 Ga0451805_033409
2518 Ga0451847_0790351
2519 Ga0451853_2599509
2520 Ga0451853_3098869
2521 Ga0439431_0002606
2522 Ga0439431_0276272
2523 Ga0439433_0024432
2524 Ga0439433_0038479
2525 Ga0439442_002961
2526 Ga0439445_0000347
2527 Ga0439445_0003104
2528 Ga0439445_0200499
2529 Ga0439448_0244134
2530 Ga0439432_000662
2531 Ga0439432_008144
2532 Ga0439432_010037
2533 Ga0439432_010592
2534 Ga0439432_014689
2535 Ga0439432_125770
2536 Ga0439432_201852
2537 Ga0439449_0000838
2538 Ga0439449_0009132
2539 Ga0439449_0184117
2540 Ga0439451_047755
2541 Ga0439452_000001
2542 Ga0439452_000003
2543 Ga0439452_000006
2544 Ga0439452_000008
2545 Ga0439452_000161
2546 Ga0439452_000216
2547 Ga0439452_000949
2548 Ga0439452_002479
2549 Ga0439457_011278
2550 Ga0439462_0000328
2551 Ga0439462_0002574
2552 Ga0439463_006410
2553 Ga0450911_000124
2554 Ga0450922_001261
2555 Ga0450922_004419
2556 Ga0450923_000221
2557 Ga0450923_013904
2558 Ga0450890_007058
2559 Ga0450894_010619
2560 Ga0450898_012816
2561 Ga0450900_017373
2562 Ga0450902_019005
2563 Ga0450907_000329
2564 Ga0439446_0014658
2565 Ga0439446_0176825
2566 Ga0450909_012251
2567 Ga0450909_015394
2568 Ga0439434_0002221
2569 Ga0439434_0086096
2570 Ga0439464_0000625
2571 Ga0439464_0003541
2572 Ga0439464_0019306
2573 Ga0439464_0044551
2574 Ga0450893_0003283
2575 Ga0450893_0004785
2576 Ga0450893_0039760
2577 Ga0451577_0014209
2578 Ga0451577_0025812
2579 Ga0451577_0118887
2580 Ga0451577_1176457
2581 Ga0466977_0000007
2582 Ga0466981_0000016
2583 Ga0453683_0504451
2584 Ga0466961_0023977
2585 Ga0453684_0000917
2586 Ga0453684_0014200
2587 Ga0453684_0693932
2588 Ga0453684_1211732
2589 Ga0466970_0209074
2590 Ga0466960_0037103
2591 Ga0451576_0252121
2592 Ga0495617_012114
2593 Ga0495617_031455
2594 Ga0495627_000027
2595 Ga0495627_073184
2596 Ga0495627_162336
2597 Ga0495592_0016839
2598 Ga0495592_0206827
2599 Ga0495591_000014
2600 Ga0495591_000238
2601 Ga0495591_002770
2602 Ga0495591_005174
2603 Ga0495591_084621
2604 Ga0495638_0002381
2605 Ga0495638_0013990
2606 Ga0495651_0005777
2607 Ga0495651_0414476
2608 Ga0495653_0198914
2609 Ga0495650_0000002
2610 Ga0495650_0000021
2611 Ga0495650_0000032
2612 Ga0495650_0000396
2613 Ga0495650_0000478
2614 Ga0495605_0004250
2615 Ga0495605_0004747
2616 Ga0495605_0033547
2617 Ga0495605_0073615
2618 Ga0495605_0127430
2619 Ga0495639_0006891
2620 Ga0495584_0006445
2621 Ga0495584_0034114
2622 Ga0495585_0004620
2623 Ga0495594_0007426
2624 Ga0495596_0000001
2625 Ga0495596_0000366
2626 Ga0495596_0045021
2627 Ga0495607_0000175
2628 Ga0495607_0007488
2629 Ga0495607_0009243
2630 Ga0495607_0178868
2631 Ga0495606_0001314
2632 Ga0495606_0231995
2633 Ga0495608_0006970
2634 Ga0495610_0000002
2635 Ga0495610_0001226
2636 Ga0495610_0029233
2637 Ga0495616_0001943
2638 Ga0495616_0002001
2639 Ga0495616_0086880
2640 Ga0495618_0012760
2641 Ga0495618_0028883
2642 Ga0495618_0106009
2643 Ga0495620_0003066
2644 Ga0495620_0141600
2645 Ga0495620_0145922
2646 Ga0495620_0147396
2647 Ga0495628_0000059
2648 Ga0495628_0006630
2649 Ga0495628_0295816
2650 Ga0495628_0548866
2651 Ga0495630_0123685
2652 Ga0495631_0000414
2653 Ga0495632_0007880
2654 Ga0495632_0011349
2655 Ga0495632_0131606
2656 Ga0495632_0354786
2657 Ga0495637_0000005
2658 Ga0495637_0031616
2659 Ga0495643_0000002
2660 Ga0495643_0019114
2661 Ga0495643_0022631
2662 Ga0495643_0025319
2663 Ga0495643_0028334
2664 Ga0495643_0081546
2665 Ga0495644_0002242
2666 Ga0495648_0000299
2667 Ga0495648_0006462
2668 Ga0495648_0021944
2669 Ga0495663_0142351
2670 Ga0495666_0001981
2671 Ga0495666_0035617
2672 Ga0495666_0499409
2673 Ga0495652_0004625
2674 Ga0495652_0035985
2675 Ga0495654_0000019
2676 Ga0495654_0001152
2677 Ga0495654_0002661
2678 Ga0495654_0008751
2679 Ga0495654_0011360
2680 Ga0495654_0053428
2681 Ga0495654_0054888
2682 Ga0495654_0082084
2683 Ga0495654_0183630
2684 Ga0495586_0097772
2685 Ga0495587_0823400
2686 Ga0495609_0010849
2687 Ga0495621_0004439
2688 Ga0495597_0000015
2689 Ga0495597_0000720
2690 Ga0495597_0001359
2691 Ga0495597_0020433
2692 Ga0495645_0054792
2693 Ga0495645_0181366
2694 Ga0495622_0013458
2695 Ga0495656_0005434
2696 Ga0495656_0007291
2697 Ga0495668_0053240
2698 Ga0495634_0069678
2699 Ga0495611_0035919
2700 Ga0495611_0401145
2701 Ga0495625_0004458
2702 Ga0495625_0005285
2703 Ga0495625_0014435
2704 Ga0495635_0083588
2705 Ga0495635_0172144
2706 Ga0495661_0009993
2707 Ga0495588_0000437
2708 Ga0495657_0043991
2709 Ga0495599_0003585
2710 Ga0495623_0003538
2711 Ga0495646_0002246
2712 Ga0495646_0014471
2713 Ga0495646_0441126
2714 Ga0495647_0067036
2715 Ga0495658_0042769
2716 Ga0495669_0147709
2717 Ga0495613_0714846
2718 Ga0495624_0008986
2719 Ga0495624_0020855
2720 Ga0495624_0255279
2721 Ga0495670_0016534
2722 Ga0495670_0016868
2723 Ga0495671_0001044
2724 Ga0495671_0001269
2725 Ga0495671_0008856
2726 Ga0495671_0258152
2727 Ga0495649_0013339
2728 Ga0495649_0014855
2729 Ga0495649_0042287
2730 Ga0495649_0107137
2731 Ga0495589_0000001
2732 Ga0495589_0039635
2733 Ga0495589_0052967
2734 Ga0495600_0003774
2735 Ga0495600_0511904
2736 Ga0495600_0682364
2737 Ga0495660_0000004
2738 Ga0495660_0000021
2739 Ga0495660_0006528
2740 Ga0495660_0037106
2741 Ga0495604_0001830
2742 Ga0495604_0014340
2743 Ga0495604_0391285
2744 Ga0495636_0010570
2745 Ga0495672_0000002
2746 Ga0495672_0000012
2747 Ga0495672_0000020
2748 Ga0495672_0024648
2749 Ga0495672_0215417
2750 Ga0495676_0008592
2751 Ga0495683_0020678
2752 Ga0495677_0413493
2753 Ga0495679_000020
2754 Ga0495679_002132
2755 Ga0495679_002328
2756 Ga0495679_047995
2757 Ga0495685_004966
2758 Ga0495673_0000065
2759 Ga0495673_0000081
2760 Ga0495681_0000088
2761 Ga0495681_0000426
2762 Ga0495686_0060309
2763 Ga0495593_0034149
2764 Ga0495593_0487597
2765 Ga0495602_0012279
2766 Ga0495602_0147112
2767 Ga0495602_0375023
2768 Ga0495614_0004433
2769 Ga0495626_0000001
2770 Ga0496100_0006740
2771 Ga0496100_0013256
2772 Ga0496100_0028570
2773 Ga0496100_0125278
2774 Ga0496100_1483057
2775 Ga0496101_0000314
2776 Ga0496101_0025960
2777 Ga0496101_0203711
2778 Ga0496101_0383973
2779 Ga0496101_0592517
2780 Ga0496101_0927755
2781 Ga0496101_1288540
2782 Ga0496102_0005511
2783 Ga0496102_0108549
2784 Ga0496102_0266586
2785 Ga0496102_0493239
2786 Ga0496103_0092134
2787 Ga0496103_0172794
2788 Ga0496103_0646170
2789 Ga0496104_0000893
2790 Ga0496104_0001151
2791 Ga0496104_0452682
2792 Ga0496104_1047988
2793 Ga0496104_1632241
2794 Ga0496105_0001685
2795 Ga0496105_0019956
2796 Ga0496105_0118704
2797 Ga0496105_0157490
2798 Ga0496106_0048665
2799 Ga0496106_1184926
2800 Ga0496107_0257645
2801 Ga0496107_0700337
2802 Ga0496108_0059934
2803 Ga0496109_0078498
2804 Ga0496110_0306314
2805 Ga0496110_1212553
2806 Ga0496110_1303227
2807 Ga0496113_0110179
2808 Ga0496113_0182493
2809 Ga0496113_0747444
2810 Ga0496114_0634583
2811 Ga0496116_0000001
2812 Ga0496116_0000094
2813 Ga0496116_0000261
2814 Ga0496116_0000431
2815 Ga0496116_0000679
2816 Ga0496116_0000738
2817 Ga0496116_0000930
2818 Ga0496116_0002175
2819 Ga0496116_0005086
2820 Ga0496116_0007904
2821 Ga0496116_0011708
2822 Ga0496116_0015751
2823 Ga0496116_0017298
2824 Ga0496116_0018592
2825 Ga0496116_0023072
2826 Ga0496116_0035310
2827 Ga0496116_0084036
2828 Ga0496116_0088658
2829 Ga0496116_0125206
2830 Ga0496116_0166367
2831 Ga0496116_0270833
2832 Ga0496117_0000004
2833 Ga0496117_0000213
2834 Ga0496117_0001414
2835 Ga0496117_0002234
2836 Ga0496117_0002320
2837 Ga0496117_0003205
2838 Ga0496117_0007415
2839 Ga0496117_0008133
2840 Ga0496117_0009227
2841 Ga0496117_0010043
2842 Ga0496117_0012413
2843 Ga0496117_0015407
2844 Ga0496117_0035442
2845 Ga0496117_0035885
2846 Ga0496117_0039172
2847 Ga0496117_0044550
2848 Ga0496117_0046718
2849 Ga0496117_0063088
2850 Ga0496117_0086922
2851 Ga0496117_0124537
2852 Ga0496117_0147540
2853 Ga0496118_0000072
2854 Ga0496118_0000137
2855 Ga0496118_0001157
2856 Ga0496118_0002508
2857 Ga0496118_0003626
2858 Ga0496118_0003664
2859 Ga0496118_0008346
2860 Ga0496118_0008657
2861 Ga0496118_0022858
2862 Ga0496118_0023065
2863 Ga0496118_0031286
2864 Ga0496118_0031499
2865 Ga0496118_0045544
2866 Ga0496118_0117588
2867 Ga0496118_0236351
2868 Ga0496118_0330465
2869 Ga0496119_0000008
2870 Ga0496119_0000080
2871 Ga0496119_0000156
2872 Ga0496119_0000677
2873 Ga0496119_0002331
2874 Ga0496119_0002686
2875 Ga0496119_0004122
2876 Ga0496119_0004498
2877 Ga0496119_0005466
2878 Ga0496119_0007741
2879 Ga0496119_0019148
2880 Ga0496119_0019675
2881 Ga0496119_0034475
2882 Ga0496119_0242819
2883 Ga0496119_0246500
2884 Ga0496120_0000035
2885 Ga0496120_0000040
2886 Ga0496120_0000075
2887 Ga0496120_0000128
2888 Ga0496120_0000302
2889 Ga0496120_0000477
2890 Ga0496120_0002786
2891 Ga0496120_0003693
2892 Ga0496120_0003747
2893 Ga0496120_0003837
2894 Ga0496120_0005107
2895 Ga0496120_0006986
2896 Ga0496120_0035747
2897 Ga0496120_0043456
2898 Ga0496120_0073631
2899 Ga0496121_0000047
2900 Ga0496121_0000124
2901 Ga0496121_0001134
2902 Ga0496121_0002661
2903 Ga0496121_0002930
2904 Ga0496121_0003880
2905 Ga0496121_0007669
2906 Ga0496121_0010355
2907 Ga0496121_0015160
2908 Ga0496121_0015971
2909 Ga0496121_0035885
2910 Ga0496121_0038890
2911 Ga0496121_0041514
2912 Ga0496121_0052914
2913 Ga0496121_0056690
2914 Ga0496122_0000007
2915 Ga0496122_0000033
2916 Ga0496122_0000130
2917 Ga0496122_0000356
2918 Ga0496122_0001024
2919 Ga0496122_0001367
2920 Ga0496122_0001535
2921 Ga0496122_0004005
2922 Ga0496122_0004980
2923 Ga0496122_0006622
2924 Ga0496122_0007333
2925 Ga0496122_0012310
2926 Ga0496122_0018241
2927 Ga0496122_0035075
2928 Ga0496122_0052511
2929 Ga0496122_0053063
2930 Ga0496122_0063042
2931 Ga0496122_0067614
2932 Ga0496122_0067953
2933 Ga0496122_0085176
2934 Ga0496122_0089083
2935 Ga0496122_0126517
2936 Ga0496122_0137705
2937 Ga0496122_0142086
2938 Ga0496122_0248225
2939 Ga0496123_0000004
2940 Ga0496123_0000064
2941 Ga0496123_0000248
2942 Ga0496123_0000263
2943 Ga0496123_0000309
2944 Ga0496123_0000827
2945 Ga0496123_0001080
2946 Ga0496123_0002455
2947 Ga0496123_0003432
2948 Ga0496123_0003815
2949 Ga0496123_0005121
2950 Ga0496123_0006692
2951 Ga0496123_0008295
2952 Ga0496123_0012224
2953 Ga0496123_0031257
2954 Ga0496123_0031549
2955 Ga0496123_0037990
2956 Ga0496123_0048163
2957 Ga0496123_0080653
2958 Ga0496123_0107980
2959 Ga0496123_0135435
2960 Ga0496123_0186925
2961 Ga0496123_0231341
2962 Ga0496123_0382431
2963 Ga0496124_0000004
2964 Ga0496124_0000008
2965 Ga0496124_0000025
2966 Ga0496124_0000097
2967 Ga0496124_0000180
2968 Ga0496124_0000659
2969 Ga0496124_0001108
2970 Ga0496124_0001496
2971 Ga0496124_0005507
2972 Ga0496124_0006593
2973 Ga0496124_0011293
2974 Ga0496124_0012761
2975 Ga0496124_0018225
2976 Ga0496124_0025818
2977 Ga0496124_0028216
2978 Ga0496124_0043725
2979 Ga0496124_0050738
2980 Ga0496124_0092781
2981 Ga0496124_0102126
2982 Ga0496124_0110891
2983 Ga0496124_0114707
2984 Ga0496124_0121468
2985 Ga0496124_0126256
2986 Ga0496124_0140729
2987 Ga0496124_0275538
2988 Ga0496124_0289900
2989 Ga0496124_0396997
2990 Ga0496124_0417766
2991 Ga0496124_0498316
2992 Ga0496124_0963776
2993 Ga0496125_0000013
2994 Ga0496125_0000055
2995 Ga0496125_0003192
2996 Ga0496125_0004562
2997 Ga0496125_0011417
2998 Ga0496125_0012992
2999 Ga0496125_0019540
3000 Ga0496125_0031099
3001 Ga0496125_0031681
3002 Ga0496125_0033541
3003 Ga0496125_0051081
3004 Ga0496125_0056246
3005 Ga0496125_0065514
3006 Ga0496125_0101308
3007 Ga0496125_0102529
3008 Ga0496125_0125272
3009 Ga0496125_0172485
3010 Ga0496126_0000524
3011 Ga0496126_0001242
3012 Ga0496126_0001275
3013 Ga0496126_0002571
3014 Ga0496126_0004513
3015 Ga0496126_0005838
3016 Ga0496126_0012055
3017 Ga0496126_0026056
3018 Ga0496126_0095925
3019 Ga0496126_0102516
3020 Ga0496126_0113215
3021 Ga0496126_0138297
3022 Ga0496126_0140140
3023 Ga0496126_0221148
3024 Ga0496126_0421096
3025 Ga0501306_044815
3026 Ga0495678_000817
3027 Ga0495678_002620
3028 Ga0495678_040935
3029 Ga0495682_0000015
3030 Ga0501290_021491
3031 Ga0501314_040360
3032 Ga0501315_101563
3033 Ga0501031_0009408
3034 Ga0501033_0005448
3035 Ga0501034_0000194
3036 Ga0501034_0067693
3037 Ga0501034_0098941
3038 Ga0501034_0450921
3039 Ga0501037_0442852
3040 Ga0501043_0906553
3041 Ga0501043_1195240
3042 Ga0501047_0022639
3043 Ga0501047_0026369
3044 Ga0501048_0259736
3045 Ga0501069_0003956
3046 Ga0501069_0092482
3047 Ga0501070_0008196
3048 Ga0501073_0004370
3049 Ga0501074_0045353
3050 Ga0501074_0145039
3051 Ga0501076_0358287
3052 Ga0501077_0023480
3053 Ga0501223_013447
3054 Ga0501228_006460
3055 Ga0501238_010976
3056 Ga0501249_006469
3057 Ga0501252_039108
3058 Ga0501257_049098
3059 Ga0501225_0012633
3060 Ga0501080_0045132
3061 Ga0501080_0176550
3062 Ga0501083_0083127
3063 Ga0501241_019985
3064 Ga0501262_000217
3065 Ga0501266_018967
3066 Ga0501279_026092
3067 Ga0501035_0008452
3068 Ga0501035_0022942
3069 Ga0501035_0030616
3070 Ga0501035_0383862
3071 Ga0501044_0000126
3072 Ga0501044_0030902
3073 nmdc:mga03683_15867_c1
3074 nmdc:mga03683_539_c1
3075 nmdc:mga03n38_13224_c1
3076 nmdc:mga03n38_14629_c1
3077 nmdc:mga00v17_146343_c1
3078 nmdc:mga00v17_151655_c1
3079 nmdc:mga00v17_18093_c1
3080 nmdc:mga00v17_210738_c1
3081 nmdc:mga00v17_223241_c1
3082 nmdc:mga00v17_223343_c1
3083 nmdc:mga00v17_320026_c1
3084 nmdc:mga00v17_50007_c1
3085 nmdc:mga00v17_629_c1
3086 nmdc:mga0k408_441955_c1
3087 nmdc:mga0k408_546176_c1
3088 nmdc:mga0k408_648838_c1
3089 nmdc:mga07m45_122425_c1
3090 nmdc:mga07m45_1446_c1
3091 nmdc:mga07m45_297849_c1
3092 nmdc:mga07m45_42155_c1
3093 nmdc:mga0qj67_683617_c1
3094 nmdc:mga0a205_524229_c1
3095 nmdc:mga0sz30_116214_c1
3096 Ga0495601_0056834
3097 Ga0495655_0116484
3098 Ga0495619_0318180
3099 Ga0500643_015944
3100 Ga0500644_0006005
3101 Ga0500644_0051178
3102 Ga0500646_0019586
3103 Ga0500647_0257671
3104 Ga0500647_0353846
3105 Ga0500651_0000054
3106 Ga0500566_0042353
3107 Ga0500641_0120823
3108 Ga0500562_007562
3109 Ga0500562_120711
3110 Ga0500571_000005
3111 Ga0500572_116828
3112 Ga0500592_003168
3113 Ga0500593_002899
3114 Ga0500594_0000763
3115 Ga0500595_001889
3116 Ga0500595_118460
3117 Ga0500597_253803
3118 Ga0500607_036794
3119 Ga0500607_038837
3120 Ga0500608_024725
3121 Ga0500614_118936
3122 Ga0500618_014532
3123 Ga0500621_000001
3124 Ga0500655_000895
3125 Ga0500559_0001788
3126 Ga0500559_0084954
3127 Ga0500559_0258511
3128 Ga0500561_0016276
3129 Ga0500564_005575
3130 Ga0500568_0002238
3131 Ga0500573_0029700
3132 Ga0500574_000299
3133 Ga0500574_001599
3134 Ga0500604_0054108
3135 Ga0500616_0047830
3136 Ga0500619_000249
3137 Ga0500622_0125928
3138 Ga0500624_004622
3139 Ga0500624_070879
3140 Ga0500634_0025168
3141 Ga0500634_0036031
3142 Ga0500634_0107998
3143 Ga0500638_004055
3144 Ga0500636_0000053
3145 Ga0500625_026945
3146 Ga0500645_011458
3147 Ga0500645_049388
3148 Ga0500661_002371
3149 Ga0501082_0077867
3150 2506579128
3151 2506584267
3152 2508853017
3153 2511245910
3154 2511378986
3155 2511433251
3156 2513953457
3157 2514042766
3158 2526213809
3159 2538425916
3160 2547694988
3161 2547698141
3162 2548501264
3163 2548648031
3164 2562463995
3165 2562467013
3166 2585829188
3167 2585834100
3168 2599623235
3169 2599675547
3170 2599680840
3171 2599692855
3172 2599907762
3173 2599927576
3174 2601533231
3175 2601535065
3176 2601538595
3177 2601541454
3178 2601756944
3179 2601758247
3180 2601761601
3181 2601764356
3182 2603638382
3183 2603641220
3184 2603642877
3185 2603698078
3186 2603703483
3187 2603867553
3188 2608669024
3189 2609910071
3190 2643863186
3191 2643868496
3192 2643978592
3193 2643994603
3194 2644061652
3195 2644075184
3196 2644121712
3197 2644295448
3198 2644467160
3199 2644649192
3200 2650897820
3201 2656280085
3202 2671103420
3203 2671108783
3204 2671587306
3205 2681997451
3206 2682007045
3207 2686352920
3208 2689445585
3209 2707098652
3210 2712470160
3211 2723879825
3212 2738721246
3213 2738882743
3214 2739243349
3215 2739250546
3216 2739280445
3217 2753855531
3218 2765588508
3219 2772439547
3220 2775542322
3221 2791925875
3222 2792311507
3223 2793405912
3224 2807180778
3225 2809036651
3226 2809126989
3227 2813727434
3228 2813729433
3229 2814694966
3230 2814696928
3231 2816473927
3232 2819544803
3233 2819600370
3234 2821119337
3235 2823374294
3236 2831271836
3237 2834645087
3238 2838059674
3239 2842679834
3240 2842721934
3241 2842735768
3242 2842750921
3243 2844427075
3244 2844530485
3245 2846541790
3246 2847088103
3247 2847800402
3248 2852107623
3249 2854601991
3250 2855197066
3251 2855731415
3252 2855768121
3253 2857542680
3254 2857545856
3255 2858469096
3256 2858691088
3257 2858954805
3258 2865015573
3259 2869555030
3260 2871275628
3261 2871285420
3262 2876601983
3263 2881413712
3264 2881612390
3265 2884089421
3266 2885198062
3267 2885198672
3268 2885211948
3269 2888369610
3270 2891672676
3271 2899928459
3272 2900052857
3273 2901304334
3274 2904452436
3275 2904460965
3276 2904475471
3277 2904548220
3278 2919154316
3279 2919463932
3280 2923638964
3281 2927144309
3282 2927834546
3283 2928041380
3284 2928048222
3285 2928056064
3286 2928066454
3287 2928077402
3288 2928087701
3289 2929163210
3290 2929522948
3291 2932408756
3292 2935627103
3293 2935629095
3294 2937543247
3295 2937968184
3296 2939568727
3297 2939574239
3298 2939580452
3299 2939603654
3300 2939607919
3301 2939619108
3302 2939621866
3303 2939644228
3304 2941481035
3305 2945877271
3306 2945946068
3307 2945953465
3308 2945975667
3309 2954768890
3310 2974312571
3311 2974321964
3312 2974437978
3313 2974439772
3314 2978975957
3315 2978978014
3316 2984496150
3317 2990262827
3318 2990715533
3319 3000376946
3320 640938510
3321 644750334
3322 8003405317
3323 8004596810
3324 8015398332
3325 8016736360
3326 8018224609
3327 8018408625
3328 8019503032
3329 8019505992
3330 8019509242
3331 8054846254
3332 8054850454
3333 8055088534
3334 8055094229
3335 8055099647
3336 8055696620
3337 8057161335
3338 8057309059

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

95

140

0.95

PF00460

Flg_bb_rod

Flagella basal body rod protein

11

41

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9386 2 130
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.9291 1 132
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9271 2 128
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9244 2 130
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.9224 1 132
ID Description Score Start End Superfamily
af_Q13023_1080_1194_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9185 93 128 1.20.58.60
af_E9Q9K8_1077_1190_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9066 93 128 1.20.58.60
af_Q9VMH8_1_121_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6726 70 129 1.10.287.370
af_Q9M1G8_208_399_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6204 38 67 3.40.50.880
af_Q94K88_191_391_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6011 12 132 1.25.40.10
ID Description Score Start End GO Terms
AF-F5NSX4-F1-model_v4 Flagellar basal-body rod protein flgC 0.9958 2 68 GO:0009288
AF-A0A6D0ENN2-F1-model_v4 deleted 0.9867 2 110
AF-A0A656YGU4-F1-model_v4 deleted 0.9792 2 63
AF-A0A376UBU8-F1-model_v4 Flagellar basal-body rod protein FlgC 0.977 2 128 GO:0030694
GO:0044781
GO:0071978
AF-A0A1I7F3P2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9684 2 132 GO:0030694
GO:0071978

Map