F495286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1674 | 584 | 3348 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100091865|Ga0070714_1000918654 |
| Length | 258 |
| Sequence | MGLRKYRPLTPSLRYKLSADFAEITTDKPEKSLVKPTKRSGGRNDTGKMTIRYIGGGHKKAYRVIDFKRDKDGIEGTVATVEYDPNRSARIALVVYKDGEKRYIIAPQGIQVGQKVMSGKGAAPEIGNTLLLSEIPLGTIIHNIELRPGQGAALSRSARMPSSEIRMILITCKATIGAVSNPDHNQEVHGKAGRRRWLGRRPRNRPVAMNPVDHPMGGGEGRASGGHPRSRKGLPAKGFKTRYKSKASNKHIIERRKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 230 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 231 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 232 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 241 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 256 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 279 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 280 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 281 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 282 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 285 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 286 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 287 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 288 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 291 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 295 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 296 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 297 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 298 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 299 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 300 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 301 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 302 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 303 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 309 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 310 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 399 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 400 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 401 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 402 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 404 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 405 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 406 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 407 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 408 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 409 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 410 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 415 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 416 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 417 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 418 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 419 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 423 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 425 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 434 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 437 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 438 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 439 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 442 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 443 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 444 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 446 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 447 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 448 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 449 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 450 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 451 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 452 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 455 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 456 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 458 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 459 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 460 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 461 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 464 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 465 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 466 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 467 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 468 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 469 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 470 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 471 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 472 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 473 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 474 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 475 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 476 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 477 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 478 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 479 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 480 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 481 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 482 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 483 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 484 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 485 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 486 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 487 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 488 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 489 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 490 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 491 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 492 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 493 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 494 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 495 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 496 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 497 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 498 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 499 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 500 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 501 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 502 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 503 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 504 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 505 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 506 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 507 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 508 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 509 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 510 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 511 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 512 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 513 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 514 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 515 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 516 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 517 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 518 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 519 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 520 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 521 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 522 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 523 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 524 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 525 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 526 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 527 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 528 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 529 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 530 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 531 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 532 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 533 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 534 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 535 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 536 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 537 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 538 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 539 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 540 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 541 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 542 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 543 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 544 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 545 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 546 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 547 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 548 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 549 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 550 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 551 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 552 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 553 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 554 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 555 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 556 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 557 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 558 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 559 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 560 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 561 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 562 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 563 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 564 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 565 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 566 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 567 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 568 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 569 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 570 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 571 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 572 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 573 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 574 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 575 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 576 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 577 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 578 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 579 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 580 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 581 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 582 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 583 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 584 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.25 |
| Metatranscriptomes | 3.52 |
| Isolates | 7.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 6.09 |
| Nodule | 0.06 |
| Rhizoplane | 0.84 |
| Rhizosphere | 87.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100091865 | 3300005435 | Bacteria | 2660 |
| 2 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 3 | SwRhRL2b_contig_843371 | 2162886007 | Bacteria | 4093 |
| 4 | JGI24740J21852_10011805 | 3300001979 | Bacteria | 3315 |
| 5 | JGI24742J22300_10012118 | 3300002244 | Bacteria | 1435 |
| 6 | JGI24751J29686_10001390 | 3300002459 | Bacteria | 5082 |
| 7 | JGI25162J39368_1001033 | 3300002737 | Bacteria | 17196 |
| 8 | JGI25154J39366_1000001 | 3300002738 | Bacteria | 483450 |
| 9 | JGI25157J39369_1004835 | 3300002741 | Bacteria | 2333 |
| 10 | JGI25406J46586_10027139 | 3300003203 | Bacteria | 2200 |
| 11 | JGI25165J46597_1000678 | 3300003214 | Bacteria | 27401 |
| 12 | JGI25153J46596_10002304 | 3300003215 | Bacteria | 11112 |
| 13 | JGI25153J46596_10013567 | 3300003215 | Bacteria | 3436 |
| 14 | rootH1_10136973 | 3300003316 | Bacteria | 2098 |
| 15 | rootH2_10003970 | 3300003320 | Bacteria | 33753 |
| 16 | rootL2_10010167 | 3300003322 | Bacteria | 22542 |
| 17 | rootL2_10011247 | 3300003322 | Bacteria | 9421 |
| 18 | rootL2_10134610 | 3300003322 | Bacteria | 2534 |
| 19 | rootH1_10002303 | 3300003323 | Bacteria | 27478 |
| 20 | rootH1_10006684 | 3300003323 | Bacteria | 9578 |
| 21 | rootH1_10008389 | 3300003323 | Bacteria | 21562 |
| 22 | rootH1_10093451 | 3300003323 | Bacteria | 1826 |
| 23 | JGI25160J50197_1001095 | 3300003354 | Bacteria | 13838 |
| 24 | JGI25160J50197_1014301 | 3300003354 | Bacteria | 2661 |
| 25 | JGI25160J50197_1014801 | 3300003354 | Bacteria | 2590 |
| 26 | Ga0055526_1004445 | 3300003771 | Bacteria | 8418 |
| 27 | Ga0055528_1000330 | 3300003790 | Bacteria | 39818 |
| 28 | Ga0055530_10000331 | 3300003791 | Bacteria | 42800 |
| 29 | Ga0055531_10000166 | 3300003794 | Bacteria | 74728 |
| 30 | Ga0058859_11782699 | 3300004798 | Bacteria | 2040 |
| 31 | Ga0058863_10160658 | 3300004799 | Bacteria | 11335 |
| 32 | Ga0058861_10035234 | 3300004800 | Bacteria | 8090 |
| 33 | Ga0058862_10235727 | 3300004803 | Bacteria | 2709 |
| 34 | Ga0065165_1000105 | 3300005262 | Bacteria | 140409 |
| 35 | Ga0065165_1029860 | 3300005262 | Bacteria | 1741 |
| 36 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 37 | Ga0065712_10002231 | 3300005290 | Bacteria | 7385 |
| 38 | Ga0065712_10010764 | 3300005290 | Bacteria | 1916 |
| 39 | Ga0065712_10085595 | 3300005290 | Bacteria | 2687 |
| 40 | Ga0065715_10015110 | 3300005293 | Bacteria | 2811 |
| 41 | Ga0065707_10103016 | 3300005295 | Bacteria | 2772 |
| 42 | Ga0065707_10104946 | 3300005295 | Bacteria | 2670 |
| 43 | Ga0070658_10000153 | 3300005327 | Bacteria | 60625 |
| 44 | Ga0070658_10015118 | 3300005327 | Bacteria | 6177 |
| 45 | Ga0070658_10178279 | 3300005327 | Bacteria | 1788 |
| 46 | Ga0070658_10197163 | 3300005327 | Bacteria | 1698 |
| 47 | Ga0070676_10006513 | 3300005328 | Bacteria | 6238 |
| 48 | Ga0070676_10032136 | 3300005328 | Bacteria | 3005 |
| 49 | Ga0070676_10080339 | 3300005328 | Bacteria | 1976 |
| 50 | Ga0070676_10152918 | 3300005328 | Bacteria | 1479 |
| 51 | Ga0070683_100001488 | 3300005329 | Bacteria | 18077 |
| 52 | Ga0070683_100005896 | 3300005329 | Bacteria | 10252 |
| 53 | Ga0070683_100012473 | 3300005329 | Bacteria | 7386 |
| 54 | Ga0070683_100017135 | 3300005329 | Bacteria | 6398 |
| 55 | Ga0070683_100025159 | 3300005329 | Bacteria | 5342 |
| 56 | Ga0070683_100077142 | 3300005329 | Bacteria | 3115 |
| 57 | Ga0070683_100538044 | 3300005329 | Bacteria | 1117 |
| 58 | Ga0070690_100187616 | 3300005330 | Bacteria | 1432 |
| 59 | Ga0070670_100024841 | 3300005331 | Bacteria | 5155 |
| 60 | Ga0070670_100109804 | 3300005331 | Bacteria | 2376 |
| 61 | Ga0070670_100112700 | 3300005331 | Bacteria | 2344 |
| 62 | Ga0070670_100158102 | 3300005331 | Bacteria | 1963 |
| 63 | Ga0070670_100208061 | 3300005331 | Bacteria | 1701 |
| 64 | Ga0070670_100402814 | 3300005331 | Bacteria | 1208 |
| 65 | Ga0070670_100403495 | 3300005331 | Bacteria | 1207 |
| 66 | Ga0070677_10004196 | 3300005333 | Bacteria | 4691 |
| 67 | Ga0070677_10044332 | 3300005333 | Bacteria | 1769 |
| 68 | Ga0068869_100017755 | 3300005334 | Bacteria | 4832 |
| 69 | Ga0068869_100044651 | 3300005334 | Bacteria | 3187 |
| 70 | Ga0068869_100086467 | 3300005334 | Bacteria | 2350 |
| 71 | Ga0068869_100089860 | 3300005334 | Bacteria | 2307 |
| 72 | Ga0068869_100093571 | 3300005334 | Bacteria | 2265 |
| 73 | Ga0068869_100164027 | 3300005334 | Bacteria | 1731 |
| 74 | Ga0068869_100210212 | 3300005334 | Bacteria | 1538 |
| 75 | Ga0070666_10000036 | 3300005335 | Bacteria | 119230 |
| 76 | Ga0070666_10000191 | 3300005335 | Bacteria | 42149 |
| 77 | Ga0070666_10018000 | 3300005335 | Bacteria | 4535 |
| 78 | Ga0070666_10025993 | 3300005335 | Bacteria | 3821 |
| 79 | Ga0070666_10150569 | 3300005335 | Bacteria | 1623 |
| 80 | Ga0070666_10254744 | 3300005335 | Bacteria | 1243 |
| 81 | Ga0070680_100013277 | 3300005336 | Bacteria | 6414 |
| 82 | Ga0070680_100067285 | 3300005336 | Bacteria | 2938 |
| 83 | Ga0070680_100116857 | 3300005336 | Bacteria | 2224 |
| 84 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 85 | Ga0070682_100089459 | 3300005337 | Bacteria | 2011 |
| 86 | Ga0070682_100264042 | 3300005337 | Bacteria | 1247 |
| 87 | Ga0068868_100015404 | 3300005338 | Bacteria | 5654 |
| 88 | Ga0068868_100017514 | 3300005338 | Bacteria | 5340 |
| 89 | Ga0068868_100031254 | 3300005338 | Bacteria | 4088 |
| 90 | Ga0068868_100059381 | 3300005338 | Bacteria | 3025 |
| 91 | Ga0068868_100092027 | 3300005338 | Bacteria | 2444 |
| 92 | Ga0068868_100123647 | 3300005338 | Bacteria | 2111 |
| 93 | Ga0068868_100140461 | 3300005338 | Bacteria | 1982 |
| 94 | Ga0068868_100198642 | 3300005338 | Bacteria | 1671 |
| 95 | Ga0068868_100245478 | 3300005338 | Bacteria | 1506 |
| 96 | Ga0070660_100003216 | 3300005339 | Bacteria | 11222 |
| 97 | Ga0070660_100014027 | 3300005339 | Bacteria | 5768 |
| 98 | Ga0070660_100218767 | 3300005339 | Bacteria | 1548 |
| 99 | Ga0070689_100021681 | 3300005340 | Bacteria | 4787 |
| 100 | Ga0070689_100041808 | 3300005340 | Bacteria | 3518 |
| 101 | Ga0070689_100459164 | 3300005340 | Bacteria | 1085 |
| 102 | Ga0070689_100464723 | 3300005340 | Bacteria | 1079 |
| 103 | Ga0070687_100003733 | 3300005343 | Bacteria | 5966 |
| 104 | Ga0070687_100118591 | 3300005343 | Bacteria | 1510 |
| 105 | Ga0070687_100128780 | 3300005343 | Bacteria | 1458 |
| 106 | Ga0070661_100004113 | 3300005344 | Bacteria | 10031 |
| 107 | Ga0070661_100040565 | 3300005344 | Bacteria | 3397 |
| 108 | Ga0070661_100127366 | 3300005344 | Bacteria | 1911 |
| 109 | Ga0070668_100017989 | 3300005347 | Bacteria | 5302 |
| 110 | Ga0070668_100025286 | 3300005347 | Bacteria | 4500 |
| 111 | Ga0070668_100050126 | 3300005347 | Bacteria | 3214 |
| 112 | Ga0070668_100155369 | 3300005347 | Bacteria | 1853 |
| 113 | Ga0070668_100221200 | 3300005347 | Bacteria | 1562 |
| 114 | Ga0070668_100240917 | 3300005347 | Bacteria | 1498 |
| 115 | Ga0070669_100002748 | 3300005353 | Bacteria | 12690 |
| 116 | Ga0070669_100024124 | 3300005353 | Bacteria | 4359 |
| 117 | Ga0070669_100324133 | 3300005353 | Bacteria | 1245 |
| 118 | Ga0070669_100357409 | 3300005353 | Bacteria | 1187 |
| 119 | Ga0070669_100422330 | 3300005353 | Bacteria | 1094 |
| 120 | Ga0070675_100014978 | 3300005354 | Bacteria | 6124 |
| 121 | Ga0070675_100018472 | 3300005354 | Bacteria | 5550 |
| 122 | Ga0070675_100027474 | 3300005354 | Bacteria | 4571 |
| 123 | Ga0070675_100090601 | 3300005354 | Bacteria | 2561 |
| 124 | Ga0070675_100120096 | 3300005354 | Bacteria | 2232 |
| 125 | Ga0070675_100129605 | 3300005354 | Bacteria | 2148 |
| 126 | Ga0070675_100143049 | 3300005354 | Bacteria | 2046 |
| 127 | Ga0070675_100182345 | 3300005354 | Bacteria | 1816 |
| 128 | Ga0070675_100304522 | 3300005354 | Bacteria | 1405 |
| 129 | Ga0070675_100348087 | 3300005354 | Bacteria | 1314 |
| 130 | Ga0070671_100027874 | 3300005355 | Bacteria | 4650 |
| 131 | Ga0070671_100030657 | 3300005355 | Bacteria | 4438 |
| 132 | Ga0070671_100231072 | 3300005355 | Bacteria | 1569 |
| 133 | Ga0070674_100065684 | 3300005356 | Bacteria | 2547 |
| 134 | Ga0070674_100085764 | 3300005356 | Bacteria | 2260 |
| 135 | Ga0070674_100141927 | 3300005356 | Bacteria | 1803 |
| 136 | Ga0070674_100196180 | 3300005356 | Bacteria | 1556 |
| 137 | Ga0070674_100363637 | 3300005356 | Bacteria | 1172 |
| 138 | Ga0070673_100003757 | 3300005364 | Bacteria | 9520 |
| 139 | Ga0070673_100030215 | 3300005364 | Bacteria | 4050 |
| 140 | Ga0070673_100051881 | 3300005364 | Bacteria | 3215 |
| 141 | Ga0070673_100052967 | 3300005364 | Bacteria | 3185 |
| 142 | Ga0070673_100075958 | 3300005364 | Bacteria | 2711 |
| 143 | Ga0070688_100018933 | 3300005365 | Bacteria | 3981 |
| 144 | Ga0070688_100028135 | 3300005365 | Bacteria | 3352 |
| 145 | Ga0070688_100046149 | 3300005365 | Bacteria | 2697 |
| 146 | Ga0070688_100252148 | 3300005365 | Bacteria | 1257 |
| 147 | Ga0070659_100000375 | 3300005366 | Bacteria | 33764 |
| 148 | Ga0070659_100006862 | 3300005366 | Bacteria | 8247 |
| 149 | Ga0070659_100008718 | 3300005366 | Bacteria | 7421 |
| 150 | Ga0070659_100010418 | 3300005366 | Bacteria | 6838 |
| 151 | Ga0070659_100019947 | 3300005366 | Bacteria | 5088 |
| 152 | Ga0070659_100131467 | 3300005366 | Bacteria | 2033 |
| 153 | Ga0070659_100451776 | 3300005366 | Bacteria | 1090 |
| 154 | Ga0070667_100000248 | 3300005367 | Bacteria | 61183 |
| 155 | Ga0070667_100004111 | 3300005367 | Bacteria | 12319 |
| 156 | Ga0070667_100162213 | 3300005367 | Bacteria | 1969 |
| 157 | Ga0070667_100187787 | 3300005367 | Bacteria | 1830 |
| 158 | Ga0070701_10094050 | 3300005438 | Bacteria | 1648 |
| 159 | Ga0070694_100152300 | 3300005444 | Bacteria | 1690 |
| 160 | Ga0070663_100099434 | 3300005455 | Bacteria | 2168 |
| 161 | Ga0070663_100314890 | 3300005455 | Bacteria | 1257 |
| 162 | Ga0070678_100047685 | 3300005456 | Bacteria | 3080 |
| 163 | Ga0070678_100083322 | 3300005456 | Bacteria | 2430 |
| 164 | Ga0070678_100124839 | 3300005456 | Bacteria | 2036 |
| 165 | Ga0070678_100480475 | 3300005456 | Bacteria | 1093 |
| 166 | Ga0070662_100004284 | 3300005457 | Bacteria | 9007 |
| 167 | Ga0070662_100017708 | 3300005457 | Bacteria | 4807 |
| 168 | Ga0070662_100033746 | 3300005457 | Bacteria | 3605 |
| 169 | Ga0070662_100040845 | 3300005457 | Bacteria | 3305 |
| 170 | Ga0070662_100044485 | 3300005457 | Bacteria | 3180 |
| 171 | Ga0070681_10007373 | 3300005458 | Bacteria | 10751 |
| 172 | Ga0070681_10013404 | 3300005458 | Bacteria | 8144 |
| 173 | Ga0070681_10134747 | 3300005458 | Bacteria | 2401 |
| 174 | Ga0070681_10206234 | 3300005458 | Bacteria | 1883 |
| 175 | Ga0070681_10281961 | 3300005458 | Bacteria | 1572 |
| 176 | Ga0070681_10335318 | 3300005458 | Bacteria | 1422 |
| 177 | Ga0068867_100011408 | 3300005459 | Bacteria | 6270 |
| 178 | Ga0068867_100011837 | 3300005459 | Bacteria | 6162 |
| 179 | Ga0068867_100027040 | 3300005459 | Bacteria | 4121 |
| 180 | Ga0068867_100031243 | 3300005459 | Bacteria | 3843 |
| 181 | Ga0068867_100067838 | 3300005459 | Bacteria | 2661 |
| 182 | Ga0068867_100162442 | 3300005459 | Bacteria | 1762 |
| 183 | Ga0070685_10040228 | 3300005466 | Bacteria | 2660 |
| 184 | Ga0070698_100002339 | 3300005471 | Bacteria | 20947 |
| 185 | Ga0070698_100002802 | 3300005471 | Bacteria | 19186 |
| 186 | Ga0070698_100021125 | 3300005471 | Bacteria | 6820 |
| 187 | Ga0070698_100171178 | 3300005471 | Bacteria | 2113 |
| 188 | Ga0070698_100241874 | 3300005471 | Bacteria | 1738 |
| 189 | Ga0070679_100008990 | 3300005530 | Bacteria | 9425 |
| 190 | Ga0070679_100018790 | 3300005530 | Bacteria | 6710 |
| 191 | Ga0070679_100033271 | 3300005530 | Bacteria | 5105 |
| 192 | Ga0070679_100050377 | 3300005530 | Bacteria | 4148 |
| 193 | Ga0070679_100075214 | 3300005530 | Bacteria | 3367 |
| 194 | Ga0070679_100095843 | 3300005530 | Bacteria | 2955 |
| 195 | Ga0070679_100237177 | 3300005530 | Bacteria | 1782 |
| 196 | Ga0070684_100006342 | 3300005535 | Bacteria | 9138 |
| 197 | Ga0070684_100008945 | 3300005535 | Bacteria | 7864 |
| 198 | Ga0070684_100046353 | 3300005535 | Bacteria | 3766 |
| 199 | Ga0070684_100069741 | 3300005535 | Bacteria | 3091 |
| 200 | Ga0070684_100193764 | 3300005535 | Bacteria | 1850 |
| 201 | Ga0068853_100000250 | 3300005539 | Bacteria | 37737 |
| 202 | Ga0068853_100013022 | 3300005539 | Bacteria | 6782 |
| 203 | Ga0068853_100039651 | 3300005539 | Bacteria | 4018 |
| 204 | Ga0068853_100042470 | 3300005539 | Bacteria | 3887 |
| 205 | Ga0068853_100104703 | 3300005539 | Bacteria | 2505 |
| 206 | Ga0068853_100107889 | 3300005539 | Bacteria | 2469 |
| 207 | Ga0068853_100110853 | 3300005539 | Bacteria | 2437 |
| 208 | Ga0068853_100187386 | 3300005539 | Bacteria | 1878 |
| 209 | Ga0068853_100368358 | 3300005539 | Bacteria | 1340 |
| 210 | Ga0068853_100451765 | 3300005539 | Bacteria | 1209 |
| 211 | Ga0070672_100001565 | 3300005543 | Bacteria | 14168 |
| 212 | Ga0070672_100010480 | 3300005543 | Bacteria | 6429 |
| 213 | Ga0070672_100043706 | 3300005543 | Bacteria | 3457 |
| 214 | Ga0070672_100058329 | 3300005543 | Bacteria | 3033 |
| 215 | Ga0070672_100140535 | 3300005543 | Bacteria | 1991 |
| 216 | Ga0070672_100188929 | 3300005543 | Bacteria | 1719 |
| 217 | Ga0070672_100206540 | 3300005543 | Bacteria | 1644 |
| 218 | Ga0070686_100018261 | 3300005544 | Bacteria | 4112 |
| 219 | Ga0070665_100000641 | 3300005548 | Bacteria | 47468 |
| 220 | Ga0070665_100045444 | 3300005548 | Bacteria | 4410 |
| 221 | Ga0070704_100100614 | 3300005549 | Bacteria | 2177 |
| 222 | Ga0068855_100000133 | 3300005563 | Bacteria | 94906 |
| 223 | Ga0068855_100000360 | 3300005563 | Bacteria | 56448 |
| 224 | Ga0068855_100000943 | 3300005563 | Bacteria | 36241 |
| 225 | Ga0068855_100002973 | 3300005563 | Bacteria | 20715 |
| 226 | Ga0068855_100012444 | 3300005563 | Bacteria | 10277 |
| 227 | Ga0068855_100033030 | 3300005563 | Bacteria | 6178 |
| 228 | Ga0068855_100044845 | 3300005563 | Bacteria | 5231 |
| 229 | Ga0068855_100051562 | 3300005563 | Bacteria | 4847 |
| 230 | Ga0068855_100058670 | 3300005563 | Bacteria | 4506 |
| 231 | Ga0068855_100062928 | 3300005563 | Bacteria | 4331 |
| 232 | Ga0068855_100076304 | 3300005563 | Bacteria | 3891 |
| 233 | Ga0068855_100091980 | 3300005563 | Bacteria | 3498 |
| 234 | Ga0068855_100161856 | 3300005563 | Bacteria | 2539 |
| 235 | Ga0068855_100243559 | 3300005563 | Bacteria | 2008 |
| 236 | Ga0068855_100424043 | 3300005563 | Bacteria | 1455 |
| 237 | Ga0068855_100651942 | 3300005563 | Bacteria | 1131 |
| 238 | Ga0070664_100011300 | 3300005564 | Bacteria | 7242 |
| 239 | Ga0070664_100041775 | 3300005564 | Bacteria | 3870 |
| 240 | Ga0070664_100084099 | 3300005564 | Bacteria | 2746 |
| 241 | Ga0068857_100014365 | 3300005577 | Bacteria | 6903 |
| 242 | Ga0068857_100018409 | 3300005577 | Bacteria | 6129 |
| 243 | Ga0068857_100036731 | 3300005577 | Bacteria | 4340 |
| 244 | Ga0068857_100040938 | 3300005577 | Bacteria | 4107 |
| 245 | Ga0068857_100063035 | 3300005577 | Bacteria | 3295 |
| 246 | Ga0068857_100085136 | 3300005577 | Bacteria | 2825 |
| 247 | Ga0068857_100119536 | 3300005577 | Bacteria | 2372 |
| 248 | Ga0068857_100131593 | 3300005577 | Bacteria | 2256 |
| 249 | Ga0068857_100181708 | 3300005577 | Bacteria | 1914 |
| 250 | Ga0068857_100387469 | 3300005577 | Bacteria | 1299 |
| 251 | Ga0068854_100048602 | 3300005578 | Bacteria | 3027 |
| 252 | Ga0068854_100068418 | 3300005578 | Bacteria | 2589 |
| 253 | Ga0068854_100115716 | 3300005578 | Bacteria | 2029 |
| 254 | Ga0068854_100132693 | 3300005578 | Bacteria | 1903 |
| 255 | Ga0068854_100172563 | 3300005578 | Bacteria | 1684 |
| 256 | Ga0068854_100217848 | 3300005578 | Bacteria | 1509 |
| 257 | Ga0068856_100001358 | 3300005614 | Bacteria | 25722 |
| 258 | Ga0068856_100003057 | 3300005614 | Bacteria | 17112 |
| 259 | Ga0068856_100010526 | 3300005614 | Bacteria | 8980 |
| 260 | Ga0068856_100064411 | 3300005614 | Bacteria | 3622 |
| 261 | Ga0068856_100136033 | 3300005614 | Bacteria | 2463 |
| 262 | Ga0068856_100183027 | 3300005614 | Bacteria | 2109 |
| 263 | Ga0068856_100248124 | 3300005614 | Bacteria | 1795 |
| 264 | Ga0068856_100540272 | 3300005614 | Bacteria | 1187 |
| 265 | Ga0070702_100049731 | 3300005615 | Bacteria | 2392 |
| 266 | Ga0070702_100411382 | 3300005615 | Bacteria | 970 |
| 267 | Ga0068852_100001842 | 3300005616 | Bacteria | 14407 |
| 268 | Ga0068852_100025622 | 3300005616 | Bacteria | 4781 |
| 269 | Ga0068852_100052504 | 3300005616 | Bacteria | 3504 |
| 270 | Ga0068852_100054084 | 3300005616 | Bacteria | 3459 |
| 271 | Ga0068852_100087742 | 3300005616 | Bacteria | 2776 |
| 272 | Ga0068852_100102354 | 3300005616 | Bacteria | 2588 |
| 273 | Ga0068852_100370778 | 3300005616 | Bacteria | 1402 |
| 274 | Ga0068852_100755508 | 3300005616 | Bacteria | 985 |
| 275 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 276 | Ga0068859_100002491 | 3300005617 | Bacteria | 18742 |
| 277 | Ga0068859_100040242 | 3300005617 | Bacteria | 4692 |
| 278 | Ga0068859_100076436 | 3300005617 | Bacteria | 3389 |
| 279 | Ga0068859_100226291 | 3300005617 | Bacteria | 1958 |
| 280 | Ga0068859_100272899 | 3300005617 | Bacteria | 1783 |
| 281 | Ga0068859_100573453 | 3300005617 | Bacteria | 1222 |
| 282 | Ga0068864_100001656 | 3300005618 | Bacteria | 18343 |
| 283 | Ga0068864_100002302 | 3300005618 | Bacteria | 15797 |
| 284 | Ga0068864_100005468 | 3300005618 | Bacteria | 10419 |
| 285 | Ga0068864_100078002 | 3300005618 | Bacteria | 2898 |
| 286 | Ga0068864_100107079 | 3300005618 | Bacteria | 2486 |
| 287 | Ga0068864_100186490 | 3300005618 | Bacteria | 1899 |
| 288 | Ga0068864_100294411 | 3300005618 | Bacteria | 1518 |
| 289 | Ga0068864_100332687 | 3300005618 | Bacteria | 1429 |
| 290 | Ga0068866_10069033 | 3300005718 | Bacteria | 1860 |
| 291 | Ga0068861_100006643 | 3300005719 | Bacteria | 7895 |
| 292 | Ga0068861_100051617 | 3300005719 | Bacteria | 3122 |
| 293 | Ga0068861_100121125 | 3300005719 | Bacteria | 2111 |
| 294 | Ga0068861_100134738 | 3300005719 | Bacteria | 2009 |
| 295 | Ga0068861_100209084 | 3300005719 | Bacteria | 1642 |
| 296 | Ga0068861_100270865 | 3300005719 | Bacteria | 1458 |
| 297 | Ga0068861_100466181 | 3300005719 | Bacteria | 1135 |
| 298 | Ga0068861_100713820 | 3300005719 | Bacteria | 933 |
| 299 | Ga0068851_10000177 | 3300005834 | Bacteria | 31928 |
| 300 | Ga0068851_10001337 | 3300005834 | Bacteria | 10765 |
| 301 | Ga0068851_10072821 | 3300005834 | Bacteria | 1781 |
| 302 | Ga0068851_10160301 | 3300005834 | Bacteria | 1235 |
| 303 | Ga0068851_10190946 | 3300005834 | Bacteria | 1139 |
| 304 | Ga0068870_10021607 | 3300005840 | Bacteria | 3151 |
| 305 | Ga0068870_10035377 | 3300005840 | Bacteria | 2562 |
| 306 | Ga0068863_100001373 | 3300005841 | Bacteria | 24175 |
| 307 | Ga0068863_100002925 | 3300005841 | Bacteria | 16912 |
| 308 | Ga0068863_100088110 | 3300005841 | Bacteria | 2941 |
| 309 | Ga0068863_100114726 | 3300005841 | Bacteria | 2566 |
| 310 | Ga0068863_100262671 | 3300005841 | Bacteria | 1669 |
| 311 | Ga0068863_100428533 | 3300005841 | Bacteria | 1296 |
| 312 | Ga0068858_100004320 | 3300005842 | Bacteria | 13960 |
| 313 | Ga0068858_100053182 | 3300005842 | Bacteria | 3747 |
| 314 | Ga0068858_100109140 | 3300005842 | Bacteria | 2583 |
| 315 | Ga0068858_100606767 | 3300005842 | Bacteria | 1062 |
| 316 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 317 | Ga0068860_100005547 | 3300005843 | Bacteria | 12773 |
| 318 | Ga0068860_100007830 | 3300005843 | Bacteria | 10668 |
| 319 | Ga0068860_100010482 | 3300005843 | Bacteria | 9162 |
| 320 | Ga0068860_100018429 | 3300005843 | Bacteria | 6791 |
| 321 | Ga0068860_100030843 | 3300005843 | Bacteria | 5154 |
| 322 | Ga0068860_100032138 | 3300005843 | Bacteria | 5045 |
| 323 | Ga0068860_100036448 | 3300005843 | Bacteria | 4712 |
| 324 | Ga0068860_100081681 | 3300005843 | Bacteria | 3074 |
| 325 | Ga0068860_100167592 | 3300005843 | Bacteria | 2121 |
| 326 | Ga0068860_100280934 | 3300005843 | Bacteria | 1627 |
| 327 | Ga0068862_100015311 | 3300005844 | Bacteria | 6369 |
| 328 | Ga0068862_100032080 | 3300005844 | Bacteria | 4438 |
| 329 | Ga0068862_100099860 | 3300005844 | Bacteria | 2538 |
| 330 | Ga0068862_100156109 | 3300005844 | Bacteria | 2034 |
| 331 | Ga0068862_100491878 | 3300005844 | Bacteria | 1163 |
| 332 | Ga0081540_1010032 | 3300005983 | Bacteria | 6448 |
| 333 | Ga0081539_10002233 | 3300005985 | Bacteria | 28209 |
| 334 | Ga0070715_10073647 | 3300006163 | Bacteria | 1532 |
| 335 | Ga0075366_10006763 | 3300006195 | Bacteria | 6298 |
| 336 | Ga0075366_10031189 | 3300006195 | Bacteria | 3136 |
| 337 | Ga0075366_10034049 | 3300006195 | Bacteria | 3001 |
| 338 | Ga0075366_10200750 | 3300006195 | Bacteria | 1213 |
| 339 | Ga0097621_100003401 | 3300006237 | Bacteria | 10956 |
| 340 | Ga0097621_100036790 | 3300006237 | Bacteria | 3917 |
| 341 | Ga0097621_100046779 | 3300006237 | Bacteria | 3503 |
| 342 | Ga0097621_100049443 | 3300006237 | Bacteria | 3415 |
| 343 | Ga0097621_100084088 | 3300006237 | Bacteria | 2652 |
| 344 | Ga0097621_100096686 | 3300006237 | Bacteria | 2478 |
| 345 | Ga0097621_100371519 | 3300006237 | Bacteria | 1276 |
| 346 | Ga0075370_10019967 | 3300006353 | Bacteria | 3653 |
| 347 | Ga0075370_10186709 | 3300006353 | Bacteria | 1221 |
| 348 | Ga0068871_100000955 | 3300006358 | Bacteria | 19316 |
| 349 | Ga0068871_100002544 | 3300006358 | Bacteria | 12445 |
| 350 | Ga0068871_100076419 | 3300006358 | Bacteria | 2766 |
| 351 | Ga0068871_100108578 | 3300006358 | Bacteria | 2332 |
| 352 | Ga0068871_100249205 | 3300006358 | Bacteria | 1546 |
| 353 | Ga0075428_100044984 | 3300006844 | Bacteria | 4851 |
| 354 | Ga0075428_100140238 | 3300006844 | Bacteria | 2628 |
| 355 | Ga0075428_100285496 | 3300006844 | Bacteria | 1776 |
| 356 | Ga0075430_100135661 | 3300006846 | Bacteria | 2051 |
| 357 | Ga0075431_100019798 | 3300006847 | Bacteria | 6870 |
| 358 | Ga0075431_100034168 | 3300006847 | Bacteria | 5240 |
| 359 | Ga0075429_100003790 | 3300006880 | Bacteria | 12900 |
| 360 | Ga0075429_100020740 | 3300006880 | Bacteria | 5704 |
| 361 | Ga0075429_100060787 | 3300006880 | Bacteria | 3290 |
| 362 | Ga0068865_100001794 | 3300006881 | Bacteria | 12594 |
| 363 | Ga0068865_100038915 | 3300006881 | Bacteria | 3222 |
| 364 | Ga0068865_100114198 | 3300006881 | Bacteria | 1997 |
| 365 | Ga0068865_100311402 | 3300006881 | Bacteria | 1263 |
| 366 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 367 | Ga0097620_100000536 | 3300006931 | Bacteria | 37574 |
| 368 | Ga0097620_100002491 | 3300006931 | Bacteria | 18742 |
| 369 | Ga0097620_100040243 | 3300006931 | Bacteria | 4692 |
| 370 | Ga0097620_100076429 | 3300006931 | Bacteria | 3389 |
| 371 | Ga0097620_100226288 | 3300006931 | Bacteria | 1958 |
| 372 | Ga0097620_100272888 | 3300006931 | Bacteria | 1783 |
| 373 | Ga0097620_100573436 | 3300006931 | Bacteria | 1222 |
| 374 | Ga0105240_10000398 | 3300009093 | Bacteria | 81045 |
| 375 | Ga0105240_10011002 | 3300009093 | Bacteria | 12667 |
| 376 | Ga0105240_10011307 | 3300009093 | Bacteria | 12434 |
| 377 | Ga0105240_10023972 | 3300009093 | Bacteria | 8060 |
| 378 | Ga0105240_10041987 | 3300009093 | Bacteria | 5831 |
| 379 | Ga0105240_10078219 | 3300009093 | Bacteria | 4073 |
| 380 | Ga0105240_10088645 | 3300009093 | Bacteria | 3785 |
| 381 | Ga0105240_10100052 | 3300009093 | Bacteria | 3528 |
| 382 | Ga0105240_10167583 | 3300009093 | Bacteria | 2604 |
| 383 | Ga0105240_10173346 | 3300009093 | Bacteria | 2552 |
| 384 | Ga0105240_10182600 | 3300009093 | Bacteria | 2474 |
| 385 | Ga0105240_10291130 | 3300009093 | Bacteria | 1872 |
| 386 | Ga0105240_10331805 | 3300009093 | Bacteria | 1730 |
| 387 | Ga0105240_10350445 | 3300009093 | Bacteria | 1675 |
| 388 | Ga0105240_10404513 | 3300009093 | Bacteria | 1537 |
| 389 | Ga0105240_10976799 | 3300009093 | Bacteria | 907 |
| 390 | Ga0111539_10013971 | 3300009094 | Bacteria | 10037 |
| 391 | Ga0111539_10014550 | 3300009094 | Bacteria | 9824 |
| 392 | Ga0111539_10044551 | 3300009094 | Bacteria | 5315 |
| 393 | Ga0111539_10620757 | 3300009094 | Bacteria | 1259 |
| 394 | Ga0105245_10068029 | 3300009098 | Bacteria | 3226 |
| 395 | Ga0105247_10002304 | 3300009101 | Bacteria | 13045 |
| 396 | Ga0105247_10015344 | 3300009101 | Bacteria | 4589 |
| 397 | Ga0114129_10006463 | 3300009147 | Bacteria | 16621 |
| 398 | Ga0114129_10303837 | 3300009147 | Bacteria | 2126 |
| 399 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 400 | Ga0105243_10077196 | 3300009148 | Bacteria | 2708 |
| 401 | Ga0105241_10007590 | 3300009174 | Bacteria | 7975 |
| 402 | Ga0105241_10009907 | 3300009174 | Bacteria | 7004 |
| 403 | Ga0105241_10014100 | 3300009174 | Bacteria | 5856 |
| 404 | Ga0105241_10037723 | 3300009174 | Bacteria | 3640 |
| 405 | Ga0105241_10206141 | 3300009174 | Bacteria | 1645 |
| 406 | Ga0105241_10617977 | 3300009174 | Bacteria | 981 |
| 407 | Ga0105241_10682033 | 3300009174 | Bacteria | 936 |
| 408 | Ga0105242_10045717 | 3300009176 | Bacteria | 3549 |
| 409 | Ga0105242_10055628 | 3300009176 | Bacteria | 3237 |
| 410 | Ga0105242_10102158 | 3300009176 | Bacteria | 2431 |
| 411 | Ga0105242_10134109 | 3300009176 | Bacteria | 2141 |
| 412 | Ga0105242_10184821 | 3300009176 | Bacteria | 1841 |
| 413 | Ga0105242_10200555 | 3300009176 | Bacteria | 1772 |
| 414 | Ga0105242_10521824 | 3300009176 | Bacteria | 1133 |
| 415 | Ga0105248_10034629 | 3300009177 | Bacteria | 5649 |
| 416 | Ga0105248_10052937 | 3300009177 | Bacteria | 4555 |
| 417 | Ga0105248_10464039 | 3300009177 | Bacteria | 1427 |
| 418 | Ga0105237_10001588 | 3300009545 | Bacteria | 29579 |
| 419 | Ga0105237_10001799 | 3300009545 | Bacteria | 27692 |
| 420 | Ga0105237_10011322 | 3300009545 | Bacteria | 9438 |
| 421 | Ga0105237_10014365 | 3300009545 | Bacteria | 8285 |
| 422 | Ga0105237_10022954 | 3300009545 | Bacteria | 6399 |
| 423 | Ga0105237_10030759 | 3300009545 | Bacteria | 5450 |
| 424 | Ga0105237_10035876 | 3300009545 | Bacteria | 5016 |
| 425 | Ga0105237_10069245 | 3300009545 | Bacteria | 3524 |
| 426 | Ga0105237_10268972 | 3300009545 | Bacteria | 1707 |
| 427 | Ga0105237_10331462 | 3300009545 | Bacteria | 1526 |
| 428 | Ga0105237_10738669 | 3300009545 | Bacteria | 991 |
| 429 | Ga0105238_10170225 | 3300009551 | Bacteria | 2154 |
| 430 | Ga0105249_10000806 | 3300009553 | Bacteria | 28220 |
| 431 | Ga0105249_10001080 | 3300009553 | Bacteria | 24205 |
| 432 | Ga0105249_10005412 | 3300009553 | Bacteria | 11022 |
| 433 | Ga0105249_10025715 | 3300009553 | Bacteria | 5302 |
| 434 | Ga0105249_10029956 | 3300009553 | Bacteria | 4916 |
| 435 | Ga0105249_10075766 | 3300009553 | Bacteria | 3116 |
| 436 | Ga0105249_10077951 | 3300009553 | Bacteria | 3074 |
| 437 | Ga0105249_10411381 | 3300009553 | Bacteria | 1385 |
| 438 | Ga0105239_10000431 | 3300010375 | Bacteria | 61098 |
| 439 | Ga0105239_10000436 | 3300010375 | Bacteria | 61031 |
| 440 | Ga0105239_10004090 | 3300010375 | Bacteria | 17535 |
| 441 | Ga0105239_10007869 | 3300010375 | Bacteria | 12183 |
| 442 | Ga0105239_10033863 | 3300010375 | Bacteria | 5608 |
| 443 | Ga0105239_10067944 | 3300010375 | Bacteria | 3916 |
| 444 | Ga0105239_10122693 | 3300010375 | Bacteria | 2887 |
| 445 | Ga0105239_10148001 | 3300010375 | Bacteria | 2620 |
| 446 | Ga0105239_10188341 | 3300010375 | Bacteria | 2310 |
| 447 | Ga0105239_10198084 | 3300010375 | Bacteria | 2250 |
| 448 | Ga0105239_10205263 | 3300010375 | Bacteria | 2208 |
| 449 | Ga0105239_10240840 | 3300010375 | Bacteria | 2030 |
| 450 | Ga0105239_10241163 | 3300010375 | Bacteria | 2029 |
| 451 | Ga0105239_10246419 | 3300010375 | Bacteria | 2006 |
| 452 | Ga0105239_10468937 | 3300010375 | Bacteria | 1430 |
| 453 | Ga0105246_10021096 | 3300011119 | Bacteria | 4187 |
| 454 | Ga0105246_10124550 | 3300011119 | Bacteria | 1915 |
| 455 | Ga0105246_10158325 | 3300011119 | Bacteria | 1723 |
| 456 | Ga0157373_10000129 | 3300013100 | Bacteria | 59252 |
| 457 | Ga0157373_10008302 | 3300013100 | Bacteria | 7716 |
| 458 | Ga0157373_10018478 | 3300013100 | Bacteria | 5076 |
| 459 | Ga0157373_10025943 | 3300013100 | Bacteria | 4235 |
| 460 | Ga0157373_10041402 | 3300013100 | Bacteria | 3295 |
| 461 | Ga0157373_10123108 | 3300013100 | Bacteria | 1823 |
| 462 | Ga0157373_10175037 | 3300013100 | Bacteria | 1510 |
| 463 | Ga0157373_10180217 | 3300013100 | Bacteria | 1487 |
| 464 | Ga0157373_10318646 | 3300013100 | Bacteria | 1106 |
| 465 | Ga0157373_10344172 | 3300013100 | Bacteria | 1063 |
| 466 | Ga0157371_10003367 | 3300013102 | Bacteria | 14536 |
| 467 | Ga0157371_10015121 | 3300013102 | Bacteria | 5800 |
| 468 | Ga0157371_10016670 | 3300013102 | Bacteria | 5476 |
| 469 | Ga0157371_10021771 | 3300013102 | Bacteria | 4703 |
| 470 | Ga0157371_10023444 | 3300013102 | Bacteria | 4513 |
| 471 | Ga0157371_10024281 | 3300013102 | Bacteria | 4429 |
| 472 | Ga0157371_10032716 | 3300013102 | Bacteria | 3740 |
| 473 | Ga0157371_10036963 | 3300013102 | Bacteria | 3497 |
| 474 | Ga0157371_10043957 | 3300013102 | Bacteria | 3182 |
| 475 | Ga0157371_10054932 | 3300013102 | Bacteria | 2827 |
| 476 | Ga0157371_10078103 | 3300013102 | Bacteria | 2344 |
| 477 | Ga0157371_10102478 | 3300013102 | Bacteria | 2031 |
| 478 | Ga0157371_10279688 | 3300013102 | Bacteria | 1205 |
| 479 | Ga0157370_10000926 | 3300013104 | Bacteria | 37246 |
| 480 | Ga0157370_10006378 | 3300013104 | Bacteria | 13019 |
| 481 | Ga0157370_10009487 | 3300013104 | Bacteria | 10389 |
| 482 | Ga0157370_10011345 | 3300013104 | Bacteria | 9332 |
| 483 | Ga0157370_10017050 | 3300013104 | Bacteria | 7340 |
| 484 | Ga0157370_10022725 | 3300013104 | Bacteria | 6240 |
| 485 | Ga0157370_10025354 | 3300013104 | Bacteria | 5869 |
| 486 | Ga0157370_10047165 | 3300013104 | Bacteria | 4130 |
| 487 | Ga0157370_10070629 | 3300013104 | Bacteria | 3296 |
| 488 | Ga0157370_10113930 | 3300013104 | Bacteria | 2526 |
| 489 | Ga0157370_10119429 | 3300013104 | Bacteria | 2461 |
| 490 | Ga0157370_10259572 | 3300013104 | Bacteria | 1606 |
| 491 | Ga0157369_10004050 | 3300013105 | Bacteria | 17366 |
| 492 | Ga0157369_10007412 | 3300013105 | Bacteria | 12631 |
| 493 | Ga0157369_10012941 | 3300013105 | Bacteria | 9454 |
| 494 | Ga0157369_10019086 | 3300013105 | Bacteria | 7676 |
| 495 | Ga0157369_10022720 | 3300013105 | Bacteria | 6995 |
| 496 | Ga0157369_10038761 | 3300013105 | Bacteria | 5210 |
| 497 | Ga0157369_10063647 | 3300013105 | Bacteria | 3973 |
| 498 | Ga0157369_10083535 | 3300013105 | Bacteria | 3415 |
| 499 | Ga0157369_10100758 | 3300013105 | Bacteria | 3079 |
| 500 | Ga0157369_10115086 | 3300013105 | Bacteria | 2856 |
| 501 | Ga0157369_10184333 | 3300013105 | Bacteria | 2195 |
| 502 | Ga0157369_10206180 | 3300013105 | Bacteria | 2062 |
| 503 | Ga0157369_10310068 | 3300013105 | Bacteria | 1641 |
| 504 | Ga0157369_10597173 | 3300013105 | Bacteria | 1140 |
| 505 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 506 | Ga0157374_10000500 | 3300013296 | Bacteria | 35513 |
| 507 | Ga0157374_10008968 | 3300013296 | Bacteria | 8573 |
| 508 | Ga0157374_10009009 | 3300013296 | Bacteria | 8561 |
| 509 | Ga0157374_10071962 | 3300013296 | Bacteria | 3261 |
| 510 | Ga0157374_10126640 | 3300013296 | Bacteria | 2469 |
| 511 | Ga0157374_10173144 | 3300013296 | Bacteria | 2106 |
| 512 | Ga0157374_10263632 | 3300013296 | Bacteria | 1698 |
| 513 | Ga0157374_10497665 | 3300013296 | Bacteria | 1223 |
| 514 | Ga0157374_10589365 | 3300013296 | Bacteria | 1121 |
| 515 | Ga0157374_10704437 | 3300013296 | Bacteria | 1023 |
| 516 | Ga0157378_10006065 | 3300013297 | Bacteria | 10591 |
| 517 | Ga0157378_10008184 | 3300013297 | Bacteria | 9121 |
| 518 | Ga0157378_10012000 | 3300013297 | Bacteria | 7586 |
| 519 | Ga0157378_10021595 | 3300013297 | Bacteria | 5661 |
| 520 | Ga0157378_10025313 | 3300013297 | Bacteria | 5226 |
| 521 | Ga0157378_10041061 | 3300013297 | Bacteria | 4104 |
| 522 | Ga0157378_10103113 | 3300013297 | Bacteria | 2606 |
| 523 | Ga0157378_10152599 | 3300013297 | Bacteria | 2153 |
| 524 | Ga0157378_10191806 | 3300013297 | Bacteria | 1928 |
| 525 | Ga0157378_10389252 | 3300013297 | Bacteria | 1371 |
| 526 | Ga0163162_10001595 | 3300013306 | Bacteria | 21212 |
| 527 | Ga0163162_10006110 | 3300013306 | Bacteria | 11654 |
| 528 | Ga0163162_10008143 | 3300013306 | Bacteria | 10230 |
| 529 | Ga0163162_10012931 | 3300013306 | Bacteria | 8148 |
| 530 | Ga0163162_10024199 | 3300013306 | Bacteria | 5993 |
| 531 | Ga0163162_10025579 | 3300013306 | Bacteria | 5834 |
| 532 | Ga0163162_10096425 | 3300013306 | Bacteria | 3046 |
| 533 | Ga0163162_10106731 | 3300013306 | Bacteria | 2896 |
| 534 | Ga0163162_10115627 | 3300013306 | Bacteria | 2783 |
| 535 | Ga0163162_10163494 | 3300013306 | Bacteria | 2349 |
| 536 | Ga0163162_10280429 | 3300013306 | Bacteria | 1798 |
| 537 | Ga0163162_10294393 | 3300013306 | Bacteria | 1755 |
| 538 | Ga0163162_10299937 | 3300013306 | Bacteria | 1739 |
| 539 | Ga0163162_10300778 | 3300013306 | Bacteria | 1736 |
| 540 | Ga0163162_10391437 | 3300013306 | Bacteria | 1523 |
| 541 | Ga0163162_10443296 | 3300013306 | Bacteria | 1431 |
| 542 | Ga0163162_10465402 | 3300013306 | Bacteria | 1396 |
| 543 | Ga0157372_10000030 | 3300013307 | Bacteria | 179925 |
| 544 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 545 | Ga0157372_10003109 | 3300013307 | Bacteria | 17892 |
| 546 | Ga0157372_10003430 | 3300013307 | Bacteria | 17111 |
| 547 | Ga0157372_10016323 | 3300013307 | Bacteria | 7968 |
| 548 | Ga0157372_10016644 | 3300013307 | Bacteria | 7892 |
| 549 | Ga0157372_10018713 | 3300013307 | Bacteria | 7451 |
| 550 | Ga0157372_10020775 | 3300013307 | Bacteria | 7090 |
| 551 | Ga0157372_10029769 | 3300013307 | Bacteria | 5966 |
| 552 | Ga0157372_10051126 | 3300013307 | Bacteria | 4598 |
| 553 | Ga0157372_10210537 | 3300013307 | Bacteria | 2253 |
| 554 | Ga0157372_10214740 | 3300013307 | Bacteria | 2229 |
| 555 | Ga0157372_10239188 | 3300013307 | Bacteria | 2106 |
| 556 | Ga0157372_10247490 | 3300013307 | Bacteria | 2069 |
| 557 | Ga0157372_10252119 | 3300013307 | Bacteria | 2049 |
| 558 | Ga0157372_10377770 | 3300013307 | Bacteria | 1651 |
| 559 | Ga0157372_10430482 | 3300013307 | Bacteria | 1538 |
| 560 | Ga0157372_10552695 | 3300013307 | Bacteria | 1342 |
| 561 | Ga0157372_10558901 | 3300013307 | Bacteria | 1334 |
| 562 | Ga0157372_10589587 | 3300013307 | Bacteria | 1296 |
| 563 | Ga0157372_10948156 | 3300013307 | Bacteria | 997 |
| 564 | Ga0157375_10001463 | 3300013308 | Bacteria | 20315 |
| 565 | Ga0157375_10005027 | 3300013308 | Bacteria | 11484 |
| 566 | Ga0157375_10010453 | 3300013308 | Bacteria | 8166 |
| 567 | Ga0157375_10012841 | 3300013308 | Bacteria | 7438 |
| 568 | Ga0157375_10082979 | 3300013308 | Bacteria | 3249 |
| 569 | Ga0157375_10090738 | 3300013308 | Bacteria | 3115 |
| 570 | Ga0157375_10094808 | 3300013308 | Bacteria | 3054 |
| 571 | Ga0157375_10101632 | 3300013308 | Bacteria | 2958 |
| 572 | Ga0157375_10128521 | 3300013308 | Bacteria | 2652 |
| 573 | Ga0157375_10153729 | 3300013308 | Bacteria | 2438 |
| 574 | Ga0157375_10208620 | 3300013308 | Bacteria | 2110 |
| 575 | Ga0157375_10253294 | 3300013308 | Bacteria | 1921 |
| 576 | Ga0157375_10603302 | 3300013308 | Bacteria | 1257 |
| 577 | Ga0157375_10827917 | 3300013308 | Bacteria | 1073 |
| 578 | Ga0163163_10001501 | 3300014325 | Bacteria | 19759 |
| 579 | Ga0163163_10036393 | 3300014325 | Bacteria | 4781 |
| 580 | Ga0163163_10054019 | 3300014325 | Bacteria | 3967 |
| 581 | Ga0163163_10089831 | 3300014325 | Bacteria | 3085 |
| 582 | Ga0163163_10092201 | 3300014325 | Bacteria | 3044 |
| 583 | Ga0163163_10152284 | 3300014325 | Bacteria | 2356 |
| 584 | Ga0163163_10300122 | 3300014325 | Bacteria | 1659 |
| 585 | Ga0157380_10008895 | 3300014326 | Bacteria | 7174 |
| 586 | Ga0157380_10030118 | 3300014326 | Bacteria | 4154 |
| 587 | Ga0157380_10065873 | 3300014326 | Bacteria | 2913 |
| 588 | Ga0157380_10071748 | 3300014326 | Bacteria | 2802 |
| 589 | Ga0157380_10113108 | 3300014326 | Bacteria | 2285 |
| 590 | Ga0157377_10021210 | 3300014745 | Bacteria | 3415 |
| 591 | Ga0157377_10069334 | 3300014745 | Bacteria | 2034 |
| 592 | Ga0157379_10000845 | 3300014968 | Bacteria | 24814 |
| 593 | Ga0157379_10008284 | 3300014968 | Bacteria | 9034 |
| 594 | Ga0157379_10036538 | 3300014968 | Bacteria | 4379 |
| 595 | Ga0157379_10495784 | 3300014968 | Bacteria | 1132 |
| 596 | Ga0157376_10008523 | 3300014969 | Bacteria | 7404 |
| 597 | Ga0157376_10022078 | 3300014969 | Bacteria | 4953 |
| 598 | Ga0157376_10040602 | 3300014969 | Bacteria | 3804 |
| 599 | Ga0157376_10043577 | 3300014969 | Bacteria | 3683 |
| 600 | Ga0157376_10083403 | 3300014969 | Bacteria | 2749 |
| 601 | Ga0157376_10105537 | 3300014969 | Bacteria | 2471 |
| 602 | Ga0157376_10135197 | 3300014969 | Bacteria | 2205 |
| 603 | Ga0157376_10250506 | 3300014969 | Bacteria | 1654 |
| 604 | Ga0157376_10516013 | 3300014969 | Bacteria | 1177 |
| 605 | Ga0182005_1000147 | 3300015265 | Bacteria | 49428 |
| 606 | Ga0163161_10001357 | 3300017792 | Bacteria | 18206 |
| 607 | Ga0163161_10012104 | 3300017792 | Bacteria | 5985 |
| 608 | Ga0163161_10015767 | 3300017792 | Bacteria | 5269 |
| 609 | Ga0163161_10076648 | 3300017792 | Bacteria | 2454 |
| 610 | Ga0163161_10146216 | 3300017792 | Bacteria | 1793 |
| 611 | Ga0197907_10169535 | 3300020069 | Bacteria | 2472 |
| 612 | Ga0206356_10575773 | 3300020070 | Bacteria | 1651 |
| 613 | Ga0206351_10170033 | 3300020077 | Bacteria | 10900 |
| 614 | Ga0206351_10512829 | 3300020077 | Bacteria | 15076 |
| 615 | Ga0206352_10703535 | 3300020078 | Bacteria | 2663 |
| 616 | Ga0206352_10938790 | 3300020078 | Bacteria | 1089 |
| 617 | Ga0206350_10057460 | 3300020080 | Bacteria | 6432 |
| 618 | Ga0206350_10752456 | 3300020080 | Bacteria | 3060 |
| 619 | Ga0206354_10778573 | 3300020081 | Bacteria | 1949 |
| 620 | Ga0206353_10311699 | 3300020082 | Bacteria | 1482 |
| 621 | Ga0154015_1495562 | 3300020610 | Bacteria | 11881 |
| 622 | Ga0213872_10013117 | 3300021361 | Bacteria | 3885 |
| 623 | Ga0213876_10007626 | 3300021384 | Bacteria | 5875 |
| 624 | Ga0224712_10003582 | 3300022467 | Bacteria | 4061 |
| 625 | Ga0224712_10014571 | 3300022467 | Bacteria | 2536 |
| 626 | Ga0209436_100232 | 3300025208 | Bacteria | 25536 |
| 627 | Ga0209436_104962 | 3300025208 | Bacteria | 3181 |
| 628 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 629 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 630 | Ga0209437_100135 | 3300025233 | Bacteria | 176455 |
| 631 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 632 | Ga0209646_1001434 | 3300025246 | Bacteria | 6411 |
| 633 | Ga0209646_1004416 | 3300025246 | Bacteria | 2566 |
| 634 | Ga0209026_1000299 | 3300025250 | Bacteria | 54147 |
| 635 | Ga0209026_1000610 | 3300025250 | Bacteria | 22917 |
| 636 | Ga0209026_1004981 | 3300025250 | Bacteria | 3723 |
| 637 | Ga0209148_1000090 | 3300025254 | Bacteria | 250982 |
| 638 | Ga0209129_1004506 | 3300025258 | Bacteria | 5402 |
| 639 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 640 | Ga0209233_1001329 | 3300025261 | Bacteria | 9868 |
| 641 | Ga0209673_1000034 | 3300025273 | Bacteria | 328788 |
| 642 | Ga0209130_1001055 | 3300025284 | Bacteria | 20897 |
| 643 | Ga0209564_1014913 | 3300025295 | Bacteria | 3198 |
| 644 | Ga0209758_1001438 | 3300025297 | Bacteria | 28062 |
| 645 | Ga0209050_1000207 | 3300025298 | Bacteria | 131328 |
| 646 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 647 | Ga0207426_1000603 | 3300025302 | Bacteria | 46872 |
| 648 | Ga0207426_1000813 | 3300025302 | Bacteria | 33506 |
| 649 | Ga0207426_1001314 | 3300025302 | Bacteria | 21207 |
| 650 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 651 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 652 | Ga0209257_1001824 | 3300025304 | Bacteria | 23309 |
| 653 | Ga0207697_10008960 | 3300025315 | Bacteria | 4344 |
| 654 | Ga0207697_10045796 | 3300025315 | Bacteria | 1801 |
| 655 | Ga0207656_10000055 | 3300025321 | Bacteria | 44377 |
| 656 | Ga0207656_10010030 | 3300025321 | Bacteria | 3532 |
| 657 | Ga0207656_10102743 | 3300025321 | Bacteria | 1312 |
| 658 | Ga0207656_10171442 | 3300025321 | Bacteria | 1038 |
| 659 | Ga0207682_10003346 | 3300025893 | Bacteria | 6992 |
| 660 | Ga0207682_10006454 | 3300025893 | Bacteria | 4723 |
| 661 | Ga0207642_10027020 | 3300025899 | Bacteria | 2344 |
| 662 | Ga0207642_10049589 | 3300025899 | Bacteria | 1888 |
| 663 | Ga0207710_10002332 | 3300025900 | Bacteria | 8872 |
| 664 | Ga0207710_10020859 | 3300025900 | Bacteria | 2804 |
| 665 | Ga0207688_10010099 | 3300025901 | Bacteria | 5135 |
| 666 | Ga0207680_10045258 | 3300025903 | Bacteria | 2593 |
| 667 | Ga0207680_10061291 | 3300025903 | Bacteria | 2294 |
| 668 | Ga0207680_10177908 | 3300025903 | Bacteria | 1437 |
| 669 | Ga0207647_10000110 | 3300025904 | Bacteria | 62980 |
| 670 | Ga0207647_10000171 | 3300025904 | Bacteria | 51875 |
| 671 | Ga0207647_10009094 | 3300025904 | Bacteria | 7073 |
| 672 | Ga0207647_10020448 | 3300025904 | Bacteria | 4439 |
| 673 | Ga0207647_10025805 | 3300025904 | Bacteria | 3853 |
| 674 | Ga0207645_10002136 | 3300025907 | Bacteria | 15798 |
| 675 | Ga0207645_10025677 | 3300025907 | Bacteria | 3811 |
| 676 | Ga0207645_10044737 | 3300025907 | Bacteria | 2832 |
| 677 | Ga0207645_10163618 | 3300025907 | Bacteria | 1456 |
| 678 | Ga0207643_10001724 | 3300025908 | Bacteria | 12262 |
| 679 | Ga0207643_10006929 | 3300025908 | Bacteria | 6076 |
| 680 | Ga0207643_10152178 | 3300025908 | Bacteria | 1387 |
| 681 | Ga0207705_10000108 | 3300025909 | Bacteria | 93501 |
| 682 | Ga0207705_10011466 | 3300025909 | Bacteria | 6413 |
| 683 | Ga0207705_10018682 | 3300025909 | Bacteria | 4959 |
| 684 | Ga0207705_10024219 | 3300025909 | Bacteria | 4332 |
| 685 | Ga0207705_10052283 | 3300025909 | Bacteria | 2941 |
| 686 | Ga0207705_10088880 | 3300025909 | Bacteria | 2260 |
| 687 | Ga0207705_10208863 | 3300025909 | Bacteria | 1481 |
| 688 | Ga0207705_10257291 | 3300025909 | Bacteria | 1332 |
| 689 | Ga0207654_10000881 | 3300025911 | Bacteria | 16661 |
| 690 | Ga0207654_10002705 | 3300025911 | Bacteria | 8996 |
| 691 | Ga0207654_10036156 | 3300025911 | Bacteria | 2757 |
| 692 | Ga0207654_10080916 | 3300025911 | Bacteria | 1955 |
| 693 | Ga0207707_10011329 | 3300025912 | Bacteria | 7764 |
| 694 | Ga0207707_10075844 | 3300025912 | Bacteria | 2934 |
| 695 | Ga0207707_10260837 | 3300025912 | Bacteria | 1504 |
| 696 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 697 | Ga0207695_10000064 | 3300025913 | Bacteria | 346010 |
| 698 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 699 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 700 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 701 | Ga0207695_10004647 | 3300025913 | Bacteria | 18602 |
| 702 | Ga0207695_10015473 | 3300025913 | Bacteria | 8978 |
| 703 | Ga0207695_10026373 | 3300025913 | Bacteria | 6486 |
| 704 | Ga0207695_10033343 | 3300025913 | Bacteria | 5618 |
| 705 | Ga0207695_10081967 | 3300025913 | Bacteria | 3263 |
| 706 | Ga0207695_10084771 | 3300025913 | Bacteria | 3198 |
| 707 | Ga0207695_10273350 | 3300025913 | Bacteria | 1585 |
| 708 | Ga0207671_10000149 | 3300025914 | Bacteria | 107722 |
| 709 | Ga0207671_10003750 | 3300025914 | Bacteria | 14958 |
| 710 | Ga0207671_10004543 | 3300025914 | Bacteria | 13186 |
| 711 | Ga0207671_10007320 | 3300025914 | Bacteria | 9585 |
| 712 | Ga0207671_10010466 | 3300025914 | Bacteria | 7650 |
| 713 | Ga0207671_10032778 | 3300025914 | Bacteria | 3865 |
| 714 | Ga0207671_10037137 | 3300025914 | Bacteria | 3613 |
| 715 | Ga0207671_10040157 | 3300025914 | Bacteria | 3463 |
| 716 | Ga0207671_10060090 | 3300025914 | Bacteria | 2820 |
| 717 | Ga0207671_10069197 | 3300025914 | Bacteria | 2631 |
| 718 | Ga0207671_10278244 | 3300025914 | Bacteria | 1319 |
| 719 | Ga0207660_10006449 | 3300025917 | Bacteria | 7609 |
| 720 | Ga0207660_10024417 | 3300025917 | Bacteria | 4093 |
| 721 | Ga0207660_10048131 | 3300025917 | Bacteria | 3017 |
| 722 | Ga0207662_10027651 | 3300025918 | Bacteria | 3274 |
| 723 | Ga0207662_10092496 | 3300025918 | Bacteria | 1862 |
| 724 | Ga0207657_10009979 | 3300025919 | Bacteria | 9505 |
| 725 | Ga0207657_10036828 | 3300025919 | Bacteria | 4376 |
| 726 | Ga0207657_10041700 | 3300025919 | Bacteria | 4056 |
| 727 | Ga0207657_10049438 | 3300025919 | Bacteria | 3664 |
| 728 | Ga0207657_10050001 | 3300025919 | Bacteria | 3640 |
| 729 | Ga0207657_10062662 | 3300025919 | Bacteria | 3183 |
| 730 | Ga0207657_10292539 | 3300025919 | Bacteria | 1291 |
| 731 | Ga0207649_10005479 | 3300025920 | Bacteria | 6870 |
| 732 | Ga0207649_10188195 | 3300025920 | Bacteria | 1450 |
| 733 | Ga0207652_10000064 | 3300025921 | Bacteria | 111997 |
| 734 | Ga0207652_10000387 | 3300025921 | Bacteria | 45946 |
| 735 | Ga0207652_10002830 | 3300025921 | Bacteria | 14557 |
| 736 | Ga0207652_10041607 | 3300025921 | Bacteria | 3907 |
| 737 | Ga0207652_10108992 | 3300025921 | Bacteria | 2454 |
| 738 | Ga0207652_10250009 | 3300025921 | Bacteria | 1599 |
| 739 | Ga0207652_10298183 | 3300025921 | Bacteria | 1455 |
| 740 | Ga0207652_10441296 | 3300025921 | Bacteria | 1173 |
| 741 | Ga0207681_10015241 | 3300025923 | Bacteria | 4793 |
| 742 | Ga0207681_10073899 | 3300025923 | Bacteria | 2386 |
| 743 | Ga0207681_10353840 | 3300025923 | Bacteria | 1176 |
| 744 | Ga0207694_10017481 | 3300025924 | Bacteria | 5419 |
| 745 | Ga0207694_10253517 | 3300025924 | Bacteria | 1440 |
| 746 | Ga0207650_10014881 | 3300025925 | Bacteria | 5413 |
| 747 | Ga0207650_10066694 | 3300025925 | Bacteria | 2699 |
| 748 | Ga0207650_10074981 | 3300025925 | Bacteria | 2552 |
| 749 | Ga0207650_10077520 | 3300025925 | Bacteria | 2513 |
| 750 | Ga0207650_10093786 | 3300025925 | Bacteria | 2298 |
| 751 | Ga0207650_10120271 | 3300025925 | Bacteria | 2044 |
| 752 | Ga0207650_10167486 | 3300025925 | Bacteria | 1744 |
| 753 | Ga0207650_10206413 | 3300025925 | Bacteria | 1576 |
| 754 | Ga0207650_10492599 | 3300025925 | Bacteria | 1024 |
| 755 | Ga0207659_10009764 | 3300025926 | Bacteria | 6003 |
| 756 | Ga0207659_10033056 | 3300025926 | Bacteria | 3556 |
| 757 | Ga0207659_10101095 | 3300025926 | Bacteria | 2174 |
| 758 | Ga0207659_10119153 | 3300025926 | Bacteria | 2020 |
| 759 | Ga0207659_10172238 | 3300025926 | Bacteria | 1708 |
| 760 | Ga0207659_10192518 | 3300025926 | Bacteria | 1624 |
| 761 | Ga0207659_10327100 | 3300025926 | Bacteria | 1266 |
| 762 | Ga0207659_10420269 | 3300025926 | Bacteria | 1121 |
| 763 | Ga0207644_10012415 | 3300025931 | Bacteria | 5658 |
| 764 | Ga0207644_10021869 | 3300025931 | Bacteria | 4361 |
| 765 | Ga0207644_10024620 | 3300025931 | Bacteria | 4134 |
| 766 | Ga0207644_10059737 | 3300025931 | Bacteria | 2758 |
| 767 | Ga0207644_10140731 | 3300025931 | Bacteria | 1858 |
| 768 | Ga0207644_10251118 | 3300025931 | Bacteria | 1411 |
| 769 | Ga0207690_10002170 | 3300025932 | Bacteria | 11970 |
| 770 | Ga0207690_10004744 | 3300025932 | Bacteria | 8027 |
| 771 | Ga0207690_10012751 | 3300025932 | Bacteria | 5037 |
| 772 | Ga0207690_10020857 | 3300025932 | Bacteria | 4055 |
| 773 | Ga0207690_10024446 | 3300025932 | Bacteria | 3784 |
| 774 | Ga0207690_10057621 | 3300025932 | Bacteria | 2625 |
| 775 | Ga0207706_10006478 | 3300025933 | Bacteria | 10869 |
| 776 | Ga0207706_10009371 | 3300025933 | Bacteria | 8991 |
| 777 | Ga0207706_10029582 | 3300025933 | Bacteria | 4889 |
| 778 | Ga0207706_10037951 | 3300025933 | Bacteria | 4275 |
| 779 | Ga0207706_10068145 | 3300025933 | Bacteria | 3131 |
| 780 | Ga0207686_10111562 | 3300025934 | Bacteria | 1845 |
| 781 | Ga0207686_10127335 | 3300025934 | Bacteria | 1742 |
| 782 | Ga0207686_10231570 | 3300025934 | Bacteria | 1340 |
| 783 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 784 | Ga0207670_10014554 | 3300025936 | Bacteria | 4674 |
| 785 | Ga0207670_10486727 | 3300025936 | Bacteria | 1000 |
| 786 | Ga0207670_10529657 | 3300025936 | Bacteria | 960 |
| 787 | Ga0207669_10005569 | 3300025937 | Bacteria | 5668 |
| 788 | Ga0207669_10235181 | 3300025937 | Bacteria | 1355 |
| 789 | Ga0207669_10344098 | 3300025937 | Bacteria | 1149 |
| 790 | Ga0207704_10003038 | 3300025938 | Bacteria | 7581 |
| 791 | Ga0207704_10039066 | 3300025938 | Bacteria | 2759 |
| 792 | Ga0207665_10026619 | 3300025939 | Bacteria | 3818 |
| 793 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 794 | Ga0207691_10002741 | 3300025940 | Bacteria | 17182 |
| 795 | Ga0207691_10019043 | 3300025940 | Bacteria | 6500 |
| 796 | Ga0207691_10027644 | 3300025940 | Bacteria | 5317 |
| 797 | Ga0207691_10075279 | 3300025940 | Bacteria | 3044 |
| 798 | Ga0207691_10176679 | 3300025940 | Bacteria | 1867 |
| 799 | Ga0207711_10092009 | 3300025941 | Bacteria | 2669 |
| 800 | Ga0207711_10182599 | 3300025941 | Bacteria | 1908 |
| 801 | Ga0207711_10191822 | 3300025941 | Bacteria | 1862 |
| 802 | Ga0207689_10005396 | 3300025942 | Bacteria | 11441 |
| 803 | Ga0207689_10010127 | 3300025942 | Bacteria | 8127 |
| 804 | Ga0207689_10014249 | 3300025942 | Bacteria | 6765 |
| 805 | Ga0207689_10018050 | 3300025942 | Bacteria | 5958 |
| 806 | Ga0207689_10045231 | 3300025942 | Bacteria | 3641 |
| 807 | Ga0207689_10075403 | 3300025942 | Bacteria | 2772 |
| 808 | Ga0207689_10088584 | 3300025942 | Bacteria | 2542 |
| 809 | Ga0207689_10101705 | 3300025942 | Bacteria | 2361 |
| 810 | Ga0207689_10182503 | 3300025942 | Bacteria | 1730 |
| 811 | Ga0207689_10195708 | 3300025942 | Bacteria | 1668 |
| 812 | Ga0207689_10347595 | 3300025942 | Bacteria | 1233 |
| 813 | Ga0207689_10472712 | 3300025942 | Bacteria | 1049 |
| 814 | Ga0207661_10005126 | 3300025944 | Bacteria | 9200 |
| 815 | Ga0207661_10008212 | 3300025944 | Bacteria | 7452 |
| 816 | Ga0207661_10009193 | 3300025944 | Bacteria | 7083 |
| 817 | Ga0207661_10019703 | 3300025944 | Bacteria | 5035 |
| 818 | Ga0207661_10031577 | 3300025944 | Bacteria | 4094 |
| 819 | Ga0207661_10178861 | 3300025944 | Bacteria | 1851 |
| 820 | Ga0207679_10000875 | 3300025945 | Bacteria | 19210 |
| 821 | Ga0207679_10050461 | 3300025945 | Bacteria | 3040 |
| 822 | Ga0207679_10156469 | 3300025945 | Bacteria | 1861 |
| 823 | Ga0207679_10214537 | 3300025945 | Bacteria | 1616 |
| 824 | Ga0207679_10226523 | 3300025945 | Bacteria | 1576 |
| 825 | Ga0207679_10340064 | 3300025945 | Bacteria | 1305 |
| 826 | Ga0207667_10000430 | 3300025949 | Bacteria | 56466 |
| 827 | Ga0207667_10000453 | 3300025949 | Bacteria | 54929 |
| 828 | Ga0207667_10001484 | 3300025949 | Bacteria | 29439 |
| 829 | Ga0207667_10003602 | 3300025949 | Bacteria | 19111 |
| 830 | Ga0207667_10005923 | 3300025949 | Bacteria | 14885 |
| 831 | Ga0207667_10009521 | 3300025949 | Bacteria | 11431 |
| 832 | Ga0207667_10059200 | 3300025949 | Bacteria | 4013 |
| 833 | Ga0207667_10073069 | 3300025949 | Bacteria | 3564 |
| 834 | Ga0207667_10087826 | 3300025949 | Bacteria | 3216 |
| 835 | Ga0207667_10095966 | 3300025949 | Bacteria | 3060 |
| 836 | Ga0207667_10182531 | 3300025949 | Bacteria | 2154 |
| 837 | Ga0207667_10211301 | 3300025949 | Bacteria | 1989 |
| 838 | Ga0207667_10329536 | 3300025949 | Bacteria | 1559 |
| 839 | Ga0207667_10387114 | 3300025949 | Bacteria | 1424 |
| 840 | Ga0207667_10741997 | 3300025949 | Bacteria | 982 |
| 841 | Ga0207651_10053397 | 3300025960 | Bacteria | 2762 |
| 842 | Ga0207651_10087831 | 3300025960 | Bacteria | 2264 |
| 843 | Ga0207651_10621071 | 3300025960 | Bacteria | 947 |
| 844 | Ga0207712_10014683 | 3300025961 | Bacteria | 5044 |
| 845 | Ga0207712_10016131 | 3300025961 | Bacteria | 4830 |
| 846 | Ga0207712_10016968 | 3300025961 | Bacteria | 4723 |
| 847 | Ga0207712_10026663 | 3300025961 | Bacteria | 3853 |
| 848 | Ga0207712_10082897 | 3300025961 | Bacteria | 2339 |
| 849 | Ga0207712_10224168 | 3300025961 | Bacteria | 1505 |
| 850 | Ga0207712_10235773 | 3300025961 | Bacteria | 1471 |
| 851 | Ga0207712_10473219 | 3300025961 | Bacteria | 1066 |
| 852 | Ga0207668_10000869 | 3300025972 | Bacteria | 18234 |
| 853 | Ga0207668_10015084 | 3300025972 | Bacteria | 4796 |
| 854 | Ga0207668_10067188 | 3300025972 | Bacteria | 2544 |
| 855 | Ga0207668_10074158 | 3300025972 | Bacteria | 2442 |
| 856 | Ga0207668_10074644 | 3300025972 | Bacteria | 2435 |
| 857 | Ga0207668_10149486 | 3300025972 | Bacteria | 1806 |
| 858 | Ga0207668_10215357 | 3300025972 | Bacteria | 1539 |
| 859 | Ga0207668_10422993 | 3300025972 | Bacteria | 1131 |
| 860 | Ga0207640_10016977 | 3300025981 | Bacteria | 4249 |
| 861 | Ga0207640_10020295 | 3300025981 | Bacteria | 3944 |
| 862 | Ga0207640_10025047 | 3300025981 | Bacteria | 3607 |
| 863 | Ga0207640_10031753 | 3300025981 | Bacteria | 3268 |
| 864 | Ga0207640_10074633 | 3300025981 | Bacteria | 2296 |
| 865 | Ga0207640_10219281 | 3300025981 | Bacteria | 1455 |
| 866 | Ga0207640_10240337 | 3300025981 | Bacteria | 1399 |
| 867 | Ga0207658_10002877 | 3300025986 | Bacteria | 12335 |
| 868 | Ga0207658_10012999 | 3300025986 | Bacteria | 5685 |
| 869 | Ga0207658_10051578 | 3300025986 | Bacteria | 3032 |
| 870 | Ga0207677_10067295 | 3300026023 | Bacteria | 2509 |
| 871 | Ga0207677_10102638 | 3300026023 | Bacteria | 2109 |
| 872 | Ga0207677_10177581 | 3300026023 | Bacteria | 1672 |
| 873 | Ga0207677_10212621 | 3300026023 | Bacteria | 1545 |
| 874 | Ga0207703_10004088 | 3300026035 | Bacteria | 12037 |
| 875 | Ga0207703_10176996 | 3300026035 | Bacteria | 1880 |
| 876 | Ga0207639_10003633 | 3300026041 | Bacteria | 10364 |
| 877 | Ga0207639_10009134 | 3300026041 | Bacteria | 6832 |
| 878 | Ga0207639_10022533 | 3300026041 | Bacteria | 4538 |
| 879 | Ga0207639_10060496 | 3300026041 | Bacteria | 2922 |
| 880 | Ga0207639_10138059 | 3300026041 | Bacteria | 2028 |
| 881 | Ga0207639_10268603 | 3300026041 | Bacteria | 1495 |
| 882 | Ga0207639_10568927 | 3300026041 | Bacteria | 1042 |
| 883 | Ga0207678_10137308 | 3300026067 | Bacteria | 2086 |
| 884 | Ga0207678_10154438 | 3300026067 | Bacteria | 1960 |
| 885 | Ga0207678_10172372 | 3300026067 | Bacteria | 1847 |
| 886 | Ga0207708_10058905 | 3300026075 | Bacteria | 2931 |
| 887 | Ga0207708_10119848 | 3300026075 | Bacteria | 2050 |
| 888 | Ga0207702_10001407 | 3300026078 | Bacteria | 24021 |
| 889 | Ga0207702_10056726 | 3300026078 | Bacteria | 3326 |
| 890 | Ga0207702_10085669 | 3300026078 | Bacteria | 2746 |
| 891 | Ga0207702_10115561 | 3300026078 | Bacteria | 2393 |
| 892 | Ga0207702_10209740 | 3300026078 | Bacteria | 1810 |
| 893 | Ga0207702_10263405 | 3300026078 | Bacteria | 1624 |
| 894 | Ga0207641_10000121 | 3300026088 | Bacteria | 114943 |
| 895 | Ga0207641_10005564 | 3300026088 | Bacteria | 10740 |
| 896 | Ga0207641_10025754 | 3300026088 | Bacteria | 4850 |
| 897 | Ga0207641_10029136 | 3300026088 | Bacteria | 4565 |
| 898 | Ga0207641_10030020 | 3300026088 | Bacteria | 4500 |
| 899 | Ga0207641_10091863 | 3300026088 | Bacteria | 2657 |
| 900 | Ga0207641_10343578 | 3300026088 | Bacteria | 1421 |
| 901 | Ga0207648_10003053 | 3300026089 | Bacteria | 17701 |
| 902 | Ga0207648_10009109 | 3300026089 | Bacteria | 9541 |
| 903 | Ga0207648_10014701 | 3300026089 | Bacteria | 7223 |
| 904 | Ga0207648_10027181 | 3300026089 | Bacteria | 5081 |
| 905 | Ga0207648_10028462 | 3300026089 | Bacteria | 4954 |
| 906 | Ga0207648_10148136 | 3300026089 | Bacteria | 2071 |
| 907 | Ga0207648_10176788 | 3300026089 | Bacteria | 1888 |
| 908 | Ga0207648_10191611 | 3300026089 | Bacteria | 1812 |
| 909 | Ga0207648_10340042 | 3300026089 | Bacteria | 1351 |
| 910 | Ga0207676_10003342 | 3300026095 | Bacteria | 11375 |
| 911 | Ga0207676_10003799 | 3300026095 | Bacteria | 10679 |
| 912 | Ga0207676_10015259 | 3300026095 | Bacteria | 5540 |
| 913 | Ga0207676_10067110 | 3300026095 | Bacteria | 2864 |
| 914 | Ga0207676_10166766 | 3300026095 | Bacteria | 1914 |
| 915 | Ga0207676_10256460 | 3300026095 | Bacteria | 1577 |
| 916 | Ga0207676_10260843 | 3300026095 | Bacteria | 1565 |
| 917 | Ga0207676_10278588 | 3300026095 | Bacteria | 1517 |
| 918 | Ga0207674_10009949 | 3300026116 | Bacteria | 10820 |
| 919 | Ga0207674_10020554 | 3300026116 | Bacteria | 7129 |
| 920 | Ga0207674_10022667 | 3300026116 | Bacteria | 6740 |
| 921 | Ga0207674_10025546 | 3300026116 | Bacteria | 6296 |
| 922 | Ga0207674_10047480 | 3300026116 | Bacteria | 4400 |
| 923 | Ga0207674_10070646 | 3300026116 | Bacteria | 3510 |
| 924 | Ga0207674_10164835 | 3300026116 | Bacteria | 2170 |
| 925 | Ga0207674_10168628 | 3300026116 | Bacteria | 2143 |
| 926 | Ga0207674_10533724 | 3300026116 | Bacteria | 1133 |
| 927 | Ga0207674_10629089 | 3300026116 | Bacteria | 1036 |
| 928 | Ga0207674_10696855 | 3300026116 | Bacteria | 981 |
| 929 | Ga0207675_100002059 | 3300026118 | Bacteria | 20054 |
| 930 | Ga0207675_100011158 | 3300026118 | Bacteria | 8416 |
| 931 | Ga0207675_100041609 | 3300026118 | Bacteria | 4291 |
| 932 | Ga0207675_100049685 | 3300026118 | Bacteria | 3913 |
| 933 | Ga0207675_100068632 | 3300026118 | Bacteria | 3313 |
| 934 | Ga0207675_100119254 | 3300026118 | Bacteria | 2495 |
| 935 | Ga0207675_100450484 | 3300026118 | Bacteria | 1275 |
| 936 | Ga0207675_100595456 | 3300026118 | Bacteria | 1108 |
| 937 | Ga0207683_10006890 | 3300026121 | Bacteria | 9730 |
| 938 | Ga0207683_10011072 | 3300026121 | Bacteria | 7685 |
| 939 | Ga0207683_10016244 | 3300026121 | Bacteria | 6334 |
| 940 | Ga0207683_10024454 | 3300026121 | Bacteria | 5203 |
| 941 | Ga0207683_10097053 | 3300026121 | Bacteria | 2628 |
| 942 | Ga0207683_10143867 | 3300026121 | Bacteria | 2149 |
| 943 | Ga0207683_10202465 | 3300026121 | Bacteria | 1805 |
| 944 | Ga0207698_10001488 | 3300026142 | Bacteria | 13640 |
| 945 | Ga0207698_10013166 | 3300026142 | Bacteria | 5446 |
| 946 | Ga0207698_10016613 | 3300026142 | Bacteria | 4968 |
| 947 | Ga0207698_10060388 | 3300026142 | Bacteria | 2948 |
| 948 | Ga0207698_10136904 | 3300026142 | Bacteria | 2103 |
| 949 | Ga0209984_1004458 | 3300027424 | Bacteria | 1650 |
| 950 | Ga0209968_1005122 | 3300027526 | Bacteria | 1965 |
| 951 | Ga0209968_1011246 | 3300027526 | Bacteria | 1384 |
| 952 | Ga0210002_1001494 | 3300027617 | Bacteria | 3313 |
| 953 | Ga0209983_1021655 | 3300027665 | Bacteria | 1345 |
| 954 | Ga0209998_10017630 | 3300027717 | Bacteria | 1511 |
| 955 | Ga0207428_10111837 | 3300027907 | Bacteria | 2101 |
| 956 | Ga0207428_10136352 | 3300027907 | Bacteria | 1876 |
| 957 | Ga0207428_10279999 | 3300027907 | Bacteria | 1238 |
| 958 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 959 | Ga0268266_10015422 | 3300028379 | Bacteria | 6557 |
| 960 | Ga0268266_10036671 | 3300028379 | Bacteria | 4175 |
| 961 | Ga0268265_10003503 | 3300028380 | Bacteria | 11231 |
| 962 | Ga0268265_10045098 | 3300028380 | Bacteria | 3288 |
| 963 | Ga0268265_10156749 | 3300028380 | Bacteria | 1928 |
| 964 | Ga0268265_10342236 | 3300028380 | Bacteria | 1362 |
| 965 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 966 | Ga0268264_10004208 | 3300028381 | Bacteria | 12284 |
| 967 | Ga0268264_10004870 | 3300028381 | Bacteria | 11377 |
| 968 | Ga0268264_10012086 | 3300028381 | Bacteria | 7108 |
| 969 | Ga0268264_10015090 | 3300028381 | Bacteria | 6337 |
| 970 | Ga0268264_10025918 | 3300028381 | Bacteria | 4786 |
| 971 | Ga0268264_10061228 | 3300028381 | Bacteria | 3157 |
| 972 | Ga0268264_10128293 | 3300028381 | Bacteria | 2245 |
| 973 | Ga0268264_10222733 | 3300028381 | Bacteria | 1737 |
| 974 | Ga0268264_10251911 | 3300028381 | Bacteria | 1641 |
| 975 | Ga0265323_10000040 | 3300028653 | Bacteria | 70373 |
| 976 | Ga0265336_10019263 | 3300028666 | Bacteria | 2203 |
| 977 | Ga0307517_10018578 | 3300028786 | Bacteria | 8983 |
| 978 | Ga0265338_10001855 | 3300028800 | Bacteria | 33207 |
| 979 | Ga0265338_10206753 | 3300028800 | Bacteria | 1476 |
| 980 | Ga0265324_10008522 | 3300029957 | Bacteria | 4070 |
| 981 | Ga0307511_10004717 | 3300030521 | Bacteria | 13935 |
| 982 | Ga0307512_10107163 | 3300030522 | Bacteria | 1861 |
| 983 | Ga0316177_1079276 | 3300030731 | Bacteria | 6692 |
| 984 | Ga0316176_1220529 | 3300030732 | Bacteria | 11720 |
| 985 | Ga0316183_1116825 | 3300030742 | Bacteria | 56435 |
| 986 | Ga0316181_1163475 | 3300030744 | Bacteria | 9442 |
| 987 | Ga0265331_10159692 | 3300031250 | Bacteria | 1022 |
| 988 | Ga0265327_10000097 | 3300031251 | Bacteria | 193156 |
| 989 | Ga0265327_10000159 | 3300031251 | Bacteria | 145537 |
| 990 | Ga0265327_10000244 | 3300031251 | Bacteria | 108867 |
| 991 | Ga0265327_10000298 | 3300031251 | Bacteria | 96149 |
| 992 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 993 | Ga0265327_10074641 | 3300031251 | Bacteria | 1689 |
| 994 | Ga0265327_10105046 | 3300031251 | Bacteria | 1357 |
| 995 | Ga0265327_10155339 | 3300031251 | Bacteria | 1060 |
| 996 | Ga0265316_10000486 | 3300031344 | Bacteria | 45040 |
| 997 | Ga0265316_10004409 | 3300031344 | Bacteria | 14019 |
| 998 | Ga0307513_10349076 | 3300031456 | Bacteria | 1228 |
| 999 | Ga0307513_10363487 | 3300031456 | Bacteria | 1191 |
| 1000 | Ga0307509_10007469 | 3300031507 | Bacteria | 14263 |
| 1001 | Ga0307408_100013046 | 3300031548 | Bacteria | 5512 |
| 1002 | Ga0307408_100038382 | 3300031548 | Bacteria | 3379 |
| 1003 | Ga0307408_100466746 | 3300031548 | Bacteria | 1098 |
| 1004 | Ga0265342_10050150 | 3300031712 | Bacteria | 2495 |
| 1005 | Ga0265342_10197336 | 3300031712 | Bacteria | 1095 |
| 1006 | Ga0316576_10007854 | 3300031727 | Bacteria | 6745 |
| 1007 | Ga0316576_10080879 | 3300031727 | Bacteria | 2410 |
| 1008 | Ga0316576_10098247 | 3300031727 | Bacteria | 2186 |
| 1009 | Ga0316576_10134476 | 3300031727 | Bacteria | 1861 |
| 1010 | Ga0316578_10009003 | 3300031728 | Bacteria | 5110 |
| 1011 | Ga0316578_10015477 | 3300031728 | Bacteria | 4102 |
| 1012 | Ga0307516_10004268 | 3300031730 | Bacteria | 17759 |
| 1013 | Ga0307405_10010819 | 3300031731 | Bacteria | 4749 |
| 1014 | Ga0307405_10182283 | 3300031731 | Bacteria | 1509 |
| 1015 | Ga0316577_10016238 | 3300031733 | Bacteria | 4101 |
| 1016 | Ga0316577_10051389 | 3300031733 | Bacteria | 2300 |
| 1017 | Ga0316577_10056390 | 3300031733 | Bacteria | 2193 |
| 1018 | Ga0316577_10057199 | 3300031733 | Bacteria | 2177 |
| 1019 | Ga0316577_10282233 | 3300031733 | Bacteria | 940 |
| 1020 | Ga0307413_10189650 | 3300031824 | Bacteria | 1475 |
| 1021 | Ga0307410_10035292 | 3300031852 | Bacteria | 3246 |
| 1022 | Ga0307410_10133130 | 3300031852 | Bacteria | 1829 |
| 1023 | Ga0307410_10159428 | 3300031852 | Bacteria | 1689 |
| 1024 | Ga0307406_10106862 | 3300031901 | Bacteria | 1918 |
| 1025 | Ga0307406_10300089 | 3300031901 | Bacteria | 1234 |
| 1026 | Ga0307407_10083520 | 3300031903 | Bacteria | 1938 |
| 1027 | Ga0307407_10439711 | 3300031903 | Bacteria | 944 |
| 1028 | Ga0307412_10002740 | 3300031911 | Bacteria | 9804 |
| 1029 | Ga0307412_10010885 | 3300031911 | Bacteria | 5251 |
| 1030 | Ga0307412_10031955 | 3300031911 | Bacteria | 3329 |
| 1031 | Ga0307412_10153514 | 3300031911 | Bacteria | 1702 |
| 1032 | Ga0307409_100054022 | 3300031995 | Bacteria | 3091 |
| 1033 | Ga0307416_100000249 | 3300032002 | Bacteria | 28628 |
| 1034 | Ga0307416_100069247 | 3300032002 | Bacteria | 2919 |
| 1035 | Ga0307416_100644143 | 3300032002 | Bacteria | 1144 |
| 1036 | Ga0307414_10046410 | 3300032004 | Bacteria | 2982 |
| 1037 | Ga0307414_10049268 | 3300032004 | Bacteria | 2912 |
| 1038 | Ga0307414_10058567 | 3300032004 | Bacteria | 2715 |
| 1039 | Ga0307414_10077937 | 3300032004 | Bacteria | 2414 |
| 1040 | Ga0307414_10149592 | 3300032004 | Bacteria | 1840 |
| 1041 | Ga0307414_10186541 | 3300032004 | Bacteria | 1674 |
| 1042 | Ga0307414_10219916 | 3300032004 | Bacteria | 1558 |
| 1043 | Ga0307414_10273647 | 3300032004 | Bacteria | 1416 |
| 1044 | Ga0307414_10453617 | 3300032004 | Bacteria | 1125 |
| 1045 | Ga0307411_10020538 | 3300032005 | Bacteria | 3844 |
| 1046 | Ga0307411_10047021 | 3300032005 | Bacteria | 2787 |
| 1047 | Ga0307411_10067723 | 3300032005 | Bacteria | 2404 |
| 1048 | Ga0307415_100012733 | 3300032126 | Bacteria | 4876 |
| 1049 | Ga0307415_100025311 | 3300032126 | Bacteria | 3721 |
| 1050 | Ga0316580_10016205 | 3300032139 | Bacteria | 2285 |
| 1051 | Ga0316580_10084222 | 3300032139 | Bacteria | 972 |
| 1052 | Ga0316580_10085624 | 3300032139 | Bacteria | 964 |
| 1053 | Ga0316593_10000279 | 3300032168 | Bacteria | 8591 |
| 1054 | Ga0316593_10000712 | 3300032168 | Bacteria | 6519 |
| 1055 | Ga0316593_10004976 | 3300032168 | Bacteria | 3464 |
| 1056 | Ga0316593_10006916 | 3300032168 | Bacteria | 3088 |
| 1057 | Ga0316593_10016946 | 3300032168 | Bacteria | 2216 |
| 1058 | Ga0316593_10026606 | 3300032168 | Bacteria | 1850 |
| 1059 | Ga0316593_10071614 | 3300032168 | Bacteria | 1200 |
| 1060 | Ga0307510_10000380 | 3300033180 | Bacteria | 42243 |
| 1061 | Ga0316592_1000047 | 3300033524 | Bacteria | 10098 |
| 1062 | Ga0316592_1000131 | 3300033524 | Bacteria | 8112 |
| 1063 | Ga0316592_1000317 | 3300033524 | Bacteria | 6265 |
| 1064 | Ga0316592_1000414 | 3300033524 | Bacteria | 5767 |
| 1065 | Ga0316592_1001892 | 3300033524 | Bacteria | 3509 |
| 1066 | Ga0316592_1003234 | 3300033524 | Bacteria | 2911 |
| 1067 | Ga0316592_1020447 | 3300033524 | Bacteria | 1406 |
| 1068 | Ga0316592_1035762 | 3300033524 | Bacteria | 1090 |
| 1069 | Ga0316586_1003187 | 3300033527 | Bacteria | 2130 |
| 1070 | Ga0316586_1012203 | 3300033527 | Bacteria | 1329 |
| 1071 | Ga0316588_1000234 | 3300033528 | Bacteria | 6658 |
| 1072 | Ga0316588_1000295 | 3300033528 | Bacteria | 6202 |
| 1073 | Ga0316588_1000569 | 3300033528 | Bacteria | 5197 |
| 1074 | Ga0316596_1000052 | 3300033541 | Bacteria | 12700 |
| 1075 | Ga0316596_1000106 | 3300033541 | Bacteria | 10634 |
| 1076 | Ga0316596_1001428 | 3300033541 | Bacteria | 4810 |
| 1077 | Ga0316596_1002332 | 3300033541 | Bacteria | 4037 |
| 1078 | Ga0316596_1003798 | 3300033541 | Bacteria | 3341 |
| 1079 | Ga0316596_1006124 | 3300033541 | Bacteria | 2784 |
| 1080 | Ga0316596_1006577 | 3300033541 | Bacteria | 2709 |
| 1081 | Ga0316596_1009489 | 3300033541 | Bacteria | 2336 |
| 1082 | Ga0316596_1014496 | 3300033541 | Bacteria | 1955 |
| 1083 | Ga0316596_1019782 | 3300033541 | Bacteria | 1710 |
| 1084 | Ga0316596_1026385 | 3300033541 | Bacteria | 1498 |
| 1085 | Ga0316596_1040079 | 3300033541 | Bacteria | 1229 |
| 1086 | Ga0373955_0075643 | 3300035172 | Bacteria | 1893 |
| 1087 | Ga0316574_0036503 | 3300035398 | Bacteria | 3009 |
| 1088 | Ga0316574_0081697 | 3300035398 | Bacteria | 2053 |
| 1089 | Ga0316574_0105203 | 3300035398 | Bacteria | 1807 |
| 1090 | Ga0373935_0165867 | 3300035692 | Bacteria | 1508 |
| 1091 | Ga0373927_0006959 | 3300035695 | Bacteria | 7677 |
| 1092 | Ga0373937_0002462 | 3300036401 | Bacteria | 15390 |
| 1093 | Ga0373937_0299425 | 3300036401 | Bacteria | 1520 |
| 1094 | Ga0316582_0168172 | 3300036647 | Bacteria | 1487 |
| 1095 | Ga0316582_0250448 | 3300036647 | Unclassified | 1214 |
| 1096 | Ga0316584_0001842 | 3300036712 | Bacteria | 13121 |
| 1097 | Ga0316584_0004403 | 3300036712 | Bacteria | 9325 |
| 1098 | Ga0316584_0015050 | 3300036712 | Bacteria | 5526 |
| 1099 | Ga0316584_0028755 | 3300036712 | Bacteria | 4102 |
| 1100 | Ga0316584_0123064 | 3300036712 | Bacteria | 1938 |
| 1101 | Ga0316584_0128854 | 3300036712 | Bacteria | 1890 |
| 1102 | Ga0373925_0286730 | 3300037068 | Bacteria | 1327 |
| 1103 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 1104 | Ga0395899_0001127 | 3300037312 | Bacteria | 23734 |
| 1105 | Ga0395899_0001602 | 3300037312 | Bacteria | 18978 |
| 1106 | Ga0395899_0006152 | 3300037312 | Bacteria | 9303 |
| 1107 | Ga0395899_0014673 | 3300037312 | Bacteria | 5979 |
| 1108 | Ga0395899_0054207 | 3300037312 | Bacteria | 2967 |
| 1109 | Ga0395900_0000346 | 3300037418 | Bacteria | 68020 |
| 1110 | Ga0395900_0001482 | 3300037418 | Bacteria | 28015 |
| 1111 | Ga0395900_0006693 | 3300037418 | Bacteria | 11974 |
| 1112 | Ga0395900_0016502 | 3300037418 | Bacteria | 7532 |
| 1113 | Ga0395900_0017444 | 3300037418 | Bacteria | 7328 |
| 1114 | Ga0395900_0052980 | 3300037418 | Bacteria | 4176 |
| 1115 | Ga0395900_0074436 | 3300037418 | Bacteria | 3491 |
| 1116 | Ga0395900_0124849 | 3300037418 | Bacteria | 2639 |
| 1117 | Ga0395900_0410611 | 3300037418 | Bacteria | 1316 |
| 1118 | Ga0395898_0002718 | 3300037466 | Bacteria | 20408 |
| 1119 | Ga0395898_0018836 | 3300037466 | Bacteria | 7033 |
| 1120 | Ga0395898_0034336 | 3300037466 | Bacteria | 5056 |
| 1121 | Ga0395898_0039390 | 3300037466 | Bacteria | 4677 |
| 1122 | Ga0395898_0094771 | 3300037466 | Bacteria | 2869 |
| 1123 | Ga0395898_0257000 | 3300037466 | Bacteria | 1666 |
| 1124 | Ga0395898_0378729 | 3300037466 | Bacteria | 1349 |
| 1125 | Ga0395898_0584577 | 3300037466 | Bacteria | 1059 |
| 1126 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 1127 | Ga0395905_0000376 | 3300037471 | Bacteria | 63695 |
| 1128 | Ga0395905_0000528 | 3300037471 | Bacteria | 52404 |
| 1129 | Ga0395905_0002823 | 3300037471 | Bacteria | 19037 |
| 1130 | Ga0395905_0002993 | 3300037471 | Bacteria | 18335 |
| 1131 | Ga0395905_0096577 | 3300037471 | Bacteria | 2774 |
| 1132 | Ga0395905_0173952 | 3300037471 | Bacteria | 2022 |
| 1133 | Ga0395905_0415359 | 3300037471 | Bacteria | 1241 |
| 1134 | Ga0395901_0000351 | 3300038443 | Bacteria | 56004 |
| 1135 | Ga0395901_0001115 | 3300038443 | Bacteria | 28520 |
| 1136 | Ga0395901_0078192 | 3300038443 | Bacteria | 3454 |
| 1137 | Ga0395901_0135999 | 3300038443 | Bacteria | 2583 |
| 1138 | Ga0395901_0158362 | 3300038443 | Bacteria | 2378 |
| 1139 | Ga0395901_0252291 | 3300038443 | Bacteria | 1838 |
| 1140 | Ga0400483_219275 | 3300039062 | Bacteria | 32517 |
| 1141 | Ga0436365_0472587 | 3300039437 | Bacteria | 3578 |
| 1142 | Ga0436365_0781227 | 3300039437 | Bacteria | 11182 |
| 1143 | Ga0436365_1312514 | 3300039437 | Bacteria | 1889 |
| 1144 | Ga0436365_1690067 | 3300039437 | Bacteria | 10061 |
| 1145 | Ga0436361_0986181 | 3300039447 | Bacteria | 4054 |
| 1146 | Ga0436361_1211924 | 3300039447 | Bacteria | 2151 |
| 1147 | Ga0439436_0004280 | 3300041404 | Bacteria | 4371 |
| 1148 | Ga0439439_0010020 | 3300041406 | Bacteria | 2261 |
| 1149 | Ga0439439_0018085 | 3300041406 | Bacteria | 1739 |
| 1150 | Ga0439453_0020145 | 3300041408 | Bacteria | 1194 |
| 1151 | Ga0439465_0022501 | 3300041413 | Bacteria | 1980 |
| 1152 | Ga0439465_0069648 | 3300041413 | Bacteria | 1178 |
| 1153 | Ga0439465_0110006 | 3300041413 | Bacteria | 958 |
| 1154 | Ga0451787_433472 | 3300041441 | Bacteria | 1374 |
| 1155 | Ga0451795_0024876 | 3300041456 | Bacteria | 963 |
| 1156 | Ga0451837_0265238 | 3300041494 | Bacteria | 4284 |
| 1157 | Ga0451837_0432158 | 3300041494 | Bacteria | 1837 |
| 1158 | Ga0439431_0000777 | 3300041997 | Bacteria | 6892 |
| 1159 | Ga0439431_0013148 | 3300041997 | Bacteria | 1907 |
| 1160 | Ga0439431_0040544 | 3300041997 | Bacteria | 1184 |
| 1161 | Ga0439433_0009272 | 3300041999 | Bacteria | 2142 |
| 1162 | Ga0439433_0031284 | 3300041999 | Bacteria | 1218 |
| 1163 | Ga0439445_0001922 | 3300042004 | Bacteria | 4584 |
| 1164 | Ga0439445_0011234 | 3300042004 | Bacteria | 2132 |
| 1165 | Ga0439448_0005262 | 3300042005 | Bacteria | 3685 |
| 1166 | Ga0439449_0005508 | 3300042007 | Bacteria | 4845 |
| 1167 | Ga0439449_0013615 | 3300042007 | Bacteria | 3061 |
| 1168 | Ga0439449_0017442 | 3300042007 | Bacteria | 2696 |
| 1169 | Ga0439454_014244 | 3300042011 | Bacteria | 1101 |
| 1170 | Ga0439455_0032158 | 3300042012 | Bacteria | 1310 |
| 1171 | Ga0439455_0052110 | 3300042012 | Bacteria | 1071 |
| 1172 | Ga0439457_000313 | 3300042014 | Bacteria | 13359 |
| 1173 | Ga0439462_0001031 | 3300042015 | Bacteria | 5982 |
| 1174 | Ga0439462_0015306 | 3300042015 | Bacteria | 1977 |
| 1175 | Ga0450923_013606 | 3300042125 | Bacteria | 1497 |
| 1176 | Ga0450894_006068 | 3300042131 | Bacteria | 1563 |
| 1177 | Ga0439446_0018535 | 3300042156 | Bacteria | 1951 |
| 1178 | Ga0439434_0002227 | 3300042435 | Bacteria | 5629 |
| 1179 | Ga0439434_0017713 | 3300042435 | Bacteria | 2133 |
| 1180 | Ga0450918_016978 | 3300042531 | Bacteria | 1267 |
| 1181 | Ga0450893_0021862 | 3300042532 | Bacteria | 1106 |
| 1182 | Ga0451577_0004463 | 3300042876 | Bacteria | 14775 |
| 1183 | Ga0451577_0014494 | 3300042876 | Bacteria | 7348 |
| 1184 | Ga0451577_0030583 | 3300042876 | Bacteria | 4865 |
| 1185 | Ga0451577_0035014 | 3300042876 | Bacteria | 4524 |
| 1186 | Ga0451577_0048590 | 3300042876 | Bacteria | 3790 |
| 1187 | Ga0451577_0053903 | 3300042876 | Bacteria | 3590 |
| 1188 | Ga0451577_0058001 | 3300042876 | Bacteria | 3451 |
| 1189 | Ga0451577_0091765 | 3300042876 | Bacteria | 2711 |
| 1190 | Ga0451577_0092287 | 3300042876 | Bacteria | 2703 |
| 1191 | Ga0451577_0160817 | 3300042876 | Bacteria | 2022 |
| 1192 | Ga0451577_0184901 | 3300042876 | Bacteria | 1879 |
| 1193 | Ga0451577_0223646 | 3300042876 | Bacteria | 1701 |
| 1194 | Ga0451577_0274290 | 3300042876 | Bacteria | 1527 |
| 1195 | Ga0451577_0281781 | 3300042876 | Bacteria | 1506 |
| 1196 | Ga0451577_0281951 | 3300042876 | Bacteria | 1505 |
| 1197 | Ga0466969_0000246 | 3300044656 | Bacteria | 29777 |
| 1198 | Ga0466972_0000025 | 3300044658 | Bacteria | 186601 |
| 1199 | Ga0466972_0043728 | 3300044658 | Bacteria | 2174 |
| 1200 | Ga0453683_0000055 | 3300044673 | Bacteria | 192588 |
| 1201 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 1202 | Ga0453683_0000935 | 3300044673 | Bacteria | 27791 |
| 1203 | Ga0453683_0005759 | 3300044673 | Bacteria | 8592 |
| 1204 | Ga0453683_0007526 | 3300044673 | Bacteria | 7375 |
| 1205 | Ga0453683_0049521 | 3300044673 | Bacteria | 2634 |
| 1206 | Ga0453683_0082507 | 3300044673 | Bacteria | 2014 |
| 1207 | Ga0453683_0099319 | 3300044673 | Bacteria | 1827 |
| 1208 | Ga0466966_0001476 | 3300044684 | Bacteria | 15131 |
| 1209 | Ga0466966_0022707 | 3300044684 | Bacteria | 4113 |
| 1210 | Ga0466961_0096365 | 3300044693 | Bacteria | 1866 |
| 1211 | Ga0466961_0114876 | 3300044693 | Bacteria | 1692 |
| 1212 | Ga0466964_0026563 | 3300044706 | Bacteria | 2267 |
| 1213 | Ga0453684_0000334 | 3300044712 | Bacteria | 196444 |
| 1214 | Ga0453684_0000413 | 3300044712 | Bacteria | 174924 |
| 1215 | Ga0453684_0000440 | 3300044712 | Bacteria | 169397 |
| 1216 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 1217 | Ga0453684_0001121 | 3300044712 | Bacteria | 83919 |
| 1218 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 1219 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 1220 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 1221 | Ga0453684_0004131 | 3300044712 | Bacteria | 31439 |
| 1222 | Ga0453684_0005611 | 3300044712 | Bacteria | 24695 |
| 1223 | Ga0453684_0012498 | 3300044712 | Bacteria | 13983 |
| 1224 | Ga0453684_0013573 | 3300044712 | Bacteria | 13209 |
| 1225 | Ga0453684_0014056 | 3300044712 | Bacteria | 12880 |
| 1226 | Ga0453684_0025154 | 3300044712 | Bacteria | 8657 |
| 1227 | Ga0453684_0032953 | 3300044712 | Bacteria | 7234 |
| 1228 | Ga0453684_0033676 | 3300044712 | Bacteria | 7134 |
| 1229 | Ga0453684_0040849 | 3300044712 | Bacteria | 6288 |
| 1230 | Ga0453684_0046321 | 3300044712 | Bacteria | 5784 |
| 1231 | Ga0453684_0048058 | 3300044712 | Bacteria | 5649 |
| 1232 | Ga0453684_0050952 | 3300044712 | Bacteria | 5435 |
| 1233 | Ga0453684_0055899 | 3300044712 | Bacteria | 5126 |
| 1234 | Ga0453684_0056141 | 3300044712 | Bacteria | 5111 |
| 1235 | Ga0453684_0059704 | 3300044712 | Bacteria | 4914 |
| 1236 | Ga0453684_0060833 | 3300044712 | Bacteria | 4853 |
| 1237 | Ga0453684_0065279 | 3300044712 | Bacteria | 4643 |
| 1238 | Ga0453684_0074193 | 3300044712 | Bacteria | 4285 |
| 1239 | Ga0453684_0092022 | 3300044712 | Bacteria | 3741 |
| 1240 | Ga0453684_0093568 | 3300044712 | Bacteria | 3701 |
| 1241 | Ga0453684_0100839 | 3300044712 | Bacteria | 3533 |
| 1242 | Ga0453684_0108960 | 3300044712 | Bacteria | 3370 |
| 1243 | Ga0453684_0133671 | 3300044712 | Bacteria | 2973 |
| 1244 | Ga0453684_0145076 | 3300044712 | Bacteria | 2829 |
| 1245 | Ga0453684_0258564 | 3300044712 | Bacteria | 1996 |
| 1246 | Ga0453684_0261069 | 3300044712 | Bacteria | 1984 |
| 1247 | Ga0453684_0435002 | 3300044712 | Bacteria | 1463 |
| 1248 | Ga0466970_0000933 | 3300044765 | Bacteria | 14121 |
| 1249 | Ga0466970_0032604 | 3300044765 | Bacteria | 2753 |
| 1250 | Ga0466957_0001187 | 3300044842 | Bacteria | 13537 |
| 1251 | Ga0466957_0009999 | 3300044842 | Bacteria | 5428 |
| 1252 | Ga0466957_0025802 | 3300044842 | Bacteria | 3484 |
| 1253 | Ga0466959_0000017 | 3300045049 | Bacteria | 143170 |
| 1254 | Ga0466959_0017683 | 3300045049 | Bacteria | 5229 |
| 1255 | Ga0466959_0019573 | 3300045049 | Bacteria | 4978 |
| 1256 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 1257 | Ga0451576_0001103 | 3300045051 | Bacteria | 49329 |
| 1258 | Ga0451576_0005920 | 3300045051 | Bacteria | 15147 |
| 1259 | Ga0451576_0010522 | 3300045051 | Bacteria | 10601 |
| 1260 | Ga0451576_0011813 | 3300045051 | Bacteria | 9886 |
| 1261 | Ga0451576_0017866 | 3300045051 | Bacteria | 7791 |
| 1262 | Ga0451576_0018019 | 3300045051 | Bacteria | 7749 |
| 1263 | Ga0451576_0021171 | 3300045051 | Bacteria | 7070 |
| 1264 | Ga0451576_0030427 | 3300045051 | Bacteria | 5770 |
| 1265 | Ga0451576_0051376 | 3300045051 | Bacteria | 4322 |
| 1266 | Ga0451576_0071147 | 3300045051 | Bacteria | 3620 |
| 1267 | Ga0451576_0099290 | 3300045051 | Bacteria | 3028 |
| 1268 | Ga0451576_0197917 | 3300045051 | Bacteria | 2099 |
| 1269 | Ga0451576_0224290 | 3300045051 | Bacteria | 1962 |
| 1270 | Ga0451576_0254434 | 3300045051 | Bacteria | 1836 |
| 1271 | Ga0451576_0360124 | 3300045051 | Bacteria | 1523 |
| 1272 | Ga0451576_0460967 | 3300045051 | Bacteria | 1335 |
| 1273 | Ga0451576_0909952 | 3300045051 | Bacteria | 923 |
| 1274 | Ga0495627_001896 | 3300046453 | Bacteria | 10966 |
| 1275 | Ga0495603_0132226 | 3300046455 | Bacteria | 1453 |
| 1276 | Ga0495638_0083919 | 3300046460 | Bacteria | 1929 |
| 1277 | Ga0495638_0085990 | 3300046460 | Bacteria | 1901 |
| 1278 | Ga0495653_0047662 | 3300046463 | Bacteria | 3314 |
| 1279 | Ga0495650_0051591 | 3300046471 | Bacteria | 1694 |
| 1280 | Ga0495580_0013181 | 3300046472 | Bacteria | 6325 |
| 1281 | Ga0495582_0139876 | 3300046473 | Bacteria | 1371 |
| 1282 | Ga0495662_0020123 | 3300046476 | Bacteria | 3230 |
| 1283 | Ga0495664_0051957 | 3300046477 | Bacteria | 2434 |
| 1284 | Ga0495583_0069279 | 3300046506 | Bacteria | 1554 |
| 1285 | Ga0495606_0021306 | 3300046507 | Bacteria | 4749 |
| 1286 | Ga0495606_0036258 | 3300046507 | Bacteria | 3361 |
| 1287 | Ga0495608_0012072 | 3300046511 | Bacteria | 6005 |
| 1288 | Ga0495608_0268649 | 3300046511 | Bacteria | 1061 |
| 1289 | Ga0495616_0018996 | 3300046513 | Bacteria | 3757 |
| 1290 | Ga0495616_0025587 | 3300046513 | Bacteria | 3151 |
| 1291 | Ga0495618_0020169 | 3300046514 | Bacteria | 4104 |
| 1292 | Ga0495628_0008937 | 3300046516 | Bacteria | 8568 |
| 1293 | Ga0495628_0610950 | 3300046516 | Bacteria | 778 |
| 1294 | Ga0495630_0017830 | 3300046517 | Bacteria | 5207 |
| 1295 | Ga0495630_0057161 | 3300046517 | Bacteria | 2924 |
| 1296 | Ga0495630_0223347 | 3300046517 | Bacteria | 1438 |
| 1297 | Ga0495643_0000294 | 3300046522 | Bacteria | 70329 |
| 1298 | Ga0495643_0101174 | 3300046522 | Bacteria | 1477 |
| 1299 | Ga0495644_0001340 | 3300046523 | Bacteria | 10069 |
| 1300 | Ga0495648_0012032 | 3300046524 | Bacteria | 6482 |
| 1301 | Ga0495652_0444576 | 3300046529 | Bacteria | 909 |
| 1302 | Ga0495640_0024578 | 3300046533 | Bacteria | 4382 |
| 1303 | Ga0495587_0115395 | 3300046536 | Bacteria | 1541 |
| 1304 | Ga0495645_0090453 | 3300046543 | Bacteria | 2188 |
| 1305 | Ga0495633_0000049 | 3300046558 | Bacteria | 156684 |
| 1306 | Ga0495668_0000108 | 3300046616 | Bacteria | 132593 |
| 1307 | Ga0495668_0000191 | 3300046616 | Bacteria | 90923 |
| 1308 | Ga0495668_0001518 | 3300046616 | Bacteria | 22075 |
| 1309 | Ga0495634_0023809 | 3300046642 | Bacteria | 4302 |
| 1310 | Ga0495634_0057670 | 3300046642 | Bacteria | 2591 |
| 1311 | Ga0495611_0085828 | 3300046648 | Bacteria | 1452 |
| 1312 | Ga0495611_0154893 | 3300046648 | Bacteria | 1070 |
| 1313 | Ga0495625_0001933 | 3300046660 | Bacteria | 23424 |
| 1314 | Ga0495625_0043576 | 3300046660 | Bacteria | 3253 |
| 1315 | Ga0495625_0051559 | 3300046660 | Bacteria | 2950 |
| 1316 | Ga0495625_0068664 | 3300046660 | Bacteria | 2491 |
| 1317 | Ga0495625_0173757 | 3300046660 | Bacteria | 1437 |
| 1318 | Ga0495657_0193260 | 3300046675 | Bacteria | 1243 |
| 1319 | Ga0495658_0006331 | 3300046683 | Bacteria | 5815 |
| 1320 | Ga0495613_0151946 | 3300046689 | Bacteria | 1651 |
| 1321 | Ga0495613_0178582 | 3300046689 | Bacteria | 1504 |
| 1322 | Ga0495670_0006417 | 3300046691 | Bacteria | 5777 |
| 1323 | Ga0495670_0031502 | 3300046691 | Bacteria | 2636 |
| 1324 | Ga0495671_0028507 | 3300046692 | Bacteria | 2875 |
| 1325 | Ga0495649_0091156 | 3300046694 | Bacteria | 1625 |
| 1326 | Ga0495600_0127185 | 3300046809 | Bacteria | 1657 |
| 1327 | Ga0495600_0329392 | 3300046809 | Bacteria | 959 |
| 1328 | Ga0495604_0070404 | 3300047317 | Bacteria | 2649 |
| 1329 | Ga0495636_0047537 | 3300047318 | Bacteria | 1792 |
| 1330 | Ga0495674_0057426 | 3300047319 | Bacteria | 3406 |
| 1331 | Ga0495674_0303326 | 3300047319 | Bacteria | 1304 |
| 1332 | Ga0495672_0035964 | 3300047320 | Bacteria | 3045 |
| 1333 | Ga0495672_0072609 | 3300047320 | Bacteria | 1943 |
| 1334 | Ga0495676_0226161 | 3300047321 | Bacteria | 1287 |
| 1335 | Ga0495676_0269599 | 3300047321 | Bacteria | 1156 |
| 1336 | Ga0495680_0035982 | 3300047322 | Bacteria | 3981 |
| 1337 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1338 | Ga0495687_000233 | 3300047443 | Bacteria | 77056 |
| 1339 | Ga0495675_0183580 | 3300047444 | Bacteria | 1280 |
| 1340 | Ga0495685_011735 | 3300047447 | Bacteria | 2961 |
| 1341 | Ga0495684_0242029 | 3300047471 | Bacteria | 1315 |
| 1342 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 1343 | Ga0495686_0039024 | 3300047472 | Bacteria | 3035 |
| 1344 | Ga0495686_0085031 | 3300047472 | Bacteria | 1927 |
| 1345 | Ga0496101_0196189 | 3300048904 | Bacteria | 1560 |
| 1346 | Ga0496104_0295323 | 3300048907 | Bacteria | 1533 |
| 1347 | Ga0496104_0327218 | 3300048907 | Bacteria | 1446 |
| 1348 | Ga0496105_0087940 | 3300048908 | Bacteria | 2567 |
| 1349 | Ga0496108_0488854 | 3300048911 | Bacteria | 1075 |
| 1350 | Ga0496110_0131071 | 3300048913 | Bacteria | 2264 |
| 1351 | Ga0496114_0473557 | 3300048917 | Bacteria | 1108 |
| 1352 | Ga0496115_0034456 | 3300048918 | Bacteria | 4001 |
| 1353 | Ga0496115_0265498 | 3300048918 | Bacteria | 1411 |
| 1354 | Ga0496115_0337815 | 3300048918 | Bacteria | 1230 |
| 1355 | Ga0496115_0525836 | 3300048918 | Bacteria | 948 |
| 1356 | Ga0496116_0019557 | 3300048919 | Bacteria | 5182 |
| 1357 | Ga0496117_0001863 | 3300048920 | Bacteria | 28457 |
| 1358 | Ga0496118_0200874 | 3300048921 | Bacteria | 1181 |
| 1359 | Ga0496121_0000030 | 3300048924 | Bacteria | 412079 |
| 1360 | Ga0496122_0008592 | 3300048925 | Bacteria | 10970 |
| 1361 | Ga0496123_0014741 | 3300048926 | Bacteria | 6457 |
| 1362 | Ga0496126_0030549 | 3300048929 | Bacteria | 5101 |
| 1363 | Ga0501306_003537 | 3300049127 | Bacteria | 1690 |
| 1364 | Ga0501305_000824 | 3300049161 | Bacteria | 2756 |
| 1365 | Ga0501307_000646 | 3300049162 | Bacteria | 2523 |
| 1366 | Ga0501311_000077 | 3300049527 | Bacteria | 4489 |
| 1367 | Ga0501311_007027 | 3300049527 | Bacteria | 1287 |
| 1368 | Ga0501312_002580 | 3300049528 | Bacteria | 1968 |
| 1369 | Ga0501315_000974 | 3300049531 | Bacteria | 2261 |
| 1370 | Ga0501316_000510 | 3300049532 | Bacteria | 2722 |
| 1371 | Ga0501319_000002 | 3300049535 | Bacteria | 13675 |
| 1372 | Ga0501032_0002362 | 3300049569 | Bacteria | 14785 |
| 1373 | Ga0501032_0002936 | 3300049569 | Bacteria | 13262 |
| 1374 | Ga0501032_0013633 | 3300049569 | Bacteria | 5773 |
| 1375 | Ga0501032_0045337 | 3300049569 | Bacteria | 2974 |
| 1376 | Ga0501033_0000011 | 3300049570 | Bacteria | 259130 |
| 1377 | Ga0501033_0430138 | 3300049570 | Bacteria | 918 |
| 1378 | Ga0501034_0001265 | 3300049571 | Bacteria | 34324 |
| 1379 | Ga0501034_0002020 | 3300049571 | Bacteria | 25539 |
| 1380 | Ga0501034_0010858 | 3300049571 | Bacteria | 9461 |
| 1381 | Ga0501034_0017257 | 3300049571 | Bacteria | 7405 |
| 1382 | Ga0501034_0040721 | 3300049571 | Bacteria | 4701 |
| 1383 | Ga0501034_0140017 | 3300049571 | Bacteria | 2399 |
| 1384 | Ga0501034_0191568 | 3300049571 | Bacteria | 2007 |
| 1385 | Ga0501034_0282372 | 3300049571 | Bacteria | 1599 |
| 1386 | Ga0501036_0009955 | 3300049572 | Bacteria | 7829 |
| 1387 | Ga0501036_0012794 | 3300049572 | Bacteria | 6962 |
| 1388 | Ga0501036_0017036 | 3300049572 | Bacteria | 6072 |
| 1389 | Ga0501036_0040807 | 3300049572 | Bacteria | 3926 |
| 1390 | Ga0501037_0003904 | 3300049573 | Bacteria | 10816 |
| 1391 | Ga0501037_0004877 | 3300049573 | Bacteria | 9757 |
| 1392 | Ga0501037_0021814 | 3300049573 | Bacteria | 4739 |
| 1393 | Ga0501037_0022979 | 3300049573 | Bacteria | 4612 |
| 1394 | Ga0501037_0032648 | 3300049573 | Bacteria | 3845 |
| 1395 | Ga0501038_0002395 | 3300049574 | Bacteria | 17463 |
| 1396 | Ga0501038_0005905 | 3300049574 | Bacteria | 11315 |
| 1397 | Ga0501038_0121981 | 3300049574 | Bacteria | 2148 |
| 1398 | Ga0501038_0222597 | 3300049574 | Bacteria | 1505 |
| 1399 | Ga0501039_0003523 | 3300049575 | Bacteria | 11722 |
| 1400 | Ga0501039_0011642 | 3300049575 | Bacteria | 6699 |
| 1401 | Ga0501039_0013024 | 3300049575 | Bacteria | 6357 |
| 1402 | Ga0501043_0000733 | 3300049579 | Bacteria | 29055 |
| 1403 | Ga0501043_0009337 | 3300049579 | Bacteria | 7705 |
| 1404 | Ga0501043_0011452 | 3300049579 | Bacteria | 6943 |
| 1405 | Ga0501043_0038700 | 3300049579 | Bacteria | 3750 |
| 1406 | Ga0501043_0041852 | 3300049579 | Bacteria | 3599 |
| 1407 | Ga0501046_0032361 | 3300049580 | Bacteria | 4234 |
| 1408 | Ga0501046_0052113 | 3300049580 | Bacteria | 3226 |
| 1409 | Ga0501046_0163745 | 3300049580 | Bacteria | 1672 |
| 1410 | Ga0501047_0075953 | 3300049581 | Bacteria | 3233 |
| 1411 | Ga0501047_0085641 | 3300049581 | Bacteria | 3028 |
| 1412 | Ga0501047_0101654 | 3300049581 | Bacteria | 2754 |
| 1413 | Ga0501047_0120170 | 3300049581 | Bacteria | 2510 |
| 1414 | Ga0501047_0185593 | 3300049581 | Bacteria | 1945 |
| 1415 | Ga0501047_0186349 | 3300049581 | Bacteria | 1940 |
| 1416 | Ga0501047_0269762 | 3300049581 | Bacteria | 1548 |
| 1417 | Ga0501047_0372115 | 3300049581 | Bacteria | 1264 |
| 1418 | Ga0501048_0123290 | 3300049582 | Bacteria | 1832 |
| 1419 | Ga0501067_0017620 | 3300049583 | Bacteria | 3953 |
| 1420 | Ga0501068_0072633 | 3300049584 | Bacteria | 2101 |
| 1421 | Ga0501069_0064770 | 3300049585 | Bacteria | 2043 |
| 1422 | Ga0501069_0146770 | 3300049585 | Bacteria | 1354 |
| 1423 | Ga0501070_0032644 | 3300049586 | Bacteria | 4357 |
| 1424 | Ga0501070_0177402 | 3300049586 | Bacteria | 1754 |
| 1425 | Ga0501072_0157654 | 3300049588 | Bacteria | 1810 |
| 1426 | Ga0501072_0228144 | 3300049588 | Bacteria | 1484 |
| 1427 | Ga0501073_0060516 | 3300049589 | Bacteria | 2642 |
| 1428 | Ga0501073_0069872 | 3300049589 | Bacteria | 2447 |
| 1429 | Ga0501074_0001790 | 3300049590 | Bacteria | 14696 |
| 1430 | Ga0501201_002320 | 3300049651 | Bacteria | 1742 |
| 1431 | Ga0501202_000998 | 3300049652 | Bacteria | 4375 |
| 1432 | Ga0501202_007720 | 3300049652 | Bacteria | 1949 |
| 1433 | Ga0501217_027892 | 3300049661 | Bacteria | 1373 |
| 1434 | Ga0501223_030230 | 3300049663 | Bacteria | 1054 |
| 1435 | Ga0501224_006724 | 3300049664 | Bacteria | 1669 |
| 1436 | Ga0501236_000758 | 3300049670 | Bacteria | 3614 |
| 1437 | Ga0501243_002414 | 3300049675 | Bacteria | 2735 |
| 1438 | Ga0501257_003554 | 3300049686 | Bacteria | 3354 |
| 1439 | Ga0501257_006334 | 3300049686 | Bacteria | 2626 |
| 1440 | Ga0501257_009003 | 3300049686 | Bacteria | 2251 |
| 1441 | Ga0501257_010822 | 3300049686 | Bacteria | 2075 |
| 1442 | Ga0501257_021787 | 3300049686 | Bacteria | 1513 |
| 1443 | Ga0501259_001205 | 3300049688 | Bacteria | 4308 |
| 1444 | Ga0501261_001010 | 3300049690 | Bacteria | 3458 |
| 1445 | Ga0501219_000689 | 3300049703 | Bacteria | 4677 |
| 1446 | Ga0501221_018469 | 3300049704 | Bacteria | 1344 |
| 1447 | Ga0501225_0004957 | 3300049705 | Bacteria | 3933 |
| 1448 | Ga0501225_0014146 | 3300049705 | Bacteria | 2229 |
| 1449 | Ga0501225_0031787 | 3300049705 | Bacteria | 1452 |
| 1450 | Ga0501079_0067091 | 3300049741 | Bacteria | 2769 |
| 1451 | Ga0501080_0032906 | 3300049742 | Bacteria | 4838 |
| 1452 | Ga0501080_0096029 | 3300049742 | Bacteria | 2752 |
| 1453 | Ga0501080_0152601 | 3300049742 | Bacteria | 2134 |
| 1454 | Ga0501083_0085302 | 3300049744 | Bacteria | 2090 |
| 1455 | Ga0501083_0110428 | 3300049744 | Bacteria | 1808 |
| 1456 | Ga0501263_015504 | 3300049760 | Bacteria | 985 |
| 1457 | Ga0501264_000532 | 3300049761 | Bacteria | 5587 |
| 1458 | Ga0501269_003046 | 3300049766 | Bacteria | 2038 |
| 1459 | Ga0501272_008342 | 3300049769 | Bacteria | 1136 |
| 1460 | Ga0501273_004702 | 3300049770 | Bacteria | 1512 |
| 1461 | Ga0501035_0006062 | 3300049822 | Bacteria | 11383 |
| 1462 | Ga0501035_0009077 | 3300049822 | Bacteria | 9245 |
| 1463 | Ga0501035_0016384 | 3300049822 | Bacteria | 6837 |
| 1464 | Ga0501035_0071324 | 3300049822 | Bacteria | 3076 |
| 1465 | Ga0501035_0110040 | 3300049822 | Bacteria | 2415 |
| 1466 | Ga0501035_0256134 | 3300049822 | Bacteria | 1485 |
| 1467 | Ga0501044_0001293 | 3300049823 | Bacteria | 29588 |
| 1468 | Ga0501044_0004248 | 3300049823 | Bacteria | 16071 |
| 1469 | Ga0501044_0020175 | 3300049823 | Bacteria | 7113 |
| 1470 | Ga0501044_0037946 | 3300049823 | Bacteria | 5034 |
| 1471 | Ga0501044_0089863 | 3300049823 | Bacteria | 3099 |
| 1472 | Ga0501044_0123100 | 3300049823 | Unclassified | 2593 |
| 1473 | Ga0501044_0129939 | 3300049823 | Bacteria | 2514 |
| 1474 | Ga0501044_0176664 | 3300049823 | Bacteria | 2104 |
| 1475 | Ga0501045_0000053 | 3300049824 | Bacteria | 51403 |
| 1476 | Ga0501284_00135 | 3300050005 | Bacteria | 9595 |
| 1477 | nmdc:mga00v17_190208_c1 | 3300050491 | Bacteria | 1325 |
| 1478 | nmdc:mga0k408_102103_c1 | 3300050493 | Bacteria | 1691 |
| 1479 | nmdc:mga0k408_109494_c1 | 3300050493 | Bacteria | 1632 |
| 1480 | nmdc:mga0k408_12089_c1 | 3300050493 | Bacteria | 4714 |
| 1481 | nmdc:mga0k408_34214_c1 | 3300050493 | Bacteria | 2908 |
| 1482 | nmdc:mga0k408_54179_c1 | 3300050493 | Bacteria | 2325 |
| 1483 | nmdc:mga0k408_7017_c1 | 3300050493 | Bacteria | 6011 |
| 1484 | nmdc:mga0k408_8427_c1 | 3300050493 | Bacteria | 5533 |
| 1485 | nmdc:mga0k408_9728_c1 | 3300050493 | Bacteria | 5190 |
| 1486 | nmdc:mga07m45_122395_c1 | 3300050496 | Bacteria | 1503 |
| 1487 | nmdc:mga07m45_69219_c1 | 3300050496 | Bacteria | 2006 |
| 1488 | nmdc:mga05p37_3944_c1 | 3300050507 | Bacteria | 17380 |
| 1489 | nmdc:mga05p37_466479_c1 | 3300050507 | Bacteria | 1458 |
| 1490 | nmdc:mga09592_4236_c1 | 3300050508 | Bacteria | 11586 |
| 1491 | nmdc:mga09592_63156_c1 | 3300050508 | Bacteria | 3134 |
| 1492 | nmdc:mga0qj67_85711_c1 | 3300050509 | Bacteria | 2527 |
| 1493 | nmdc:mga06r32_145795_c1 | 3300050510 | Bacteria | 2345 |
| 1494 | nmdc:mga06r32_46732_c1 | 3300050510 | Bacteria | 4131 |
| 1495 | nmdc:mga08y16_10401_c1 | 3300050511 | Bacteria | 9761 |
| 1496 | nmdc:mga08y16_106009_c1 | 3300050511 | Bacteria | 2926 |
| 1497 | nmdc:mga08y16_26169_c1 | 3300050511 | Bacteria | 6153 |
| 1498 | nmdc:mga08y16_342131_c1 | 3300050511 | Bacteria | 1538 |
| 1499 | Ga0500635_0004581 | 3300053080 | Bacteria | 3570 |
| 1500 | Ga0495619_0033330 | 3300053085 | Bacteria | 3345 |
| 1501 | Ga0500578_0000136 | 3300053086 | Bacteria | 88612 |
| 1502 | Ga0500578_0018759 | 3300053086 | Bacteria | 4445 |
| 1503 | Ga0500644_0002759 | 3300053088 | Bacteria | 4382 |
| 1504 | Ga0500581_059303 | 3300053089 | Bacteria | 1941 |
| 1505 | Ga0500646_0005243 | 3300053090 | Bacteria | 3278 |
| 1506 | Ga0500646_0007315 | 3300053090 | Bacteria | 2821 |
| 1507 | Ga0500646_0029761 | 3300053090 | Bacteria | 1496 |
| 1508 | Ga0500583_0000248 | 3300053092 | Bacteria | 19303 |
| 1509 | Ga0500583_0003873 | 3300053092 | Bacteria | 4793 |
| 1510 | Ga0500651_0061432 | 3300053093 | Bacteria | 2347 |
| 1511 | Ga0500651_0107621 | 3300053093 | Bacteria | 1704 |
| 1512 | Ga0500651_0108917 | 3300053093 | Bacteria | 1692 |
| 1513 | Ga0500641_0021869 | 3300053096 | Bacteria | 2444 |
| 1514 | Ga0500555_028876 | 3300053103 | Bacteria | 1578 |
| 1515 | Ga0500556_0011703 | 3300053104 | Bacteria | 2603 |
| 1516 | Ga0500562_000061 | 3300053108 | Bacteria | 53142 |
| 1517 | Ga0500562_013235 | 3300053108 | Bacteria | 2105 |
| 1518 | Ga0500569_000284 | 3300053109 | Bacteria | 8035 |
| 1519 | Ga0500594_0009518 | 3300053118 | Bacteria | 2239 |
| 1520 | Ga0500594_0011328 | 3300053118 | Bacteria | 2081 |
| 1521 | Ga0500642_0007688 | 3300053130 | Bacteria | 3637 |
| 1522 | Ga0500642_0030776 | 3300053130 | Bacteria | 2236 |
| 1523 | Ga0500652_001629 | 3300053131 | Bacteria | 6828 |
| 1524 | Ga0500652_021805 | 3300053131 | Bacteria | 2417 |
| 1525 | Ga0500559_0019375 | 3300053136 | Bacteria | 2876 |
| 1526 | Ga0500559_0062978 | 3300053136 | Bacteria | 1657 |
| 1527 | Ga0500561_0029324 | 3300053137 | Bacteria | 1373 |
| 1528 | Ga0500568_0000439 | 3300053139 | Bacteria | 31243 |
| 1529 | Ga0500568_0013282 | 3300053139 | Bacteria | 3756 |
| 1530 | Ga0500577_0000711 | 3300053142 | Bacteria | 8518 |
| 1531 | Ga0500588_0045696 | 3300053146 | Bacteria | 1343 |
| 1532 | Ga0500590_014980 | 3300053148 | Bacteria | 4000 |
| 1533 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 1534 | Ga0500616_0001754 | 3300053153 | Bacteria | 19883 |
| 1535 | Ga0500616_0016628 | 3300053153 | Bacteria | 4183 |
| 1536 | Ga0500622_0000113 | 3300053156 | Bacteria | 83196 |
| 1537 | Ga0500622_0000133 | 3300053156 | Bacteria | 78532 |
| 1538 | Ga0500622_0000156 | 3300053156 | Bacteria | 71907 |
| 1539 | Ga0500622_0000385 | 3300053156 | Bacteria | 42685 |
| 1540 | Ga0500622_0000655 | 3300053156 | Bacteria | 30835 |
| 1541 | Ga0500622_0001823 | 3300053156 | Bacteria | 16170 |
| 1542 | Ga0500622_0053963 | 3300053156 | Bacteria | 2062 |
| 1543 | Ga0500624_000517 | 3300053157 | Bacteria | 11167 |
| 1544 | Ga0500627_0009946 | 3300053158 | Bacteria | 3449 |
| 1545 | Ga0500637_0160320 | 3300053178 | Bacteria | 1297 |
| 1546 | Ga0500637_0261492 | 3300053178 | Bacteria | 961 |
| 1547 | Ga0500611_000032 | 3300053727 | Bacteria | 83927 |
| 1548 | Ga0500645_003859 | 3300053730 | Bacteria | 5931 |
| 1549 | Ga0500645_025794 | 3300053730 | Bacteria | 1792 |
| 1550 | Ga0500661_005867 | 3300055283 | Bacteria | 2288 |
| 1551 | Ga0587091_015081 | 3300059511 | Bacteria | 1270 |
| 1552 | Ga0501082_0180686 | 3300060353 | Bacteria | 1835 |
| 1553 | Ga0466962_0027756 | 3300061719 | Bacteria | 2714 |
| 1554 | 2513232367 | 2513020052 | Bacteria | 5120511 |
| 1555 | 2520879531 | 2519899754 | Bacteria | 5336938 |
| 1556 | 2524006227 | 2523533629 | Bacteria | 2982326 |
| 1557 | 2585143578 | 2582581278 | Bacteria | 5296881 |
| 1558 | 2585156581 | 2582581281 | Bacteria | 4487904 |
| 1559 | 2585160768 | 2582581282 | Bacteria | 4495830 |
| 1560 | 2587679968 | 2585428045 | Bacteria | 5203023 |
| 1561 | 2587748626 | 2585428060 | Bacteria | 5304711 |
| 1562 | 2587753464 | 2585428061 | Bacteria | 3939663 |
| 1563 | 2587864992 | 2585428095 | Bacteria | 3789702 |
| 1564 | 2588211483 | 2585428182 | Bacteria | 5007281 |
| 1565 | 2588215865 | 2585428183 | Bacteria | 5166119 |
| 1566 | 2588219287 | 2585428184 | Bacteria | 4978681 |
| 1567 | 2588224765 | 2585428185 | Bacteria | 4969476 |
| 1568 | 2588234600 | 2585428187 | Bacteria | 4629388 |
| 1569 | 2588447560 | 2588253712 | Bacteria | 5403181 |
| 1570 | 2590603187 | 2588254255 | Bacteria | 5014294 |
| 1571 | 2590610208 | 2588254257 | Bacteria | 5436094 |
| 1572 | 2599479391 | 2599185184 | Bacteria | 6430550 |
| 1573 | 2644373930 | 2643221667 | Bacteria | 5627472 |
| 1574 | 2644643938 | 2643221716 | Bacteria | 4986332 |
| 1575 | 2644681833 | 2643221725 | Bacteria | 5087956 |
| 1576 | 2722726168 | 2721755487 | Bacteria | 6357185 |
| 1577 | 2729200764 | 2728369107 | Bacteria | 5082720 |
| 1578 | 2738698384 | 2738541273 | Bacteria | 4048577 |
| 1579 | 2738726202 | 2738541278 | Bacteria | 9755573 |
| 1580 | 2738733068 | 2738541279 | Bacteria | 6149495 |
| 1581 | 2738765606 | 2738541285 | Bacteria | 6150075 |
| 1582 | 2738854392 | 2738541302 | Bacteria | 5944758 |
| 1583 | 2739214649 | 2738543007 | Bacteria | 6149845 |
| 1584 | 2739252710 | 2738543014 | Bacteria | 4048139 |
| 1585 | 2739587944 | 2739367651 | Bacteria | 6359826 |
| 1586 | 2739614405 | 2739367656 | Bacteria | 5152243 |
| 1587 | 2739646663 | 2739367663 | Bacteria | 5040914 |
| 1588 | 2740002835 | 2739367857 | Bacteria | 5433684 |
| 1589 | 2740007652 | 2739367858 | Bacteria | 5432813 |
| 1590 | 2740060422 | 2739367874 | Bacteria | 4872888 |
| 1591 | 2753674200 | 2751185877 | Bacteria | 4921427 |
| 1592 | 2765575672 | 2765235839 | Bacteria | 5314748 |
| 1593 | 2772605776 | 2772190705 | Bacteria | 4666226 |
| 1594 | 2775674346 | 2775506739 | Bacteria | 3855222 |
| 1595 | 2802655257 | 2802428842 | Bacteria | 4926114 |
| 1596 | 2816875518 | 2816332188 | Bacteria | 5133218 |
| 1597 | 2817413549 | 2816332280 | Bacteria | 5109718 |
| 1598 | 2819545820 | 2818991437 | Bacteria | 5805520 |
| 1599 | 2819573333 | 2818991442 | Bacteria | 8318214 |
| 1600 | 2819590244 | 2818991444 | Bacteria | 6968812 |
| 1601 | 2819681069 | 2818991460 | Bacteria | 7595395 |
| 1602 | 2821136745 | 2821136567 | Bacteria | 8080116 |
| 1603 | 2833640623 | 2833640130 | Bacteria | 4858325 |
| 1604 | 2839990124 | 2839989709 | Bacteria | 3773432 |
| 1605 | 2842086249 | 2842083920 | Bacteria | 4857652 |
| 1606 | 2842724287 | 2842722452 | Bacteria | 6263924 |
| 1607 | 2842908305 | 2842903701 | Bacteria | 6986368 |
| 1608 | 2842913579 | 2842909656 | Bacteria | 6185908 |
| 1609 | 2849282609 | 2849281842 | Bacteria | 6065644 |
| 1610 | 2852625403 | 2852623160 | Bacteria | 4376875 |
| 1611 | 2857617048 | 2857613821 | Bacteria | 4917088 |
| 1612 | 2857619717 | 2857618242 | Bacteria | 5635925 |
| 1613 | 2857631642 | 2857627736 | Bacteria | 5625397 |
| 1614 | 2871723598 | 2871720351 | Bacteria | 4862476 |
| 1615 | 2881247573 | 2881247448 | Bacteria | 3717788 |
| 1616 | 2881364101 | 2881359912 | Bacteria | 4935907 |
| 1617 | 2881955871 | 2881955468 | Bacteria | 3545609 |
| 1618 | 2883072442 | 2883068021 | Bacteria | 6192739 |
| 1619 | 2884795844 | 2884791551 | Bacteria | 8511252 |
| 1620 | 2884934414 | 2884933994 | Bacteria | 4535041 |
| 1621 | 2889293824 | 2889290771 | Bacteria | 5530962 |
| 1622 | 2890740672 | 2890737413 | Bacteria | 4269751 |
| 1623 | 2895504000 | 2895498888 | Bacteria | 5283788 |
| 1624 | 2896087577 | 2896085136 | Bacteria | 6129793 |
| 1625 | 2896112703 | 2896109856 | Bacteria | 7140722 |
| 1626 | 2896320847 | 2896317667 | Bacteria | 4606601 |
| 1627 | 2898716199 | 2898713307 | Bacteria | 4110805 |
| 1628 | 2903898660 | 2903895155 | Bacteria | 5258610 |
| 1629 | 2904422400 | 2904419702 | Bacteria | 5166287 |
| 1630 | 2904449060 | 2904445276 | Bacteria | 5310396 |
| 1631 | 2904468510 | 2904467357 | Bacteria | 8057758 |
| 1632 | 2904558494 | 2904555929 | Bacteria | 5218588 |
| 1633 | 2904782778 | 2904780799 | Bacteria | 5840761 |
| 1634 | 2906001181 | 2905999023 | Bacteria | 4591259 |
| 1635 | 2906800771 | 2906799679 | Bacteria | 4031749 |
| 1636 | 2911143829 | 2911138879 | Bacteria | 5811561 |
| 1637 | 2914763464 | 2914759650 | Bacteria | 4701441 |
| 1638 | 2919097961 | 2919097161 | Bacteria | 3860339 |
| 1639 | 2919180388 | 2919177583 | Bacteria | 5641607 |
| 1640 | 2919194219 | 2919191525 | Bacteria | 5765973 |
| 1641 | 2919438008 | 2919437846 | Bacteria | 6199444 |
| 1642 | 2919684616 | 2919683626 | Bacteria | 5534354 |
| 1643 | 2919697455 | 2919692658 | Bacteria | 5943958 |
| 1644 | 2928082299 | 2928078545 | Bacteria | 6534839 |
| 1645 | 2928149122 | 2928147474 | Bacteria | 6512076 |
| 1646 | 2929150605 | 2929150217 | Bacteria | 5462483 |
| 1647 | 2929155011 | 2929154850 | Bacteria | 6753285 |
| 1648 | 2929178591 | 2929177148 | Bacteria | 7883697 |
| 1649 | 2929240968 | 2929239360 | Bacteria | 7745570 |
| 1650 | 2929922992 | 2929921140 | Bacteria | 8649150 |
| 1651 | 2932085011 | 2932082852 | Bacteria | 6563563 |
| 1652 | 2945924807 | 2945924605 | Bacteria | 4296724 |
| 1653 | 2945980999 | 2945977869 | Bacteria | 7777518 |
| 1654 | 2945998890 | 2945997725 | Bacteria | 6404843 |
| 1655 | 2946019598 | 2946013367 | Bacteria | 7766675 |
| 1656 | 2946024079 | 2946019816 | Bacteria | 4621265 |
| 1657 | 2954021333 | 2954016120 | Bacteria | 6446024 |
| 1658 | 2958462002 | 2958458903 | Bacteria | 5301041 |
| 1659 | 2958514497 | 2958512119 | Bacteria | 4528530 |
| 1660 | 2965321921 | 2965320100 | Bacteria | 3975600 |
| 1661 | 2977235844 | 2977232053 | Bacteria | 5485925 |
| 1662 | 2977247760 | 2977243572 | Bacteria | 4374394 |
| 1663 | 2977272077 | 2977268062 | Bacteria | 5243061 |
| 1664 | 2984574444 | 2984572630 | Bacteria | 4186940 |
| 1665 | 2984607893 | 2984606641 | Bacteria | 4186971 |
| 1666 | 2993375109 | 2993372514 | Bacteria | 4214139 |
| 1667 | 2993481973 | 2993480792 | Bacteria | 4022225 |
| 1668 | 8003152326 | 8003151029 | Bacteria | 8187759 |
| 1669 | 8036739266 | 8036736890 | Bacteria | 2944828 |
| 1670 | 8054311427 | 8054307821 | Bacteria | 5212224 |
| 1671 | 8055423584 | 8055419101 | Bacteria | 5289643 |
| 1672 | 8055591295 | 8055588893 | Bacteria | 3619545 |
| 1673 | 8055595062 | 8055592153 | Bacteria | 5961247 |
| 1674 | 8056443519 | 8056440228 | Bacteria | 4946504 |
| 1675 | Ga0070714_100091865 | |||
| 1676 | SwRhRL2b_contig_1663050 | |||
| 1677 | SwRhRL2b_contig_843371 | |||
| 1678 | JGI24740J21852_10011805 | |||
| 1679 | JGI24742J22300_10012118 | |||
| 1680 | JGI24751J29686_10001390 | |||
| 1681 | JGI25162J39368_1001033 | |||
| 1682 | JGI25154J39366_1000001 | |||
| 1683 | JGI25157J39369_1004835 | |||
| 1684 | JGI25406J46586_10027139 | |||
| 1685 | JGI25165J46597_1000678 | |||
| 1686 | JGI25153J46596_10002304 | |||
| 1687 | JGI25153J46596_10013567 | |||
| 1688 | rootH1_10136973 | |||
| 1689 | rootH2_10003970 | |||
| 1690 | rootL2_10010167 | |||
| 1691 | rootL2_10011247 | |||
| 1692 | rootL2_10134610 | |||
| 1693 | rootH1_10002303 | |||
| 1694 | rootH1_10006684 | |||
| 1695 | rootH1_10008389 | |||
| 1696 | rootH1_10093451 | |||
| 1697 | JGI25160J50197_1001095 | |||
| 1698 | JGI25160J50197_1014301 | |||
| 1699 | JGI25160J50197_1014801 | |||
| 1700 | Ga0055526_1004445 | |||
| 1701 | Ga0055528_1000330 | |||
| 1702 | Ga0055530_10000331 | |||
| 1703 | Ga0055531_10000166 | |||
| 1704 | Ga0058859_11782699 | |||
| 1705 | Ga0058863_10160658 | |||
| 1706 | Ga0058861_10035234 | |||
| 1707 | Ga0058862_10235727 | |||
| 1708 | Ga0065165_1000105 | |||
| 1709 | Ga0065165_1029860 | |||
| 1710 | Ga0065704_10070140 | |||
| 1711 | Ga0065712_10002231 | |||
| 1712 | Ga0065712_10010764 | |||
| 1713 | Ga0065712_10085595 | |||
| 1714 | Ga0065715_10015110 | |||
| 1715 | Ga0065707_10103016 | |||
| 1716 | Ga0065707_10104946 | |||
| 1717 | Ga0070658_10000153 | |||
| 1718 | Ga0070658_10015118 | |||
| 1719 | Ga0070658_10178279 | |||
| 1720 | Ga0070658_10197163 | |||
| 1721 | Ga0070676_10006513 | |||
| 1722 | Ga0070676_10032136 | |||
| 1723 | Ga0070676_10080339 | |||
| 1724 | Ga0070676_10152918 | |||
| 1725 | Ga0070683_100001488 | |||
| 1726 | Ga0070683_100005896 | |||
| 1727 | Ga0070683_100012473 | |||
| 1728 | Ga0070683_100017135 | |||
| 1729 | Ga0070683_100025159 | |||
| 1730 | Ga0070683_100077142 | |||
| 1731 | Ga0070683_100538044 | |||
| 1732 | Ga0070690_100187616 | |||
| 1733 | Ga0070670_100024841 | |||
| 1734 | Ga0070670_100109804 | |||
| 1735 | Ga0070670_100112700 | |||
| 1736 | Ga0070670_100158102 | |||
| 1737 | Ga0070670_100208061 | |||
| 1738 | Ga0070670_100402814 | |||
| 1739 | Ga0070670_100403495 | |||
| 1740 | Ga0070677_10004196 | |||
| 1741 | Ga0070677_10044332 | |||
| 1742 | Ga0068869_100017755 | |||
| 1743 | Ga0068869_100044651 | |||
| 1744 | Ga0068869_100086467 | |||
| 1745 | Ga0068869_100089860 | |||
| 1746 | Ga0068869_100093571 | |||
| 1747 | Ga0068869_100164027 | |||
| 1748 | Ga0068869_100210212 | |||
| 1749 | Ga0070666_10000036 | |||
| 1750 | Ga0070666_10000191 | |||
| 1751 | Ga0070666_10018000 | |||
| 1752 | Ga0070666_10025993 | |||
| 1753 | Ga0070666_10150569 | |||
| 1754 | Ga0070666_10254744 | |||
| 1755 | Ga0070680_100013277 | |||
| 1756 | Ga0070680_100067285 | |||
| 1757 | Ga0070680_100116857 | |||
| 1758 | Ga0070682_100000039 | |||
| 1759 | Ga0070682_100089459 | |||
| 1760 | Ga0070682_100264042 | |||
| 1761 | Ga0068868_100015404 | |||
| 1762 | Ga0068868_100017514 | |||
| 1763 | Ga0068868_100031254 | |||
| 1764 | Ga0068868_100059381 | |||
| 1765 | Ga0068868_100092027 | |||
| 1766 | Ga0068868_100123647 | |||
| 1767 | Ga0068868_100140461 | |||
| 1768 | Ga0068868_100198642 | |||
| 1769 | Ga0068868_100245478 | |||
| 1770 | Ga0070660_100003216 | |||
| 1771 | Ga0070660_100014027 | |||
| 1772 | Ga0070660_100218767 | |||
| 1773 | Ga0070689_100021681 | |||
| 1774 | Ga0070689_100041808 | |||
| 1775 | Ga0070689_100459164 | |||
| 1776 | Ga0070689_100464723 | |||
| 1777 | Ga0070687_100003733 | |||
| 1778 | Ga0070687_100118591 | |||
| 1779 | Ga0070687_100128780 | |||
| 1780 | Ga0070661_100004113 | |||
| 1781 | Ga0070661_100040565 | |||
| 1782 | Ga0070661_100127366 | |||
| 1783 | Ga0070668_100017989 | |||
| 1784 | Ga0070668_100025286 | |||
| 1785 | Ga0070668_100050126 | |||
| 1786 | Ga0070668_100155369 | |||
| 1787 | Ga0070668_100221200 | |||
| 1788 | Ga0070668_100240917 | |||
| 1789 | Ga0070669_100002748 | |||
| 1790 | Ga0070669_100024124 | |||
| 1791 | Ga0070669_100324133 | |||
| 1792 | Ga0070669_100357409 | |||
| 1793 | Ga0070669_100422330 | |||
| 1794 | Ga0070675_100014978 | |||
| 1795 | Ga0070675_100018472 | |||
| 1796 | Ga0070675_100027474 | |||
| 1797 | Ga0070675_100090601 | |||
| 1798 | Ga0070675_100120096 | |||
| 1799 | Ga0070675_100129605 | |||
| 1800 | Ga0070675_100143049 | |||
| 1801 | Ga0070675_100182345 | |||
| 1802 | Ga0070675_100304522 | |||
| 1803 | Ga0070675_100348087 | |||
| 1804 | Ga0070671_100027874 | |||
| 1805 | Ga0070671_100030657 | |||
| 1806 | Ga0070671_100231072 | |||
| 1807 | Ga0070674_100065684 | |||
| 1808 | Ga0070674_100085764 | |||
| 1809 | Ga0070674_100141927 | |||
| 1810 | Ga0070674_100196180 | |||
| 1811 | Ga0070674_100363637 | |||
| 1812 | Ga0070673_100003757 | |||
| 1813 | Ga0070673_100030215 | |||
| 1814 | Ga0070673_100051881 | |||
| 1815 | Ga0070673_100052967 | |||
| 1816 | Ga0070673_100075958 | |||
| 1817 | Ga0070688_100018933 | |||
| 1818 | Ga0070688_100028135 | |||
| 1819 | Ga0070688_100046149 | |||
| 1820 | Ga0070688_100252148 | |||
| 1821 | Ga0070659_100000375 | |||
| 1822 | Ga0070659_100006862 | |||
| 1823 | Ga0070659_100008718 | |||
| 1824 | Ga0070659_100010418 | |||
| 1825 | Ga0070659_100019947 | |||
| 1826 | Ga0070659_100131467 | |||
| 1827 | Ga0070659_100451776 | |||
| 1828 | Ga0070667_100000248 | |||
| 1829 | Ga0070667_100004111 | |||
| 1830 | Ga0070667_100162213 | |||
| 1831 | Ga0070667_100187787 | |||
| 1832 | Ga0070701_10094050 | |||
| 1833 | Ga0070694_100152300 | |||
| 1834 | Ga0070663_100099434 | |||
| 1835 | Ga0070663_100314890 | |||
| 1836 | Ga0070678_100047685 | |||
| 1837 | Ga0070678_100083322 | |||
| 1838 | Ga0070678_100124839 | |||
| 1839 | Ga0070678_100480475 | |||
| 1840 | Ga0070662_100004284 | |||
| 1841 | Ga0070662_100017708 | |||
| 1842 | Ga0070662_100033746 | |||
| 1843 | Ga0070662_100040845 | |||
| 1844 | Ga0070662_100044485 | |||
| 1845 | Ga0070681_10007373 | |||
| 1846 | Ga0070681_10013404 | |||
| 1847 | Ga0070681_10134747 | |||
| 1848 | Ga0070681_10206234 | |||
| 1849 | Ga0070681_10281961 | |||
| 1850 | Ga0070681_10335318 | |||
| 1851 | Ga0068867_100011408 | |||
| 1852 | Ga0068867_100011837 | |||
| 1853 | Ga0068867_100027040 | |||
| 1854 | Ga0068867_100031243 | |||
| 1855 | Ga0068867_100067838 | |||
| 1856 | Ga0068867_100162442 | |||
| 1857 | Ga0070685_10040228 | |||
| 1858 | Ga0070698_100002339 | |||
| 1859 | Ga0070698_100002802 | |||
| 1860 | Ga0070698_100021125 | |||
| 1861 | Ga0070698_100171178 | |||
| 1862 | Ga0070698_100241874 | |||
| 1863 | Ga0070679_100008990 | |||
| 1864 | Ga0070679_100018790 | |||
| 1865 | Ga0070679_100033271 | |||
| 1866 | Ga0070679_100050377 | |||
| 1867 | Ga0070679_100075214 | |||
| 1868 | Ga0070679_100095843 | |||
| 1869 | Ga0070679_100237177 | |||
| 1870 | Ga0070684_100006342 | |||
| 1871 | Ga0070684_100008945 | |||
| 1872 | Ga0070684_100046353 | |||
| 1873 | Ga0070684_100069741 | |||
| 1874 | Ga0070684_100193764 | |||
| 1875 | Ga0068853_100000250 | |||
| 1876 | Ga0068853_100013022 | |||
| 1877 | Ga0068853_100039651 | |||
| 1878 | Ga0068853_100042470 | |||
| 1879 | Ga0068853_100104703 | |||
| 1880 | Ga0068853_100107889 | |||
| 1881 | Ga0068853_100110853 | |||
| 1882 | Ga0068853_100187386 | |||
| 1883 | Ga0068853_100368358 | |||
| 1884 | Ga0068853_100451765 | |||
| 1885 | Ga0070672_100001565 | |||
| 1886 | Ga0070672_100010480 | |||
| 1887 | Ga0070672_100043706 | |||
| 1888 | Ga0070672_100058329 | |||
| 1889 | Ga0070672_100140535 | |||
| 1890 | Ga0070672_100188929 | |||
| 1891 | Ga0070672_100206540 | |||
| 1892 | Ga0070686_100018261 | |||
| 1893 | Ga0070665_100000641 | |||
| 1894 | Ga0070665_100045444 | |||
| 1895 | Ga0070704_100100614 | |||
| 1896 | Ga0068855_100000133 | |||
| 1897 | Ga0068855_100000360 | |||
| 1898 | Ga0068855_100000943 | |||
| 1899 | Ga0068855_100002973 | |||
| 1900 | Ga0068855_100012444 | |||
| 1901 | Ga0068855_100033030 | |||
| 1902 | Ga0068855_100044845 | |||
| 1903 | Ga0068855_100051562 | |||
| 1904 | Ga0068855_100058670 | |||
| 1905 | Ga0068855_100062928 | |||
| 1906 | Ga0068855_100076304 | |||
| 1907 | Ga0068855_100091980 | |||
| 1908 | Ga0068855_100161856 | |||
| 1909 | Ga0068855_100243559 | |||
| 1910 | Ga0068855_100424043 | |||
| 1911 | Ga0068855_100651942 | |||
| 1912 | Ga0070664_100011300 | |||
| 1913 | Ga0070664_100041775 | |||
| 1914 | Ga0070664_100084099 | |||
| 1915 | Ga0068857_100014365 | |||
| 1916 | Ga0068857_100018409 | |||
| 1917 | Ga0068857_100036731 | |||
| 1918 | Ga0068857_100040938 | |||
| 1919 | Ga0068857_100063035 | |||
| 1920 | Ga0068857_100085136 | |||
| 1921 | Ga0068857_100119536 | |||
| 1922 | Ga0068857_100131593 | |||
| 1923 | Ga0068857_100181708 | |||
| 1924 | Ga0068857_100387469 | |||
| 1925 | Ga0068854_100048602 | |||
| 1926 | Ga0068854_100068418 | |||
| 1927 | Ga0068854_100115716 | |||
| 1928 | Ga0068854_100132693 | |||
| 1929 | Ga0068854_100172563 | |||
| 1930 | Ga0068854_100217848 | |||
| 1931 | Ga0068856_100001358 | |||
| 1932 | Ga0068856_100003057 | |||
| 1933 | Ga0068856_100010526 | |||
| 1934 | Ga0068856_100064411 | |||
| 1935 | Ga0068856_100136033 | |||
| 1936 | Ga0068856_100183027 | |||
| 1937 | Ga0068856_100248124 | |||
| 1938 | Ga0068856_100540272 | |||
| 1939 | Ga0070702_100049731 | |||
| 1940 | Ga0070702_100411382 | |||
| 1941 | Ga0068852_100001842 | |||
| 1942 | Ga0068852_100025622 | |||
| 1943 | Ga0068852_100052504 | |||
| 1944 | Ga0068852_100054084 | |||
| 1945 | Ga0068852_100087742 | |||
| 1946 | Ga0068852_100102354 | |||
| 1947 | Ga0068852_100370778 | |||
| 1948 | Ga0068852_100755508 | |||
| 1949 | Ga0068859_100000037 | |||
| 1950 | Ga0068859_100002491 | |||
| 1951 | Ga0068859_100040242 | |||
| 1952 | Ga0068859_100076436 | |||
| 1953 | Ga0068859_100226291 | |||
| 1954 | Ga0068859_100272899 | |||
| 1955 | Ga0068859_100573453 | |||
| 1956 | Ga0068864_100001656 | |||
| 1957 | Ga0068864_100002302 | |||
| 1958 | Ga0068864_100005468 | |||
| 1959 | Ga0068864_100078002 | |||
| 1960 | Ga0068864_100107079 | |||
| 1961 | Ga0068864_100186490 | |||
| 1962 | Ga0068864_100294411 | |||
| 1963 | Ga0068864_100332687 | |||
| 1964 | Ga0068866_10069033 | |||
| 1965 | Ga0068861_100006643 | |||
| 1966 | Ga0068861_100051617 | |||
| 1967 | Ga0068861_100121125 | |||
| 1968 | Ga0068861_100134738 | |||
| 1969 | Ga0068861_100209084 | |||
| 1970 | Ga0068861_100270865 | |||
| 1971 | Ga0068861_100466181 | |||
| 1972 | Ga0068861_100713820 | |||
| 1973 | Ga0068851_10000177 | |||
| 1974 | Ga0068851_10001337 | |||
| 1975 | Ga0068851_10072821 | |||
| 1976 | Ga0068851_10160301 | |||
| 1977 | Ga0068851_10190946 | |||
| 1978 | Ga0068870_10021607 | |||
| 1979 | Ga0068870_10035377 | |||
| 1980 | Ga0068863_100001373 | |||
| 1981 | Ga0068863_100002925 | |||
| 1982 | Ga0068863_100088110 | |||
| 1983 | Ga0068863_100114726 | |||
| 1984 | Ga0068863_100262671 | |||
| 1985 | Ga0068863_100428533 | |||
| 1986 | Ga0068858_100004320 | |||
| 1987 | Ga0068858_100053182 | |||
| 1988 | Ga0068858_100109140 | |||
| 1989 | Ga0068858_100606767 | |||
| 1990 | Ga0068860_100000097 | |||
| 1991 | Ga0068860_100005547 | |||
| 1992 | Ga0068860_100007830 | |||
| 1993 | Ga0068860_100010482 | |||
| 1994 | Ga0068860_100018429 | |||
| 1995 | Ga0068860_100030843 | |||
| 1996 | Ga0068860_100032138 | |||
| 1997 | Ga0068860_100036448 | |||
| 1998 | Ga0068860_100081681 | |||
| 1999 | Ga0068860_100167592 | |||
| 2000 | Ga0068860_100280934 | |||
| 2001 | Ga0068862_100015311 | |||
| 2002 | Ga0068862_100032080 | |||
| 2003 | Ga0068862_100099860 | |||
| 2004 | Ga0068862_100156109 | |||
| 2005 | Ga0068862_100491878 | |||
| 2006 | Ga0081540_1010032 | |||
| 2007 | Ga0081539_10002233 | |||
| 2008 | Ga0070715_10073647 | |||
| 2009 | Ga0075366_10006763 | |||
| 2010 | Ga0075366_10031189 | |||
| 2011 | Ga0075366_10034049 | |||
| 2012 | Ga0075366_10200750 | |||
| 2013 | Ga0097621_100003401 | |||
| 2014 | Ga0097621_100036790 | |||
| 2015 | Ga0097621_100046779 | |||
| 2016 | Ga0097621_100049443 | |||
| 2017 | Ga0097621_100084088 | |||
| 2018 | Ga0097621_100096686 | |||
| 2019 | Ga0097621_100371519 | |||
| 2020 | Ga0075370_10019967 | |||
| 2021 | Ga0075370_10186709 | |||
| 2022 | Ga0068871_100000955 | |||
| 2023 | Ga0068871_100002544 | |||
| 2024 | Ga0068871_100076419 | |||
| 2025 | Ga0068871_100108578 | |||
| 2026 | Ga0068871_100249205 | |||
| 2027 | Ga0075428_100044984 | |||
| 2028 | Ga0075428_100140238 | |||
| 2029 | Ga0075428_100285496 | |||
| 2030 | Ga0075430_100135661 | |||
| 2031 | Ga0075431_100019798 | |||
| 2032 | Ga0075431_100034168 | |||
| 2033 | Ga0075429_100003790 | |||
| 2034 | Ga0075429_100020740 | |||
| 2035 | Ga0075429_100060787 | |||
| 2036 | Ga0068865_100001794 | |||
| 2037 | Ga0068865_100038915 | |||
| 2038 | Ga0068865_100114198 | |||
| 2039 | Ga0068865_100311402 | |||
| 2040 | Ga0097620_100000037 | |||
| 2041 | Ga0097620_100000536 | |||
| 2042 | Ga0097620_100002491 | |||
| 2043 | Ga0097620_100040243 | |||
| 2044 | Ga0097620_100076429 | |||
| 2045 | Ga0097620_100226288 | |||
| 2046 | Ga0097620_100272888 | |||
| 2047 | Ga0097620_100573436 | |||
| 2048 | Ga0105240_10000398 | |||
| 2049 | Ga0105240_10011002 | |||
| 2050 | Ga0105240_10011307 | |||
| 2051 | Ga0105240_10023972 | |||
| 2052 | Ga0105240_10041987 | |||
| 2053 | Ga0105240_10078219 | |||
| 2054 | Ga0105240_10088645 | |||
| 2055 | Ga0105240_10100052 | |||
| 2056 | Ga0105240_10167583 | |||
| 2057 | Ga0105240_10173346 | |||
| 2058 | Ga0105240_10182600 | |||
| 2059 | Ga0105240_10291130 | |||
| 2060 | Ga0105240_10331805 | |||
| 2061 | Ga0105240_10350445 | |||
| 2062 | Ga0105240_10404513 | |||
| 2063 | Ga0105240_10976799 | |||
| 2064 | Ga0111539_10013971 | |||
| 2065 | Ga0111539_10014550 | |||
| 2066 | Ga0111539_10044551 | |||
| 2067 | Ga0111539_10620757 | |||
| 2068 | Ga0105245_10068029 | |||
| 2069 | Ga0105247_10002304 | |||
| 2070 | Ga0105247_10015344 | |||
| 2071 | Ga0114129_10006463 | |||
| 2072 | Ga0114129_10303837 | |||
| 2073 | Ga0105243_10000009 | |||
| 2074 | Ga0105243_10077196 | |||
| 2075 | Ga0105241_10007590 | |||
| 2076 | Ga0105241_10009907 | |||
| 2077 | Ga0105241_10014100 | |||
| 2078 | Ga0105241_10037723 | |||
| 2079 | Ga0105241_10206141 | |||
| 2080 | Ga0105241_10617977 | |||
| 2081 | Ga0105241_10682033 | |||
| 2082 | Ga0105242_10045717 | |||
| 2083 | Ga0105242_10055628 | |||
| 2084 | Ga0105242_10102158 | |||
| 2085 | Ga0105242_10134109 | |||
| 2086 | Ga0105242_10184821 | |||
| 2087 | Ga0105242_10200555 | |||
| 2088 | Ga0105242_10521824 | |||
| 2089 | Ga0105248_10034629 | |||
| 2090 | Ga0105248_10052937 | |||
| 2091 | Ga0105248_10464039 | |||
| 2092 | Ga0105237_10001588 | |||
| 2093 | Ga0105237_10001799 | |||
| 2094 | Ga0105237_10011322 | |||
| 2095 | Ga0105237_10014365 | |||
| 2096 | Ga0105237_10022954 | |||
| 2097 | Ga0105237_10030759 | |||
| 2098 | Ga0105237_10035876 | |||
| 2099 | Ga0105237_10069245 | |||
| 2100 | Ga0105237_10268972 | |||
| 2101 | Ga0105237_10331462 | |||
| 2102 | Ga0105237_10738669 | |||
| 2103 | Ga0105238_10170225 | |||
| 2104 | Ga0105249_10000806 | |||
| 2105 | Ga0105249_10001080 | |||
| 2106 | Ga0105249_10005412 | |||
| 2107 | Ga0105249_10025715 | |||
| 2108 | Ga0105249_10029956 | |||
| 2109 | Ga0105249_10075766 | |||
| 2110 | Ga0105249_10077951 | |||
| 2111 | Ga0105249_10411381 | |||
| 2112 | Ga0105239_10000431 | |||
| 2113 | Ga0105239_10000436 | |||
| 2114 | Ga0105239_10004090 | |||
| 2115 | Ga0105239_10007869 | |||
| 2116 | Ga0105239_10033863 | |||
| 2117 | Ga0105239_10067944 | |||
| 2118 | Ga0105239_10122693 | |||
| 2119 | Ga0105239_10148001 | |||
| 2120 | Ga0105239_10188341 | |||
| 2121 | Ga0105239_10198084 | |||
| 2122 | Ga0105239_10205263 | |||
| 2123 | Ga0105239_10240840 | |||
| 2124 | Ga0105239_10241163 | |||
| 2125 | Ga0105239_10246419 | |||
| 2126 | Ga0105239_10468937 | |||
| 2127 | Ga0105246_10021096 | |||
| 2128 | Ga0105246_10124550 | |||
| 2129 | Ga0105246_10158325 | |||
| 2130 | Ga0157373_10000129 | |||
| 2131 | Ga0157373_10008302 | |||
| 2132 | Ga0157373_10018478 | |||
| 2133 | Ga0157373_10025943 | |||
| 2134 | Ga0157373_10041402 | |||
| 2135 | Ga0157373_10123108 | |||
| 2136 | Ga0157373_10175037 | |||
| 2137 | Ga0157373_10180217 | |||
| 2138 | Ga0157373_10318646 | |||
| 2139 | Ga0157373_10344172 | |||
| 2140 | Ga0157371_10003367 | |||
| 2141 | Ga0157371_10015121 | |||
| 2142 | Ga0157371_10016670 | |||
| 2143 | Ga0157371_10021771 | |||
| 2144 | Ga0157371_10023444 | |||
| 2145 | Ga0157371_10024281 | |||
| 2146 | Ga0157371_10032716 | |||
| 2147 | Ga0157371_10036963 | |||
| 2148 | Ga0157371_10043957 | |||
| 2149 | Ga0157371_10054932 | |||
| 2150 | Ga0157371_10078103 | |||
| 2151 | Ga0157371_10102478 | |||
| 2152 | Ga0157371_10279688 | |||
| 2153 | Ga0157370_10000926 | |||
| 2154 | Ga0157370_10006378 | |||
| 2155 | Ga0157370_10009487 | |||
| 2156 | Ga0157370_10011345 | |||
| 2157 | Ga0157370_10017050 | |||
| 2158 | Ga0157370_10022725 | |||
| 2159 | Ga0157370_10025354 | |||
| 2160 | Ga0157370_10047165 | |||
| 2161 | Ga0157370_10070629 | |||
| 2162 | Ga0157370_10113930 | |||
| 2163 | Ga0157370_10119429 | |||
| 2164 | Ga0157370_10259572 | |||
| 2165 | Ga0157369_10004050 | |||
| 2166 | Ga0157369_10007412 | |||
| 2167 | Ga0157369_10012941 | |||
| 2168 | Ga0157369_10019086 | |||
| 2169 | Ga0157369_10022720 | |||
| 2170 | Ga0157369_10038761 | |||
| 2171 | Ga0157369_10063647 | |||
| 2172 | Ga0157369_10083535 | |||
| 2173 | Ga0157369_10100758 | |||
| 2174 | Ga0157369_10115086 | |||
| 2175 | Ga0157369_10184333 | |||
| 2176 | Ga0157369_10206180 | |||
| 2177 | Ga0157369_10310068 | |||
| 2178 | Ga0157369_10597173 | |||
| 2179 | Ga0157374_10000001 | |||
| 2180 | Ga0157374_10000500 | |||
| 2181 | Ga0157374_10008968 | |||
| 2182 | Ga0157374_10009009 | |||
| 2183 | Ga0157374_10071962 | |||
| 2184 | Ga0157374_10126640 | |||
| 2185 | Ga0157374_10173144 | |||
| 2186 | Ga0157374_10263632 | |||
| 2187 | Ga0157374_10497665 | |||
| 2188 | Ga0157374_10589365 | |||
| 2189 | Ga0157374_10704437 | |||
| 2190 | Ga0157378_10006065 | |||
| 2191 | Ga0157378_10008184 | |||
| 2192 | Ga0157378_10012000 | |||
| 2193 | Ga0157378_10021595 | |||
| 2194 | Ga0157378_10025313 | |||
| 2195 | Ga0157378_10041061 | |||
| 2196 | Ga0157378_10103113 | |||
| 2197 | Ga0157378_10152599 | |||
| 2198 | Ga0157378_10191806 | |||
| 2199 | Ga0157378_10389252 | |||
| 2200 | Ga0163162_10001595 | |||
| 2201 | Ga0163162_10006110 | |||
| 2202 | Ga0163162_10008143 | |||
| 2203 | Ga0163162_10012931 | |||
| 2204 | Ga0163162_10024199 | |||
| 2205 | Ga0163162_10025579 | |||
| 2206 | Ga0163162_10096425 | |||
| 2207 | Ga0163162_10106731 | |||
| 2208 | Ga0163162_10115627 | |||
| 2209 | Ga0163162_10163494 | |||
| 2210 | Ga0163162_10280429 | |||
| 2211 | Ga0163162_10294393 | |||
| 2212 | Ga0163162_10299937 | |||
| 2213 | Ga0163162_10300778 | |||
| 2214 | Ga0163162_10391437 | |||
| 2215 | Ga0163162_10443296 | |||
| 2216 | Ga0163162_10465402 | |||
| 2217 | Ga0157372_10000030 | |||
| 2218 | Ga0157372_10000332 | |||
| 2219 | Ga0157372_10003109 | |||
| 2220 | Ga0157372_10003430 | |||
| 2221 | Ga0157372_10016323 | |||
| 2222 | Ga0157372_10016644 | |||
| 2223 | Ga0157372_10018713 | |||
| 2224 | Ga0157372_10020775 | |||
| 2225 | Ga0157372_10029769 | |||
| 2226 | Ga0157372_10051126 | |||
| 2227 | Ga0157372_10210537 | |||
| 2228 | Ga0157372_10214740 | |||
| 2229 | Ga0157372_10239188 | |||
| 2230 | Ga0157372_10247490 | |||
| 2231 | Ga0157372_10252119 | |||
| 2232 | Ga0157372_10377770 | |||
| 2233 | Ga0157372_10430482 | |||
| 2234 | Ga0157372_10552695 | |||
| 2235 | Ga0157372_10558901 | |||
| 2236 | Ga0157372_10589587 | |||
| 2237 | Ga0157372_10948156 | |||
| 2238 | Ga0157375_10001463 | |||
| 2239 | Ga0157375_10005027 | |||
| 2240 | Ga0157375_10010453 | |||
| 2241 | Ga0157375_10012841 | |||
| 2242 | Ga0157375_10082979 | |||
| 2243 | Ga0157375_10090738 | |||
| 2244 | Ga0157375_10094808 | |||
| 2245 | Ga0157375_10101632 | |||
| 2246 | Ga0157375_10128521 | |||
| 2247 | Ga0157375_10153729 | |||
| 2248 | Ga0157375_10208620 | |||
| 2249 | Ga0157375_10253294 | |||
| 2250 | Ga0157375_10603302 | |||
| 2251 | Ga0157375_10827917 | |||
| 2252 | Ga0163163_10001501 | |||
| 2253 | Ga0163163_10036393 | |||
| 2254 | Ga0163163_10054019 | |||
| 2255 | Ga0163163_10089831 | |||
| 2256 | Ga0163163_10092201 | |||
| 2257 | Ga0163163_10152284 | |||
| 2258 | Ga0163163_10300122 | |||
| 2259 | Ga0157380_10008895 | |||
| 2260 | Ga0157380_10030118 | |||
| 2261 | Ga0157380_10065873 | |||
| 2262 | Ga0157380_10071748 | |||
| 2263 | Ga0157380_10113108 | |||
| 2264 | Ga0157377_10021210 | |||
| 2265 | Ga0157377_10069334 | |||
| 2266 | Ga0157379_10000845 | |||
| 2267 | Ga0157379_10008284 | |||
| 2268 | Ga0157379_10036538 | |||
| 2269 | Ga0157379_10495784 | |||
| 2270 | Ga0157376_10008523 | |||
| 2271 | Ga0157376_10022078 | |||
| 2272 | Ga0157376_10040602 | |||
| 2273 | Ga0157376_10043577 | |||
| 2274 | Ga0157376_10083403 | |||
| 2275 | Ga0157376_10105537 | |||
| 2276 | Ga0157376_10135197 | |||
| 2277 | Ga0157376_10250506 | |||
| 2278 | Ga0157376_10516013 | |||
| 2279 | Ga0182005_1000147 | |||
| 2280 | Ga0163161_10001357 | |||
| 2281 | Ga0163161_10012104 | |||
| 2282 | Ga0163161_10015767 | |||
| 2283 | Ga0163161_10076648 | |||
| 2284 | Ga0163161_10146216 | |||
| 2285 | Ga0197907_10169535 | |||
| 2286 | Ga0206356_10575773 | |||
| 2287 | Ga0206351_10170033 | |||
| 2288 | Ga0206351_10512829 | |||
| 2289 | Ga0206352_10703535 | |||
| 2290 | Ga0206352_10938790 | |||
| 2291 | Ga0206350_10057460 | |||
| 2292 | Ga0206350_10752456 | |||
| 2293 | Ga0206354_10778573 | |||
| 2294 | Ga0206353_10311699 | |||
| 2295 | Ga0154015_1495562 | |||
| 2296 | Ga0213872_10013117 | |||
| 2297 | Ga0213876_10007626 | |||
| 2298 | Ga0224712_10003582 | |||
| 2299 | Ga0224712_10014571 | |||
| 2300 | Ga0209436_100232 | |||
| 2301 | Ga0209436_104962 | |||
| 2302 | Ga0207427_100025 | |||
| 2303 | Ga0209437_100010 | |||
| 2304 | Ga0209437_100135 | |||
| 2305 | Ga0209646_1000002 | |||
| 2306 | Ga0209646_1001434 | |||
| 2307 | Ga0209646_1004416 | |||
| 2308 | Ga0209026_1000299 | |||
| 2309 | Ga0209026_1000610 | |||
| 2310 | Ga0209026_1004981 | |||
| 2311 | Ga0209148_1000090 | |||
| 2312 | Ga0209129_1004506 | |||
| 2313 | Ga0209233_1000017 | |||
| 2314 | Ga0209233_1001329 | |||
| 2315 | Ga0209673_1000034 | |||
| 2316 | Ga0209130_1001055 | |||
| 2317 | Ga0209564_1014913 | |||
| 2318 | Ga0209758_1001438 | |||
| 2319 | Ga0209050_1000207 | |||
| 2320 | Ga0207426_1000105 | |||
| 2321 | Ga0207426_1000603 | |||
| 2322 | Ga0207426_1000813 | |||
| 2323 | Ga0207426_1001314 | |||
| 2324 | Ga0209257_1000001 | |||
| 2325 | Ga0209257_1000007 | |||
| 2326 | Ga0209257_1001824 | |||
| 2327 | Ga0207697_10008960 | |||
| 2328 | Ga0207697_10045796 | |||
| 2329 | Ga0207656_10000055 | |||
| 2330 | Ga0207656_10010030 | |||
| 2331 | Ga0207656_10102743 | |||
| 2332 | Ga0207656_10171442 | |||
| 2333 | Ga0207682_10003346 | |||
| 2334 | Ga0207682_10006454 | |||
| 2335 | Ga0207642_10027020 | |||
| 2336 | Ga0207642_10049589 | |||
| 2337 | Ga0207710_10002332 | |||
| 2338 | Ga0207710_10020859 | |||
| 2339 | Ga0207688_10010099 | |||
| 2340 | Ga0207680_10045258 | |||
| 2341 | Ga0207680_10061291 | |||
| 2342 | Ga0207680_10177908 | |||
| 2343 | Ga0207647_10000110 | |||
| 2344 | Ga0207647_10000171 | |||
| 2345 | Ga0207647_10009094 | |||
| 2346 | Ga0207647_10020448 | |||
| 2347 | Ga0207647_10025805 | |||
| 2348 | Ga0207645_10002136 | |||
| 2349 | Ga0207645_10025677 | |||
| 2350 | Ga0207645_10044737 | |||
| 2351 | Ga0207645_10163618 | |||
| 2352 | Ga0207643_10001724 | |||
| 2353 | Ga0207643_10006929 | |||
| 2354 | Ga0207643_10152178 | |||
| 2355 | Ga0207705_10000108 | |||
| 2356 | Ga0207705_10011466 | |||
| 2357 | Ga0207705_10018682 | |||
| 2358 | Ga0207705_10024219 | |||
| 2359 | Ga0207705_10052283 | |||
| 2360 | Ga0207705_10088880 | |||
| 2361 | Ga0207705_10208863 | |||
| 2362 | Ga0207705_10257291 | |||
| 2363 | Ga0207654_10000881 | |||
| 2364 | Ga0207654_10002705 | |||
| 2365 | Ga0207654_10036156 | |||
| 2366 | Ga0207654_10080916 | |||
| 2367 | Ga0207707_10011329 | |||
| 2368 | Ga0207707_10075844 | |||
| 2369 | Ga0207707_10260837 | |||
| 2370 | Ga0207695_10000053 | |||
| 2371 | Ga0207695_10000064 | |||
| 2372 | Ga0207695_10000076 | |||
| 2373 | Ga0207695_10000084 | |||
| 2374 | Ga0207695_10000090 | |||
| 2375 | Ga0207695_10004647 | |||
| 2376 | Ga0207695_10015473 | |||
| 2377 | Ga0207695_10026373 | |||
| 2378 | Ga0207695_10033343 | |||
| 2379 | Ga0207695_10081967 | |||
| 2380 | Ga0207695_10084771 | |||
| 2381 | Ga0207695_10273350 | |||
| 2382 | Ga0207671_10000149 | |||
| 2383 | Ga0207671_10003750 | |||
| 2384 | Ga0207671_10004543 | |||
| 2385 | Ga0207671_10007320 | |||
| 2386 | Ga0207671_10010466 | |||
| 2387 | Ga0207671_10032778 | |||
| 2388 | Ga0207671_10037137 | |||
| 2389 | Ga0207671_10040157 | |||
| 2390 | Ga0207671_10060090 | |||
| 2391 | Ga0207671_10069197 | |||
| 2392 | Ga0207671_10278244 | |||
| 2393 | Ga0207660_10006449 | |||
| 2394 | Ga0207660_10024417 | |||
| 2395 | Ga0207660_10048131 | |||
| 2396 | Ga0207662_10027651 | |||
| 2397 | Ga0207662_10092496 | |||
| 2398 | Ga0207657_10009979 | |||
| 2399 | Ga0207657_10036828 | |||
| 2400 | Ga0207657_10041700 | |||
| 2401 | Ga0207657_10049438 | |||
| 2402 | Ga0207657_10050001 | |||
| 2403 | Ga0207657_10062662 | |||
| 2404 | Ga0207657_10292539 | |||
| 2405 | Ga0207649_10005479 | |||
| 2406 | Ga0207649_10188195 | |||
| 2407 | Ga0207652_10000064 | |||
| 2408 | Ga0207652_10000387 | |||
| 2409 | Ga0207652_10002830 | |||
| 2410 | Ga0207652_10041607 | |||
| 2411 | Ga0207652_10108992 | |||
| 2412 | Ga0207652_10250009 | |||
| 2413 | Ga0207652_10298183 | |||
| 2414 | Ga0207652_10441296 | |||
| 2415 | Ga0207681_10015241 | |||
| 2416 | Ga0207681_10073899 | |||
| 2417 | Ga0207681_10353840 | |||
| 2418 | Ga0207694_10017481 | |||
| 2419 | Ga0207694_10253517 | |||
| 2420 | Ga0207650_10014881 | |||
| 2421 | Ga0207650_10066694 | |||
| 2422 | Ga0207650_10074981 | |||
| 2423 | Ga0207650_10077520 | |||
| 2424 | Ga0207650_10093786 | |||
| 2425 | Ga0207650_10120271 | |||
| 2426 | Ga0207650_10167486 | |||
| 2427 | Ga0207650_10206413 | |||
| 2428 | Ga0207650_10492599 | |||
| 2429 | Ga0207659_10009764 | |||
| 2430 | Ga0207659_10033056 | |||
| 2431 | Ga0207659_10101095 | |||
| 2432 | Ga0207659_10119153 | |||
| 2433 | Ga0207659_10172238 | |||
| 2434 | Ga0207659_10192518 | |||
| 2435 | Ga0207659_10327100 | |||
| 2436 | Ga0207659_10420269 | |||
| 2437 | Ga0207644_10012415 | |||
| 2438 | Ga0207644_10021869 | |||
| 2439 | Ga0207644_10024620 | |||
| 2440 | Ga0207644_10059737 | |||
| 2441 | Ga0207644_10140731 | |||
| 2442 | Ga0207644_10251118 | |||
| 2443 | Ga0207690_10002170 | |||
| 2444 | Ga0207690_10004744 | |||
| 2445 | Ga0207690_10012751 | |||
| 2446 | Ga0207690_10020857 | |||
| 2447 | Ga0207690_10024446 | |||
| 2448 | Ga0207690_10057621 | |||
| 2449 | Ga0207706_10006478 | |||
| 2450 | Ga0207706_10009371 | |||
| 2451 | Ga0207706_10029582 | |||
| 2452 | Ga0207706_10037951 | |||
| 2453 | Ga0207706_10068145 | |||
| 2454 | Ga0207686_10111562 | |||
| 2455 | Ga0207686_10127335 | |||
| 2456 | Ga0207686_10231570 | |||
| 2457 | Ga0207709_10000026 | |||
| 2458 | Ga0207670_10014554 | |||
| 2459 | Ga0207670_10486727 | |||
| 2460 | Ga0207670_10529657 | |||
| 2461 | Ga0207669_10005569 | |||
| 2462 | Ga0207669_10235181 | |||
| 2463 | Ga0207669_10344098 | |||
| 2464 | Ga0207704_10003038 | |||
| 2465 | Ga0207704_10039066 | |||
| 2466 | Ga0207665_10026619 | |||
| 2467 | Ga0207691_10000001 | |||
| 2468 | Ga0207691_10002741 | |||
| 2469 | Ga0207691_10019043 | |||
| 2470 | Ga0207691_10027644 | |||
| 2471 | Ga0207691_10075279 | |||
| 2472 | Ga0207691_10176679 | |||
| 2473 | Ga0207711_10092009 | |||
| 2474 | Ga0207711_10182599 | |||
| 2475 | Ga0207711_10191822 | |||
| 2476 | Ga0207689_10005396 | |||
| 2477 | Ga0207689_10010127 | |||
| 2478 | Ga0207689_10014249 | |||
| 2479 | Ga0207689_10018050 | |||
| 2480 | Ga0207689_10045231 | |||
| 2481 | Ga0207689_10075403 | |||
| 2482 | Ga0207689_10088584 | |||
| 2483 | Ga0207689_10101705 | |||
| 2484 | Ga0207689_10182503 | |||
| 2485 | Ga0207689_10195708 | |||
| 2486 | Ga0207689_10347595 | |||
| 2487 | Ga0207689_10472712 | |||
| 2488 | Ga0207661_10005126 | |||
| 2489 | Ga0207661_10008212 | |||
| 2490 | Ga0207661_10009193 | |||
| 2491 | Ga0207661_10019703 | |||
| 2492 | Ga0207661_10031577 | |||
| 2493 | Ga0207661_10178861 | |||
| 2494 | Ga0207679_10000875 | |||
| 2495 | Ga0207679_10050461 | |||
| 2496 | Ga0207679_10156469 | |||
| 2497 | Ga0207679_10214537 | |||
| 2498 | Ga0207679_10226523 | |||
| 2499 | Ga0207679_10340064 | |||
| 2500 | Ga0207667_10000430 | |||
| 2501 | Ga0207667_10000453 | |||
| 2502 | Ga0207667_10001484 | |||
| 2503 | Ga0207667_10003602 | |||
| 2504 | Ga0207667_10005923 | |||
| 2505 | Ga0207667_10009521 | |||
| 2506 | Ga0207667_10059200 | |||
| 2507 | Ga0207667_10073069 | |||
| 2508 | Ga0207667_10087826 | |||
| 2509 | Ga0207667_10095966 | |||
| 2510 | Ga0207667_10182531 | |||
| 2511 | Ga0207667_10211301 | |||
| 2512 | Ga0207667_10329536 | |||
| 2513 | Ga0207667_10387114 | |||
| 2514 | Ga0207667_10741997 | |||
| 2515 | Ga0207651_10053397 | |||
| 2516 | Ga0207651_10087831 | |||
| 2517 | Ga0207651_10621071 | |||
| 2518 | Ga0207712_10014683 | |||
| 2519 | Ga0207712_10016131 | |||
| 2520 | Ga0207712_10016968 | |||
| 2521 | Ga0207712_10026663 | |||
| 2522 | Ga0207712_10082897 | |||
| 2523 | Ga0207712_10224168 | |||
| 2524 | Ga0207712_10235773 | |||
| 2525 | Ga0207712_10473219 | |||
| 2526 | Ga0207668_10000869 | |||
| 2527 | Ga0207668_10015084 | |||
| 2528 | Ga0207668_10067188 | |||
| 2529 | Ga0207668_10074158 | |||
| 2530 | Ga0207668_10074644 | |||
| 2531 | Ga0207668_10149486 | |||
| 2532 | Ga0207668_10215357 | |||
| 2533 | Ga0207668_10422993 | |||
| 2534 | Ga0207640_10016977 | |||
| 2535 | Ga0207640_10020295 | |||
| 2536 | Ga0207640_10025047 | |||
| 2537 | Ga0207640_10031753 | |||
| 2538 | Ga0207640_10074633 | |||
| 2539 | Ga0207640_10219281 | |||
| 2540 | Ga0207640_10240337 | |||
| 2541 | Ga0207658_10002877 | |||
| 2542 | Ga0207658_10012999 | |||
| 2543 | Ga0207658_10051578 | |||
| 2544 | Ga0207677_10067295 | |||
| 2545 | Ga0207677_10102638 | |||
| 2546 | Ga0207677_10177581 | |||
| 2547 | Ga0207677_10212621 | |||
| 2548 | Ga0207703_10004088 | |||
| 2549 | Ga0207703_10176996 | |||
| 2550 | Ga0207639_10003633 | |||
| 2551 | Ga0207639_10009134 | |||
| 2552 | Ga0207639_10022533 | |||
| 2553 | Ga0207639_10060496 | |||
| 2554 | Ga0207639_10138059 | |||
| 2555 | Ga0207639_10268603 | |||
| 2556 | Ga0207639_10568927 | |||
| 2557 | Ga0207678_10137308 | |||
| 2558 | Ga0207678_10154438 | |||
| 2559 | Ga0207678_10172372 | |||
| 2560 | Ga0207708_10058905 | |||
| 2561 | Ga0207708_10119848 | |||
| 2562 | Ga0207702_10001407 | |||
| 2563 | Ga0207702_10056726 | |||
| 2564 | Ga0207702_10085669 | |||
| 2565 | Ga0207702_10115561 | |||
| 2566 | Ga0207702_10209740 | |||
| 2567 | Ga0207702_10263405 | |||
| 2568 | Ga0207641_10000121 | |||
| 2569 | Ga0207641_10005564 | |||
| 2570 | Ga0207641_10025754 | |||
| 2571 | Ga0207641_10029136 | |||
| 2572 | Ga0207641_10030020 | |||
| 2573 | Ga0207641_10091863 | |||
| 2574 | Ga0207641_10343578 | |||
| 2575 | Ga0207648_10003053 | |||
| 2576 | Ga0207648_10009109 | |||
| 2577 | Ga0207648_10014701 | |||
| 2578 | Ga0207648_10027181 | |||
| 2579 | Ga0207648_10028462 | |||
| 2580 | Ga0207648_10148136 | |||
| 2581 | Ga0207648_10176788 | |||
| 2582 | Ga0207648_10191611 | |||
| 2583 | Ga0207648_10340042 | |||
| 2584 | Ga0207676_10003342 | |||
| 2585 | Ga0207676_10003799 | |||
| 2586 | Ga0207676_10015259 | |||
| 2587 | Ga0207676_10067110 | |||
| 2588 | Ga0207676_10166766 | |||
| 2589 | Ga0207676_10256460 | |||
| 2590 | Ga0207676_10260843 | |||
| 2591 | Ga0207676_10278588 | |||
| 2592 | Ga0207674_10009949 | |||
| 2593 | Ga0207674_10020554 | |||
| 2594 | Ga0207674_10022667 | |||
| 2595 | Ga0207674_10025546 | |||
| 2596 | Ga0207674_10047480 | |||
| 2597 | Ga0207674_10070646 | |||
| 2598 | Ga0207674_10164835 | |||
| 2599 | Ga0207674_10168628 | |||
| 2600 | Ga0207674_10533724 | |||
| 2601 | Ga0207674_10629089 | |||
| 2602 | Ga0207674_10696855 | |||
| 2603 | Ga0207675_100002059 | |||
| 2604 | Ga0207675_100011158 | |||
| 2605 | Ga0207675_100041609 | |||
| 2606 | Ga0207675_100049685 | |||
| 2607 | Ga0207675_100068632 | |||
| 2608 | Ga0207675_100119254 | |||
| 2609 | Ga0207675_100450484 | |||
| 2610 | Ga0207675_100595456 | |||
| 2611 | Ga0207683_10006890 | |||
| 2612 | Ga0207683_10011072 | |||
| 2613 | Ga0207683_10016244 | |||
| 2614 | Ga0207683_10024454 | |||
| 2615 | Ga0207683_10097053 | |||
| 2616 | Ga0207683_10143867 | |||
| 2617 | Ga0207683_10202465 | |||
| 2618 | Ga0207698_10001488 | |||
| 2619 | Ga0207698_10013166 | |||
| 2620 | Ga0207698_10016613 | |||
| 2621 | Ga0207698_10060388 | |||
| 2622 | Ga0207698_10136904 | |||
| 2623 | Ga0209984_1004458 | |||
| 2624 | Ga0209968_1005122 | |||
| 2625 | Ga0209968_1011246 | |||
| 2626 | Ga0210002_1001494 | |||
| 2627 | Ga0209983_1021655 | |||
| 2628 | Ga0209998_10017630 | |||
| 2629 | Ga0207428_10111837 | |||
| 2630 | Ga0207428_10136352 | |||
| 2631 | Ga0207428_10279999 | |||
| 2632 | Ga0268266_10000038 | |||
| 2633 | Ga0268266_10015422 | |||
| 2634 | Ga0268266_10036671 | |||
| 2635 | Ga0268265_10003503 | |||
| 2636 | Ga0268265_10045098 | |||
| 2637 | Ga0268265_10156749 | |||
| 2638 | Ga0268265_10342236 | |||
| 2639 | Ga0268264_10000167 | |||
| 2640 | Ga0268264_10004208 | |||
| 2641 | Ga0268264_10004870 | |||
| 2642 | Ga0268264_10012086 | |||
| 2643 | Ga0268264_10015090 | |||
| 2644 | Ga0268264_10025918 | |||
| 2645 | Ga0268264_10061228 | |||
| 2646 | Ga0268264_10128293 | |||
| 2647 | Ga0268264_10222733 | |||
| 2648 | Ga0268264_10251911 | |||
| 2649 | Ga0265323_10000040 | |||
| 2650 | Ga0265336_10019263 | |||
| 2651 | Ga0307517_10018578 | |||
| 2652 | Ga0265338_10001855 | |||
| 2653 | Ga0265338_10206753 | |||
| 2654 | Ga0265324_10008522 | |||
| 2655 | Ga0307511_10004717 | |||
| 2656 | Ga0307512_10107163 | |||
| 2657 | Ga0316177_1079276 | |||
| 2658 | Ga0316176_1220529 | |||
| 2659 | Ga0316183_1116825 | |||
| 2660 | Ga0316181_1163475 | |||
| 2661 | Ga0265331_10159692 | |||
| 2662 | Ga0265327_10000097 | |||
| 2663 | Ga0265327_10000159 | |||
| 2664 | Ga0265327_10000244 | |||
| 2665 | Ga0265327_10000298 | |||
| 2666 | Ga0265327_10000370 | |||
| 2667 | Ga0265327_10074641 | |||
| 2668 | Ga0265327_10105046 | |||
| 2669 | Ga0265327_10155339 | |||
| 2670 | Ga0265316_10000486 | |||
| 2671 | Ga0265316_10004409 | |||
| 2672 | Ga0307513_10349076 | |||
| 2673 | Ga0307513_10363487 | |||
| 2674 | Ga0307509_10007469 | |||
| 2675 | Ga0307408_100013046 | |||
| 2676 | Ga0307408_100038382 | |||
| 2677 | Ga0307408_100466746 | |||
| 2678 | Ga0265342_10050150 | |||
| 2679 | Ga0265342_10197336 | |||
| 2680 | Ga0316576_10007854 | |||
| 2681 | Ga0316576_10080879 | |||
| 2682 | Ga0316576_10098247 | |||
| 2683 | Ga0316576_10134476 | |||
| 2684 | Ga0316578_10009003 | |||
| 2685 | Ga0316578_10015477 | |||
| 2686 | Ga0307516_10004268 | |||
| 2687 | Ga0307405_10010819 | |||
| 2688 | Ga0307405_10182283 | |||
| 2689 | Ga0316577_10016238 | |||
| 2690 | Ga0316577_10051389 | |||
| 2691 | Ga0316577_10056390 | |||
| 2692 | Ga0316577_10057199 | |||
| 2693 | Ga0316577_10282233 | |||
| 2694 | Ga0307413_10189650 | |||
| 2695 | Ga0307410_10035292 | |||
| 2696 | Ga0307410_10133130 | |||
| 2697 | Ga0307410_10159428 | |||
| 2698 | Ga0307406_10106862 | |||
| 2699 | Ga0307406_10300089 | |||
| 2700 | Ga0307407_10083520 | |||
| 2701 | Ga0307407_10439711 | |||
| 2702 | Ga0307412_10002740 | |||
| 2703 | Ga0307412_10010885 | |||
| 2704 | Ga0307412_10031955 | |||
| 2705 | Ga0307412_10153514 | |||
| 2706 | Ga0307409_100054022 | |||
| 2707 | Ga0307416_100000249 | |||
| 2708 | Ga0307416_100069247 | |||
| 2709 | Ga0307416_100644143 | |||
| 2710 | Ga0307414_10046410 | |||
| 2711 | Ga0307414_10049268 | |||
| 2712 | Ga0307414_10058567 | |||
| 2713 | Ga0307414_10077937 | |||
| 2714 | Ga0307414_10149592 | |||
| 2715 | Ga0307414_10186541 | |||
| 2716 | Ga0307414_10219916 | |||
| 2717 | Ga0307414_10273647 | |||
| 2718 | Ga0307414_10453617 | |||
| 2719 | Ga0307411_10020538 | |||
| 2720 | Ga0307411_10047021 | |||
| 2721 | Ga0307411_10067723 | |||
| 2722 | Ga0307415_100012733 | |||
| 2723 | Ga0307415_100025311 | |||
| 2724 | Ga0316580_10016205 | |||
| 2725 | Ga0316580_10084222 | |||
| 2726 | Ga0316580_10085624 | |||
| 2727 | Ga0316593_10000279 | |||
| 2728 | Ga0316593_10000712 | |||
| 2729 | Ga0316593_10004976 | |||
| 2730 | Ga0316593_10006916 | |||
| 2731 | Ga0316593_10016946 | |||
| 2732 | Ga0316593_10026606 | |||
| 2733 | Ga0316593_10071614 | |||
| 2734 | Ga0307510_10000380 | |||
| 2735 | Ga0316592_1000047 | |||
| 2736 | Ga0316592_1000131 | |||
| 2737 | Ga0316592_1000317 | |||
| 2738 | Ga0316592_1000414 | |||
| 2739 | Ga0316592_1001892 | |||
| 2740 | Ga0316592_1003234 | |||
| 2741 | Ga0316592_1020447 | |||
| 2742 | Ga0316592_1035762 | |||
| 2743 | Ga0316586_1003187 | |||
| 2744 | Ga0316586_1012203 | |||
| 2745 | Ga0316588_1000234 | |||
| 2746 | Ga0316588_1000295 | |||
| 2747 | Ga0316588_1000569 | |||
| 2748 | Ga0316596_1000052 | |||
| 2749 | Ga0316596_1000106 | |||
| 2750 | Ga0316596_1001428 | |||
| 2751 | Ga0316596_1002332 | |||
| 2752 | Ga0316596_1003798 | |||
| 2753 | Ga0316596_1006124 | |||
| 2754 | Ga0316596_1006577 | |||
| 2755 | Ga0316596_1009489 | |||
| 2756 | Ga0316596_1014496 | |||
| 2757 | Ga0316596_1019782 | |||
| 2758 | Ga0316596_1026385 | |||
| 2759 | Ga0316596_1040079 | |||
| 2760 | Ga0373955_0075643 | |||
| 2761 | Ga0316574_0036503 | |||
| 2762 | Ga0316574_0081697 | |||
| 2763 | Ga0316574_0105203 | |||
| 2764 | Ga0373935_0165867 | |||
| 2765 | Ga0373927_0006959 | |||
| 2766 | Ga0373937_0002462 | |||
| 2767 | Ga0373937_0299425 | |||
| 2768 | Ga0316582_0168172 | |||
| 2769 | Ga0316582_0250448 | |||
| 2770 | Ga0316584_0001842 | |||
| 2771 | Ga0316584_0004403 | |||
| 2772 | Ga0316584_0015050 | |||
| 2773 | Ga0316584_0028755 | |||
| 2774 | Ga0316584_0123064 | |||
| 2775 | Ga0316584_0128854 | |||
| 2776 | Ga0373925_0286730 | |||
| 2777 | Ga0395899_0000034 | |||
| 2778 | Ga0395899_0001127 | |||
| 2779 | Ga0395899_0001602 | |||
| 2780 | Ga0395899_0006152 | |||
| 2781 | Ga0395899_0014673 | |||
| 2782 | Ga0395899_0054207 | |||
| 2783 | Ga0395900_0000346 | |||
| 2784 | Ga0395900_0001482 | |||
| 2785 | Ga0395900_0006693 | |||
| 2786 | Ga0395900_0016502 | |||
| 2787 | Ga0395900_0017444 | |||
| 2788 | Ga0395900_0052980 | |||
| 2789 | Ga0395900_0074436 | |||
| 2790 | Ga0395900_0124849 | |||
| 2791 | Ga0395900_0410611 | |||
| 2792 | Ga0395898_0002718 | |||
| 2793 | Ga0395898_0018836 | |||
| 2794 | Ga0395898_0034336 | |||
| 2795 | Ga0395898_0039390 | |||
| 2796 | Ga0395898_0094771 | |||
| 2797 | Ga0395898_0257000 | |||
| 2798 | Ga0395898_0378729 | |||
| 2799 | Ga0395898_0584577 | |||
| 2800 | Ga0395905_0000001 | |||
| 2801 | Ga0395905_0000376 | |||
| 2802 | Ga0395905_0000528 | |||
| 2803 | Ga0395905_0002823 | |||
| 2804 | Ga0395905_0002993 | |||
| 2805 | Ga0395905_0096577 | |||
| 2806 | Ga0395905_0173952 | |||
| 2807 | Ga0395905_0415359 | |||
| 2808 | Ga0395901_0000351 | |||
| 2809 | Ga0395901_0001115 | |||
| 2810 | Ga0395901_0078192 | |||
| 2811 | Ga0395901_0135999 | |||
| 2812 | Ga0395901_0158362 | |||
| 2813 | Ga0395901_0252291 | |||
| 2814 | Ga0400483_219275 | |||
| 2815 | Ga0436365_0472587 | |||
| 2816 | Ga0436365_0781227 | |||
| 2817 | Ga0436365_1312514 | |||
| 2818 | Ga0436365_1690067 | |||
| 2819 | Ga0436361_0986181 | |||
| 2820 | Ga0436361_1211924 | |||
| 2821 | Ga0439436_0004280 | |||
| 2822 | Ga0439439_0010020 | |||
| 2823 | Ga0439439_0018085 | |||
| 2824 | Ga0439453_0020145 | |||
| 2825 | Ga0439465_0022501 | |||
| 2826 | Ga0439465_0069648 | |||
| 2827 | Ga0439465_0110006 | |||
| 2828 | Ga0451787_433472 | |||
| 2829 | Ga0451795_0024876 | |||
| 2830 | Ga0451837_0265238 | |||
| 2831 | Ga0451837_0432158 | |||
| 2832 | Ga0439431_0000777 | |||
| 2833 | Ga0439431_0013148 | |||
| 2834 | Ga0439431_0040544 | |||
| 2835 | Ga0439433_0009272 | |||
| 2836 | Ga0439433_0031284 | |||
| 2837 | Ga0439445_0001922 | |||
| 2838 | Ga0439445_0011234 | |||
| 2839 | Ga0439448_0005262 | |||
| 2840 | Ga0439449_0005508 | |||
| 2841 | Ga0439449_0013615 | |||
| 2842 | Ga0439449_0017442 | |||
| 2843 | Ga0439454_014244 | |||
| 2844 | Ga0439455_0032158 | |||
| 2845 | Ga0439455_0052110 | |||
| 2846 | Ga0439457_000313 | |||
| 2847 | Ga0439462_0001031 | |||
| 2848 | Ga0439462_0015306 | |||
| 2849 | Ga0450923_013606 | |||
| 2850 | Ga0450894_006068 | |||
| 2851 | Ga0439446_0018535 | |||
| 2852 | Ga0439434_0002227 | |||
| 2853 | Ga0439434_0017713 | |||
| 2854 | Ga0450918_016978 | |||
| 2855 | Ga0450893_0021862 | |||
| 2856 | Ga0451577_0004463 | |||
| 2857 | Ga0451577_0014494 | |||
| 2858 | Ga0451577_0030583 | |||
| 2859 | Ga0451577_0035014 | |||
| 2860 | Ga0451577_0048590 | |||
| 2861 | Ga0451577_0053903 | |||
| 2862 | Ga0451577_0058001 | |||
| 2863 | Ga0451577_0091765 | |||
| 2864 | Ga0451577_0092287 | |||
| 2865 | Ga0451577_0160817 | |||
| 2866 | Ga0451577_0184901 | |||
| 2867 | Ga0451577_0223646 | |||
| 2868 | Ga0451577_0274290 | |||
| 2869 | Ga0451577_0281781 | |||
| 2870 | Ga0451577_0281951 | |||
| 2871 | Ga0466969_0000246 | |||
| 2872 | Ga0466972_0000025 | |||
| 2873 | Ga0466972_0043728 | |||
| 2874 | Ga0453683_0000055 | |||
| 2875 | Ga0453683_0000522 | |||
| 2876 | Ga0453683_0000935 | |||
| 2877 | Ga0453683_0005759 | |||
| 2878 | Ga0453683_0007526 | |||
| 2879 | Ga0453683_0049521 | |||
| 2880 | Ga0453683_0082507 | |||
| 2881 | Ga0453683_0099319 | |||
| 2882 | Ga0466966_0001476 | |||
| 2883 | Ga0466966_0022707 | |||
| 2884 | Ga0466961_0096365 | |||
| 2885 | Ga0466961_0114876 | |||
| 2886 | Ga0466964_0026563 | |||
| 2887 | Ga0453684_0000334 | |||
| 2888 | Ga0453684_0000413 | |||
| 2889 | Ga0453684_0000440 | |||
| 2890 | Ga0453684_0000506 | |||
| 2891 | Ga0453684_0001121 | |||
| 2892 | Ga0453684_0001193 | |||
| 2893 | Ga0453684_0001382 | |||
| 2894 | Ga0453684_0001549 | |||
| 2895 | Ga0453684_0004131 | |||
| 2896 | Ga0453684_0005611 | |||
| 2897 | Ga0453684_0012498 | |||
| 2898 | Ga0453684_0013573 | |||
| 2899 | Ga0453684_0014056 | |||
| 2900 | Ga0453684_0025154 | |||
| 2901 | Ga0453684_0032953 | |||
| 2902 | Ga0453684_0033676 | |||
| 2903 | Ga0453684_0040849 | |||
| 2904 | Ga0453684_0046321 | |||
| 2905 | Ga0453684_0048058 | |||
| 2906 | Ga0453684_0050952 | |||
| 2907 | Ga0453684_0055899 | |||
| 2908 | Ga0453684_0056141 | |||
| 2909 | Ga0453684_0059704 | |||
| 2910 | Ga0453684_0060833 | |||
| 2911 | Ga0453684_0065279 | |||
| 2912 | Ga0453684_0074193 | |||
| 2913 | Ga0453684_0092022 | |||
| 2914 | Ga0453684_0093568 | |||
| 2915 | Ga0453684_0100839 | |||
| 2916 | Ga0453684_0108960 | |||
| 2917 | Ga0453684_0133671 | |||
| 2918 | Ga0453684_0145076 | |||
| 2919 | Ga0453684_0258564 | |||
| 2920 | Ga0453684_0261069 | |||
| 2921 | Ga0453684_0435002 | |||
| 2922 | Ga0466970_0000933 | |||
| 2923 | Ga0466970_0032604 | |||
| 2924 | Ga0466957_0001187 | |||
| 2925 | Ga0466957_0009999 | |||
| 2926 | Ga0466957_0025802 | |||
| 2927 | Ga0466959_0000017 | |||
| 2928 | Ga0466959_0017683 | |||
| 2929 | Ga0466959_0019573 | |||
| 2930 | Ga0451576_0000113 | |||
| 2931 | Ga0451576_0001103 | |||
| 2932 | Ga0451576_0005920 | |||
| 2933 | Ga0451576_0010522 | |||
| 2934 | Ga0451576_0011813 | |||
| 2935 | Ga0451576_0017866 | |||
| 2936 | Ga0451576_0018019 | |||
| 2937 | Ga0451576_0021171 | |||
| 2938 | Ga0451576_0030427 | |||
| 2939 | Ga0451576_0051376 | |||
| 2940 | Ga0451576_0071147 | |||
| 2941 | Ga0451576_0099290 | |||
| 2942 | Ga0451576_0197917 | |||
| 2943 | Ga0451576_0224290 | |||
| 2944 | Ga0451576_0254434 | |||
| 2945 | Ga0451576_0360124 | |||
| 2946 | Ga0451576_0460967 | |||
| 2947 | Ga0451576_0909952 | |||
| 2948 | Ga0495627_001896 | |||
| 2949 | Ga0495603_0132226 | |||
| 2950 | Ga0495638_0083919 | |||
| 2951 | Ga0495638_0085990 | |||
| 2952 | Ga0495653_0047662 | |||
| 2953 | Ga0495650_0051591 | |||
| 2954 | Ga0495580_0013181 | |||
| 2955 | Ga0495582_0139876 | |||
| 2956 | Ga0495662_0020123 | |||
| 2957 | Ga0495664_0051957 | |||
| 2958 | Ga0495583_0069279 | |||
| 2959 | Ga0495606_0021306 | |||
| 2960 | Ga0495606_0036258 | |||
| 2961 | Ga0495608_0012072 | |||
| 2962 | Ga0495608_0268649 | |||
| 2963 | Ga0495616_0018996 | |||
| 2964 | Ga0495616_0025587 | |||
| 2965 | Ga0495618_0020169 | |||
| 2966 | Ga0495628_0008937 | |||
| 2967 | Ga0495628_0610950 | |||
| 2968 | Ga0495630_0017830 | |||
| 2969 | Ga0495630_0057161 | |||
| 2970 | Ga0495630_0223347 | |||
| 2971 | Ga0495643_0000294 | |||
| 2972 | Ga0495643_0101174 | |||
| 2973 | Ga0495644_0001340 | |||
| 2974 | Ga0495648_0012032 | |||
| 2975 | Ga0495652_0444576 | |||
| 2976 | Ga0495640_0024578 | |||
| 2977 | Ga0495587_0115395 | |||
| 2978 | Ga0495645_0090453 | |||
| 2979 | Ga0495633_0000049 | |||
| 2980 | Ga0495668_0000108 | |||
| 2981 | Ga0495668_0000191 | |||
| 2982 | Ga0495668_0001518 | |||
| 2983 | Ga0495634_0023809 | |||
| 2984 | Ga0495634_0057670 | |||
| 2985 | Ga0495611_0085828 | |||
| 2986 | Ga0495611_0154893 | |||
| 2987 | Ga0495625_0001933 | |||
| 2988 | Ga0495625_0043576 | |||
| 2989 | Ga0495625_0051559 | |||
| 2990 | Ga0495625_0068664 | |||
| 2991 | Ga0495625_0173757 | |||
| 2992 | Ga0495657_0193260 | |||
| 2993 | Ga0495658_0006331 | |||
| 2994 | Ga0495613_0151946 | |||
| 2995 | Ga0495613_0178582 | |||
| 2996 | Ga0495670_0006417 | |||
| 2997 | Ga0495670_0031502 | |||
| 2998 | Ga0495671_0028507 | |||
| 2999 | Ga0495649_0091156 | |||
| 3000 | Ga0495600_0127185 | |||
| 3001 | Ga0495600_0329392 | |||
| 3002 | Ga0495604_0070404 | |||
| 3003 | Ga0495636_0047537 | |||
| 3004 | Ga0495674_0057426 | |||
| 3005 | Ga0495674_0303326 | |||
| 3006 | Ga0495672_0035964 | |||
| 3007 | Ga0495672_0072609 | |||
| 3008 | Ga0495676_0226161 | |||
| 3009 | Ga0495676_0269599 | |||
| 3010 | Ga0495680_0035982 | |||
| 3011 | Ga0495687_000001 | |||
| 3012 | Ga0495687_000233 | |||
| 3013 | Ga0495675_0183580 | |||
| 3014 | Ga0495685_011735 | |||
| 3015 | Ga0495684_0242029 | |||
| 3016 | Ga0495686_0000004 | |||
| 3017 | Ga0495686_0039024 | |||
| 3018 | Ga0495686_0085031 | |||
| 3019 | Ga0496101_0196189 | |||
| 3020 | Ga0496104_0295323 | |||
| 3021 | Ga0496104_0327218 | |||
| 3022 | Ga0496105_0087940 | |||
| 3023 | Ga0496108_0488854 | |||
| 3024 | Ga0496110_0131071 | |||
| 3025 | Ga0496114_0473557 | |||
| 3026 | Ga0496115_0034456 | |||
| 3027 | Ga0496115_0265498 | |||
| 3028 | Ga0496115_0337815 | |||
| 3029 | Ga0496115_0525836 | |||
| 3030 | Ga0496116_0019557 | |||
| 3031 | Ga0496117_0001863 | |||
| 3032 | Ga0496118_0200874 | |||
| 3033 | Ga0496121_0000030 | |||
| 3034 | Ga0496122_0008592 | |||
| 3035 | Ga0496123_0014741 | |||
| 3036 | Ga0496126_0030549 | |||
| 3037 | Ga0501306_003537 | |||
| 3038 | Ga0501305_000824 | |||
| 3039 | Ga0501307_000646 | |||
| 3040 | Ga0501311_000077 | |||
| 3041 | Ga0501311_007027 | |||
| 3042 | Ga0501312_002580 | |||
| 3043 | Ga0501315_000974 | |||
| 3044 | Ga0501316_000510 | |||
| 3045 | Ga0501319_000002 | |||
| 3046 | Ga0501032_0002362 | |||
| 3047 | Ga0501032_0002936 | |||
| 3048 | Ga0501032_0013633 | |||
| 3049 | Ga0501032_0045337 | |||
| 3050 | Ga0501033_0000011 | |||
| 3051 | Ga0501033_0430138 | |||
| 3052 | Ga0501034_0001265 | |||
| 3053 | Ga0501034_0002020 | |||
| 3054 | Ga0501034_0010858 | |||
| 3055 | Ga0501034_0017257 | |||
| 3056 | Ga0501034_0040721 | |||
| 3057 | Ga0501034_0140017 | |||
| 3058 | Ga0501034_0191568 | |||
| 3059 | Ga0501034_0282372 | |||
| 3060 | Ga0501036_0009955 | |||
| 3061 | Ga0501036_0012794 | |||
| 3062 | Ga0501036_0017036 | |||
| 3063 | Ga0501036_0040807 | |||
| 3064 | Ga0501037_0003904 | |||
| 3065 | Ga0501037_0004877 | |||
| 3066 | Ga0501037_0021814 | |||
| 3067 | Ga0501037_0022979 | |||
| 3068 | Ga0501037_0032648 | |||
| 3069 | Ga0501038_0002395 | |||
| 3070 | Ga0501038_0005905 | |||
| 3071 | Ga0501038_0121981 | |||
| 3072 | Ga0501038_0222597 | |||
| 3073 | Ga0501039_0003523 | |||
| 3074 | Ga0501039_0011642 | |||
| 3075 | Ga0501039_0013024 | |||
| 3076 | Ga0501043_0000733 | |||
| 3077 | Ga0501043_0009337 | |||
| 3078 | Ga0501043_0011452 | |||
| 3079 | Ga0501043_0038700 | |||
| 3080 | Ga0501043_0041852 | |||
| 3081 | Ga0501046_0032361 | |||
| 3082 | Ga0501046_0052113 | |||
| 3083 | Ga0501046_0163745 | |||
| 3084 | Ga0501047_0075953 | |||
| 3085 | Ga0501047_0085641 | |||
| 3086 | Ga0501047_0101654 | |||
| 3087 | Ga0501047_0120170 | |||
| 3088 | Ga0501047_0185593 | |||
| 3089 | Ga0501047_0186349 | |||
| 3090 | Ga0501047_0269762 | |||
| 3091 | Ga0501047_0372115 | |||
| 3092 | Ga0501048_0123290 | |||
| 3093 | Ga0501067_0017620 | |||
| 3094 | Ga0501068_0072633 | |||
| 3095 | Ga0501069_0064770 | |||
| 3096 | Ga0501069_0146770 | |||
| 3097 | Ga0501070_0032644 | |||
| 3098 | Ga0501070_0177402 | |||
| 3099 | Ga0501072_0157654 | |||
| 3100 | Ga0501072_0228144 | |||
| 3101 | Ga0501073_0060516 | |||
| 3102 | Ga0501073_0069872 | |||
| 3103 | Ga0501074_0001790 | |||
| 3104 | Ga0501201_002320 | |||
| 3105 | Ga0501202_000998 | |||
| 3106 | Ga0501202_007720 | |||
| 3107 | Ga0501217_027892 | |||
| 3108 | Ga0501223_030230 | |||
| 3109 | Ga0501224_006724 | |||
| 3110 | Ga0501236_000758 | |||
| 3111 | Ga0501243_002414 | |||
| 3112 | Ga0501257_003554 | |||
| 3113 | Ga0501257_006334 | |||
| 3114 | Ga0501257_009003 | |||
| 3115 | Ga0501257_010822 | |||
| 3116 | Ga0501257_021787 | |||
| 3117 | Ga0501259_001205 | |||
| 3118 | Ga0501261_001010 | |||
| 3119 | Ga0501219_000689 | |||
| 3120 | Ga0501221_018469 | |||
| 3121 | Ga0501225_0004957 | |||
| 3122 | Ga0501225_0014146 | |||
| 3123 | Ga0501225_0031787 | |||
| 3124 | Ga0501079_0067091 | |||
| 3125 | Ga0501080_0032906 | |||
| 3126 | Ga0501080_0096029 | |||
| 3127 | Ga0501080_0152601 | |||
| 3128 | Ga0501083_0085302 | |||
| 3129 | Ga0501083_0110428 | |||
| 3130 | Ga0501263_015504 | |||
| 3131 | Ga0501264_000532 | |||
| 3132 | Ga0501269_003046 | |||
| 3133 | Ga0501272_008342 | |||
| 3134 | Ga0501273_004702 | |||
| 3135 | Ga0501035_0006062 | |||
| 3136 | Ga0501035_0009077 | |||
| 3137 | Ga0501035_0016384 | |||
| 3138 | Ga0501035_0071324 | |||
| 3139 | Ga0501035_0110040 | |||
| 3140 | Ga0501035_0256134 | |||
| 3141 | Ga0501044_0001293 | |||
| 3142 | Ga0501044_0004248 | |||
| 3143 | Ga0501044_0020175 | |||
| 3144 | Ga0501044_0037946 | |||
| 3145 | Ga0501044_0089863 | |||
| 3146 | Ga0501044_0123100 | |||
| 3147 | Ga0501044_0129939 | |||
| 3148 | Ga0501044_0176664 | |||
| 3149 | Ga0501045_0000053 | |||
| 3150 | Ga0501284_00135 | |||
| 3151 | nmdc:mga00v17_190208_c1 | |||
| 3152 | nmdc:mga0k408_102103_c1 | |||
| 3153 | nmdc:mga0k408_109494_c1 | |||
| 3154 | nmdc:mga0k408_12089_c1 | |||
| 3155 | nmdc:mga0k408_34214_c1 | |||
| 3156 | nmdc:mga0k408_54179_c1 | |||
| 3157 | nmdc:mga0k408_7017_c1 | |||
| 3158 | nmdc:mga0k408_8427_c1 | |||
| 3159 | nmdc:mga0k408_9728_c1 | |||
| 3160 | nmdc:mga07m45_122395_c1 | |||
| 3161 | nmdc:mga07m45_69219_c1 | |||
| 3162 | nmdc:mga05p37_3944_c1 | |||
| 3163 | nmdc:mga05p37_466479_c1 | |||
| 3164 | nmdc:mga09592_4236_c1 | |||
| 3165 | nmdc:mga09592_63156_c1 | |||
| 3166 | nmdc:mga0qj67_85711_c1 | |||
| 3167 | nmdc:mga06r32_145795_c1 | |||
| 3168 | nmdc:mga06r32_46732_c1 | |||
| 3169 | nmdc:mga08y16_10401_c1 | |||
| 3170 | nmdc:mga08y16_106009_c1 | |||
| 3171 | nmdc:mga08y16_26169_c1 | |||
| 3172 | nmdc:mga08y16_342131_c1 | |||
| 3173 | Ga0500635_0004581 | |||
| 3174 | Ga0495619_0033330 | |||
| 3175 | Ga0500578_0000136 | |||
| 3176 | Ga0500578_0018759 | |||
| 3177 | Ga0500644_0002759 | |||
| 3178 | Ga0500581_059303 | |||
| 3179 | Ga0500646_0005243 | |||
| 3180 | Ga0500646_0007315 | |||
| 3181 | Ga0500646_0029761 | |||
| 3182 | Ga0500583_0000248 | |||
| 3183 | Ga0500583_0003873 | |||
| 3184 | Ga0500651_0061432 | |||
| 3185 | Ga0500651_0107621 | |||
| 3186 | Ga0500651_0108917 | |||
| 3187 | Ga0500641_0021869 | |||
| 3188 | Ga0500555_028876 | |||
| 3189 | Ga0500556_0011703 | |||
| 3190 | Ga0500562_000061 | |||
| 3191 | Ga0500562_013235 | |||
| 3192 | Ga0500569_000284 | |||
| 3193 | Ga0500594_0009518 | |||
| 3194 | Ga0500594_0011328 | |||
| 3195 | Ga0500642_0007688 | |||
| 3196 | Ga0500642_0030776 | |||
| 3197 | Ga0500652_001629 | |||
| 3198 | Ga0500652_021805 | |||
| 3199 | Ga0500559_0019375 | |||
| 3200 | Ga0500559_0062978 | |||
| 3201 | Ga0500561_0029324 | |||
| 3202 | Ga0500568_0000439 | |||
| 3203 | Ga0500568_0013282 | |||
| 3204 | Ga0500577_0000711 | |||
| 3205 | Ga0500588_0045696 | |||
| 3206 | Ga0500590_014980 | |||
| 3207 | Ga0500616_0000013 | |||
| 3208 | Ga0500616_0001754 | |||
| 3209 | Ga0500616_0016628 | |||
| 3210 | Ga0500622_0000113 | |||
| 3211 | Ga0500622_0000133 | |||
| 3212 | Ga0500622_0000156 | |||
| 3213 | Ga0500622_0000385 | |||
| 3214 | Ga0500622_0000655 | |||
| 3215 | Ga0500622_0001823 | |||
| 3216 | Ga0500622_0053963 | |||
| 3217 | Ga0500624_000517 | |||
| 3218 | Ga0500627_0009946 | |||
| 3219 | Ga0500637_0160320 | |||
| 3220 | Ga0500637_0261492 | |||
| 3221 | Ga0500611_000032 | |||
| 3222 | Ga0500645_003859 | |||
| 3223 | Ga0500645_025794 | |||
| 3224 | Ga0500661_005867 | |||
| 3225 | Ga0587091_015081 | |||
| 3226 | Ga0501082_0180686 | |||
| 3227 | Ga0466962_0027756 | |||
| 3228 | 2513232367 | |||
| 3229 | 2520879531 | |||
| 3230 | 2524006227 | |||
| 3231 | 2585143578 | |||
| 3232 | 2585156581 | |||
| 3233 | 2585160768 | |||
| 3234 | 2587679968 | |||
| 3235 | 2587748626 | |||
| 3236 | 2587753464 | |||
| 3237 | 2587864992 | |||
| 3238 | 2588211483 | |||
| 3239 | 2588215865 | |||
| 3240 | 2588219287 | |||
| 3241 | 2588224765 | |||
| 3242 | 2588234600 | |||
| 3243 | 2588447560 | |||
| 3244 | 2590603187 | |||
| 3245 | 2590610208 | |||
| 3246 | 2599479391 | |||
| 3247 | 2644373930 | |||
| 3248 | 2644643938 | |||
| 3249 | 2644681833 | |||
| 3250 | 2722726168 | |||
| 3251 | 2729200764 | |||
| 3252 | 2738698384 | |||
| 3253 | 2738726202 | |||
| 3254 | 2738733068 | |||
| 3255 | 2738765606 | |||
| 3256 | 2738854392 | |||
| 3257 | 2739214649 | |||
| 3258 | 2739252710 | |||
| 3259 | 2739587944 | |||
| 3260 | 2739614405 | |||
| 3261 | 2739646663 | |||
| 3262 | 2740002835 | |||
| 3263 | 2740007652 | |||
| 3264 | 2740060422 | |||
| 3265 | 2753674200 | |||
| 3266 | 2765575672 | |||
| 3267 | 2772605776 | |||
| 3268 | 2775674346 | |||
| 3269 | 2802655257 | |||
| 3270 | 2816875518 | |||
| 3271 | 2817413549 | |||
| 3272 | 2819545820 | |||
| 3273 | 2819573333 | |||
| 3274 | 2819590244 | |||
| 3275 | 2819681069 | |||
| 3276 | 2821136745 | |||
| 3277 | 2833640623 | |||
| 3278 | 2839990124 | |||
| 3279 | 2842086249 | |||
| 3280 | 2842724287 | |||
| 3281 | 2842908305 | |||
| 3282 | 2842913579 | |||
| 3283 | 2849282609 | |||
| 3284 | 2852625403 | |||
| 3285 | 2857617048 | |||
| 3286 | 2857619717 | |||
| 3287 | 2857631642 | |||
| 3288 | 2871723598 | |||
| 3289 | 2881247573 | |||
| 3290 | 2881364101 | |||
| 3291 | 2881955871 | |||
| 3292 | 2883072442 | |||
| 3293 | 2884795844 | |||
| 3294 | 2884934414 | |||
| 3295 | 2889293824 | |||
| 3296 | 2890740672 | |||
| 3297 | 2895504000 | |||
| 3298 | 2896087577 | |||
| 3299 | 2896112703 | |||
| 3300 | 2896320847 | |||
| 3301 | 2898716199 | |||
| 3302 | 2903898660 | |||
| 3303 | 2904422400 | |||
| 3304 | 2904449060 | |||
| 3305 | 2904468510 | |||
| 3306 | 2904558494 | |||
| 3307 | 2904782778 | |||
| 3308 | 2906001181 | |||
| 3309 | 2906800771 | |||
| 3310 | 2911143829 | |||
| 3311 | 2914763464 | |||
| 3312 | 2919097961 | |||
| 3313 | 2919180388 | |||
| 3314 | 2919194219 | |||
| 3315 | 2919438008 | |||
| 3316 | 2919684616 | |||
| 3317 | 2919697455 | |||
| 3318 | 2928082299 | |||
| 3319 | 2928149122 | |||
| 3320 | 2929150605 | |||
| 3321 | 2929155011 | |||
| 3322 | 2929178591 | |||
| 3323 | 2929240968 | |||
| 3324 | 2929922992 | |||
| 3325 | 2932085011 | |||
| 3326 | 2945924807 | |||
| 3327 | 2945980999 | |||
| 3328 | 2945998890 | |||
| 3329 | 2946019598 | |||
| 3330 | 2946024079 | |||
| 3331 | 2954021333 | |||
| 3332 | 2958462002 | |||
| 3333 | 2958514497 | |||
| 3334 | 2965321921 | |||
| 3335 | 2977235844 | |||
| 3336 | 2977247760 | |||
| 3337 | 2977272077 | |||
| 3338 | 2984574444 | |||
| 3339 | 2984607893 | |||
| 3340 | 2993375109 | |||
| 3341 | 2993481973 | |||
| 3342 | 8003152326 | |||
| 3343 | 8036739266 | |||
| 3344 | 8054311427 | |||
| 3345 | 8055423584 | |||
| 3346 | 8055591295 | |||
| 3347 | 8055595062 | |||
| 3348 | 8056443519 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c04-assembly1.cif.gz_A | identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui | 0.976 | 62 | 193 |
| 1c04-assembly1.cif.gz_A | identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui | 0.9478 | 62 | 193 |
| 8c91-assembly1.cif.gz_C | cryo-em captures early ribosome assembly in action | 0.9448 | 62 | 200 |
| 3iy9-assembly1.cif.gz_B | leishmania tarentolae mitochondrial large ribosomal subunit model | 0.8916 | 81 | 209 |
| 7qh6-assembly1.cif.gz_D | cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 1 | 0.8559 | 62 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rl2B01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9872 | 62 | 113 | 2.40.50.140 |
| af_Q6R9C6_19_86_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.986 | 131 | 196 | 2.30.30.30 |
| af_Q5A7P6_207_283_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9753 | 124 | 195 | 2.30.30.30 |
| af_P92812_354_429_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9712 | 125 | 195 | 2.30.30.30 |
| 1vqoA02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9706 | 121 | 195 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F2I9X1-F1-model_v4 | 50S ribosomal protein L2 | 0.9941 | 62 | 187 |
GO:0002181
GO:0003723 GO:0003735 GO:0015934 GO:0016740 |
| AF-A0A3D1RTI2-F1-model_v4 | 50S ribosomal protein L2 | 0.9905 | 69 | 168 |
GO:0002181
GO:0003723 GO:0003735 GO:0005840 GO:1990904 |
| AF-A0A5K1AQ75-F1-model_v4 | Large ribosomal subunit protein uL2 RNA-binding domain-containing protein | 0.9879 | 60 | 132 |
GO:0003723
GO:0003735 GO:0005762 GO:0032543 |
| AF-A0A3D4Z242-F1-model_v4 | 50S ribosomal protein L2 | 0.9872 | 99 | 197 |
GO:0002181
GO:0003723 GO:0003735 GO:0005840 GO:1990904 |
| AF-A0A3C1P018-F1-model_v4 | 50S ribosomal protein L2 | 0.9864 | 132 | 202 |
GO:0002181
GO:0003723 GO:0003735 GO:0005840 GO:1990904 |