F495286

General Info

Members Datasets Scaffolds Average Seq Length
1674 584 3348 277

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100091865|Ga0070714_1000918654
Length 258
Sequence MGLRKYRPLTPSLRYKLSADFAEITTDKPEKSLVKPTKRSGGRNDTGKMTIRYIGGGHKKAYRVIDFKRDKDGIEGTVATVEYDPNRSARIALVVYKDGEKRYIIAPQGIQVGQKVMSGKGAAPEIGNTLLLSEIPLGTIIHNIELRPGQGAALSRSARMPSSEIRMILITCKATIGAVSNPDHNQEVHGKAGRRRWLGRRPRNRPVAMNPVDHPMGGGEGRASGGHPRSRKGLPAKGFKTRYKSKASNKHIIERRKK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
229 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
230 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
231 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
232 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
256 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
268 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
280 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
283 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
284 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
285 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
286 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
287 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
291 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
295 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
296 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
300 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
301 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
399 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
400 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
401 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
402 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
403 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
404 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
405 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
406 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
407 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
408 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
409 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
410 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
411 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
414 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
415 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
416 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
417 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
418 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
422 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
423 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
424 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
434 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
435 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
436 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
437 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
440 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
441 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
442 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
443 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
444 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
445 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
446 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
447 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
448 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
451 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
452 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
455 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
456 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
457 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
458 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
459 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
460 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
461 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
464 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
465 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
466 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
467 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
468 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
469 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
470 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
471 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
472 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
473 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
474 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
475 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
476 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
477 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
478 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
479 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
480 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
481 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
482 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
483 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
484 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
485 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
486 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
487 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
488 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
489 2738541278 Niastella sp. CF465 Isolate Unclassified
490 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
491 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
492 2738541302 Pedobacter sp. CF074 Isolate Unclassified
493 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
494 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
495 2739367651 Pedobacter sp. OK291 Isolate Unclassified
496 2739367656 Pedobacter sp. CF523 Isolate Unclassified
497 2739367663 Pedobacter sp. YR510 Isolate Unclassified
498 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
499 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
500 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
501 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
502 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
503 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
504 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
505 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
506 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
507 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
508 2818991437 Pedobacter terrae 518 Isolate Unclassified
509 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
510 2818991444 Filimonas endophytica 3197 Isolate Unclassified
511 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
512 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
513 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
514 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
515 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
516 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
517 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
518 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
519 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
520 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
521 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
522 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
523 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
524 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
525 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
526 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
527 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
528 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
529 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
530 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
531 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
532 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
533 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
534 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
535 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
536 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
537 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
538 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
539 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
540 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
541 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
542 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
543 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
544 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
545 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
546 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
547 2914759650 Rhizosphaericola mali Isolate Rhizosphere
548 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
549 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
550 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
551 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
552 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
553 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
554 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
555 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
556 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
557 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
558 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
559 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
560 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
561 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
562 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
563 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
564 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
565 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
566 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
567 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
568 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
569 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
570 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
571 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
572 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
573 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
574 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
575 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
576 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
577 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
578 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
579 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
580 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
581 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
582 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
583 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
584 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 3.52
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 6.09
Nodule 0.06
Rhizoplane 0.84
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100091865 3300005435 Bacteria 2660
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 SwRhRL2b_contig_843371 2162886007 Bacteria 4093
4 JGI24740J21852_10011805 3300001979 Bacteria 3315
5 JGI24742J22300_10012118 3300002244 Bacteria 1435
6 JGI24751J29686_10001390 3300002459 Bacteria 5082
7 JGI25162J39368_1001033 3300002737 Bacteria 17196
8 JGI25154J39366_1000001 3300002738 Bacteria 483450
9 JGI25157J39369_1004835 3300002741 Bacteria 2333
10 JGI25406J46586_10027139 3300003203 Bacteria 2200
11 JGI25165J46597_1000678 3300003214 Bacteria 27401
12 JGI25153J46596_10002304 3300003215 Bacteria 11112
13 JGI25153J46596_10013567 3300003215 Bacteria 3436
14 rootH1_10136973 3300003316 Bacteria 2098
15 rootH2_10003970 3300003320 Bacteria 33753
16 rootL2_10010167 3300003322 Bacteria 22542
17 rootL2_10011247 3300003322 Bacteria 9421
18 rootL2_10134610 3300003322 Bacteria 2534
19 rootH1_10002303 3300003323 Bacteria 27478
20 rootH1_10006684 3300003323 Bacteria 9578
21 rootH1_10008389 3300003323 Bacteria 21562
22 rootH1_10093451 3300003323 Bacteria 1826
23 JGI25160J50197_1001095 3300003354 Bacteria 13838
24 JGI25160J50197_1014301 3300003354 Bacteria 2661
25 JGI25160J50197_1014801 3300003354 Bacteria 2590
26 Ga0055526_1004445 3300003771 Bacteria 8418
27 Ga0055528_1000330 3300003790 Bacteria 39818
28 Ga0055530_10000331 3300003791 Bacteria 42800
29 Ga0055531_10000166 3300003794 Bacteria 74728
30 Ga0058859_11782699 3300004798 Bacteria 2040
31 Ga0058863_10160658 3300004799 Bacteria 11335
32 Ga0058861_10035234 3300004800 Bacteria 8090
33 Ga0058862_10235727 3300004803 Bacteria 2709
34 Ga0065165_1000105 3300005262 Bacteria 140409
35 Ga0065165_1029860 3300005262 Bacteria 1741
36 Ga0065704_10070140 3300005289 Bacteria 482257
37 Ga0065712_10002231 3300005290 Bacteria 7385
38 Ga0065712_10010764 3300005290 Bacteria 1916
39 Ga0065712_10085595 3300005290 Bacteria 2687
40 Ga0065715_10015110 3300005293 Bacteria 2811
41 Ga0065707_10103016 3300005295 Bacteria 2772
42 Ga0065707_10104946 3300005295 Bacteria 2670
43 Ga0070658_10000153 3300005327 Bacteria 60625
44 Ga0070658_10015118 3300005327 Bacteria 6177
45 Ga0070658_10178279 3300005327 Bacteria 1788
46 Ga0070658_10197163 3300005327 Bacteria 1698
47 Ga0070676_10006513 3300005328 Bacteria 6238
48 Ga0070676_10032136 3300005328 Bacteria 3005
49 Ga0070676_10080339 3300005328 Bacteria 1976
50 Ga0070676_10152918 3300005328 Bacteria 1479
51 Ga0070683_100001488 3300005329 Bacteria 18077
52 Ga0070683_100005896 3300005329 Bacteria 10252
53 Ga0070683_100012473 3300005329 Bacteria 7386
54 Ga0070683_100017135 3300005329 Bacteria 6398
55 Ga0070683_100025159 3300005329 Bacteria 5342
56 Ga0070683_100077142 3300005329 Bacteria 3115
57 Ga0070683_100538044 3300005329 Bacteria 1117
58 Ga0070690_100187616 3300005330 Bacteria 1432
59 Ga0070670_100024841 3300005331 Bacteria 5155
60 Ga0070670_100109804 3300005331 Bacteria 2376
61 Ga0070670_100112700 3300005331 Bacteria 2344
62 Ga0070670_100158102 3300005331 Bacteria 1963
63 Ga0070670_100208061 3300005331 Bacteria 1701
64 Ga0070670_100402814 3300005331 Bacteria 1208
65 Ga0070670_100403495 3300005331 Bacteria 1207
66 Ga0070677_10004196 3300005333 Bacteria 4691
67 Ga0070677_10044332 3300005333 Bacteria 1769
68 Ga0068869_100017755 3300005334 Bacteria 4832
69 Ga0068869_100044651 3300005334 Bacteria 3187
70 Ga0068869_100086467 3300005334 Bacteria 2350
71 Ga0068869_100089860 3300005334 Bacteria 2307
72 Ga0068869_100093571 3300005334 Bacteria 2265
73 Ga0068869_100164027 3300005334 Bacteria 1731
74 Ga0068869_100210212 3300005334 Bacteria 1538
75 Ga0070666_10000036 3300005335 Bacteria 119230
76 Ga0070666_10000191 3300005335 Bacteria 42149
77 Ga0070666_10018000 3300005335 Bacteria 4535
78 Ga0070666_10025993 3300005335 Bacteria 3821
79 Ga0070666_10150569 3300005335 Bacteria 1623
80 Ga0070666_10254744 3300005335 Bacteria 1243
81 Ga0070680_100013277 3300005336 Bacteria 6414
82 Ga0070680_100067285 3300005336 Bacteria 2938
83 Ga0070680_100116857 3300005336 Bacteria 2224
84 Ga0070682_100000039 3300005337 Bacteria 144400
85 Ga0070682_100089459 3300005337 Bacteria 2011
86 Ga0070682_100264042 3300005337 Bacteria 1247
87 Ga0068868_100015404 3300005338 Bacteria 5654
88 Ga0068868_100017514 3300005338 Bacteria 5340
89 Ga0068868_100031254 3300005338 Bacteria 4088
90 Ga0068868_100059381 3300005338 Bacteria 3025
91 Ga0068868_100092027 3300005338 Bacteria 2444
92 Ga0068868_100123647 3300005338 Bacteria 2111
93 Ga0068868_100140461 3300005338 Bacteria 1982
94 Ga0068868_100198642 3300005338 Bacteria 1671
95 Ga0068868_100245478 3300005338 Bacteria 1506
96 Ga0070660_100003216 3300005339 Bacteria 11222
97 Ga0070660_100014027 3300005339 Bacteria 5768
98 Ga0070660_100218767 3300005339 Bacteria 1548
99 Ga0070689_100021681 3300005340 Bacteria 4787
100 Ga0070689_100041808 3300005340 Bacteria 3518
101 Ga0070689_100459164 3300005340 Bacteria 1085
102 Ga0070689_100464723 3300005340 Bacteria 1079
103 Ga0070687_100003733 3300005343 Bacteria 5966
104 Ga0070687_100118591 3300005343 Bacteria 1510
105 Ga0070687_100128780 3300005343 Bacteria 1458
106 Ga0070661_100004113 3300005344 Bacteria 10031
107 Ga0070661_100040565 3300005344 Bacteria 3397
108 Ga0070661_100127366 3300005344 Bacteria 1911
109 Ga0070668_100017989 3300005347 Bacteria 5302
110 Ga0070668_100025286 3300005347 Bacteria 4500
111 Ga0070668_100050126 3300005347 Bacteria 3214
112 Ga0070668_100155369 3300005347 Bacteria 1853
113 Ga0070668_100221200 3300005347 Bacteria 1562
114 Ga0070668_100240917 3300005347 Bacteria 1498
115 Ga0070669_100002748 3300005353 Bacteria 12690
116 Ga0070669_100024124 3300005353 Bacteria 4359
117 Ga0070669_100324133 3300005353 Bacteria 1245
118 Ga0070669_100357409 3300005353 Bacteria 1187
119 Ga0070669_100422330 3300005353 Bacteria 1094
120 Ga0070675_100014978 3300005354 Bacteria 6124
121 Ga0070675_100018472 3300005354 Bacteria 5550
122 Ga0070675_100027474 3300005354 Bacteria 4571
123 Ga0070675_100090601 3300005354 Bacteria 2561
124 Ga0070675_100120096 3300005354 Bacteria 2232
125 Ga0070675_100129605 3300005354 Bacteria 2148
126 Ga0070675_100143049 3300005354 Bacteria 2046
127 Ga0070675_100182345 3300005354 Bacteria 1816
128 Ga0070675_100304522 3300005354 Bacteria 1405
129 Ga0070675_100348087 3300005354 Bacteria 1314
130 Ga0070671_100027874 3300005355 Bacteria 4650
131 Ga0070671_100030657 3300005355 Bacteria 4438
132 Ga0070671_100231072 3300005355 Bacteria 1569
133 Ga0070674_100065684 3300005356 Bacteria 2547
134 Ga0070674_100085764 3300005356 Bacteria 2260
135 Ga0070674_100141927 3300005356 Bacteria 1803
136 Ga0070674_100196180 3300005356 Bacteria 1556
137 Ga0070674_100363637 3300005356 Bacteria 1172
138 Ga0070673_100003757 3300005364 Bacteria 9520
139 Ga0070673_100030215 3300005364 Bacteria 4050
140 Ga0070673_100051881 3300005364 Bacteria 3215
141 Ga0070673_100052967 3300005364 Bacteria 3185
142 Ga0070673_100075958 3300005364 Bacteria 2711
143 Ga0070688_100018933 3300005365 Bacteria 3981
144 Ga0070688_100028135 3300005365 Bacteria 3352
145 Ga0070688_100046149 3300005365 Bacteria 2697
146 Ga0070688_100252148 3300005365 Bacteria 1257
147 Ga0070659_100000375 3300005366 Bacteria 33764
148 Ga0070659_100006862 3300005366 Bacteria 8247
149 Ga0070659_100008718 3300005366 Bacteria 7421
150 Ga0070659_100010418 3300005366 Bacteria 6838
151 Ga0070659_100019947 3300005366 Bacteria 5088
152 Ga0070659_100131467 3300005366 Bacteria 2033
153 Ga0070659_100451776 3300005366 Bacteria 1090
154 Ga0070667_100000248 3300005367 Bacteria 61183
155 Ga0070667_100004111 3300005367 Bacteria 12319
156 Ga0070667_100162213 3300005367 Bacteria 1969
157 Ga0070667_100187787 3300005367 Bacteria 1830
158 Ga0070701_10094050 3300005438 Bacteria 1648
159 Ga0070694_100152300 3300005444 Bacteria 1690
160 Ga0070663_100099434 3300005455 Bacteria 2168
161 Ga0070663_100314890 3300005455 Bacteria 1257
162 Ga0070678_100047685 3300005456 Bacteria 3080
163 Ga0070678_100083322 3300005456 Bacteria 2430
164 Ga0070678_100124839 3300005456 Bacteria 2036
165 Ga0070678_100480475 3300005456 Bacteria 1093
166 Ga0070662_100004284 3300005457 Bacteria 9007
167 Ga0070662_100017708 3300005457 Bacteria 4807
168 Ga0070662_100033746 3300005457 Bacteria 3605
169 Ga0070662_100040845 3300005457 Bacteria 3305
170 Ga0070662_100044485 3300005457 Bacteria 3180
171 Ga0070681_10007373 3300005458 Bacteria 10751
172 Ga0070681_10013404 3300005458 Bacteria 8144
173 Ga0070681_10134747 3300005458 Bacteria 2401
174 Ga0070681_10206234 3300005458 Bacteria 1883
175 Ga0070681_10281961 3300005458 Bacteria 1572
176 Ga0070681_10335318 3300005458 Bacteria 1422
177 Ga0068867_100011408 3300005459 Bacteria 6270
178 Ga0068867_100011837 3300005459 Bacteria 6162
179 Ga0068867_100027040 3300005459 Bacteria 4121
180 Ga0068867_100031243 3300005459 Bacteria 3843
181 Ga0068867_100067838 3300005459 Bacteria 2661
182 Ga0068867_100162442 3300005459 Bacteria 1762
183 Ga0070685_10040228 3300005466 Bacteria 2660
184 Ga0070698_100002339 3300005471 Bacteria 20947
185 Ga0070698_100002802 3300005471 Bacteria 19186
186 Ga0070698_100021125 3300005471 Bacteria 6820
187 Ga0070698_100171178 3300005471 Bacteria 2113
188 Ga0070698_100241874 3300005471 Bacteria 1738
189 Ga0070679_100008990 3300005530 Bacteria 9425
190 Ga0070679_100018790 3300005530 Bacteria 6710
191 Ga0070679_100033271 3300005530 Bacteria 5105
192 Ga0070679_100050377 3300005530 Bacteria 4148
193 Ga0070679_100075214 3300005530 Bacteria 3367
194 Ga0070679_100095843 3300005530 Bacteria 2955
195 Ga0070679_100237177 3300005530 Bacteria 1782
196 Ga0070684_100006342 3300005535 Bacteria 9138
197 Ga0070684_100008945 3300005535 Bacteria 7864
198 Ga0070684_100046353 3300005535 Bacteria 3766
199 Ga0070684_100069741 3300005535 Bacteria 3091
200 Ga0070684_100193764 3300005535 Bacteria 1850
201 Ga0068853_100000250 3300005539 Bacteria 37737
202 Ga0068853_100013022 3300005539 Bacteria 6782
203 Ga0068853_100039651 3300005539 Bacteria 4018
204 Ga0068853_100042470 3300005539 Bacteria 3887
205 Ga0068853_100104703 3300005539 Bacteria 2505
206 Ga0068853_100107889 3300005539 Bacteria 2469
207 Ga0068853_100110853 3300005539 Bacteria 2437
208 Ga0068853_100187386 3300005539 Bacteria 1878
209 Ga0068853_100368358 3300005539 Bacteria 1340
210 Ga0068853_100451765 3300005539 Bacteria 1209
211 Ga0070672_100001565 3300005543 Bacteria 14168
212 Ga0070672_100010480 3300005543 Bacteria 6429
213 Ga0070672_100043706 3300005543 Bacteria 3457
214 Ga0070672_100058329 3300005543 Bacteria 3033
215 Ga0070672_100140535 3300005543 Bacteria 1991
216 Ga0070672_100188929 3300005543 Bacteria 1719
217 Ga0070672_100206540 3300005543 Bacteria 1644
218 Ga0070686_100018261 3300005544 Bacteria 4112
219 Ga0070665_100000641 3300005548 Bacteria 47468
220 Ga0070665_100045444 3300005548 Bacteria 4410
221 Ga0070704_100100614 3300005549 Bacteria 2177
222 Ga0068855_100000133 3300005563 Bacteria 94906
223 Ga0068855_100000360 3300005563 Bacteria 56448
224 Ga0068855_100000943 3300005563 Bacteria 36241
225 Ga0068855_100002973 3300005563 Bacteria 20715
226 Ga0068855_100012444 3300005563 Bacteria 10277
227 Ga0068855_100033030 3300005563 Bacteria 6178
228 Ga0068855_100044845 3300005563 Bacteria 5231
229 Ga0068855_100051562 3300005563 Bacteria 4847
230 Ga0068855_100058670 3300005563 Bacteria 4506
231 Ga0068855_100062928 3300005563 Bacteria 4331
232 Ga0068855_100076304 3300005563 Bacteria 3891
233 Ga0068855_100091980 3300005563 Bacteria 3498
234 Ga0068855_100161856 3300005563 Bacteria 2539
235 Ga0068855_100243559 3300005563 Bacteria 2008
236 Ga0068855_100424043 3300005563 Bacteria 1455
237 Ga0068855_100651942 3300005563 Bacteria 1131
238 Ga0070664_100011300 3300005564 Bacteria 7242
239 Ga0070664_100041775 3300005564 Bacteria 3870
240 Ga0070664_100084099 3300005564 Bacteria 2746
241 Ga0068857_100014365 3300005577 Bacteria 6903
242 Ga0068857_100018409 3300005577 Bacteria 6129
243 Ga0068857_100036731 3300005577 Bacteria 4340
244 Ga0068857_100040938 3300005577 Bacteria 4107
245 Ga0068857_100063035 3300005577 Bacteria 3295
246 Ga0068857_100085136 3300005577 Bacteria 2825
247 Ga0068857_100119536 3300005577 Bacteria 2372
248 Ga0068857_100131593 3300005577 Bacteria 2256
249 Ga0068857_100181708 3300005577 Bacteria 1914
250 Ga0068857_100387469 3300005577 Bacteria 1299
251 Ga0068854_100048602 3300005578 Bacteria 3027
252 Ga0068854_100068418 3300005578 Bacteria 2589
253 Ga0068854_100115716 3300005578 Bacteria 2029
254 Ga0068854_100132693 3300005578 Bacteria 1903
255 Ga0068854_100172563 3300005578 Bacteria 1684
256 Ga0068854_100217848 3300005578 Bacteria 1509
257 Ga0068856_100001358 3300005614 Bacteria 25722
258 Ga0068856_100003057 3300005614 Bacteria 17112
259 Ga0068856_100010526 3300005614 Bacteria 8980
260 Ga0068856_100064411 3300005614 Bacteria 3622
261 Ga0068856_100136033 3300005614 Bacteria 2463
262 Ga0068856_100183027 3300005614 Bacteria 2109
263 Ga0068856_100248124 3300005614 Bacteria 1795
264 Ga0068856_100540272 3300005614 Bacteria 1187
265 Ga0070702_100049731 3300005615 Bacteria 2392
266 Ga0070702_100411382 3300005615 Bacteria 970
267 Ga0068852_100001842 3300005616 Bacteria 14407
268 Ga0068852_100025622 3300005616 Bacteria 4781
269 Ga0068852_100052504 3300005616 Bacteria 3504
270 Ga0068852_100054084 3300005616 Bacteria 3459
271 Ga0068852_100087742 3300005616 Bacteria 2776
272 Ga0068852_100102354 3300005616 Bacteria 2588
273 Ga0068852_100370778 3300005616 Bacteria 1402
274 Ga0068852_100755508 3300005616 Bacteria 985
275 Ga0068859_100000037 3300005617 Bacteria 165480
276 Ga0068859_100002491 3300005617 Bacteria 18742
277 Ga0068859_100040242 3300005617 Bacteria 4692
278 Ga0068859_100076436 3300005617 Bacteria 3389
279 Ga0068859_100226291 3300005617 Bacteria 1958
280 Ga0068859_100272899 3300005617 Bacteria 1783
281 Ga0068859_100573453 3300005617 Bacteria 1222
282 Ga0068864_100001656 3300005618 Bacteria 18343
283 Ga0068864_100002302 3300005618 Bacteria 15797
284 Ga0068864_100005468 3300005618 Bacteria 10419
285 Ga0068864_100078002 3300005618 Bacteria 2898
286 Ga0068864_100107079 3300005618 Bacteria 2486
287 Ga0068864_100186490 3300005618 Bacteria 1899
288 Ga0068864_100294411 3300005618 Bacteria 1518
289 Ga0068864_100332687 3300005618 Bacteria 1429
290 Ga0068866_10069033 3300005718 Bacteria 1860
291 Ga0068861_100006643 3300005719 Bacteria 7895
292 Ga0068861_100051617 3300005719 Bacteria 3122
293 Ga0068861_100121125 3300005719 Bacteria 2111
294 Ga0068861_100134738 3300005719 Bacteria 2009
295 Ga0068861_100209084 3300005719 Bacteria 1642
296 Ga0068861_100270865 3300005719 Bacteria 1458
297 Ga0068861_100466181 3300005719 Bacteria 1135
298 Ga0068861_100713820 3300005719 Bacteria 933
299 Ga0068851_10000177 3300005834 Bacteria 31928
300 Ga0068851_10001337 3300005834 Bacteria 10765
301 Ga0068851_10072821 3300005834 Bacteria 1781
302 Ga0068851_10160301 3300005834 Bacteria 1235
303 Ga0068851_10190946 3300005834 Bacteria 1139
304 Ga0068870_10021607 3300005840 Bacteria 3151
305 Ga0068870_10035377 3300005840 Bacteria 2562
306 Ga0068863_100001373 3300005841 Bacteria 24175
307 Ga0068863_100002925 3300005841 Bacteria 16912
308 Ga0068863_100088110 3300005841 Bacteria 2941
309 Ga0068863_100114726 3300005841 Bacteria 2566
310 Ga0068863_100262671 3300005841 Bacteria 1669
311 Ga0068863_100428533 3300005841 Bacteria 1296
312 Ga0068858_100004320 3300005842 Bacteria 13960
313 Ga0068858_100053182 3300005842 Bacteria 3747
314 Ga0068858_100109140 3300005842 Bacteria 2583
315 Ga0068858_100606767 3300005842 Bacteria 1062
316 Ga0068860_100000097 3300005843 Bacteria 146573
317 Ga0068860_100005547 3300005843 Bacteria 12773
318 Ga0068860_100007830 3300005843 Bacteria 10668
319 Ga0068860_100010482 3300005843 Bacteria 9162
320 Ga0068860_100018429 3300005843 Bacteria 6791
321 Ga0068860_100030843 3300005843 Bacteria 5154
322 Ga0068860_100032138 3300005843 Bacteria 5045
323 Ga0068860_100036448 3300005843 Bacteria 4712
324 Ga0068860_100081681 3300005843 Bacteria 3074
325 Ga0068860_100167592 3300005843 Bacteria 2121
326 Ga0068860_100280934 3300005843 Bacteria 1627
327 Ga0068862_100015311 3300005844 Bacteria 6369
328 Ga0068862_100032080 3300005844 Bacteria 4438
329 Ga0068862_100099860 3300005844 Bacteria 2538
330 Ga0068862_100156109 3300005844 Bacteria 2034
331 Ga0068862_100491878 3300005844 Bacteria 1163
332 Ga0081540_1010032 3300005983 Bacteria 6448
333 Ga0081539_10002233 3300005985 Bacteria 28209
334 Ga0070715_10073647 3300006163 Bacteria 1532
335 Ga0075366_10006763 3300006195 Bacteria 6298
336 Ga0075366_10031189 3300006195 Bacteria 3136
337 Ga0075366_10034049 3300006195 Bacteria 3001
338 Ga0075366_10200750 3300006195 Bacteria 1213
339 Ga0097621_100003401 3300006237 Bacteria 10956
340 Ga0097621_100036790 3300006237 Bacteria 3917
341 Ga0097621_100046779 3300006237 Bacteria 3503
342 Ga0097621_100049443 3300006237 Bacteria 3415
343 Ga0097621_100084088 3300006237 Bacteria 2652
344 Ga0097621_100096686 3300006237 Bacteria 2478
345 Ga0097621_100371519 3300006237 Bacteria 1276
346 Ga0075370_10019967 3300006353 Bacteria 3653
347 Ga0075370_10186709 3300006353 Bacteria 1221
348 Ga0068871_100000955 3300006358 Bacteria 19316
349 Ga0068871_100002544 3300006358 Bacteria 12445
350 Ga0068871_100076419 3300006358 Bacteria 2766
351 Ga0068871_100108578 3300006358 Bacteria 2332
352 Ga0068871_100249205 3300006358 Bacteria 1546
353 Ga0075428_100044984 3300006844 Bacteria 4851
354 Ga0075428_100140238 3300006844 Bacteria 2628
355 Ga0075428_100285496 3300006844 Bacteria 1776
356 Ga0075430_100135661 3300006846 Bacteria 2051
357 Ga0075431_100019798 3300006847 Bacteria 6870
358 Ga0075431_100034168 3300006847 Bacteria 5240
359 Ga0075429_100003790 3300006880 Bacteria 12900
360 Ga0075429_100020740 3300006880 Bacteria 5704
361 Ga0075429_100060787 3300006880 Bacteria 3290
362 Ga0068865_100001794 3300006881 Bacteria 12594
363 Ga0068865_100038915 3300006881 Bacteria 3222
364 Ga0068865_100114198 3300006881 Bacteria 1997
365 Ga0068865_100311402 3300006881 Bacteria 1263
366 Ga0097620_100000037 3300006931 Bacteria 165480
367 Ga0097620_100000536 3300006931 Bacteria 37574
368 Ga0097620_100002491 3300006931 Bacteria 18742
369 Ga0097620_100040243 3300006931 Bacteria 4692
370 Ga0097620_100076429 3300006931 Bacteria 3389
371 Ga0097620_100226288 3300006931 Bacteria 1958
372 Ga0097620_100272888 3300006931 Bacteria 1783
373 Ga0097620_100573436 3300006931 Bacteria 1222
374 Ga0105240_10000398 3300009093 Bacteria 81045
375 Ga0105240_10011002 3300009093 Bacteria 12667
376 Ga0105240_10011307 3300009093 Bacteria 12434
377 Ga0105240_10023972 3300009093 Bacteria 8060
378 Ga0105240_10041987 3300009093 Bacteria 5831
379 Ga0105240_10078219 3300009093 Bacteria 4073
380 Ga0105240_10088645 3300009093 Bacteria 3785
381 Ga0105240_10100052 3300009093 Bacteria 3528
382 Ga0105240_10167583 3300009093 Bacteria 2604
383 Ga0105240_10173346 3300009093 Bacteria 2552
384 Ga0105240_10182600 3300009093 Bacteria 2474
385 Ga0105240_10291130 3300009093 Bacteria 1872
386 Ga0105240_10331805 3300009093 Bacteria 1730
387 Ga0105240_10350445 3300009093 Bacteria 1675
388 Ga0105240_10404513 3300009093 Bacteria 1537
389 Ga0105240_10976799 3300009093 Bacteria 907
390 Ga0111539_10013971 3300009094 Bacteria 10037
391 Ga0111539_10014550 3300009094 Bacteria 9824
392 Ga0111539_10044551 3300009094 Bacteria 5315
393 Ga0111539_10620757 3300009094 Bacteria 1259
394 Ga0105245_10068029 3300009098 Bacteria 3226
395 Ga0105247_10002304 3300009101 Bacteria 13045
396 Ga0105247_10015344 3300009101 Bacteria 4589
397 Ga0114129_10006463 3300009147 Bacteria 16621
398 Ga0114129_10303837 3300009147 Bacteria 2126
399 Ga0105243_10000009 3300009148 Bacteria 354419
400 Ga0105243_10077196 3300009148 Bacteria 2708
401 Ga0105241_10007590 3300009174 Bacteria 7975
402 Ga0105241_10009907 3300009174 Bacteria 7004
403 Ga0105241_10014100 3300009174 Bacteria 5856
404 Ga0105241_10037723 3300009174 Bacteria 3640
405 Ga0105241_10206141 3300009174 Bacteria 1645
406 Ga0105241_10617977 3300009174 Bacteria 981
407 Ga0105241_10682033 3300009174 Bacteria 936
408 Ga0105242_10045717 3300009176 Bacteria 3549
409 Ga0105242_10055628 3300009176 Bacteria 3237
410 Ga0105242_10102158 3300009176 Bacteria 2431
411 Ga0105242_10134109 3300009176 Bacteria 2141
412 Ga0105242_10184821 3300009176 Bacteria 1841
413 Ga0105242_10200555 3300009176 Bacteria 1772
414 Ga0105242_10521824 3300009176 Bacteria 1133
415 Ga0105248_10034629 3300009177 Bacteria 5649
416 Ga0105248_10052937 3300009177 Bacteria 4555
417 Ga0105248_10464039 3300009177 Bacteria 1427
418 Ga0105237_10001588 3300009545 Bacteria 29579
419 Ga0105237_10001799 3300009545 Bacteria 27692
420 Ga0105237_10011322 3300009545 Bacteria 9438
421 Ga0105237_10014365 3300009545 Bacteria 8285
422 Ga0105237_10022954 3300009545 Bacteria 6399
423 Ga0105237_10030759 3300009545 Bacteria 5450
424 Ga0105237_10035876 3300009545 Bacteria 5016
425 Ga0105237_10069245 3300009545 Bacteria 3524
426 Ga0105237_10268972 3300009545 Bacteria 1707
427 Ga0105237_10331462 3300009545 Bacteria 1526
428 Ga0105237_10738669 3300009545 Bacteria 991
429 Ga0105238_10170225 3300009551 Bacteria 2154
430 Ga0105249_10000806 3300009553 Bacteria 28220
431 Ga0105249_10001080 3300009553 Bacteria 24205
432 Ga0105249_10005412 3300009553 Bacteria 11022
433 Ga0105249_10025715 3300009553 Bacteria 5302
434 Ga0105249_10029956 3300009553 Bacteria 4916
435 Ga0105249_10075766 3300009553 Bacteria 3116
436 Ga0105249_10077951 3300009553 Bacteria 3074
437 Ga0105249_10411381 3300009553 Bacteria 1385
438 Ga0105239_10000431 3300010375 Bacteria 61098
439 Ga0105239_10000436 3300010375 Bacteria 61031
440 Ga0105239_10004090 3300010375 Bacteria 17535
441 Ga0105239_10007869 3300010375 Bacteria 12183
442 Ga0105239_10033863 3300010375 Bacteria 5608
443 Ga0105239_10067944 3300010375 Bacteria 3916
444 Ga0105239_10122693 3300010375 Bacteria 2887
445 Ga0105239_10148001 3300010375 Bacteria 2620
446 Ga0105239_10188341 3300010375 Bacteria 2310
447 Ga0105239_10198084 3300010375 Bacteria 2250
448 Ga0105239_10205263 3300010375 Bacteria 2208
449 Ga0105239_10240840 3300010375 Bacteria 2030
450 Ga0105239_10241163 3300010375 Bacteria 2029
451 Ga0105239_10246419 3300010375 Bacteria 2006
452 Ga0105239_10468937 3300010375 Bacteria 1430
453 Ga0105246_10021096 3300011119 Bacteria 4187
454 Ga0105246_10124550 3300011119 Bacteria 1915
455 Ga0105246_10158325 3300011119 Bacteria 1723
456 Ga0157373_10000129 3300013100 Bacteria 59252
457 Ga0157373_10008302 3300013100 Bacteria 7716
458 Ga0157373_10018478 3300013100 Bacteria 5076
459 Ga0157373_10025943 3300013100 Bacteria 4235
460 Ga0157373_10041402 3300013100 Bacteria 3295
461 Ga0157373_10123108 3300013100 Bacteria 1823
462 Ga0157373_10175037 3300013100 Bacteria 1510
463 Ga0157373_10180217 3300013100 Bacteria 1487
464 Ga0157373_10318646 3300013100 Bacteria 1106
465 Ga0157373_10344172 3300013100 Bacteria 1063
466 Ga0157371_10003367 3300013102 Bacteria 14536
467 Ga0157371_10015121 3300013102 Bacteria 5800
468 Ga0157371_10016670 3300013102 Bacteria 5476
469 Ga0157371_10021771 3300013102 Bacteria 4703
470 Ga0157371_10023444 3300013102 Bacteria 4513
471 Ga0157371_10024281 3300013102 Bacteria 4429
472 Ga0157371_10032716 3300013102 Bacteria 3740
473 Ga0157371_10036963 3300013102 Bacteria 3497
474 Ga0157371_10043957 3300013102 Bacteria 3182
475 Ga0157371_10054932 3300013102 Bacteria 2827
476 Ga0157371_10078103 3300013102 Bacteria 2344
477 Ga0157371_10102478 3300013102 Bacteria 2031
478 Ga0157371_10279688 3300013102 Bacteria 1205
479 Ga0157370_10000926 3300013104 Bacteria 37246
480 Ga0157370_10006378 3300013104 Bacteria 13019
481 Ga0157370_10009487 3300013104 Bacteria 10389
482 Ga0157370_10011345 3300013104 Bacteria 9332
483 Ga0157370_10017050 3300013104 Bacteria 7340
484 Ga0157370_10022725 3300013104 Bacteria 6240
485 Ga0157370_10025354 3300013104 Bacteria 5869
486 Ga0157370_10047165 3300013104 Bacteria 4130
487 Ga0157370_10070629 3300013104 Bacteria 3296
488 Ga0157370_10113930 3300013104 Bacteria 2526
489 Ga0157370_10119429 3300013104 Bacteria 2461
490 Ga0157370_10259572 3300013104 Bacteria 1606
491 Ga0157369_10004050 3300013105 Bacteria 17366
492 Ga0157369_10007412 3300013105 Bacteria 12631
493 Ga0157369_10012941 3300013105 Bacteria 9454
494 Ga0157369_10019086 3300013105 Bacteria 7676
495 Ga0157369_10022720 3300013105 Bacteria 6995
496 Ga0157369_10038761 3300013105 Bacteria 5210
497 Ga0157369_10063647 3300013105 Bacteria 3973
498 Ga0157369_10083535 3300013105 Bacteria 3415
499 Ga0157369_10100758 3300013105 Bacteria 3079
500 Ga0157369_10115086 3300013105 Bacteria 2856
501 Ga0157369_10184333 3300013105 Bacteria 2195
502 Ga0157369_10206180 3300013105 Bacteria 2062
503 Ga0157369_10310068 3300013105 Bacteria 1641
504 Ga0157369_10597173 3300013105 Bacteria 1140
505 Ga0157374_10000001 3300013296 Bacteria 1077351
506 Ga0157374_10000500 3300013296 Bacteria 35513
507 Ga0157374_10008968 3300013296 Bacteria 8573
508 Ga0157374_10009009 3300013296 Bacteria 8561
509 Ga0157374_10071962 3300013296 Bacteria 3261
510 Ga0157374_10126640 3300013296 Bacteria 2469
511 Ga0157374_10173144 3300013296 Bacteria 2106
512 Ga0157374_10263632 3300013296 Bacteria 1698
513 Ga0157374_10497665 3300013296 Bacteria 1223
514 Ga0157374_10589365 3300013296 Bacteria 1121
515 Ga0157374_10704437 3300013296 Bacteria 1023
516 Ga0157378_10006065 3300013297 Bacteria 10591
517 Ga0157378_10008184 3300013297 Bacteria 9121
518 Ga0157378_10012000 3300013297 Bacteria 7586
519 Ga0157378_10021595 3300013297 Bacteria 5661
520 Ga0157378_10025313 3300013297 Bacteria 5226
521 Ga0157378_10041061 3300013297 Bacteria 4104
522 Ga0157378_10103113 3300013297 Bacteria 2606
523 Ga0157378_10152599 3300013297 Bacteria 2153
524 Ga0157378_10191806 3300013297 Bacteria 1928
525 Ga0157378_10389252 3300013297 Bacteria 1371
526 Ga0163162_10001595 3300013306 Bacteria 21212
527 Ga0163162_10006110 3300013306 Bacteria 11654
528 Ga0163162_10008143 3300013306 Bacteria 10230
529 Ga0163162_10012931 3300013306 Bacteria 8148
530 Ga0163162_10024199 3300013306 Bacteria 5993
531 Ga0163162_10025579 3300013306 Bacteria 5834
532 Ga0163162_10096425 3300013306 Bacteria 3046
533 Ga0163162_10106731 3300013306 Bacteria 2896
534 Ga0163162_10115627 3300013306 Bacteria 2783
535 Ga0163162_10163494 3300013306 Bacteria 2349
536 Ga0163162_10280429 3300013306 Bacteria 1798
537 Ga0163162_10294393 3300013306 Bacteria 1755
538 Ga0163162_10299937 3300013306 Bacteria 1739
539 Ga0163162_10300778 3300013306 Bacteria 1736
540 Ga0163162_10391437 3300013306 Bacteria 1523
541 Ga0163162_10443296 3300013306 Bacteria 1431
542 Ga0163162_10465402 3300013306 Bacteria 1396
543 Ga0157372_10000030 3300013307 Bacteria 179925
544 Ga0157372_10000332 3300013307 Bacteria 51907
545 Ga0157372_10003109 3300013307 Bacteria 17892
546 Ga0157372_10003430 3300013307 Bacteria 17111
547 Ga0157372_10016323 3300013307 Bacteria 7968
548 Ga0157372_10016644 3300013307 Bacteria 7892
549 Ga0157372_10018713 3300013307 Bacteria 7451
550 Ga0157372_10020775 3300013307 Bacteria 7090
551 Ga0157372_10029769 3300013307 Bacteria 5966
552 Ga0157372_10051126 3300013307 Bacteria 4598
553 Ga0157372_10210537 3300013307 Bacteria 2253
554 Ga0157372_10214740 3300013307 Bacteria 2229
555 Ga0157372_10239188 3300013307 Bacteria 2106
556 Ga0157372_10247490 3300013307 Bacteria 2069
557 Ga0157372_10252119 3300013307 Bacteria 2049
558 Ga0157372_10377770 3300013307 Bacteria 1651
559 Ga0157372_10430482 3300013307 Bacteria 1538
560 Ga0157372_10552695 3300013307 Bacteria 1342
561 Ga0157372_10558901 3300013307 Bacteria 1334
562 Ga0157372_10589587 3300013307 Bacteria 1296
563 Ga0157372_10948156 3300013307 Bacteria 997
564 Ga0157375_10001463 3300013308 Bacteria 20315
565 Ga0157375_10005027 3300013308 Bacteria 11484
566 Ga0157375_10010453 3300013308 Bacteria 8166
567 Ga0157375_10012841 3300013308 Bacteria 7438
568 Ga0157375_10082979 3300013308 Bacteria 3249
569 Ga0157375_10090738 3300013308 Bacteria 3115
570 Ga0157375_10094808 3300013308 Bacteria 3054
571 Ga0157375_10101632 3300013308 Bacteria 2958
572 Ga0157375_10128521 3300013308 Bacteria 2652
573 Ga0157375_10153729 3300013308 Bacteria 2438
574 Ga0157375_10208620 3300013308 Bacteria 2110
575 Ga0157375_10253294 3300013308 Bacteria 1921
576 Ga0157375_10603302 3300013308 Bacteria 1257
577 Ga0157375_10827917 3300013308 Bacteria 1073
578 Ga0163163_10001501 3300014325 Bacteria 19759
579 Ga0163163_10036393 3300014325 Bacteria 4781
580 Ga0163163_10054019 3300014325 Bacteria 3967
581 Ga0163163_10089831 3300014325 Bacteria 3085
582 Ga0163163_10092201 3300014325 Bacteria 3044
583 Ga0163163_10152284 3300014325 Bacteria 2356
584 Ga0163163_10300122 3300014325 Bacteria 1659
585 Ga0157380_10008895 3300014326 Bacteria 7174
586 Ga0157380_10030118 3300014326 Bacteria 4154
587 Ga0157380_10065873 3300014326 Bacteria 2913
588 Ga0157380_10071748 3300014326 Bacteria 2802
589 Ga0157380_10113108 3300014326 Bacteria 2285
590 Ga0157377_10021210 3300014745 Bacteria 3415
591 Ga0157377_10069334 3300014745 Bacteria 2034
592 Ga0157379_10000845 3300014968 Bacteria 24814
593 Ga0157379_10008284 3300014968 Bacteria 9034
594 Ga0157379_10036538 3300014968 Bacteria 4379
595 Ga0157379_10495784 3300014968 Bacteria 1132
596 Ga0157376_10008523 3300014969 Bacteria 7404
597 Ga0157376_10022078 3300014969 Bacteria 4953
598 Ga0157376_10040602 3300014969 Bacteria 3804
599 Ga0157376_10043577 3300014969 Bacteria 3683
600 Ga0157376_10083403 3300014969 Bacteria 2749
601 Ga0157376_10105537 3300014969 Bacteria 2471
602 Ga0157376_10135197 3300014969 Bacteria 2205
603 Ga0157376_10250506 3300014969 Bacteria 1654
604 Ga0157376_10516013 3300014969 Bacteria 1177
605 Ga0182005_1000147 3300015265 Bacteria 49428
606 Ga0163161_10001357 3300017792 Bacteria 18206
607 Ga0163161_10012104 3300017792 Bacteria 5985
608 Ga0163161_10015767 3300017792 Bacteria 5269
609 Ga0163161_10076648 3300017792 Bacteria 2454
610 Ga0163161_10146216 3300017792 Bacteria 1793
611 Ga0197907_10169535 3300020069 Bacteria 2472
612 Ga0206356_10575773 3300020070 Bacteria 1651
613 Ga0206351_10170033 3300020077 Bacteria 10900
614 Ga0206351_10512829 3300020077 Bacteria 15076
615 Ga0206352_10703535 3300020078 Bacteria 2663
616 Ga0206352_10938790 3300020078 Bacteria 1089
617 Ga0206350_10057460 3300020080 Bacteria 6432
618 Ga0206350_10752456 3300020080 Bacteria 3060
619 Ga0206354_10778573 3300020081 Bacteria 1949
620 Ga0206353_10311699 3300020082 Bacteria 1482
621 Ga0154015_1495562 3300020610 Bacteria 11881
622 Ga0213872_10013117 3300021361 Bacteria 3885
623 Ga0213876_10007626 3300021384 Bacteria 5875
624 Ga0224712_10003582 3300022467 Bacteria 4061
625 Ga0224712_10014571 3300022467 Bacteria 2536
626 Ga0209436_100232 3300025208 Bacteria 25536
627 Ga0209436_104962 3300025208 Bacteria 3181
628 Ga0207427_100025 3300025231 Bacteria 433726
629 Ga0209437_100010 3300025233 Bacteria 838447
630 Ga0209437_100135 3300025233 Bacteria 176455
631 Ga0209646_1000002 3300025246 Bacteria 1425781
632 Ga0209646_1001434 3300025246 Bacteria 6411
633 Ga0209646_1004416 3300025246 Bacteria 2566
634 Ga0209026_1000299 3300025250 Bacteria 54147
635 Ga0209026_1000610 3300025250 Bacteria 22917
636 Ga0209026_1004981 3300025250 Bacteria 3723
637 Ga0209148_1000090 3300025254 Bacteria 250982
638 Ga0209129_1004506 3300025258 Bacteria 5402
639 Ga0209233_1000017 3300025261 Bacteria 898076
640 Ga0209233_1001329 3300025261 Bacteria 9868
641 Ga0209673_1000034 3300025273 Bacteria 328788
642 Ga0209130_1001055 3300025284 Bacteria 20897
643 Ga0209564_1014913 3300025295 Bacteria 3198
644 Ga0209758_1001438 3300025297 Bacteria 28062
645 Ga0209050_1000207 3300025298 Bacteria 131328
646 Ga0207426_1000105 3300025302 Bacteria 247269
647 Ga0207426_1000603 3300025302 Bacteria 46872
648 Ga0207426_1000813 3300025302 Bacteria 33506
649 Ga0207426_1001314 3300025302 Bacteria 21207
650 Ga0209257_1000001 3300025304 Bacteria 2274655
651 Ga0209257_1000007 3300025304 Bacteria 1564415
652 Ga0209257_1001824 3300025304 Bacteria 23309
653 Ga0207697_10008960 3300025315 Bacteria 4344
654 Ga0207697_10045796 3300025315 Bacteria 1801
655 Ga0207656_10000055 3300025321 Bacteria 44377
656 Ga0207656_10010030 3300025321 Bacteria 3532
657 Ga0207656_10102743 3300025321 Bacteria 1312
658 Ga0207656_10171442 3300025321 Bacteria 1038
659 Ga0207682_10003346 3300025893 Bacteria 6992
660 Ga0207682_10006454 3300025893 Bacteria 4723
661 Ga0207642_10027020 3300025899 Bacteria 2344
662 Ga0207642_10049589 3300025899 Bacteria 1888
663 Ga0207710_10002332 3300025900 Bacteria 8872
664 Ga0207710_10020859 3300025900 Bacteria 2804
665 Ga0207688_10010099 3300025901 Bacteria 5135
666 Ga0207680_10045258 3300025903 Bacteria 2593
667 Ga0207680_10061291 3300025903 Bacteria 2294
668 Ga0207680_10177908 3300025903 Bacteria 1437
669 Ga0207647_10000110 3300025904 Bacteria 62980
670 Ga0207647_10000171 3300025904 Bacteria 51875
671 Ga0207647_10009094 3300025904 Bacteria 7073
672 Ga0207647_10020448 3300025904 Bacteria 4439
673 Ga0207647_10025805 3300025904 Bacteria 3853
674 Ga0207645_10002136 3300025907 Bacteria 15798
675 Ga0207645_10025677 3300025907 Bacteria 3811
676 Ga0207645_10044737 3300025907 Bacteria 2832
677 Ga0207645_10163618 3300025907 Bacteria 1456
678 Ga0207643_10001724 3300025908 Bacteria 12262
679 Ga0207643_10006929 3300025908 Bacteria 6076
680 Ga0207643_10152178 3300025908 Bacteria 1387
681 Ga0207705_10000108 3300025909 Bacteria 93501
682 Ga0207705_10011466 3300025909 Bacteria 6413
683 Ga0207705_10018682 3300025909 Bacteria 4959
684 Ga0207705_10024219 3300025909 Bacteria 4332
685 Ga0207705_10052283 3300025909 Bacteria 2941
686 Ga0207705_10088880 3300025909 Bacteria 2260
687 Ga0207705_10208863 3300025909 Bacteria 1481
688 Ga0207705_10257291 3300025909 Bacteria 1332
689 Ga0207654_10000881 3300025911 Bacteria 16661
690 Ga0207654_10002705 3300025911 Bacteria 8996
691 Ga0207654_10036156 3300025911 Bacteria 2757
692 Ga0207654_10080916 3300025911 Bacteria 1955
693 Ga0207707_10011329 3300025912 Bacteria 7764
694 Ga0207707_10075844 3300025912 Bacteria 2934
695 Ga0207707_10260837 3300025912 Bacteria 1504
696 Ga0207695_10000053 3300025913 Bacteria 396740
697 Ga0207695_10000064 3300025913 Bacteria 346010
698 Ga0207695_10000076 3300025913 Bacteria 307969
699 Ga0207695_10000084 3300025913 Bacteria 282392
700 Ga0207695_10000090 3300025913 Bacteria 272143
701 Ga0207695_10004647 3300025913 Bacteria 18602
702 Ga0207695_10015473 3300025913 Bacteria 8978
703 Ga0207695_10026373 3300025913 Bacteria 6486
704 Ga0207695_10033343 3300025913 Bacteria 5618
705 Ga0207695_10081967 3300025913 Bacteria 3263
706 Ga0207695_10084771 3300025913 Bacteria 3198
707 Ga0207695_10273350 3300025913 Bacteria 1585
708 Ga0207671_10000149 3300025914 Bacteria 107722
709 Ga0207671_10003750 3300025914 Bacteria 14958
710 Ga0207671_10004543 3300025914 Bacteria 13186
711 Ga0207671_10007320 3300025914 Bacteria 9585
712 Ga0207671_10010466 3300025914 Bacteria 7650
713 Ga0207671_10032778 3300025914 Bacteria 3865
714 Ga0207671_10037137 3300025914 Bacteria 3613
715 Ga0207671_10040157 3300025914 Bacteria 3463
716 Ga0207671_10060090 3300025914 Bacteria 2820
717 Ga0207671_10069197 3300025914 Bacteria 2631
718 Ga0207671_10278244 3300025914 Bacteria 1319
719 Ga0207660_10006449 3300025917 Bacteria 7609
720 Ga0207660_10024417 3300025917 Bacteria 4093
721 Ga0207660_10048131 3300025917 Bacteria 3017
722 Ga0207662_10027651 3300025918 Bacteria 3274
723 Ga0207662_10092496 3300025918 Bacteria 1862
724 Ga0207657_10009979 3300025919 Bacteria 9505
725 Ga0207657_10036828 3300025919 Bacteria 4376
726 Ga0207657_10041700 3300025919 Bacteria 4056
727 Ga0207657_10049438 3300025919 Bacteria 3664
728 Ga0207657_10050001 3300025919 Bacteria 3640
729 Ga0207657_10062662 3300025919 Bacteria 3183
730 Ga0207657_10292539 3300025919 Bacteria 1291
731 Ga0207649_10005479 3300025920 Bacteria 6870
732 Ga0207649_10188195 3300025920 Bacteria 1450
733 Ga0207652_10000064 3300025921 Bacteria 111997
734 Ga0207652_10000387 3300025921 Bacteria 45946
735 Ga0207652_10002830 3300025921 Bacteria 14557
736 Ga0207652_10041607 3300025921 Bacteria 3907
737 Ga0207652_10108992 3300025921 Bacteria 2454
738 Ga0207652_10250009 3300025921 Bacteria 1599
739 Ga0207652_10298183 3300025921 Bacteria 1455
740 Ga0207652_10441296 3300025921 Bacteria 1173
741 Ga0207681_10015241 3300025923 Bacteria 4793
742 Ga0207681_10073899 3300025923 Bacteria 2386
743 Ga0207681_10353840 3300025923 Bacteria 1176
744 Ga0207694_10017481 3300025924 Bacteria 5419
745 Ga0207694_10253517 3300025924 Bacteria 1440
746 Ga0207650_10014881 3300025925 Bacteria 5413
747 Ga0207650_10066694 3300025925 Bacteria 2699
748 Ga0207650_10074981 3300025925 Bacteria 2552
749 Ga0207650_10077520 3300025925 Bacteria 2513
750 Ga0207650_10093786 3300025925 Bacteria 2298
751 Ga0207650_10120271 3300025925 Bacteria 2044
752 Ga0207650_10167486 3300025925 Bacteria 1744
753 Ga0207650_10206413 3300025925 Bacteria 1576
754 Ga0207650_10492599 3300025925 Bacteria 1024
755 Ga0207659_10009764 3300025926 Bacteria 6003
756 Ga0207659_10033056 3300025926 Bacteria 3556
757 Ga0207659_10101095 3300025926 Bacteria 2174
758 Ga0207659_10119153 3300025926 Bacteria 2020
759 Ga0207659_10172238 3300025926 Bacteria 1708
760 Ga0207659_10192518 3300025926 Bacteria 1624
761 Ga0207659_10327100 3300025926 Bacteria 1266
762 Ga0207659_10420269 3300025926 Bacteria 1121
763 Ga0207644_10012415 3300025931 Bacteria 5658
764 Ga0207644_10021869 3300025931 Bacteria 4361
765 Ga0207644_10024620 3300025931 Bacteria 4134
766 Ga0207644_10059737 3300025931 Bacteria 2758
767 Ga0207644_10140731 3300025931 Bacteria 1858
768 Ga0207644_10251118 3300025931 Bacteria 1411
769 Ga0207690_10002170 3300025932 Bacteria 11970
770 Ga0207690_10004744 3300025932 Bacteria 8027
771 Ga0207690_10012751 3300025932 Bacteria 5037
772 Ga0207690_10020857 3300025932 Bacteria 4055
773 Ga0207690_10024446 3300025932 Bacteria 3784
774 Ga0207690_10057621 3300025932 Bacteria 2625
775 Ga0207706_10006478 3300025933 Bacteria 10869
776 Ga0207706_10009371 3300025933 Bacteria 8991
777 Ga0207706_10029582 3300025933 Bacteria 4889
778 Ga0207706_10037951 3300025933 Bacteria 4275
779 Ga0207706_10068145 3300025933 Bacteria 3131
780 Ga0207686_10111562 3300025934 Bacteria 1845
781 Ga0207686_10127335 3300025934 Bacteria 1742
782 Ga0207686_10231570 3300025934 Bacteria 1340
783 Ga0207709_10000026 3300025935 Bacteria 354467
784 Ga0207670_10014554 3300025936 Bacteria 4674
785 Ga0207670_10486727 3300025936 Bacteria 1000
786 Ga0207670_10529657 3300025936 Bacteria 960
787 Ga0207669_10005569 3300025937 Bacteria 5668
788 Ga0207669_10235181 3300025937 Bacteria 1355
789 Ga0207669_10344098 3300025937 Bacteria 1149
790 Ga0207704_10003038 3300025938 Bacteria 7581
791 Ga0207704_10039066 3300025938 Bacteria 2759
792 Ga0207665_10026619 3300025939 Bacteria 3818
793 Ga0207691_10000001 3300025940 Bacteria 220829
794 Ga0207691_10002741 3300025940 Bacteria 17182
795 Ga0207691_10019043 3300025940 Bacteria 6500
796 Ga0207691_10027644 3300025940 Bacteria 5317
797 Ga0207691_10075279 3300025940 Bacteria 3044
798 Ga0207691_10176679 3300025940 Bacteria 1867
799 Ga0207711_10092009 3300025941 Bacteria 2669
800 Ga0207711_10182599 3300025941 Bacteria 1908
801 Ga0207711_10191822 3300025941 Bacteria 1862
802 Ga0207689_10005396 3300025942 Bacteria 11441
803 Ga0207689_10010127 3300025942 Bacteria 8127
804 Ga0207689_10014249 3300025942 Bacteria 6765
805 Ga0207689_10018050 3300025942 Bacteria 5958
806 Ga0207689_10045231 3300025942 Bacteria 3641
807 Ga0207689_10075403 3300025942 Bacteria 2772
808 Ga0207689_10088584 3300025942 Bacteria 2542
809 Ga0207689_10101705 3300025942 Bacteria 2361
810 Ga0207689_10182503 3300025942 Bacteria 1730
811 Ga0207689_10195708 3300025942 Bacteria 1668
812 Ga0207689_10347595 3300025942 Bacteria 1233
813 Ga0207689_10472712 3300025942 Bacteria 1049
814 Ga0207661_10005126 3300025944 Bacteria 9200
815 Ga0207661_10008212 3300025944 Bacteria 7452
816 Ga0207661_10009193 3300025944 Bacteria 7083
817 Ga0207661_10019703 3300025944 Bacteria 5035
818 Ga0207661_10031577 3300025944 Bacteria 4094
819 Ga0207661_10178861 3300025944 Bacteria 1851
820 Ga0207679_10000875 3300025945 Bacteria 19210
821 Ga0207679_10050461 3300025945 Bacteria 3040
822 Ga0207679_10156469 3300025945 Bacteria 1861
823 Ga0207679_10214537 3300025945 Bacteria 1616
824 Ga0207679_10226523 3300025945 Bacteria 1576
825 Ga0207679_10340064 3300025945 Bacteria 1305
826 Ga0207667_10000430 3300025949 Bacteria 56466
827 Ga0207667_10000453 3300025949 Bacteria 54929
828 Ga0207667_10001484 3300025949 Bacteria 29439
829 Ga0207667_10003602 3300025949 Bacteria 19111
830 Ga0207667_10005923 3300025949 Bacteria 14885
831 Ga0207667_10009521 3300025949 Bacteria 11431
832 Ga0207667_10059200 3300025949 Bacteria 4013
833 Ga0207667_10073069 3300025949 Bacteria 3564
834 Ga0207667_10087826 3300025949 Bacteria 3216
835 Ga0207667_10095966 3300025949 Bacteria 3060
836 Ga0207667_10182531 3300025949 Bacteria 2154
837 Ga0207667_10211301 3300025949 Bacteria 1989
838 Ga0207667_10329536 3300025949 Bacteria 1559
839 Ga0207667_10387114 3300025949 Bacteria 1424
840 Ga0207667_10741997 3300025949 Bacteria 982
841 Ga0207651_10053397 3300025960 Bacteria 2762
842 Ga0207651_10087831 3300025960 Bacteria 2264
843 Ga0207651_10621071 3300025960 Bacteria 947
844 Ga0207712_10014683 3300025961 Bacteria 5044
845 Ga0207712_10016131 3300025961 Bacteria 4830
846 Ga0207712_10016968 3300025961 Bacteria 4723
847 Ga0207712_10026663 3300025961 Bacteria 3853
848 Ga0207712_10082897 3300025961 Bacteria 2339
849 Ga0207712_10224168 3300025961 Bacteria 1505
850 Ga0207712_10235773 3300025961 Bacteria 1471
851 Ga0207712_10473219 3300025961 Bacteria 1066
852 Ga0207668_10000869 3300025972 Bacteria 18234
853 Ga0207668_10015084 3300025972 Bacteria 4796
854 Ga0207668_10067188 3300025972 Bacteria 2544
855 Ga0207668_10074158 3300025972 Bacteria 2442
856 Ga0207668_10074644 3300025972 Bacteria 2435
857 Ga0207668_10149486 3300025972 Bacteria 1806
858 Ga0207668_10215357 3300025972 Bacteria 1539
859 Ga0207668_10422993 3300025972 Bacteria 1131
860 Ga0207640_10016977 3300025981 Bacteria 4249
861 Ga0207640_10020295 3300025981 Bacteria 3944
862 Ga0207640_10025047 3300025981 Bacteria 3607
863 Ga0207640_10031753 3300025981 Bacteria 3268
864 Ga0207640_10074633 3300025981 Bacteria 2296
865 Ga0207640_10219281 3300025981 Bacteria 1455
866 Ga0207640_10240337 3300025981 Bacteria 1399
867 Ga0207658_10002877 3300025986 Bacteria 12335
868 Ga0207658_10012999 3300025986 Bacteria 5685
869 Ga0207658_10051578 3300025986 Bacteria 3032
870 Ga0207677_10067295 3300026023 Bacteria 2509
871 Ga0207677_10102638 3300026023 Bacteria 2109
872 Ga0207677_10177581 3300026023 Bacteria 1672
873 Ga0207677_10212621 3300026023 Bacteria 1545
874 Ga0207703_10004088 3300026035 Bacteria 12037
875 Ga0207703_10176996 3300026035 Bacteria 1880
876 Ga0207639_10003633 3300026041 Bacteria 10364
877 Ga0207639_10009134 3300026041 Bacteria 6832
878 Ga0207639_10022533 3300026041 Bacteria 4538
879 Ga0207639_10060496 3300026041 Bacteria 2922
880 Ga0207639_10138059 3300026041 Bacteria 2028
881 Ga0207639_10268603 3300026041 Bacteria 1495
882 Ga0207639_10568927 3300026041 Bacteria 1042
883 Ga0207678_10137308 3300026067 Bacteria 2086
884 Ga0207678_10154438 3300026067 Bacteria 1960
885 Ga0207678_10172372 3300026067 Bacteria 1847
886 Ga0207708_10058905 3300026075 Bacteria 2931
887 Ga0207708_10119848 3300026075 Bacteria 2050
888 Ga0207702_10001407 3300026078 Bacteria 24021
889 Ga0207702_10056726 3300026078 Bacteria 3326
890 Ga0207702_10085669 3300026078 Bacteria 2746
891 Ga0207702_10115561 3300026078 Bacteria 2393
892 Ga0207702_10209740 3300026078 Bacteria 1810
893 Ga0207702_10263405 3300026078 Bacteria 1624
894 Ga0207641_10000121 3300026088 Bacteria 114943
895 Ga0207641_10005564 3300026088 Bacteria 10740
896 Ga0207641_10025754 3300026088 Bacteria 4850
897 Ga0207641_10029136 3300026088 Bacteria 4565
898 Ga0207641_10030020 3300026088 Bacteria 4500
899 Ga0207641_10091863 3300026088 Bacteria 2657
900 Ga0207641_10343578 3300026088 Bacteria 1421
901 Ga0207648_10003053 3300026089 Bacteria 17701
902 Ga0207648_10009109 3300026089 Bacteria 9541
903 Ga0207648_10014701 3300026089 Bacteria 7223
904 Ga0207648_10027181 3300026089 Bacteria 5081
905 Ga0207648_10028462 3300026089 Bacteria 4954
906 Ga0207648_10148136 3300026089 Bacteria 2071
907 Ga0207648_10176788 3300026089 Bacteria 1888
908 Ga0207648_10191611 3300026089 Bacteria 1812
909 Ga0207648_10340042 3300026089 Bacteria 1351
910 Ga0207676_10003342 3300026095 Bacteria 11375
911 Ga0207676_10003799 3300026095 Bacteria 10679
912 Ga0207676_10015259 3300026095 Bacteria 5540
913 Ga0207676_10067110 3300026095 Bacteria 2864
914 Ga0207676_10166766 3300026095 Bacteria 1914
915 Ga0207676_10256460 3300026095 Bacteria 1577
916 Ga0207676_10260843 3300026095 Bacteria 1565
917 Ga0207676_10278588 3300026095 Bacteria 1517
918 Ga0207674_10009949 3300026116 Bacteria 10820
919 Ga0207674_10020554 3300026116 Bacteria 7129
920 Ga0207674_10022667 3300026116 Bacteria 6740
921 Ga0207674_10025546 3300026116 Bacteria 6296
922 Ga0207674_10047480 3300026116 Bacteria 4400
923 Ga0207674_10070646 3300026116 Bacteria 3510
924 Ga0207674_10164835 3300026116 Bacteria 2170
925 Ga0207674_10168628 3300026116 Bacteria 2143
926 Ga0207674_10533724 3300026116 Bacteria 1133
927 Ga0207674_10629089 3300026116 Bacteria 1036
928 Ga0207674_10696855 3300026116 Bacteria 981
929 Ga0207675_100002059 3300026118 Bacteria 20054
930 Ga0207675_100011158 3300026118 Bacteria 8416
931 Ga0207675_100041609 3300026118 Bacteria 4291
932 Ga0207675_100049685 3300026118 Bacteria 3913
933 Ga0207675_100068632 3300026118 Bacteria 3313
934 Ga0207675_100119254 3300026118 Bacteria 2495
935 Ga0207675_100450484 3300026118 Bacteria 1275
936 Ga0207675_100595456 3300026118 Bacteria 1108
937 Ga0207683_10006890 3300026121 Bacteria 9730
938 Ga0207683_10011072 3300026121 Bacteria 7685
939 Ga0207683_10016244 3300026121 Bacteria 6334
940 Ga0207683_10024454 3300026121 Bacteria 5203
941 Ga0207683_10097053 3300026121 Bacteria 2628
942 Ga0207683_10143867 3300026121 Bacteria 2149
943 Ga0207683_10202465 3300026121 Bacteria 1805
944 Ga0207698_10001488 3300026142 Bacteria 13640
945 Ga0207698_10013166 3300026142 Bacteria 5446
946 Ga0207698_10016613 3300026142 Bacteria 4968
947 Ga0207698_10060388 3300026142 Bacteria 2948
948 Ga0207698_10136904 3300026142 Bacteria 2103
949 Ga0209984_1004458 3300027424 Bacteria 1650
950 Ga0209968_1005122 3300027526 Bacteria 1965
951 Ga0209968_1011246 3300027526 Bacteria 1384
952 Ga0210002_1001494 3300027617 Bacteria 3313
953 Ga0209983_1021655 3300027665 Bacteria 1345
954 Ga0209998_10017630 3300027717 Bacteria 1511
955 Ga0207428_10111837 3300027907 Bacteria 2101
956 Ga0207428_10136352 3300027907 Bacteria 1876
957 Ga0207428_10279999 3300027907 Bacteria 1238
958 Ga0268266_10000038 3300028379 Bacteria 325729
959 Ga0268266_10015422 3300028379 Bacteria 6557
960 Ga0268266_10036671 3300028379 Bacteria 4175
961 Ga0268265_10003503 3300028380 Bacteria 11231
962 Ga0268265_10045098 3300028380 Bacteria 3288
963 Ga0268265_10156749 3300028380 Bacteria 1928
964 Ga0268265_10342236 3300028380 Bacteria 1362
965 Ga0268264_10000167 3300028381 Bacteria 146190
966 Ga0268264_10004208 3300028381 Bacteria 12284
967 Ga0268264_10004870 3300028381 Bacteria 11377
968 Ga0268264_10012086 3300028381 Bacteria 7108
969 Ga0268264_10015090 3300028381 Bacteria 6337
970 Ga0268264_10025918 3300028381 Bacteria 4786
971 Ga0268264_10061228 3300028381 Bacteria 3157
972 Ga0268264_10128293 3300028381 Bacteria 2245
973 Ga0268264_10222733 3300028381 Bacteria 1737
974 Ga0268264_10251911 3300028381 Bacteria 1641
975 Ga0265323_10000040 3300028653 Bacteria 70373
976 Ga0265336_10019263 3300028666 Bacteria 2203
977 Ga0307517_10018578 3300028786 Bacteria 8983
978 Ga0265338_10001855 3300028800 Bacteria 33207
979 Ga0265338_10206753 3300028800 Bacteria 1476
980 Ga0265324_10008522 3300029957 Bacteria 4070
981 Ga0307511_10004717 3300030521 Bacteria 13935
982 Ga0307512_10107163 3300030522 Bacteria 1861
983 Ga0316177_1079276 3300030731 Bacteria 6692
984 Ga0316176_1220529 3300030732 Bacteria 11720
985 Ga0316183_1116825 3300030742 Bacteria 56435
986 Ga0316181_1163475 3300030744 Bacteria 9442
987 Ga0265331_10159692 3300031250 Bacteria 1022
988 Ga0265327_10000097 3300031251 Bacteria 193156
989 Ga0265327_10000159 3300031251 Bacteria 145537
990 Ga0265327_10000244 3300031251 Bacteria 108867
991 Ga0265327_10000298 3300031251 Bacteria 96149
992 Ga0265327_10000370 3300031251 Bacteria 84921
993 Ga0265327_10074641 3300031251 Bacteria 1689
994 Ga0265327_10105046 3300031251 Bacteria 1357
995 Ga0265327_10155339 3300031251 Bacteria 1060
996 Ga0265316_10000486 3300031344 Bacteria 45040
997 Ga0265316_10004409 3300031344 Bacteria 14019
998 Ga0307513_10349076 3300031456 Bacteria 1228
999 Ga0307513_10363487 3300031456 Bacteria 1191
1000 Ga0307509_10007469 3300031507 Bacteria 14263
1001 Ga0307408_100013046 3300031548 Bacteria 5512
1002 Ga0307408_100038382 3300031548 Bacteria 3379
1003 Ga0307408_100466746 3300031548 Bacteria 1098
1004 Ga0265342_10050150 3300031712 Bacteria 2495
1005 Ga0265342_10197336 3300031712 Bacteria 1095
1006 Ga0316576_10007854 3300031727 Bacteria 6745
1007 Ga0316576_10080879 3300031727 Bacteria 2410
1008 Ga0316576_10098247 3300031727 Bacteria 2186
1009 Ga0316576_10134476 3300031727 Bacteria 1861
1010 Ga0316578_10009003 3300031728 Bacteria 5110
1011 Ga0316578_10015477 3300031728 Bacteria 4102
1012 Ga0307516_10004268 3300031730 Bacteria 17759
1013 Ga0307405_10010819 3300031731 Bacteria 4749
1014 Ga0307405_10182283 3300031731 Bacteria 1509
1015 Ga0316577_10016238 3300031733 Bacteria 4101
1016 Ga0316577_10051389 3300031733 Bacteria 2300
1017 Ga0316577_10056390 3300031733 Bacteria 2193
1018 Ga0316577_10057199 3300031733 Bacteria 2177
1019 Ga0316577_10282233 3300031733 Bacteria 940
1020 Ga0307413_10189650 3300031824 Bacteria 1475
1021 Ga0307410_10035292 3300031852 Bacteria 3246
1022 Ga0307410_10133130 3300031852 Bacteria 1829
1023 Ga0307410_10159428 3300031852 Bacteria 1689
1024 Ga0307406_10106862 3300031901 Bacteria 1918
1025 Ga0307406_10300089 3300031901 Bacteria 1234
1026 Ga0307407_10083520 3300031903 Bacteria 1938
1027 Ga0307407_10439711 3300031903 Bacteria 944
1028 Ga0307412_10002740 3300031911 Bacteria 9804
1029 Ga0307412_10010885 3300031911 Bacteria 5251
1030 Ga0307412_10031955 3300031911 Bacteria 3329
1031 Ga0307412_10153514 3300031911 Bacteria 1702
1032 Ga0307409_100054022 3300031995 Bacteria 3091
1033 Ga0307416_100000249 3300032002 Bacteria 28628
1034 Ga0307416_100069247 3300032002 Bacteria 2919
1035 Ga0307416_100644143 3300032002 Bacteria 1144
1036 Ga0307414_10046410 3300032004 Bacteria 2982
1037 Ga0307414_10049268 3300032004 Bacteria 2912
1038 Ga0307414_10058567 3300032004 Bacteria 2715
1039 Ga0307414_10077937 3300032004 Bacteria 2414
1040 Ga0307414_10149592 3300032004 Bacteria 1840
1041 Ga0307414_10186541 3300032004 Bacteria 1674
1042 Ga0307414_10219916 3300032004 Bacteria 1558
1043 Ga0307414_10273647 3300032004 Bacteria 1416
1044 Ga0307414_10453617 3300032004 Bacteria 1125
1045 Ga0307411_10020538 3300032005 Bacteria 3844
1046 Ga0307411_10047021 3300032005 Bacteria 2787
1047 Ga0307411_10067723 3300032005 Bacteria 2404
1048 Ga0307415_100012733 3300032126 Bacteria 4876
1049 Ga0307415_100025311 3300032126 Bacteria 3721
1050 Ga0316580_10016205 3300032139 Bacteria 2285
1051 Ga0316580_10084222 3300032139 Bacteria 972
1052 Ga0316580_10085624 3300032139 Bacteria 964
1053 Ga0316593_10000279 3300032168 Bacteria 8591
1054 Ga0316593_10000712 3300032168 Bacteria 6519
1055 Ga0316593_10004976 3300032168 Bacteria 3464
1056 Ga0316593_10006916 3300032168 Bacteria 3088
1057 Ga0316593_10016946 3300032168 Bacteria 2216
1058 Ga0316593_10026606 3300032168 Bacteria 1850
1059 Ga0316593_10071614 3300032168 Bacteria 1200
1060 Ga0307510_10000380 3300033180 Bacteria 42243
1061 Ga0316592_1000047 3300033524 Bacteria 10098
1062 Ga0316592_1000131 3300033524 Bacteria 8112
1063 Ga0316592_1000317 3300033524 Bacteria 6265
1064 Ga0316592_1000414 3300033524 Bacteria 5767
1065 Ga0316592_1001892 3300033524 Bacteria 3509
1066 Ga0316592_1003234 3300033524 Bacteria 2911
1067 Ga0316592_1020447 3300033524 Bacteria 1406
1068 Ga0316592_1035762 3300033524 Bacteria 1090
1069 Ga0316586_1003187 3300033527 Bacteria 2130
1070 Ga0316586_1012203 3300033527 Bacteria 1329
1071 Ga0316588_1000234 3300033528 Bacteria 6658
1072 Ga0316588_1000295 3300033528 Bacteria 6202
1073 Ga0316588_1000569 3300033528 Bacteria 5197
1074 Ga0316596_1000052 3300033541 Bacteria 12700
1075 Ga0316596_1000106 3300033541 Bacteria 10634
1076 Ga0316596_1001428 3300033541 Bacteria 4810
1077 Ga0316596_1002332 3300033541 Bacteria 4037
1078 Ga0316596_1003798 3300033541 Bacteria 3341
1079 Ga0316596_1006124 3300033541 Bacteria 2784
1080 Ga0316596_1006577 3300033541 Bacteria 2709
1081 Ga0316596_1009489 3300033541 Bacteria 2336
1082 Ga0316596_1014496 3300033541 Bacteria 1955
1083 Ga0316596_1019782 3300033541 Bacteria 1710
1084 Ga0316596_1026385 3300033541 Bacteria 1498
1085 Ga0316596_1040079 3300033541 Bacteria 1229
1086 Ga0373955_0075643 3300035172 Bacteria 1893
1087 Ga0316574_0036503 3300035398 Bacteria 3009
1088 Ga0316574_0081697 3300035398 Bacteria 2053
1089 Ga0316574_0105203 3300035398 Bacteria 1807
1090 Ga0373935_0165867 3300035692 Bacteria 1508
1091 Ga0373927_0006959 3300035695 Bacteria 7677
1092 Ga0373937_0002462 3300036401 Bacteria 15390
1093 Ga0373937_0299425 3300036401 Bacteria 1520
1094 Ga0316582_0168172 3300036647 Bacteria 1487
1095 Ga0316582_0250448 3300036647 Unclassified 1214
1096 Ga0316584_0001842 3300036712 Bacteria 13121
1097 Ga0316584_0004403 3300036712 Bacteria 9325
1098 Ga0316584_0015050 3300036712 Bacteria 5526
1099 Ga0316584_0028755 3300036712 Bacteria 4102
1100 Ga0316584_0123064 3300036712 Bacteria 1938
1101 Ga0316584_0128854 3300036712 Bacteria 1890
1102 Ga0373925_0286730 3300037068 Bacteria 1327
1103 Ga0395899_0000034 3300037312 Bacteria 302623
1104 Ga0395899_0001127 3300037312 Bacteria 23734
1105 Ga0395899_0001602 3300037312 Bacteria 18978
1106 Ga0395899_0006152 3300037312 Bacteria 9303
1107 Ga0395899_0014673 3300037312 Bacteria 5979
1108 Ga0395899_0054207 3300037312 Bacteria 2967
1109 Ga0395900_0000346 3300037418 Bacteria 68020
1110 Ga0395900_0001482 3300037418 Bacteria 28015
1111 Ga0395900_0006693 3300037418 Bacteria 11974
1112 Ga0395900_0016502 3300037418 Bacteria 7532
1113 Ga0395900_0017444 3300037418 Bacteria 7328
1114 Ga0395900_0052980 3300037418 Bacteria 4176
1115 Ga0395900_0074436 3300037418 Bacteria 3491
1116 Ga0395900_0124849 3300037418 Bacteria 2639
1117 Ga0395900_0410611 3300037418 Bacteria 1316
1118 Ga0395898_0002718 3300037466 Bacteria 20408
1119 Ga0395898_0018836 3300037466 Bacteria 7033
1120 Ga0395898_0034336 3300037466 Bacteria 5056
1121 Ga0395898_0039390 3300037466 Bacteria 4677
1122 Ga0395898_0094771 3300037466 Bacteria 2869
1123 Ga0395898_0257000 3300037466 Bacteria 1666
1124 Ga0395898_0378729 3300037466 Bacteria 1349
1125 Ga0395898_0584577 3300037466 Bacteria 1059
1126 Ga0395905_0000001 3300037471 Bacteria 2037079
1127 Ga0395905_0000376 3300037471 Bacteria 63695
1128 Ga0395905_0000528 3300037471 Bacteria 52404
1129 Ga0395905_0002823 3300037471 Bacteria 19037
1130 Ga0395905_0002993 3300037471 Bacteria 18335
1131 Ga0395905_0096577 3300037471 Bacteria 2774
1132 Ga0395905_0173952 3300037471 Bacteria 2022
1133 Ga0395905_0415359 3300037471 Bacteria 1241
1134 Ga0395901_0000351 3300038443 Bacteria 56004
1135 Ga0395901_0001115 3300038443 Bacteria 28520
1136 Ga0395901_0078192 3300038443 Bacteria 3454
1137 Ga0395901_0135999 3300038443 Bacteria 2583
1138 Ga0395901_0158362 3300038443 Bacteria 2378
1139 Ga0395901_0252291 3300038443 Bacteria 1838
1140 Ga0400483_219275 3300039062 Bacteria 32517
1141 Ga0436365_0472587 3300039437 Bacteria 3578
1142 Ga0436365_0781227 3300039437 Bacteria 11182
1143 Ga0436365_1312514 3300039437 Bacteria 1889
1144 Ga0436365_1690067 3300039437 Bacteria 10061
1145 Ga0436361_0986181 3300039447 Bacteria 4054
1146 Ga0436361_1211924 3300039447 Bacteria 2151
1147 Ga0439436_0004280 3300041404 Bacteria 4371
1148 Ga0439439_0010020 3300041406 Bacteria 2261
1149 Ga0439439_0018085 3300041406 Bacteria 1739
1150 Ga0439453_0020145 3300041408 Bacteria 1194
1151 Ga0439465_0022501 3300041413 Bacteria 1980
1152 Ga0439465_0069648 3300041413 Bacteria 1178
1153 Ga0439465_0110006 3300041413 Bacteria 958
1154 Ga0451787_433472 3300041441 Bacteria 1374
1155 Ga0451795_0024876 3300041456 Bacteria 963
1156 Ga0451837_0265238 3300041494 Bacteria 4284
1157 Ga0451837_0432158 3300041494 Bacteria 1837
1158 Ga0439431_0000777 3300041997 Bacteria 6892
1159 Ga0439431_0013148 3300041997 Bacteria 1907
1160 Ga0439431_0040544 3300041997 Bacteria 1184
1161 Ga0439433_0009272 3300041999 Bacteria 2142
1162 Ga0439433_0031284 3300041999 Bacteria 1218
1163 Ga0439445_0001922 3300042004 Bacteria 4584
1164 Ga0439445_0011234 3300042004 Bacteria 2132
1165 Ga0439448_0005262 3300042005 Bacteria 3685
1166 Ga0439449_0005508 3300042007 Bacteria 4845
1167 Ga0439449_0013615 3300042007 Bacteria 3061
1168 Ga0439449_0017442 3300042007 Bacteria 2696
1169 Ga0439454_014244 3300042011 Bacteria 1101
1170 Ga0439455_0032158 3300042012 Bacteria 1310
1171 Ga0439455_0052110 3300042012 Bacteria 1071
1172 Ga0439457_000313 3300042014 Bacteria 13359
1173 Ga0439462_0001031 3300042015 Bacteria 5982
1174 Ga0439462_0015306 3300042015 Bacteria 1977
1175 Ga0450923_013606 3300042125 Bacteria 1497
1176 Ga0450894_006068 3300042131 Bacteria 1563
1177 Ga0439446_0018535 3300042156 Bacteria 1951
1178 Ga0439434_0002227 3300042435 Bacteria 5629
1179 Ga0439434_0017713 3300042435 Bacteria 2133
1180 Ga0450918_016978 3300042531 Bacteria 1267
1181 Ga0450893_0021862 3300042532 Bacteria 1106
1182 Ga0451577_0004463 3300042876 Bacteria 14775
1183 Ga0451577_0014494 3300042876 Bacteria 7348
1184 Ga0451577_0030583 3300042876 Bacteria 4865
1185 Ga0451577_0035014 3300042876 Bacteria 4524
1186 Ga0451577_0048590 3300042876 Bacteria 3790
1187 Ga0451577_0053903 3300042876 Bacteria 3590
1188 Ga0451577_0058001 3300042876 Bacteria 3451
1189 Ga0451577_0091765 3300042876 Bacteria 2711
1190 Ga0451577_0092287 3300042876 Bacteria 2703
1191 Ga0451577_0160817 3300042876 Bacteria 2022
1192 Ga0451577_0184901 3300042876 Bacteria 1879
1193 Ga0451577_0223646 3300042876 Bacteria 1701
1194 Ga0451577_0274290 3300042876 Bacteria 1527
1195 Ga0451577_0281781 3300042876 Bacteria 1506
1196 Ga0451577_0281951 3300042876 Bacteria 1505
1197 Ga0466969_0000246 3300044656 Bacteria 29777
1198 Ga0466972_0000025 3300044658 Bacteria 186601
1199 Ga0466972_0043728 3300044658 Bacteria 2174
1200 Ga0453683_0000055 3300044673 Bacteria 192588
1201 Ga0453683_0000522 3300044673 Bacteria 43145
1202 Ga0453683_0000935 3300044673 Bacteria 27791
1203 Ga0453683_0005759 3300044673 Bacteria 8592
1204 Ga0453683_0007526 3300044673 Bacteria 7375
1205 Ga0453683_0049521 3300044673 Bacteria 2634
1206 Ga0453683_0082507 3300044673 Bacteria 2014
1207 Ga0453683_0099319 3300044673 Bacteria 1827
1208 Ga0466966_0001476 3300044684 Bacteria 15131
1209 Ga0466966_0022707 3300044684 Bacteria 4113
1210 Ga0466961_0096365 3300044693 Bacteria 1866
1211 Ga0466961_0114876 3300044693 Bacteria 1692
1212 Ga0466964_0026563 3300044706 Bacteria 2267
1213 Ga0453684_0000334 3300044712 Bacteria 196444
1214 Ga0453684_0000413 3300044712 Bacteria 174924
1215 Ga0453684_0000440 3300044712 Bacteria 169397
1216 Ga0453684_0000506 3300044712 Bacteria 152143
1217 Ga0453684_0001121 3300044712 Bacteria 83919
1218 Ga0453684_0001193 3300044712 Bacteria 80343
1219 Ga0453684_0001382 3300044712 Bacteria 70292
1220 Ga0453684_0001549 3300044712 Bacteria 64220
1221 Ga0453684_0004131 3300044712 Bacteria 31439
1222 Ga0453684_0005611 3300044712 Bacteria 24695
1223 Ga0453684_0012498 3300044712 Bacteria 13983
1224 Ga0453684_0013573 3300044712 Bacteria 13209
1225 Ga0453684_0014056 3300044712 Bacteria 12880
1226 Ga0453684_0025154 3300044712 Bacteria 8657
1227 Ga0453684_0032953 3300044712 Bacteria 7234
1228 Ga0453684_0033676 3300044712 Bacteria 7134
1229 Ga0453684_0040849 3300044712 Bacteria 6288
1230 Ga0453684_0046321 3300044712 Bacteria 5784
1231 Ga0453684_0048058 3300044712 Bacteria 5649
1232 Ga0453684_0050952 3300044712 Bacteria 5435
1233 Ga0453684_0055899 3300044712 Bacteria 5126
1234 Ga0453684_0056141 3300044712 Bacteria 5111
1235 Ga0453684_0059704 3300044712 Bacteria 4914
1236 Ga0453684_0060833 3300044712 Bacteria 4853
1237 Ga0453684_0065279 3300044712 Bacteria 4643
1238 Ga0453684_0074193 3300044712 Bacteria 4285
1239 Ga0453684_0092022 3300044712 Bacteria 3741
1240 Ga0453684_0093568 3300044712 Bacteria 3701
1241 Ga0453684_0100839 3300044712 Bacteria 3533
1242 Ga0453684_0108960 3300044712 Bacteria 3370
1243 Ga0453684_0133671 3300044712 Bacteria 2973
1244 Ga0453684_0145076 3300044712 Bacteria 2829
1245 Ga0453684_0258564 3300044712 Bacteria 1996
1246 Ga0453684_0261069 3300044712 Bacteria 1984
1247 Ga0453684_0435002 3300044712 Bacteria 1463
1248 Ga0466970_0000933 3300044765 Bacteria 14121
1249 Ga0466970_0032604 3300044765 Bacteria 2753
1250 Ga0466957_0001187 3300044842 Bacteria 13537
1251 Ga0466957_0009999 3300044842 Bacteria 5428
1252 Ga0466957_0025802 3300044842 Bacteria 3484
1253 Ga0466959_0000017 3300045049 Bacteria 143170
1254 Ga0466959_0017683 3300045049 Bacteria 5229
1255 Ga0466959_0019573 3300045049 Bacteria 4978
1256 Ga0451576_0000113 3300045051 Bacteria 208644
1257 Ga0451576_0001103 3300045051 Bacteria 49329
1258 Ga0451576_0005920 3300045051 Bacteria 15147
1259 Ga0451576_0010522 3300045051 Bacteria 10601
1260 Ga0451576_0011813 3300045051 Bacteria 9886
1261 Ga0451576_0017866 3300045051 Bacteria 7791
1262 Ga0451576_0018019 3300045051 Bacteria 7749
1263 Ga0451576_0021171 3300045051 Bacteria 7070
1264 Ga0451576_0030427 3300045051 Bacteria 5770
1265 Ga0451576_0051376 3300045051 Bacteria 4322
1266 Ga0451576_0071147 3300045051 Bacteria 3620
1267 Ga0451576_0099290 3300045051 Bacteria 3028
1268 Ga0451576_0197917 3300045051 Bacteria 2099
1269 Ga0451576_0224290 3300045051 Bacteria 1962
1270 Ga0451576_0254434 3300045051 Bacteria 1836
1271 Ga0451576_0360124 3300045051 Bacteria 1523
1272 Ga0451576_0460967 3300045051 Bacteria 1335
1273 Ga0451576_0909952 3300045051 Bacteria 923
1274 Ga0495627_001896 3300046453 Bacteria 10966
1275 Ga0495603_0132226 3300046455 Bacteria 1453
1276 Ga0495638_0083919 3300046460 Bacteria 1929
1277 Ga0495638_0085990 3300046460 Bacteria 1901
1278 Ga0495653_0047662 3300046463 Bacteria 3314
1279 Ga0495650_0051591 3300046471 Bacteria 1694
1280 Ga0495580_0013181 3300046472 Bacteria 6325
1281 Ga0495582_0139876 3300046473 Bacteria 1371
1282 Ga0495662_0020123 3300046476 Bacteria 3230
1283 Ga0495664_0051957 3300046477 Bacteria 2434
1284 Ga0495583_0069279 3300046506 Bacteria 1554
1285 Ga0495606_0021306 3300046507 Bacteria 4749
1286 Ga0495606_0036258 3300046507 Bacteria 3361
1287 Ga0495608_0012072 3300046511 Bacteria 6005
1288 Ga0495608_0268649 3300046511 Bacteria 1061
1289 Ga0495616_0018996 3300046513 Bacteria 3757
1290 Ga0495616_0025587 3300046513 Bacteria 3151
1291 Ga0495618_0020169 3300046514 Bacteria 4104
1292 Ga0495628_0008937 3300046516 Bacteria 8568
1293 Ga0495628_0610950 3300046516 Bacteria 778
1294 Ga0495630_0017830 3300046517 Bacteria 5207
1295 Ga0495630_0057161 3300046517 Bacteria 2924
1296 Ga0495630_0223347 3300046517 Bacteria 1438
1297 Ga0495643_0000294 3300046522 Bacteria 70329
1298 Ga0495643_0101174 3300046522 Bacteria 1477
1299 Ga0495644_0001340 3300046523 Bacteria 10069
1300 Ga0495648_0012032 3300046524 Bacteria 6482
1301 Ga0495652_0444576 3300046529 Bacteria 909
1302 Ga0495640_0024578 3300046533 Bacteria 4382
1303 Ga0495587_0115395 3300046536 Bacteria 1541
1304 Ga0495645_0090453 3300046543 Bacteria 2188
1305 Ga0495633_0000049 3300046558 Bacteria 156684
1306 Ga0495668_0000108 3300046616 Bacteria 132593
1307 Ga0495668_0000191 3300046616 Bacteria 90923
1308 Ga0495668_0001518 3300046616 Bacteria 22075
1309 Ga0495634_0023809 3300046642 Bacteria 4302
1310 Ga0495634_0057670 3300046642 Bacteria 2591
1311 Ga0495611_0085828 3300046648 Bacteria 1452
1312 Ga0495611_0154893 3300046648 Bacteria 1070
1313 Ga0495625_0001933 3300046660 Bacteria 23424
1314 Ga0495625_0043576 3300046660 Bacteria 3253
1315 Ga0495625_0051559 3300046660 Bacteria 2950
1316 Ga0495625_0068664 3300046660 Bacteria 2491
1317 Ga0495625_0173757 3300046660 Bacteria 1437
1318 Ga0495657_0193260 3300046675 Bacteria 1243
1319 Ga0495658_0006331 3300046683 Bacteria 5815
1320 Ga0495613_0151946 3300046689 Bacteria 1651
1321 Ga0495613_0178582 3300046689 Bacteria 1504
1322 Ga0495670_0006417 3300046691 Bacteria 5777
1323 Ga0495670_0031502 3300046691 Bacteria 2636
1324 Ga0495671_0028507 3300046692 Bacteria 2875
1325 Ga0495649_0091156 3300046694 Bacteria 1625
1326 Ga0495600_0127185 3300046809 Bacteria 1657
1327 Ga0495600_0329392 3300046809 Bacteria 959
1328 Ga0495604_0070404 3300047317 Bacteria 2649
1329 Ga0495636_0047537 3300047318 Bacteria 1792
1330 Ga0495674_0057426 3300047319 Bacteria 3406
1331 Ga0495674_0303326 3300047319 Bacteria 1304
1332 Ga0495672_0035964 3300047320 Bacteria 3045
1333 Ga0495672_0072609 3300047320 Bacteria 1943
1334 Ga0495676_0226161 3300047321 Bacteria 1287
1335 Ga0495676_0269599 3300047321 Bacteria 1156
1336 Ga0495680_0035982 3300047322 Bacteria 3981
1337 Ga0495687_000001 3300047443 Bacteria 1215582
1338 Ga0495687_000233 3300047443 Bacteria 77056
1339 Ga0495675_0183580 3300047444 Bacteria 1280
1340 Ga0495685_011735 3300047447 Bacteria 2961
1341 Ga0495684_0242029 3300047471 Bacteria 1315
1342 Ga0495686_0000004 3300047472 Bacteria 869019
1343 Ga0495686_0039024 3300047472 Bacteria 3035
1344 Ga0495686_0085031 3300047472 Bacteria 1927
1345 Ga0496101_0196189 3300048904 Bacteria 1560
1346 Ga0496104_0295323 3300048907 Bacteria 1533
1347 Ga0496104_0327218 3300048907 Bacteria 1446
1348 Ga0496105_0087940 3300048908 Bacteria 2567
1349 Ga0496108_0488854 3300048911 Bacteria 1075
1350 Ga0496110_0131071 3300048913 Bacteria 2264
1351 Ga0496114_0473557 3300048917 Bacteria 1108
1352 Ga0496115_0034456 3300048918 Bacteria 4001
1353 Ga0496115_0265498 3300048918 Bacteria 1411
1354 Ga0496115_0337815 3300048918 Bacteria 1230
1355 Ga0496115_0525836 3300048918 Bacteria 948
1356 Ga0496116_0019557 3300048919 Bacteria 5182
1357 Ga0496117_0001863 3300048920 Bacteria 28457
1358 Ga0496118_0200874 3300048921 Bacteria 1181
1359 Ga0496121_0000030 3300048924 Bacteria 412079
1360 Ga0496122_0008592 3300048925 Bacteria 10970
1361 Ga0496123_0014741 3300048926 Bacteria 6457
1362 Ga0496126_0030549 3300048929 Bacteria 5101
1363 Ga0501306_003537 3300049127 Bacteria 1690
1364 Ga0501305_000824 3300049161 Bacteria 2756
1365 Ga0501307_000646 3300049162 Bacteria 2523
1366 Ga0501311_000077 3300049527 Bacteria 4489
1367 Ga0501311_007027 3300049527 Bacteria 1287
1368 Ga0501312_002580 3300049528 Bacteria 1968
1369 Ga0501315_000974 3300049531 Bacteria 2261
1370 Ga0501316_000510 3300049532 Bacteria 2722
1371 Ga0501319_000002 3300049535 Bacteria 13675
1372 Ga0501032_0002362 3300049569 Bacteria 14785
1373 Ga0501032_0002936 3300049569 Bacteria 13262
1374 Ga0501032_0013633 3300049569 Bacteria 5773
1375 Ga0501032_0045337 3300049569 Bacteria 2974
1376 Ga0501033_0000011 3300049570 Bacteria 259130
1377 Ga0501033_0430138 3300049570 Bacteria 918
1378 Ga0501034_0001265 3300049571 Bacteria 34324
1379 Ga0501034_0002020 3300049571 Bacteria 25539
1380 Ga0501034_0010858 3300049571 Bacteria 9461
1381 Ga0501034_0017257 3300049571 Bacteria 7405
1382 Ga0501034_0040721 3300049571 Bacteria 4701
1383 Ga0501034_0140017 3300049571 Bacteria 2399
1384 Ga0501034_0191568 3300049571 Bacteria 2007
1385 Ga0501034_0282372 3300049571 Bacteria 1599
1386 Ga0501036_0009955 3300049572 Bacteria 7829
1387 Ga0501036_0012794 3300049572 Bacteria 6962
1388 Ga0501036_0017036 3300049572 Bacteria 6072
1389 Ga0501036_0040807 3300049572 Bacteria 3926
1390 Ga0501037_0003904 3300049573 Bacteria 10816
1391 Ga0501037_0004877 3300049573 Bacteria 9757
1392 Ga0501037_0021814 3300049573 Bacteria 4739
1393 Ga0501037_0022979 3300049573 Bacteria 4612
1394 Ga0501037_0032648 3300049573 Bacteria 3845
1395 Ga0501038_0002395 3300049574 Bacteria 17463
1396 Ga0501038_0005905 3300049574 Bacteria 11315
1397 Ga0501038_0121981 3300049574 Bacteria 2148
1398 Ga0501038_0222597 3300049574 Bacteria 1505
1399 Ga0501039_0003523 3300049575 Bacteria 11722
1400 Ga0501039_0011642 3300049575 Bacteria 6699
1401 Ga0501039_0013024 3300049575 Bacteria 6357
1402 Ga0501043_0000733 3300049579 Bacteria 29055
1403 Ga0501043_0009337 3300049579 Bacteria 7705
1404 Ga0501043_0011452 3300049579 Bacteria 6943
1405 Ga0501043_0038700 3300049579 Bacteria 3750
1406 Ga0501043_0041852 3300049579 Bacteria 3599
1407 Ga0501046_0032361 3300049580 Bacteria 4234
1408 Ga0501046_0052113 3300049580 Bacteria 3226
1409 Ga0501046_0163745 3300049580 Bacteria 1672
1410 Ga0501047_0075953 3300049581 Bacteria 3233
1411 Ga0501047_0085641 3300049581 Bacteria 3028
1412 Ga0501047_0101654 3300049581 Bacteria 2754
1413 Ga0501047_0120170 3300049581 Bacteria 2510
1414 Ga0501047_0185593 3300049581 Bacteria 1945
1415 Ga0501047_0186349 3300049581 Bacteria 1940
1416 Ga0501047_0269762 3300049581 Bacteria 1548
1417 Ga0501047_0372115 3300049581 Bacteria 1264
1418 Ga0501048_0123290 3300049582 Bacteria 1832
1419 Ga0501067_0017620 3300049583 Bacteria 3953
1420 Ga0501068_0072633 3300049584 Bacteria 2101
1421 Ga0501069_0064770 3300049585 Bacteria 2043
1422 Ga0501069_0146770 3300049585 Bacteria 1354
1423 Ga0501070_0032644 3300049586 Bacteria 4357
1424 Ga0501070_0177402 3300049586 Bacteria 1754
1425 Ga0501072_0157654 3300049588 Bacteria 1810
1426 Ga0501072_0228144 3300049588 Bacteria 1484
1427 Ga0501073_0060516 3300049589 Bacteria 2642
1428 Ga0501073_0069872 3300049589 Bacteria 2447
1429 Ga0501074_0001790 3300049590 Bacteria 14696
1430 Ga0501201_002320 3300049651 Bacteria 1742
1431 Ga0501202_000998 3300049652 Bacteria 4375
1432 Ga0501202_007720 3300049652 Bacteria 1949
1433 Ga0501217_027892 3300049661 Bacteria 1373
1434 Ga0501223_030230 3300049663 Bacteria 1054
1435 Ga0501224_006724 3300049664 Bacteria 1669
1436 Ga0501236_000758 3300049670 Bacteria 3614
1437 Ga0501243_002414 3300049675 Bacteria 2735
1438 Ga0501257_003554 3300049686 Bacteria 3354
1439 Ga0501257_006334 3300049686 Bacteria 2626
1440 Ga0501257_009003 3300049686 Bacteria 2251
1441 Ga0501257_010822 3300049686 Bacteria 2075
1442 Ga0501257_021787 3300049686 Bacteria 1513
1443 Ga0501259_001205 3300049688 Bacteria 4308
1444 Ga0501261_001010 3300049690 Bacteria 3458
1445 Ga0501219_000689 3300049703 Bacteria 4677
1446 Ga0501221_018469 3300049704 Bacteria 1344
1447 Ga0501225_0004957 3300049705 Bacteria 3933
1448 Ga0501225_0014146 3300049705 Bacteria 2229
1449 Ga0501225_0031787 3300049705 Bacteria 1452
1450 Ga0501079_0067091 3300049741 Bacteria 2769
1451 Ga0501080_0032906 3300049742 Bacteria 4838
1452 Ga0501080_0096029 3300049742 Bacteria 2752
1453 Ga0501080_0152601 3300049742 Bacteria 2134
1454 Ga0501083_0085302 3300049744 Bacteria 2090
1455 Ga0501083_0110428 3300049744 Bacteria 1808
1456 Ga0501263_015504 3300049760 Bacteria 985
1457 Ga0501264_000532 3300049761 Bacteria 5587
1458 Ga0501269_003046 3300049766 Bacteria 2038
1459 Ga0501272_008342 3300049769 Bacteria 1136
1460 Ga0501273_004702 3300049770 Bacteria 1512
1461 Ga0501035_0006062 3300049822 Bacteria 11383
1462 Ga0501035_0009077 3300049822 Bacteria 9245
1463 Ga0501035_0016384 3300049822 Bacteria 6837
1464 Ga0501035_0071324 3300049822 Bacteria 3076
1465 Ga0501035_0110040 3300049822 Bacteria 2415
1466 Ga0501035_0256134 3300049822 Bacteria 1485
1467 Ga0501044_0001293 3300049823 Bacteria 29588
1468 Ga0501044_0004248 3300049823 Bacteria 16071
1469 Ga0501044_0020175 3300049823 Bacteria 7113
1470 Ga0501044_0037946 3300049823 Bacteria 5034
1471 Ga0501044_0089863 3300049823 Bacteria 3099
1472 Ga0501044_0123100 3300049823 Unclassified 2593
1473 Ga0501044_0129939 3300049823 Bacteria 2514
1474 Ga0501044_0176664 3300049823 Bacteria 2104
1475 Ga0501045_0000053 3300049824 Bacteria 51403
1476 Ga0501284_00135 3300050005 Bacteria 9595
1477 nmdc:mga00v17_190208_c1 3300050491 Bacteria 1325
1478 nmdc:mga0k408_102103_c1 3300050493 Bacteria 1691
1479 nmdc:mga0k408_109494_c1 3300050493 Bacteria 1632
1480 nmdc:mga0k408_12089_c1 3300050493 Bacteria 4714
1481 nmdc:mga0k408_34214_c1 3300050493 Bacteria 2908
1482 nmdc:mga0k408_54179_c1 3300050493 Bacteria 2325
1483 nmdc:mga0k408_7017_c1 3300050493 Bacteria 6011
1484 nmdc:mga0k408_8427_c1 3300050493 Bacteria 5533
1485 nmdc:mga0k408_9728_c1 3300050493 Bacteria 5190
1486 nmdc:mga07m45_122395_c1 3300050496 Bacteria 1503
1487 nmdc:mga07m45_69219_c1 3300050496 Bacteria 2006
1488 nmdc:mga05p37_3944_c1 3300050507 Bacteria 17380
1489 nmdc:mga05p37_466479_c1 3300050507 Bacteria 1458
1490 nmdc:mga09592_4236_c1 3300050508 Bacteria 11586
1491 nmdc:mga09592_63156_c1 3300050508 Bacteria 3134
1492 nmdc:mga0qj67_85711_c1 3300050509 Bacteria 2527
1493 nmdc:mga06r32_145795_c1 3300050510 Bacteria 2345
1494 nmdc:mga06r32_46732_c1 3300050510 Bacteria 4131
1495 nmdc:mga08y16_10401_c1 3300050511 Bacteria 9761
1496 nmdc:mga08y16_106009_c1 3300050511 Bacteria 2926
1497 nmdc:mga08y16_26169_c1 3300050511 Bacteria 6153
1498 nmdc:mga08y16_342131_c1 3300050511 Bacteria 1538
1499 Ga0500635_0004581 3300053080 Bacteria 3570
1500 Ga0495619_0033330 3300053085 Bacteria 3345
1501 Ga0500578_0000136 3300053086 Bacteria 88612
1502 Ga0500578_0018759 3300053086 Bacteria 4445
1503 Ga0500644_0002759 3300053088 Bacteria 4382
1504 Ga0500581_059303 3300053089 Bacteria 1941
1505 Ga0500646_0005243 3300053090 Bacteria 3278
1506 Ga0500646_0007315 3300053090 Bacteria 2821
1507 Ga0500646_0029761 3300053090 Bacteria 1496
1508 Ga0500583_0000248 3300053092 Bacteria 19303
1509 Ga0500583_0003873 3300053092 Bacteria 4793
1510 Ga0500651_0061432 3300053093 Bacteria 2347
1511 Ga0500651_0107621 3300053093 Bacteria 1704
1512 Ga0500651_0108917 3300053093 Bacteria 1692
1513 Ga0500641_0021869 3300053096 Bacteria 2444
1514 Ga0500555_028876 3300053103 Bacteria 1578
1515 Ga0500556_0011703 3300053104 Bacteria 2603
1516 Ga0500562_000061 3300053108 Bacteria 53142
1517 Ga0500562_013235 3300053108 Bacteria 2105
1518 Ga0500569_000284 3300053109 Bacteria 8035
1519 Ga0500594_0009518 3300053118 Bacteria 2239
1520 Ga0500594_0011328 3300053118 Bacteria 2081
1521 Ga0500642_0007688 3300053130 Bacteria 3637
1522 Ga0500642_0030776 3300053130 Bacteria 2236
1523 Ga0500652_001629 3300053131 Bacteria 6828
1524 Ga0500652_021805 3300053131 Bacteria 2417
1525 Ga0500559_0019375 3300053136 Bacteria 2876
1526 Ga0500559_0062978 3300053136 Bacteria 1657
1527 Ga0500561_0029324 3300053137 Bacteria 1373
1528 Ga0500568_0000439 3300053139 Bacteria 31243
1529 Ga0500568_0013282 3300053139 Bacteria 3756
1530 Ga0500577_0000711 3300053142 Bacteria 8518
1531 Ga0500588_0045696 3300053146 Bacteria 1343
1532 Ga0500590_014980 3300053148 Bacteria 4000
1533 Ga0500616_0000013 3300053153 Bacteria 674172
1534 Ga0500616_0001754 3300053153 Bacteria 19883
1535 Ga0500616_0016628 3300053153 Bacteria 4183
1536 Ga0500622_0000113 3300053156 Bacteria 83196
1537 Ga0500622_0000133 3300053156 Bacteria 78532
1538 Ga0500622_0000156 3300053156 Bacteria 71907
1539 Ga0500622_0000385 3300053156 Bacteria 42685
1540 Ga0500622_0000655 3300053156 Bacteria 30835
1541 Ga0500622_0001823 3300053156 Bacteria 16170
1542 Ga0500622_0053963 3300053156 Bacteria 2062
1543 Ga0500624_000517 3300053157 Bacteria 11167
1544 Ga0500627_0009946 3300053158 Bacteria 3449
1545 Ga0500637_0160320 3300053178 Bacteria 1297
1546 Ga0500637_0261492 3300053178 Bacteria 961
1547 Ga0500611_000032 3300053727 Bacteria 83927
1548 Ga0500645_003859 3300053730 Bacteria 5931
1549 Ga0500645_025794 3300053730 Bacteria 1792
1550 Ga0500661_005867 3300055283 Bacteria 2288
1551 Ga0587091_015081 3300059511 Bacteria 1270
1552 Ga0501082_0180686 3300060353 Bacteria 1835
1553 Ga0466962_0027756 3300061719 Bacteria 2714
1554 2513232367 2513020052 Bacteria 5120511
1555 2520879531 2519899754 Bacteria 5336938
1556 2524006227 2523533629 Bacteria 2982326
1557 2585143578 2582581278 Bacteria 5296881
1558 2585156581 2582581281 Bacteria 4487904
1559 2585160768 2582581282 Bacteria 4495830
1560 2587679968 2585428045 Bacteria 5203023
1561 2587748626 2585428060 Bacteria 5304711
1562 2587753464 2585428061 Bacteria 3939663
1563 2587864992 2585428095 Bacteria 3789702
1564 2588211483 2585428182 Bacteria 5007281
1565 2588215865 2585428183 Bacteria 5166119
1566 2588219287 2585428184 Bacteria 4978681
1567 2588224765 2585428185 Bacteria 4969476
1568 2588234600 2585428187 Bacteria 4629388
1569 2588447560 2588253712 Bacteria 5403181
1570 2590603187 2588254255 Bacteria 5014294
1571 2590610208 2588254257 Bacteria 5436094
1572 2599479391 2599185184 Bacteria 6430550
1573 2644373930 2643221667 Bacteria 5627472
1574 2644643938 2643221716 Bacteria 4986332
1575 2644681833 2643221725 Bacteria 5087956
1576 2722726168 2721755487 Bacteria 6357185
1577 2729200764 2728369107 Bacteria 5082720
1578 2738698384 2738541273 Bacteria 4048577
1579 2738726202 2738541278 Bacteria 9755573
1580 2738733068 2738541279 Bacteria 6149495
1581 2738765606 2738541285 Bacteria 6150075
1582 2738854392 2738541302 Bacteria 5944758
1583 2739214649 2738543007 Bacteria 6149845
1584 2739252710 2738543014 Bacteria 4048139
1585 2739587944 2739367651 Bacteria 6359826
1586 2739614405 2739367656 Bacteria 5152243
1587 2739646663 2739367663 Bacteria 5040914
1588 2740002835 2739367857 Bacteria 5433684
1589 2740007652 2739367858 Bacteria 5432813
1590 2740060422 2739367874 Bacteria 4872888
1591 2753674200 2751185877 Bacteria 4921427
1592 2765575672 2765235839 Bacteria 5314748
1593 2772605776 2772190705 Bacteria 4666226
1594 2775674346 2775506739 Bacteria 3855222
1595 2802655257 2802428842 Bacteria 4926114
1596 2816875518 2816332188 Bacteria 5133218
1597 2817413549 2816332280 Bacteria 5109718
1598 2819545820 2818991437 Bacteria 5805520
1599 2819573333 2818991442 Bacteria 8318214
1600 2819590244 2818991444 Bacteria 6968812
1601 2819681069 2818991460 Bacteria 7595395
1602 2821136745 2821136567 Bacteria 8080116
1603 2833640623 2833640130 Bacteria 4858325
1604 2839990124 2839989709 Bacteria 3773432
1605 2842086249 2842083920 Bacteria 4857652
1606 2842724287 2842722452 Bacteria 6263924
1607 2842908305 2842903701 Bacteria 6986368
1608 2842913579 2842909656 Bacteria 6185908
1609 2849282609 2849281842 Bacteria 6065644
1610 2852625403 2852623160 Bacteria 4376875
1611 2857617048 2857613821 Bacteria 4917088
1612 2857619717 2857618242 Bacteria 5635925
1613 2857631642 2857627736 Bacteria 5625397
1614 2871723598 2871720351 Bacteria 4862476
1615 2881247573 2881247448 Bacteria 3717788
1616 2881364101 2881359912 Bacteria 4935907
1617 2881955871 2881955468 Bacteria 3545609
1618 2883072442 2883068021 Bacteria 6192739
1619 2884795844 2884791551 Bacteria 8511252
1620 2884934414 2884933994 Bacteria 4535041
1621 2889293824 2889290771 Bacteria 5530962
1622 2890740672 2890737413 Bacteria 4269751
1623 2895504000 2895498888 Bacteria 5283788
1624 2896087577 2896085136 Bacteria 6129793
1625 2896112703 2896109856 Bacteria 7140722
1626 2896320847 2896317667 Bacteria 4606601
1627 2898716199 2898713307 Bacteria 4110805
1628 2903898660 2903895155 Bacteria 5258610
1629 2904422400 2904419702 Bacteria 5166287
1630 2904449060 2904445276 Bacteria 5310396
1631 2904468510 2904467357 Bacteria 8057758
1632 2904558494 2904555929 Bacteria 5218588
1633 2904782778 2904780799 Bacteria 5840761
1634 2906001181 2905999023 Bacteria 4591259
1635 2906800771 2906799679 Bacteria 4031749
1636 2911143829 2911138879 Bacteria 5811561
1637 2914763464 2914759650 Bacteria 4701441
1638 2919097961 2919097161 Bacteria 3860339
1639 2919180388 2919177583 Bacteria 5641607
1640 2919194219 2919191525 Bacteria 5765973
1641 2919438008 2919437846 Bacteria 6199444
1642 2919684616 2919683626 Bacteria 5534354
1643 2919697455 2919692658 Bacteria 5943958
1644 2928082299 2928078545 Bacteria 6534839
1645 2928149122 2928147474 Bacteria 6512076
1646 2929150605 2929150217 Bacteria 5462483
1647 2929155011 2929154850 Bacteria 6753285
1648 2929178591 2929177148 Bacteria 7883697
1649 2929240968 2929239360 Bacteria 7745570
1650 2929922992 2929921140 Bacteria 8649150
1651 2932085011 2932082852 Bacteria 6563563
1652 2945924807 2945924605 Bacteria 4296724
1653 2945980999 2945977869 Bacteria 7777518
1654 2945998890 2945997725 Bacteria 6404843
1655 2946019598 2946013367 Bacteria 7766675
1656 2946024079 2946019816 Bacteria 4621265
1657 2954021333 2954016120 Bacteria 6446024
1658 2958462002 2958458903 Bacteria 5301041
1659 2958514497 2958512119 Bacteria 4528530
1660 2965321921 2965320100 Bacteria 3975600
1661 2977235844 2977232053 Bacteria 5485925
1662 2977247760 2977243572 Bacteria 4374394
1663 2977272077 2977268062 Bacteria 5243061
1664 2984574444 2984572630 Bacteria 4186940
1665 2984607893 2984606641 Bacteria 4186971
1666 2993375109 2993372514 Bacteria 4214139
1667 2993481973 2993480792 Bacteria 4022225
1668 8003152326 8003151029 Bacteria 8187759
1669 8036739266 8036736890 Bacteria 2944828
1670 8054311427 8054307821 Bacteria 5212224
1671 8055423584 8055419101 Bacteria 5289643
1672 8055591295 8055588893 Bacteria 3619545
1673 8055595062 8055592153 Bacteria 5961247
1674 8056443519 8056440228 Bacteria 4946504
1675 Ga0070714_100091865
1676 SwRhRL2b_contig_1663050
1677 SwRhRL2b_contig_843371
1678 JGI24740J21852_10011805
1679 JGI24742J22300_10012118
1680 JGI24751J29686_10001390
1681 JGI25162J39368_1001033
1682 JGI25154J39366_1000001
1683 JGI25157J39369_1004835
1684 JGI25406J46586_10027139
1685 JGI25165J46597_1000678
1686 JGI25153J46596_10002304
1687 JGI25153J46596_10013567
1688 rootH1_10136973
1689 rootH2_10003970
1690 rootL2_10010167
1691 rootL2_10011247
1692 rootL2_10134610
1693 rootH1_10002303
1694 rootH1_10006684
1695 rootH1_10008389
1696 rootH1_10093451
1697 JGI25160J50197_1001095
1698 JGI25160J50197_1014301
1699 JGI25160J50197_1014801
1700 Ga0055526_1004445
1701 Ga0055528_1000330
1702 Ga0055530_10000331
1703 Ga0055531_10000166
1704 Ga0058859_11782699
1705 Ga0058863_10160658
1706 Ga0058861_10035234
1707 Ga0058862_10235727
1708 Ga0065165_1000105
1709 Ga0065165_1029860
1710 Ga0065704_10070140
1711 Ga0065712_10002231
1712 Ga0065712_10010764
1713 Ga0065712_10085595
1714 Ga0065715_10015110
1715 Ga0065707_10103016
1716 Ga0065707_10104946
1717 Ga0070658_10000153
1718 Ga0070658_10015118
1719 Ga0070658_10178279
1720 Ga0070658_10197163
1721 Ga0070676_10006513
1722 Ga0070676_10032136
1723 Ga0070676_10080339
1724 Ga0070676_10152918
1725 Ga0070683_100001488
1726 Ga0070683_100005896
1727 Ga0070683_100012473
1728 Ga0070683_100017135
1729 Ga0070683_100025159
1730 Ga0070683_100077142
1731 Ga0070683_100538044
1732 Ga0070690_100187616
1733 Ga0070670_100024841
1734 Ga0070670_100109804
1735 Ga0070670_100112700
1736 Ga0070670_100158102
1737 Ga0070670_100208061
1738 Ga0070670_100402814
1739 Ga0070670_100403495
1740 Ga0070677_10004196
1741 Ga0070677_10044332
1742 Ga0068869_100017755
1743 Ga0068869_100044651
1744 Ga0068869_100086467
1745 Ga0068869_100089860
1746 Ga0068869_100093571
1747 Ga0068869_100164027
1748 Ga0068869_100210212
1749 Ga0070666_10000036
1750 Ga0070666_10000191
1751 Ga0070666_10018000
1752 Ga0070666_10025993
1753 Ga0070666_10150569
1754 Ga0070666_10254744
1755 Ga0070680_100013277
1756 Ga0070680_100067285
1757 Ga0070680_100116857
1758 Ga0070682_100000039
1759 Ga0070682_100089459
1760 Ga0070682_100264042
1761 Ga0068868_100015404
1762 Ga0068868_100017514
1763 Ga0068868_100031254
1764 Ga0068868_100059381
1765 Ga0068868_100092027
1766 Ga0068868_100123647
1767 Ga0068868_100140461
1768 Ga0068868_100198642
1769 Ga0068868_100245478
1770 Ga0070660_100003216
1771 Ga0070660_100014027
1772 Ga0070660_100218767
1773 Ga0070689_100021681
1774 Ga0070689_100041808
1775 Ga0070689_100459164
1776 Ga0070689_100464723
1777 Ga0070687_100003733
1778 Ga0070687_100118591
1779 Ga0070687_100128780
1780 Ga0070661_100004113
1781 Ga0070661_100040565
1782 Ga0070661_100127366
1783 Ga0070668_100017989
1784 Ga0070668_100025286
1785 Ga0070668_100050126
1786 Ga0070668_100155369
1787 Ga0070668_100221200
1788 Ga0070668_100240917
1789 Ga0070669_100002748
1790 Ga0070669_100024124
1791 Ga0070669_100324133
1792 Ga0070669_100357409
1793 Ga0070669_100422330
1794 Ga0070675_100014978
1795 Ga0070675_100018472
1796 Ga0070675_100027474
1797 Ga0070675_100090601
1798 Ga0070675_100120096
1799 Ga0070675_100129605
1800 Ga0070675_100143049
1801 Ga0070675_100182345
1802 Ga0070675_100304522
1803 Ga0070675_100348087
1804 Ga0070671_100027874
1805 Ga0070671_100030657
1806 Ga0070671_100231072
1807 Ga0070674_100065684
1808 Ga0070674_100085764
1809 Ga0070674_100141927
1810 Ga0070674_100196180
1811 Ga0070674_100363637
1812 Ga0070673_100003757
1813 Ga0070673_100030215
1814 Ga0070673_100051881
1815 Ga0070673_100052967
1816 Ga0070673_100075958
1817 Ga0070688_100018933
1818 Ga0070688_100028135
1819 Ga0070688_100046149
1820 Ga0070688_100252148
1821 Ga0070659_100000375
1822 Ga0070659_100006862
1823 Ga0070659_100008718
1824 Ga0070659_100010418
1825 Ga0070659_100019947
1826 Ga0070659_100131467
1827 Ga0070659_100451776
1828 Ga0070667_100000248
1829 Ga0070667_100004111
1830 Ga0070667_100162213
1831 Ga0070667_100187787
1832 Ga0070701_10094050
1833 Ga0070694_100152300
1834 Ga0070663_100099434
1835 Ga0070663_100314890
1836 Ga0070678_100047685
1837 Ga0070678_100083322
1838 Ga0070678_100124839
1839 Ga0070678_100480475
1840 Ga0070662_100004284
1841 Ga0070662_100017708
1842 Ga0070662_100033746
1843 Ga0070662_100040845
1844 Ga0070662_100044485
1845 Ga0070681_10007373
1846 Ga0070681_10013404
1847 Ga0070681_10134747
1848 Ga0070681_10206234
1849 Ga0070681_10281961
1850 Ga0070681_10335318
1851 Ga0068867_100011408
1852 Ga0068867_100011837
1853 Ga0068867_100027040
1854 Ga0068867_100031243
1855 Ga0068867_100067838
1856 Ga0068867_100162442
1857 Ga0070685_10040228
1858 Ga0070698_100002339
1859 Ga0070698_100002802
1860 Ga0070698_100021125
1861 Ga0070698_100171178
1862 Ga0070698_100241874
1863 Ga0070679_100008990
1864 Ga0070679_100018790
1865 Ga0070679_100033271
1866 Ga0070679_100050377
1867 Ga0070679_100075214
1868 Ga0070679_100095843
1869 Ga0070679_100237177
1870 Ga0070684_100006342
1871 Ga0070684_100008945
1872 Ga0070684_100046353
1873 Ga0070684_100069741
1874 Ga0070684_100193764
1875 Ga0068853_100000250
1876 Ga0068853_100013022
1877 Ga0068853_100039651
1878 Ga0068853_100042470
1879 Ga0068853_100104703
1880 Ga0068853_100107889
1881 Ga0068853_100110853
1882 Ga0068853_100187386
1883 Ga0068853_100368358
1884 Ga0068853_100451765
1885 Ga0070672_100001565
1886 Ga0070672_100010480
1887 Ga0070672_100043706
1888 Ga0070672_100058329
1889 Ga0070672_100140535
1890 Ga0070672_100188929
1891 Ga0070672_100206540
1892 Ga0070686_100018261
1893 Ga0070665_100000641
1894 Ga0070665_100045444
1895 Ga0070704_100100614
1896 Ga0068855_100000133
1897 Ga0068855_100000360
1898 Ga0068855_100000943
1899 Ga0068855_100002973
1900 Ga0068855_100012444
1901 Ga0068855_100033030
1902 Ga0068855_100044845
1903 Ga0068855_100051562
1904 Ga0068855_100058670
1905 Ga0068855_100062928
1906 Ga0068855_100076304
1907 Ga0068855_100091980
1908 Ga0068855_100161856
1909 Ga0068855_100243559
1910 Ga0068855_100424043
1911 Ga0068855_100651942
1912 Ga0070664_100011300
1913 Ga0070664_100041775
1914 Ga0070664_100084099
1915 Ga0068857_100014365
1916 Ga0068857_100018409
1917 Ga0068857_100036731
1918 Ga0068857_100040938
1919 Ga0068857_100063035
1920 Ga0068857_100085136
1921 Ga0068857_100119536
1922 Ga0068857_100131593
1923 Ga0068857_100181708
1924 Ga0068857_100387469
1925 Ga0068854_100048602
1926 Ga0068854_100068418
1927 Ga0068854_100115716
1928 Ga0068854_100132693
1929 Ga0068854_100172563
1930 Ga0068854_100217848
1931 Ga0068856_100001358
1932 Ga0068856_100003057
1933 Ga0068856_100010526
1934 Ga0068856_100064411
1935 Ga0068856_100136033
1936 Ga0068856_100183027
1937 Ga0068856_100248124
1938 Ga0068856_100540272
1939 Ga0070702_100049731
1940 Ga0070702_100411382
1941 Ga0068852_100001842
1942 Ga0068852_100025622
1943 Ga0068852_100052504
1944 Ga0068852_100054084
1945 Ga0068852_100087742
1946 Ga0068852_100102354
1947 Ga0068852_100370778
1948 Ga0068852_100755508
1949 Ga0068859_100000037
1950 Ga0068859_100002491
1951 Ga0068859_100040242
1952 Ga0068859_100076436
1953 Ga0068859_100226291
1954 Ga0068859_100272899
1955 Ga0068859_100573453
1956 Ga0068864_100001656
1957 Ga0068864_100002302
1958 Ga0068864_100005468
1959 Ga0068864_100078002
1960 Ga0068864_100107079
1961 Ga0068864_100186490
1962 Ga0068864_100294411
1963 Ga0068864_100332687
1964 Ga0068866_10069033
1965 Ga0068861_100006643
1966 Ga0068861_100051617
1967 Ga0068861_100121125
1968 Ga0068861_100134738
1969 Ga0068861_100209084
1970 Ga0068861_100270865
1971 Ga0068861_100466181
1972 Ga0068861_100713820
1973 Ga0068851_10000177
1974 Ga0068851_10001337
1975 Ga0068851_10072821
1976 Ga0068851_10160301
1977 Ga0068851_10190946
1978 Ga0068870_10021607
1979 Ga0068870_10035377
1980 Ga0068863_100001373
1981 Ga0068863_100002925
1982 Ga0068863_100088110
1983 Ga0068863_100114726
1984 Ga0068863_100262671
1985 Ga0068863_100428533
1986 Ga0068858_100004320
1987 Ga0068858_100053182
1988 Ga0068858_100109140
1989 Ga0068858_100606767
1990 Ga0068860_100000097
1991 Ga0068860_100005547
1992 Ga0068860_100007830
1993 Ga0068860_100010482
1994 Ga0068860_100018429
1995 Ga0068860_100030843
1996 Ga0068860_100032138
1997 Ga0068860_100036448
1998 Ga0068860_100081681
1999 Ga0068860_100167592
2000 Ga0068860_100280934
2001 Ga0068862_100015311
2002 Ga0068862_100032080
2003 Ga0068862_100099860
2004 Ga0068862_100156109
2005 Ga0068862_100491878
2006 Ga0081540_1010032
2007 Ga0081539_10002233
2008 Ga0070715_10073647
2009 Ga0075366_10006763
2010 Ga0075366_10031189
2011 Ga0075366_10034049
2012 Ga0075366_10200750
2013 Ga0097621_100003401
2014 Ga0097621_100036790
2015 Ga0097621_100046779
2016 Ga0097621_100049443
2017 Ga0097621_100084088
2018 Ga0097621_100096686
2019 Ga0097621_100371519
2020 Ga0075370_10019967
2021 Ga0075370_10186709
2022 Ga0068871_100000955
2023 Ga0068871_100002544
2024 Ga0068871_100076419
2025 Ga0068871_100108578
2026 Ga0068871_100249205
2027 Ga0075428_100044984
2028 Ga0075428_100140238
2029 Ga0075428_100285496
2030 Ga0075430_100135661
2031 Ga0075431_100019798
2032 Ga0075431_100034168
2033 Ga0075429_100003790
2034 Ga0075429_100020740
2035 Ga0075429_100060787
2036 Ga0068865_100001794
2037 Ga0068865_100038915
2038 Ga0068865_100114198
2039 Ga0068865_100311402
2040 Ga0097620_100000037
2041 Ga0097620_100000536
2042 Ga0097620_100002491
2043 Ga0097620_100040243
2044 Ga0097620_100076429
2045 Ga0097620_100226288
2046 Ga0097620_100272888
2047 Ga0097620_100573436
2048 Ga0105240_10000398
2049 Ga0105240_10011002
2050 Ga0105240_10011307
2051 Ga0105240_10023972
2052 Ga0105240_10041987
2053 Ga0105240_10078219
2054 Ga0105240_10088645
2055 Ga0105240_10100052
2056 Ga0105240_10167583
2057 Ga0105240_10173346
2058 Ga0105240_10182600
2059 Ga0105240_10291130
2060 Ga0105240_10331805
2061 Ga0105240_10350445
2062 Ga0105240_10404513
2063 Ga0105240_10976799
2064 Ga0111539_10013971
2065 Ga0111539_10014550
2066 Ga0111539_10044551
2067 Ga0111539_10620757
2068 Ga0105245_10068029
2069 Ga0105247_10002304
2070 Ga0105247_10015344
2071 Ga0114129_10006463
2072 Ga0114129_10303837
2073 Ga0105243_10000009
2074 Ga0105243_10077196
2075 Ga0105241_10007590
2076 Ga0105241_10009907
2077 Ga0105241_10014100
2078 Ga0105241_10037723
2079 Ga0105241_10206141
2080 Ga0105241_10617977
2081 Ga0105241_10682033
2082 Ga0105242_10045717
2083 Ga0105242_10055628
2084 Ga0105242_10102158
2085 Ga0105242_10134109
2086 Ga0105242_10184821
2087 Ga0105242_10200555
2088 Ga0105242_10521824
2089 Ga0105248_10034629
2090 Ga0105248_10052937
2091 Ga0105248_10464039
2092 Ga0105237_10001588
2093 Ga0105237_10001799
2094 Ga0105237_10011322
2095 Ga0105237_10014365
2096 Ga0105237_10022954
2097 Ga0105237_10030759
2098 Ga0105237_10035876
2099 Ga0105237_10069245
2100 Ga0105237_10268972
2101 Ga0105237_10331462
2102 Ga0105237_10738669
2103 Ga0105238_10170225
2104 Ga0105249_10000806
2105 Ga0105249_10001080
2106 Ga0105249_10005412
2107 Ga0105249_10025715
2108 Ga0105249_10029956
2109 Ga0105249_10075766
2110 Ga0105249_10077951
2111 Ga0105249_10411381
2112 Ga0105239_10000431
2113 Ga0105239_10000436
2114 Ga0105239_10004090
2115 Ga0105239_10007869
2116 Ga0105239_10033863
2117 Ga0105239_10067944
2118 Ga0105239_10122693
2119 Ga0105239_10148001
2120 Ga0105239_10188341
2121 Ga0105239_10198084
2122 Ga0105239_10205263
2123 Ga0105239_10240840
2124 Ga0105239_10241163
2125 Ga0105239_10246419
2126 Ga0105239_10468937
2127 Ga0105246_10021096
2128 Ga0105246_10124550
2129 Ga0105246_10158325
2130 Ga0157373_10000129
2131 Ga0157373_10008302
2132 Ga0157373_10018478
2133 Ga0157373_10025943
2134 Ga0157373_10041402
2135 Ga0157373_10123108
2136 Ga0157373_10175037
2137 Ga0157373_10180217
2138 Ga0157373_10318646
2139 Ga0157373_10344172
2140 Ga0157371_10003367
2141 Ga0157371_10015121
2142 Ga0157371_10016670
2143 Ga0157371_10021771
2144 Ga0157371_10023444
2145 Ga0157371_10024281
2146 Ga0157371_10032716
2147 Ga0157371_10036963
2148 Ga0157371_10043957
2149 Ga0157371_10054932
2150 Ga0157371_10078103
2151 Ga0157371_10102478
2152 Ga0157371_10279688
2153 Ga0157370_10000926
2154 Ga0157370_10006378
2155 Ga0157370_10009487
2156 Ga0157370_10011345
2157 Ga0157370_10017050
2158 Ga0157370_10022725
2159 Ga0157370_10025354
2160 Ga0157370_10047165
2161 Ga0157370_10070629
2162 Ga0157370_10113930
2163 Ga0157370_10119429
2164 Ga0157370_10259572
2165 Ga0157369_10004050
2166 Ga0157369_10007412
2167 Ga0157369_10012941
2168 Ga0157369_10019086
2169 Ga0157369_10022720
2170 Ga0157369_10038761
2171 Ga0157369_10063647
2172 Ga0157369_10083535
2173 Ga0157369_10100758
2174 Ga0157369_10115086
2175 Ga0157369_10184333
2176 Ga0157369_10206180
2177 Ga0157369_10310068
2178 Ga0157369_10597173
2179 Ga0157374_10000001
2180 Ga0157374_10000500
2181 Ga0157374_10008968
2182 Ga0157374_10009009
2183 Ga0157374_10071962
2184 Ga0157374_10126640
2185 Ga0157374_10173144
2186 Ga0157374_10263632
2187 Ga0157374_10497665
2188 Ga0157374_10589365
2189 Ga0157374_10704437
2190 Ga0157378_10006065
2191 Ga0157378_10008184
2192 Ga0157378_10012000
2193 Ga0157378_10021595
2194 Ga0157378_10025313
2195 Ga0157378_10041061
2196 Ga0157378_10103113
2197 Ga0157378_10152599
2198 Ga0157378_10191806
2199 Ga0157378_10389252
2200 Ga0163162_10001595
2201 Ga0163162_10006110
2202 Ga0163162_10008143
2203 Ga0163162_10012931
2204 Ga0163162_10024199
2205 Ga0163162_10025579
2206 Ga0163162_10096425
2207 Ga0163162_10106731
2208 Ga0163162_10115627
2209 Ga0163162_10163494
2210 Ga0163162_10280429
2211 Ga0163162_10294393
2212 Ga0163162_10299937
2213 Ga0163162_10300778
2214 Ga0163162_10391437
2215 Ga0163162_10443296
2216 Ga0163162_10465402
2217 Ga0157372_10000030
2218 Ga0157372_10000332
2219 Ga0157372_10003109
2220 Ga0157372_10003430
2221 Ga0157372_10016323
2222 Ga0157372_10016644
2223 Ga0157372_10018713
2224 Ga0157372_10020775
2225 Ga0157372_10029769
2226 Ga0157372_10051126
2227 Ga0157372_10210537
2228 Ga0157372_10214740
2229 Ga0157372_10239188
2230 Ga0157372_10247490
2231 Ga0157372_10252119
2232 Ga0157372_10377770
2233 Ga0157372_10430482
2234 Ga0157372_10552695
2235 Ga0157372_10558901
2236 Ga0157372_10589587
2237 Ga0157372_10948156
2238 Ga0157375_10001463
2239 Ga0157375_10005027
2240 Ga0157375_10010453
2241 Ga0157375_10012841
2242 Ga0157375_10082979
2243 Ga0157375_10090738
2244 Ga0157375_10094808
2245 Ga0157375_10101632
2246 Ga0157375_10128521
2247 Ga0157375_10153729
2248 Ga0157375_10208620
2249 Ga0157375_10253294
2250 Ga0157375_10603302
2251 Ga0157375_10827917
2252 Ga0163163_10001501
2253 Ga0163163_10036393
2254 Ga0163163_10054019
2255 Ga0163163_10089831
2256 Ga0163163_10092201
2257 Ga0163163_10152284
2258 Ga0163163_10300122
2259 Ga0157380_10008895
2260 Ga0157380_10030118
2261 Ga0157380_10065873
2262 Ga0157380_10071748
2263 Ga0157380_10113108
2264 Ga0157377_10021210
2265 Ga0157377_10069334
2266 Ga0157379_10000845
2267 Ga0157379_10008284
2268 Ga0157379_10036538
2269 Ga0157379_10495784
2270 Ga0157376_10008523
2271 Ga0157376_10022078
2272 Ga0157376_10040602
2273 Ga0157376_10043577
2274 Ga0157376_10083403
2275 Ga0157376_10105537
2276 Ga0157376_10135197
2277 Ga0157376_10250506
2278 Ga0157376_10516013
2279 Ga0182005_1000147
2280 Ga0163161_10001357
2281 Ga0163161_10012104
2282 Ga0163161_10015767
2283 Ga0163161_10076648
2284 Ga0163161_10146216
2285 Ga0197907_10169535
2286 Ga0206356_10575773
2287 Ga0206351_10170033
2288 Ga0206351_10512829
2289 Ga0206352_10703535
2290 Ga0206352_10938790
2291 Ga0206350_10057460
2292 Ga0206350_10752456
2293 Ga0206354_10778573
2294 Ga0206353_10311699
2295 Ga0154015_1495562
2296 Ga0213872_10013117
2297 Ga0213876_10007626
2298 Ga0224712_10003582
2299 Ga0224712_10014571
2300 Ga0209436_100232
2301 Ga0209436_104962
2302 Ga0207427_100025
2303 Ga0209437_100010
2304 Ga0209437_100135
2305 Ga0209646_1000002
2306 Ga0209646_1001434
2307 Ga0209646_1004416
2308 Ga0209026_1000299
2309 Ga0209026_1000610
2310 Ga0209026_1004981
2311 Ga0209148_1000090
2312 Ga0209129_1004506
2313 Ga0209233_1000017
2314 Ga0209233_1001329
2315 Ga0209673_1000034
2316 Ga0209130_1001055
2317 Ga0209564_1014913
2318 Ga0209758_1001438
2319 Ga0209050_1000207
2320 Ga0207426_1000105
2321 Ga0207426_1000603
2322 Ga0207426_1000813
2323 Ga0207426_1001314
2324 Ga0209257_1000001
2325 Ga0209257_1000007
2326 Ga0209257_1001824
2327 Ga0207697_10008960
2328 Ga0207697_10045796
2329 Ga0207656_10000055
2330 Ga0207656_10010030
2331 Ga0207656_10102743
2332 Ga0207656_10171442
2333 Ga0207682_10003346
2334 Ga0207682_10006454
2335 Ga0207642_10027020
2336 Ga0207642_10049589
2337 Ga0207710_10002332
2338 Ga0207710_10020859
2339 Ga0207688_10010099
2340 Ga0207680_10045258
2341 Ga0207680_10061291
2342 Ga0207680_10177908
2343 Ga0207647_10000110
2344 Ga0207647_10000171
2345 Ga0207647_10009094
2346 Ga0207647_10020448
2347 Ga0207647_10025805
2348 Ga0207645_10002136
2349 Ga0207645_10025677
2350 Ga0207645_10044737
2351 Ga0207645_10163618
2352 Ga0207643_10001724
2353 Ga0207643_10006929
2354 Ga0207643_10152178
2355 Ga0207705_10000108
2356 Ga0207705_10011466
2357 Ga0207705_10018682
2358 Ga0207705_10024219
2359 Ga0207705_10052283
2360 Ga0207705_10088880
2361 Ga0207705_10208863
2362 Ga0207705_10257291
2363 Ga0207654_10000881
2364 Ga0207654_10002705
2365 Ga0207654_10036156
2366 Ga0207654_10080916
2367 Ga0207707_10011329
2368 Ga0207707_10075844
2369 Ga0207707_10260837
2370 Ga0207695_10000053
2371 Ga0207695_10000064
2372 Ga0207695_10000076
2373 Ga0207695_10000084
2374 Ga0207695_10000090
2375 Ga0207695_10004647
2376 Ga0207695_10015473
2377 Ga0207695_10026373
2378 Ga0207695_10033343
2379 Ga0207695_10081967
2380 Ga0207695_10084771
2381 Ga0207695_10273350
2382 Ga0207671_10000149
2383 Ga0207671_10003750
2384 Ga0207671_10004543
2385 Ga0207671_10007320
2386 Ga0207671_10010466
2387 Ga0207671_10032778
2388 Ga0207671_10037137
2389 Ga0207671_10040157
2390 Ga0207671_10060090
2391 Ga0207671_10069197
2392 Ga0207671_10278244
2393 Ga0207660_10006449
2394 Ga0207660_10024417
2395 Ga0207660_10048131
2396 Ga0207662_10027651
2397 Ga0207662_10092496
2398 Ga0207657_10009979
2399 Ga0207657_10036828
2400 Ga0207657_10041700
2401 Ga0207657_10049438
2402 Ga0207657_10050001
2403 Ga0207657_10062662
2404 Ga0207657_10292539
2405 Ga0207649_10005479
2406 Ga0207649_10188195
2407 Ga0207652_10000064
2408 Ga0207652_10000387
2409 Ga0207652_10002830
2410 Ga0207652_10041607
2411 Ga0207652_10108992
2412 Ga0207652_10250009
2413 Ga0207652_10298183
2414 Ga0207652_10441296
2415 Ga0207681_10015241
2416 Ga0207681_10073899
2417 Ga0207681_10353840
2418 Ga0207694_10017481
2419 Ga0207694_10253517
2420 Ga0207650_10014881
2421 Ga0207650_10066694
2422 Ga0207650_10074981
2423 Ga0207650_10077520
2424 Ga0207650_10093786
2425 Ga0207650_10120271
2426 Ga0207650_10167486
2427 Ga0207650_10206413
2428 Ga0207650_10492599
2429 Ga0207659_10009764
2430 Ga0207659_10033056
2431 Ga0207659_10101095
2432 Ga0207659_10119153
2433 Ga0207659_10172238
2434 Ga0207659_10192518
2435 Ga0207659_10327100
2436 Ga0207659_10420269
2437 Ga0207644_10012415
2438 Ga0207644_10021869
2439 Ga0207644_10024620
2440 Ga0207644_10059737
2441 Ga0207644_10140731
2442 Ga0207644_10251118
2443 Ga0207690_10002170
2444 Ga0207690_10004744
2445 Ga0207690_10012751
2446 Ga0207690_10020857
2447 Ga0207690_10024446
2448 Ga0207690_10057621
2449 Ga0207706_10006478
2450 Ga0207706_10009371
2451 Ga0207706_10029582
2452 Ga0207706_10037951
2453 Ga0207706_10068145
2454 Ga0207686_10111562
2455 Ga0207686_10127335
2456 Ga0207686_10231570
2457 Ga0207709_10000026
2458 Ga0207670_10014554
2459 Ga0207670_10486727
2460 Ga0207670_10529657
2461 Ga0207669_10005569
2462 Ga0207669_10235181
2463 Ga0207669_10344098
2464 Ga0207704_10003038
2465 Ga0207704_10039066
2466 Ga0207665_10026619
2467 Ga0207691_10000001
2468 Ga0207691_10002741
2469 Ga0207691_10019043
2470 Ga0207691_10027644
2471 Ga0207691_10075279
2472 Ga0207691_10176679
2473 Ga0207711_10092009
2474 Ga0207711_10182599
2475 Ga0207711_10191822
2476 Ga0207689_10005396
2477 Ga0207689_10010127
2478 Ga0207689_10014249
2479 Ga0207689_10018050
2480 Ga0207689_10045231
2481 Ga0207689_10075403
2482 Ga0207689_10088584
2483 Ga0207689_10101705
2484 Ga0207689_10182503
2485 Ga0207689_10195708
2486 Ga0207689_10347595
2487 Ga0207689_10472712
2488 Ga0207661_10005126
2489 Ga0207661_10008212
2490 Ga0207661_10009193
2491 Ga0207661_10019703
2492 Ga0207661_10031577
2493 Ga0207661_10178861
2494 Ga0207679_10000875
2495 Ga0207679_10050461
2496 Ga0207679_10156469
2497 Ga0207679_10214537
2498 Ga0207679_10226523
2499 Ga0207679_10340064
2500 Ga0207667_10000430
2501 Ga0207667_10000453
2502 Ga0207667_10001484
2503 Ga0207667_10003602
2504 Ga0207667_10005923
2505 Ga0207667_10009521
2506 Ga0207667_10059200
2507 Ga0207667_10073069
2508 Ga0207667_10087826
2509 Ga0207667_10095966
2510 Ga0207667_10182531
2511 Ga0207667_10211301
2512 Ga0207667_10329536
2513 Ga0207667_10387114
2514 Ga0207667_10741997
2515 Ga0207651_10053397
2516 Ga0207651_10087831
2517 Ga0207651_10621071
2518 Ga0207712_10014683
2519 Ga0207712_10016131
2520 Ga0207712_10016968
2521 Ga0207712_10026663
2522 Ga0207712_10082897
2523 Ga0207712_10224168
2524 Ga0207712_10235773
2525 Ga0207712_10473219
2526 Ga0207668_10000869
2527 Ga0207668_10015084
2528 Ga0207668_10067188
2529 Ga0207668_10074158
2530 Ga0207668_10074644
2531 Ga0207668_10149486
2532 Ga0207668_10215357
2533 Ga0207668_10422993
2534 Ga0207640_10016977
2535 Ga0207640_10020295
2536 Ga0207640_10025047
2537 Ga0207640_10031753
2538 Ga0207640_10074633
2539 Ga0207640_10219281
2540 Ga0207640_10240337
2541 Ga0207658_10002877
2542 Ga0207658_10012999
2543 Ga0207658_10051578
2544 Ga0207677_10067295
2545 Ga0207677_10102638
2546 Ga0207677_10177581
2547 Ga0207677_10212621
2548 Ga0207703_10004088
2549 Ga0207703_10176996
2550 Ga0207639_10003633
2551 Ga0207639_10009134
2552 Ga0207639_10022533
2553 Ga0207639_10060496
2554 Ga0207639_10138059
2555 Ga0207639_10268603
2556 Ga0207639_10568927
2557 Ga0207678_10137308
2558 Ga0207678_10154438
2559 Ga0207678_10172372
2560 Ga0207708_10058905
2561 Ga0207708_10119848
2562 Ga0207702_10001407
2563 Ga0207702_10056726
2564 Ga0207702_10085669
2565 Ga0207702_10115561
2566 Ga0207702_10209740
2567 Ga0207702_10263405
2568 Ga0207641_10000121
2569 Ga0207641_10005564
2570 Ga0207641_10025754
2571 Ga0207641_10029136
2572 Ga0207641_10030020
2573 Ga0207641_10091863
2574 Ga0207641_10343578
2575 Ga0207648_10003053
2576 Ga0207648_10009109
2577 Ga0207648_10014701
2578 Ga0207648_10027181
2579 Ga0207648_10028462
2580 Ga0207648_10148136
2581 Ga0207648_10176788
2582 Ga0207648_10191611
2583 Ga0207648_10340042
2584 Ga0207676_10003342
2585 Ga0207676_10003799
2586 Ga0207676_10015259
2587 Ga0207676_10067110
2588 Ga0207676_10166766
2589 Ga0207676_10256460
2590 Ga0207676_10260843
2591 Ga0207676_10278588
2592 Ga0207674_10009949
2593 Ga0207674_10020554
2594 Ga0207674_10022667
2595 Ga0207674_10025546
2596 Ga0207674_10047480
2597 Ga0207674_10070646
2598 Ga0207674_10164835
2599 Ga0207674_10168628
2600 Ga0207674_10533724
2601 Ga0207674_10629089
2602 Ga0207674_10696855
2603 Ga0207675_100002059
2604 Ga0207675_100011158
2605 Ga0207675_100041609
2606 Ga0207675_100049685
2607 Ga0207675_100068632
2608 Ga0207675_100119254
2609 Ga0207675_100450484
2610 Ga0207675_100595456
2611 Ga0207683_10006890
2612 Ga0207683_10011072
2613 Ga0207683_10016244
2614 Ga0207683_10024454
2615 Ga0207683_10097053
2616 Ga0207683_10143867
2617 Ga0207683_10202465
2618 Ga0207698_10001488
2619 Ga0207698_10013166
2620 Ga0207698_10016613
2621 Ga0207698_10060388
2622 Ga0207698_10136904
2623 Ga0209984_1004458
2624 Ga0209968_1005122
2625 Ga0209968_1011246
2626 Ga0210002_1001494
2627 Ga0209983_1021655
2628 Ga0209998_10017630
2629 Ga0207428_10111837
2630 Ga0207428_10136352
2631 Ga0207428_10279999
2632 Ga0268266_10000038
2633 Ga0268266_10015422
2634 Ga0268266_10036671
2635 Ga0268265_10003503
2636 Ga0268265_10045098
2637 Ga0268265_10156749
2638 Ga0268265_10342236
2639 Ga0268264_10000167
2640 Ga0268264_10004208
2641 Ga0268264_10004870
2642 Ga0268264_10012086
2643 Ga0268264_10015090
2644 Ga0268264_10025918
2645 Ga0268264_10061228
2646 Ga0268264_10128293
2647 Ga0268264_10222733
2648 Ga0268264_10251911
2649 Ga0265323_10000040
2650 Ga0265336_10019263
2651 Ga0307517_10018578
2652 Ga0265338_10001855
2653 Ga0265338_10206753
2654 Ga0265324_10008522
2655 Ga0307511_10004717
2656 Ga0307512_10107163
2657 Ga0316177_1079276
2658 Ga0316176_1220529
2659 Ga0316183_1116825
2660 Ga0316181_1163475
2661 Ga0265331_10159692
2662 Ga0265327_10000097
2663 Ga0265327_10000159
2664 Ga0265327_10000244
2665 Ga0265327_10000298
2666 Ga0265327_10000370
2667 Ga0265327_10074641
2668 Ga0265327_10105046
2669 Ga0265327_10155339
2670 Ga0265316_10000486
2671 Ga0265316_10004409
2672 Ga0307513_10349076
2673 Ga0307513_10363487
2674 Ga0307509_10007469
2675 Ga0307408_100013046
2676 Ga0307408_100038382
2677 Ga0307408_100466746
2678 Ga0265342_10050150
2679 Ga0265342_10197336
2680 Ga0316576_10007854
2681 Ga0316576_10080879
2682 Ga0316576_10098247
2683 Ga0316576_10134476
2684 Ga0316578_10009003
2685 Ga0316578_10015477
2686 Ga0307516_10004268
2687 Ga0307405_10010819
2688 Ga0307405_10182283
2689 Ga0316577_10016238
2690 Ga0316577_10051389
2691 Ga0316577_10056390
2692 Ga0316577_10057199
2693 Ga0316577_10282233
2694 Ga0307413_10189650
2695 Ga0307410_10035292
2696 Ga0307410_10133130
2697 Ga0307410_10159428
2698 Ga0307406_10106862
2699 Ga0307406_10300089
2700 Ga0307407_10083520
2701 Ga0307407_10439711
2702 Ga0307412_10002740
2703 Ga0307412_10010885
2704 Ga0307412_10031955
2705 Ga0307412_10153514
2706 Ga0307409_100054022
2707 Ga0307416_100000249
2708 Ga0307416_100069247
2709 Ga0307416_100644143
2710 Ga0307414_10046410
2711 Ga0307414_10049268
2712 Ga0307414_10058567
2713 Ga0307414_10077937
2714 Ga0307414_10149592
2715 Ga0307414_10186541
2716 Ga0307414_10219916
2717 Ga0307414_10273647
2718 Ga0307414_10453617
2719 Ga0307411_10020538
2720 Ga0307411_10047021
2721 Ga0307411_10067723
2722 Ga0307415_100012733
2723 Ga0307415_100025311
2724 Ga0316580_10016205
2725 Ga0316580_10084222
2726 Ga0316580_10085624
2727 Ga0316593_10000279
2728 Ga0316593_10000712
2729 Ga0316593_10004976
2730 Ga0316593_10006916
2731 Ga0316593_10016946
2732 Ga0316593_10026606
2733 Ga0316593_10071614
2734 Ga0307510_10000380
2735 Ga0316592_1000047
2736 Ga0316592_1000131
2737 Ga0316592_1000317
2738 Ga0316592_1000414
2739 Ga0316592_1001892
2740 Ga0316592_1003234
2741 Ga0316592_1020447
2742 Ga0316592_1035762
2743 Ga0316586_1003187
2744 Ga0316586_1012203
2745 Ga0316588_1000234
2746 Ga0316588_1000295
2747 Ga0316588_1000569
2748 Ga0316596_1000052
2749 Ga0316596_1000106
2750 Ga0316596_1001428
2751 Ga0316596_1002332
2752 Ga0316596_1003798
2753 Ga0316596_1006124
2754 Ga0316596_1006577
2755 Ga0316596_1009489
2756 Ga0316596_1014496
2757 Ga0316596_1019782
2758 Ga0316596_1026385
2759 Ga0316596_1040079
2760 Ga0373955_0075643
2761 Ga0316574_0036503
2762 Ga0316574_0081697
2763 Ga0316574_0105203
2764 Ga0373935_0165867
2765 Ga0373927_0006959
2766 Ga0373937_0002462
2767 Ga0373937_0299425
2768 Ga0316582_0168172
2769 Ga0316582_0250448
2770 Ga0316584_0001842
2771 Ga0316584_0004403
2772 Ga0316584_0015050
2773 Ga0316584_0028755
2774 Ga0316584_0123064
2775 Ga0316584_0128854
2776 Ga0373925_0286730
2777 Ga0395899_0000034
2778 Ga0395899_0001127
2779 Ga0395899_0001602
2780 Ga0395899_0006152
2781 Ga0395899_0014673
2782 Ga0395899_0054207
2783 Ga0395900_0000346
2784 Ga0395900_0001482
2785 Ga0395900_0006693
2786 Ga0395900_0016502
2787 Ga0395900_0017444
2788 Ga0395900_0052980
2789 Ga0395900_0074436
2790 Ga0395900_0124849
2791 Ga0395900_0410611
2792 Ga0395898_0002718
2793 Ga0395898_0018836
2794 Ga0395898_0034336
2795 Ga0395898_0039390
2796 Ga0395898_0094771
2797 Ga0395898_0257000
2798 Ga0395898_0378729
2799 Ga0395898_0584577
2800 Ga0395905_0000001
2801 Ga0395905_0000376
2802 Ga0395905_0000528
2803 Ga0395905_0002823
2804 Ga0395905_0002993
2805 Ga0395905_0096577
2806 Ga0395905_0173952
2807 Ga0395905_0415359
2808 Ga0395901_0000351
2809 Ga0395901_0001115
2810 Ga0395901_0078192
2811 Ga0395901_0135999
2812 Ga0395901_0158362
2813 Ga0395901_0252291
2814 Ga0400483_219275
2815 Ga0436365_0472587
2816 Ga0436365_0781227
2817 Ga0436365_1312514
2818 Ga0436365_1690067
2819 Ga0436361_0986181
2820 Ga0436361_1211924
2821 Ga0439436_0004280
2822 Ga0439439_0010020
2823 Ga0439439_0018085
2824 Ga0439453_0020145
2825 Ga0439465_0022501
2826 Ga0439465_0069648
2827 Ga0439465_0110006
2828 Ga0451787_433472
2829 Ga0451795_0024876
2830 Ga0451837_0265238
2831 Ga0451837_0432158
2832 Ga0439431_0000777
2833 Ga0439431_0013148
2834 Ga0439431_0040544
2835 Ga0439433_0009272
2836 Ga0439433_0031284
2837 Ga0439445_0001922
2838 Ga0439445_0011234
2839 Ga0439448_0005262
2840 Ga0439449_0005508
2841 Ga0439449_0013615
2842 Ga0439449_0017442
2843 Ga0439454_014244
2844 Ga0439455_0032158
2845 Ga0439455_0052110
2846 Ga0439457_000313
2847 Ga0439462_0001031
2848 Ga0439462_0015306
2849 Ga0450923_013606
2850 Ga0450894_006068
2851 Ga0439446_0018535
2852 Ga0439434_0002227
2853 Ga0439434_0017713
2854 Ga0450918_016978
2855 Ga0450893_0021862
2856 Ga0451577_0004463
2857 Ga0451577_0014494
2858 Ga0451577_0030583
2859 Ga0451577_0035014
2860 Ga0451577_0048590
2861 Ga0451577_0053903
2862 Ga0451577_0058001
2863 Ga0451577_0091765
2864 Ga0451577_0092287
2865 Ga0451577_0160817
2866 Ga0451577_0184901
2867 Ga0451577_0223646
2868 Ga0451577_0274290
2869 Ga0451577_0281781
2870 Ga0451577_0281951
2871 Ga0466969_0000246
2872 Ga0466972_0000025
2873 Ga0466972_0043728
2874 Ga0453683_0000055
2875 Ga0453683_0000522
2876 Ga0453683_0000935
2877 Ga0453683_0005759
2878 Ga0453683_0007526
2879 Ga0453683_0049521
2880 Ga0453683_0082507
2881 Ga0453683_0099319
2882 Ga0466966_0001476
2883 Ga0466966_0022707
2884 Ga0466961_0096365
2885 Ga0466961_0114876
2886 Ga0466964_0026563
2887 Ga0453684_0000334
2888 Ga0453684_0000413
2889 Ga0453684_0000440
2890 Ga0453684_0000506
2891 Ga0453684_0001121
2892 Ga0453684_0001193
2893 Ga0453684_0001382
2894 Ga0453684_0001549
2895 Ga0453684_0004131
2896 Ga0453684_0005611
2897 Ga0453684_0012498
2898 Ga0453684_0013573
2899 Ga0453684_0014056
2900 Ga0453684_0025154
2901 Ga0453684_0032953
2902 Ga0453684_0033676
2903 Ga0453684_0040849
2904 Ga0453684_0046321
2905 Ga0453684_0048058
2906 Ga0453684_0050952
2907 Ga0453684_0055899
2908 Ga0453684_0056141
2909 Ga0453684_0059704
2910 Ga0453684_0060833
2911 Ga0453684_0065279
2912 Ga0453684_0074193
2913 Ga0453684_0092022
2914 Ga0453684_0093568
2915 Ga0453684_0100839
2916 Ga0453684_0108960
2917 Ga0453684_0133671
2918 Ga0453684_0145076
2919 Ga0453684_0258564
2920 Ga0453684_0261069
2921 Ga0453684_0435002
2922 Ga0466970_0000933
2923 Ga0466970_0032604
2924 Ga0466957_0001187
2925 Ga0466957_0009999
2926 Ga0466957_0025802
2927 Ga0466959_0000017
2928 Ga0466959_0017683
2929 Ga0466959_0019573
2930 Ga0451576_0000113
2931 Ga0451576_0001103
2932 Ga0451576_0005920
2933 Ga0451576_0010522
2934 Ga0451576_0011813
2935 Ga0451576_0017866
2936 Ga0451576_0018019
2937 Ga0451576_0021171
2938 Ga0451576_0030427
2939 Ga0451576_0051376
2940 Ga0451576_0071147
2941 Ga0451576_0099290
2942 Ga0451576_0197917
2943 Ga0451576_0224290
2944 Ga0451576_0254434
2945 Ga0451576_0360124
2946 Ga0451576_0460967
2947 Ga0451576_0909952
2948 Ga0495627_001896
2949 Ga0495603_0132226
2950 Ga0495638_0083919
2951 Ga0495638_0085990
2952 Ga0495653_0047662
2953 Ga0495650_0051591
2954 Ga0495580_0013181
2955 Ga0495582_0139876
2956 Ga0495662_0020123
2957 Ga0495664_0051957
2958 Ga0495583_0069279
2959 Ga0495606_0021306
2960 Ga0495606_0036258
2961 Ga0495608_0012072
2962 Ga0495608_0268649
2963 Ga0495616_0018996
2964 Ga0495616_0025587
2965 Ga0495618_0020169
2966 Ga0495628_0008937
2967 Ga0495628_0610950
2968 Ga0495630_0017830
2969 Ga0495630_0057161
2970 Ga0495630_0223347
2971 Ga0495643_0000294
2972 Ga0495643_0101174
2973 Ga0495644_0001340
2974 Ga0495648_0012032
2975 Ga0495652_0444576
2976 Ga0495640_0024578
2977 Ga0495587_0115395
2978 Ga0495645_0090453
2979 Ga0495633_0000049
2980 Ga0495668_0000108
2981 Ga0495668_0000191
2982 Ga0495668_0001518
2983 Ga0495634_0023809
2984 Ga0495634_0057670
2985 Ga0495611_0085828
2986 Ga0495611_0154893
2987 Ga0495625_0001933
2988 Ga0495625_0043576
2989 Ga0495625_0051559
2990 Ga0495625_0068664
2991 Ga0495625_0173757
2992 Ga0495657_0193260
2993 Ga0495658_0006331
2994 Ga0495613_0151946
2995 Ga0495613_0178582
2996 Ga0495670_0006417
2997 Ga0495670_0031502
2998 Ga0495671_0028507
2999 Ga0495649_0091156
3000 Ga0495600_0127185
3001 Ga0495600_0329392
3002 Ga0495604_0070404
3003 Ga0495636_0047537
3004 Ga0495674_0057426
3005 Ga0495674_0303326
3006 Ga0495672_0035964
3007 Ga0495672_0072609
3008 Ga0495676_0226161
3009 Ga0495676_0269599
3010 Ga0495680_0035982
3011 Ga0495687_000001
3012 Ga0495687_000233
3013 Ga0495675_0183580
3014 Ga0495685_011735
3015 Ga0495684_0242029
3016 Ga0495686_0000004
3017 Ga0495686_0039024
3018 Ga0495686_0085031
3019 Ga0496101_0196189
3020 Ga0496104_0295323
3021 Ga0496104_0327218
3022 Ga0496105_0087940
3023 Ga0496108_0488854
3024 Ga0496110_0131071
3025 Ga0496114_0473557
3026 Ga0496115_0034456
3027 Ga0496115_0265498
3028 Ga0496115_0337815
3029 Ga0496115_0525836
3030 Ga0496116_0019557
3031 Ga0496117_0001863
3032 Ga0496118_0200874
3033 Ga0496121_0000030
3034 Ga0496122_0008592
3035 Ga0496123_0014741
3036 Ga0496126_0030549
3037 Ga0501306_003537
3038 Ga0501305_000824
3039 Ga0501307_000646
3040 Ga0501311_000077
3041 Ga0501311_007027
3042 Ga0501312_002580
3043 Ga0501315_000974
3044 Ga0501316_000510
3045 Ga0501319_000002
3046 Ga0501032_0002362
3047 Ga0501032_0002936
3048 Ga0501032_0013633
3049 Ga0501032_0045337
3050 Ga0501033_0000011
3051 Ga0501033_0430138
3052 Ga0501034_0001265
3053 Ga0501034_0002020
3054 Ga0501034_0010858
3055 Ga0501034_0017257
3056 Ga0501034_0040721
3057 Ga0501034_0140017
3058 Ga0501034_0191568
3059 Ga0501034_0282372
3060 Ga0501036_0009955
3061 Ga0501036_0012794
3062 Ga0501036_0017036
3063 Ga0501036_0040807
3064 Ga0501037_0003904
3065 Ga0501037_0004877
3066 Ga0501037_0021814
3067 Ga0501037_0022979
3068 Ga0501037_0032648
3069 Ga0501038_0002395
3070 Ga0501038_0005905
3071 Ga0501038_0121981
3072 Ga0501038_0222597
3073 Ga0501039_0003523
3074 Ga0501039_0011642
3075 Ga0501039_0013024
3076 Ga0501043_0000733
3077 Ga0501043_0009337
3078 Ga0501043_0011452
3079 Ga0501043_0038700
3080 Ga0501043_0041852
3081 Ga0501046_0032361
3082 Ga0501046_0052113
3083 Ga0501046_0163745
3084 Ga0501047_0075953
3085 Ga0501047_0085641
3086 Ga0501047_0101654
3087 Ga0501047_0120170
3088 Ga0501047_0185593
3089 Ga0501047_0186349
3090 Ga0501047_0269762
3091 Ga0501047_0372115
3092 Ga0501048_0123290
3093 Ga0501067_0017620
3094 Ga0501068_0072633
3095 Ga0501069_0064770
3096 Ga0501069_0146770
3097 Ga0501070_0032644
3098 Ga0501070_0177402
3099 Ga0501072_0157654
3100 Ga0501072_0228144
3101 Ga0501073_0060516
3102 Ga0501073_0069872
3103 Ga0501074_0001790
3104 Ga0501201_002320
3105 Ga0501202_000998
3106 Ga0501202_007720
3107 Ga0501217_027892
3108 Ga0501223_030230
3109 Ga0501224_006724
3110 Ga0501236_000758
3111 Ga0501243_002414
3112 Ga0501257_003554
3113 Ga0501257_006334
3114 Ga0501257_009003
3115 Ga0501257_010822
3116 Ga0501257_021787
3117 Ga0501259_001205
3118 Ga0501261_001010
3119 Ga0501219_000689
3120 Ga0501221_018469
3121 Ga0501225_0004957
3122 Ga0501225_0014146
3123 Ga0501225_0031787
3124 Ga0501079_0067091
3125 Ga0501080_0032906
3126 Ga0501080_0096029
3127 Ga0501080_0152601
3128 Ga0501083_0085302
3129 Ga0501083_0110428
3130 Ga0501263_015504
3131 Ga0501264_000532
3132 Ga0501269_003046
3133 Ga0501272_008342
3134 Ga0501273_004702
3135 Ga0501035_0006062
3136 Ga0501035_0009077
3137 Ga0501035_0016384
3138 Ga0501035_0071324
3139 Ga0501035_0110040
3140 Ga0501035_0256134
3141 Ga0501044_0001293
3142 Ga0501044_0004248
3143 Ga0501044_0020175
3144 Ga0501044_0037946
3145 Ga0501044_0089863
3146 Ga0501044_0123100
3147 Ga0501044_0129939
3148 Ga0501044_0176664
3149 Ga0501045_0000053
3150 Ga0501284_00135
3151 nmdc:mga00v17_190208_c1
3152 nmdc:mga0k408_102103_c1
3153 nmdc:mga0k408_109494_c1
3154 nmdc:mga0k408_12089_c1
3155 nmdc:mga0k408_34214_c1
3156 nmdc:mga0k408_54179_c1
3157 nmdc:mga0k408_7017_c1
3158 nmdc:mga0k408_8427_c1
3159 nmdc:mga0k408_9728_c1
3160 nmdc:mga07m45_122395_c1
3161 nmdc:mga07m45_69219_c1
3162 nmdc:mga05p37_3944_c1
3163 nmdc:mga05p37_466479_c1
3164 nmdc:mga09592_4236_c1
3165 nmdc:mga09592_63156_c1
3166 nmdc:mga0qj67_85711_c1
3167 nmdc:mga06r32_145795_c1
3168 nmdc:mga06r32_46732_c1
3169 nmdc:mga08y16_10401_c1
3170 nmdc:mga08y16_106009_c1
3171 nmdc:mga08y16_26169_c1
3172 nmdc:mga08y16_342131_c1
3173 Ga0500635_0004581
3174 Ga0495619_0033330
3175 Ga0500578_0000136
3176 Ga0500578_0018759
3177 Ga0500644_0002759
3178 Ga0500581_059303
3179 Ga0500646_0005243
3180 Ga0500646_0007315
3181 Ga0500646_0029761
3182 Ga0500583_0000248
3183 Ga0500583_0003873
3184 Ga0500651_0061432
3185 Ga0500651_0107621
3186 Ga0500651_0108917
3187 Ga0500641_0021869
3188 Ga0500555_028876
3189 Ga0500556_0011703
3190 Ga0500562_000061
3191 Ga0500562_013235
3192 Ga0500569_000284
3193 Ga0500594_0009518
3194 Ga0500594_0011328
3195 Ga0500642_0007688
3196 Ga0500642_0030776
3197 Ga0500652_001629
3198 Ga0500652_021805
3199 Ga0500559_0019375
3200 Ga0500559_0062978
3201 Ga0500561_0029324
3202 Ga0500568_0000439
3203 Ga0500568_0013282
3204 Ga0500577_0000711
3205 Ga0500588_0045696
3206 Ga0500590_014980
3207 Ga0500616_0000013
3208 Ga0500616_0001754
3209 Ga0500616_0016628
3210 Ga0500622_0000113
3211 Ga0500622_0000133
3212 Ga0500622_0000156
3213 Ga0500622_0000385
3214 Ga0500622_0000655
3215 Ga0500622_0001823
3216 Ga0500622_0053963
3217 Ga0500624_000517
3218 Ga0500627_0009946
3219 Ga0500637_0160320
3220 Ga0500637_0261492
3221 Ga0500611_000032
3222 Ga0500645_003859
3223 Ga0500645_025794
3224 Ga0500661_005867
3225 Ga0587091_015081
3226 Ga0501082_0180686
3227 Ga0466962_0027756
3228 2513232367
3229 2520879531
3230 2524006227
3231 2585143578
3232 2585156581
3233 2585160768
3234 2587679968
3235 2587748626
3236 2587753464
3237 2587864992
3238 2588211483
3239 2588215865
3240 2588219287
3241 2588224765
3242 2588234600
3243 2588447560
3244 2590603187
3245 2590610208
3246 2599479391
3247 2644373930
3248 2644643938
3249 2644681833
3250 2722726168
3251 2729200764
3252 2738698384
3253 2738726202
3254 2738733068
3255 2738765606
3256 2738854392
3257 2739214649
3258 2739252710
3259 2739587944
3260 2739614405
3261 2739646663
3262 2740002835
3263 2740007652
3264 2740060422
3265 2753674200
3266 2765575672
3267 2772605776
3268 2775674346
3269 2802655257
3270 2816875518
3271 2817413549
3272 2819545820
3273 2819573333
3274 2819590244
3275 2819681069
3276 2821136745
3277 2833640623
3278 2839990124
3279 2842086249
3280 2842724287
3281 2842908305
3282 2842913579
3283 2849282609
3284 2852625403
3285 2857617048
3286 2857619717
3287 2857631642
3288 2871723598
3289 2881247573
3290 2881364101
3291 2881955871
3292 2883072442
3293 2884795844
3294 2884934414
3295 2889293824
3296 2890740672
3297 2895504000
3298 2896087577
3299 2896112703
3300 2896320847
3301 2898716199
3302 2903898660
3303 2904422400
3304 2904449060
3305 2904468510
3306 2904558494
3307 2904782778
3308 2906001181
3309 2906800771
3310 2911143829
3311 2914763464
3312 2919097961
3313 2919180388
3314 2919194219
3315 2919438008
3316 2919684616
3317 2919697455
3318 2928082299
3319 2928149122
3320 2929150605
3321 2929155011
3322 2929178591
3323 2929240968
3324 2929922992
3325 2932085011
3326 2945924807
3327 2945980999
3328 2945998890
3329 2946019598
3330 2946024079
3331 2954021333
3332 2958462002
3333 2958514497
3334 2965321921
3335 2977235844
3336 2977247760
3337 2977272077
3338 2984574444
3339 2984607893
3340 2993375109
3341 2993481973
3342 8003152326
3343 8036739266
3344 8054311427
3345 8055423584
3346 8055591295
3347 8055595062
3348 8056443519

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00181

Ribosomal_L2

Ribosomal Proteins L2, RNA binding domain

42

118

0.99

PF03947

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain

125

159

0.96

PF03947

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain

158

233

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.976 62 193
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.9478 62 193
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.9448 62 200
3iy9-assembly1.cif.gz_B leishmania tarentolae mitochondrial large ribosomal subunit model 0.8916 81 209
7qh6-assembly1.cif.gz_D cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 1 0.8559 62 219
ID Description Score Start End Superfamily
1rl2B01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9872 62 113 2.40.50.140
af_Q6R9C6_19_86_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.986 131 196 2.30.30.30
af_Q5A7P6_207_283_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9753 124 195 2.30.30.30
af_P92812_354_429_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9712 125 195 2.30.30.30
1vqoA02 Mainly Beta;Roll;SH3 type barrels.; 0.9706 121 195 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A0F2I9X1-F1-model_v4 50S ribosomal protein L2 0.9941 62 187 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-A0A3D1RTI2-F1-model_v4 50S ribosomal protein L2 0.9905 69 168 GO:0002181
GO:0003723
GO:0003735
GO:0005840
GO:1990904
AF-A0A5K1AQ75-F1-model_v4 Large ribosomal subunit protein uL2 RNA-binding domain-containing protein 0.9879 60 132 GO:0003723
GO:0003735
GO:0005762
GO:0032543
AF-A0A3D4Z242-F1-model_v4 50S ribosomal protein L2 0.9872 99 197 GO:0002181
GO:0003723
GO:0003735
GO:0005840
GO:1990904
AF-A0A3C1P018-F1-model_v4 50S ribosomal protein L2 0.9864 132 202 GO:0002181
GO:0003723
GO:0003735
GO:0005840
GO:1990904

Map