F495287
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1674 | 566 | 3348 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10040946|Ga0105239_100409464 |
| Length | 285 |
| Sequence | VVDPAHGSDLTSGRGGGGRRCAMGHRLAIDEVSMAAQLQFNDVTLGYDRHPAVHHLSGEIAAGALLAVAGPNGAGKSTLFRGIVGILKPLSGTIRTAGLDIRDIAYLPQTADIDRSFPISVFDFVGTGLWRKTGVFGGIGSKARQAIAQALTAVGLNGFENRAIGTLSGGQMQRMLFARLLLQDARLIVLDEPFNAVDAKTSADLLALIKRWYAEGRTVLAALHDLDLVRASFPETLLLARGKVAWGVTADILTADNLLEARRMCEAFDDSAAACAVDDPPSQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 103 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 234 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 235 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 246 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 247 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 286 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 287 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 288 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 289 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 290 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 291 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 292 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 293 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 297 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 298 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 385 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 386 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 387 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 388 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 389 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 390 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 393 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 394 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 395 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 396 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 397 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 398 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 399 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 400 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 401 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 402 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 403 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 404 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 405 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 406 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 407 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 408 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 462 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 466 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 468 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 470 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 471 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 473 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 475 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 476 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 477 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 479 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 480 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 481 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 484 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 485 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 490 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 491 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 494 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 495 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 497 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 498 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 499 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 501 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 503 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 504 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 505 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 506 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 508 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 510 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 512 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 513 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 514 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 515 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 516 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 517 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 518 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 519 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 520 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 521 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 522 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 523 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 524 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 525 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 526 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 527 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 528 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 529 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 530 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 531 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 532 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 533 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 534 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 535 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 536 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 537 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 538 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 539 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 540 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 541 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 542 | 2904699407 | |||
| 543 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 544 | 2906610324 | |||
| 545 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 546 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 547 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 548 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 549 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 550 | 2922425934 | |||
| 551 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 552 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 553 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 554 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 555 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 556 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 557 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 558 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 559 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 560 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 561 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 562 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 563 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 564 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 565 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 566 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.65 |
| Metatranscriptomes | 0.24 |
| Isolates | 3.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8 |
| Nodule | 2.09 |
| Rhizoplane | 7.59 |
| Rhizosphere | 75.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10040946 | 3300010375 | Bacteria | 5078 |
| 2 | JGI24739J22299_10004386 | 3300001989 | Bacteria | 5402 |
| 3 | JGI24737J22298_10036272 | 3300001990 | Bacteria | 1523 |
| 4 | JGI24735J21928_10043583 | 3300002067 | Bacteria | 1305 |
| 5 | JGI24744J21845_10016883 | 3300002077 | Bacteria | 1452 |
| 6 | JGI25406J46586_10000123 | 3300003203 | Bacteria | 33753 |
| 7 | JGI25406J46586_10002008 | 3300003203 | Bacteria | 9613 |
| 8 | JGI25406J46586_10011288 | 3300003203 | Bacteria | 3925 |
| 9 | JGI25153J46596_10013220 | 3300003215 | Bacteria | 3505 |
| 10 | JGI25404J52841_10006783 | 3300003659 | Bacteria | 2403 |
| 11 | JGI25404J52841_10029708 | 3300003659 | Bacteria | 1172 |
| 12 | Ga0065165_1077181 | 3300005262 | Bacteria | 872 |
| 13 | Ga0070676_10160260 | 3300005328 | Bacteria | 1447 |
| 14 | Ga0070676_10469751 | 3300005328 | Bacteria | 888 |
| 15 | Ga0070683_100652076 | 3300005329 | Bacteria | 1008 |
| 16 | Ga0070690_100015033 | 3300005330 | Bacteria | 4606 |
| 17 | Ga0070690_100035314 | 3300005330 | Bacteria | 3136 |
| 18 | Ga0070690_100097902 | 3300005330 | Bacteria | 1941 |
| 19 | Ga0070690_100325104 | 3300005330 | Bacteria | 1109 |
| 20 | Ga0070670_100015459 | 3300005331 | Bacteria | 6555 |
| 21 | Ga0070670_100018725 | 3300005331 | Bacteria | 5936 |
| 22 | Ga0070670_100022211 | 3300005331 | Bacteria | 5461 |
| 23 | Ga0070670_100028912 | 3300005331 | Bacteria | 4771 |
| 24 | Ga0070677_10003744 | 3300005333 | Bacteria | 4918 |
| 25 | Ga0070666_10044995 | 3300005335 | Bacteria | 2959 |
| 26 | Ga0070666_10066295 | 3300005335 | Bacteria | 2450 |
| 27 | Ga0070666_10148576 | 3300005335 | Bacteria | 1634 |
| 28 | Ga0070680_100173606 | 3300005336 | Bacteria | 1814 |
| 29 | Ga0070680_100264188 | 3300005336 | Bacteria | 1456 |
| 30 | Ga0070680_100287855 | 3300005336 | Bacteria | 1392 |
| 31 | Ga0068868_100015983 | 3300005338 | Bacteria | 5565 |
| 32 | Ga0068868_100040355 | 3300005338 | Bacteria | 3633 |
| 33 | Ga0068868_100080496 | 3300005338 | Bacteria | 2611 |
| 34 | Ga0068868_100509881 | 3300005338 | Bacteria | 1055 |
| 35 | Ga0070660_100112612 | 3300005339 | Bacteria | 2166 |
| 36 | Ga0070660_100166316 | 3300005339 | Bacteria | 1779 |
| 37 | Ga0070689_100003230 | 3300005340 | Bacteria | 10805 |
| 38 | Ga0070689_100012114 | 3300005340 | Bacteria | 6201 |
| 39 | Ga0070689_100013407 | 3300005340 | Bacteria | 5930 |
| 40 | Ga0070689_100017936 | 3300005340 | Bacteria | 5204 |
| 41 | Ga0070691_10030581 | 3300005341 | Bacteria | 2522 |
| 42 | Ga0070687_100005935 | 3300005343 | Bacteria | 4968 |
| 43 | Ga0070687_100183708 | 3300005343 | Bacteria | 1254 |
| 44 | Ga0070661_100076325 | 3300005344 | Bacteria | 2470 |
| 45 | Ga0070661_100229369 | 3300005344 | Bacteria | 1427 |
| 46 | Ga0070661_100259604 | 3300005344 | Bacteria | 1343 |
| 47 | Ga0070661_100339875 | 3300005344 | Bacteria | 1176 |
| 48 | Ga0070668_100155491 | 3300005347 | Bacteria | 1852 |
| 49 | Ga0070668_100277548 | 3300005347 | Bacteria | 1398 |
| 50 | Ga0070669_100203534 | 3300005353 | Bacteria | 1559 |
| 51 | Ga0070669_100258011 | 3300005353 | Bacteria | 1390 |
| 52 | Ga0070675_100013324 | 3300005354 | Bacteria | 6460 |
| 53 | Ga0070675_100049538 | 3300005354 | Bacteria | 3448 |
| 54 | Ga0070675_100267317 | 3300005354 | Bacteria | 1500 |
| 55 | Ga0070675_100373682 | 3300005354 | Bacteria | 1268 |
| 56 | Ga0070675_100405536 | 3300005354 | Bacteria | 1217 |
| 57 | Ga0070671_100001610 | 3300005355 | Bacteria | 17014 |
| 58 | Ga0070671_100007034 | 3300005355 | Bacteria | 9013 |
| 59 | Ga0070671_100457826 | 3300005355 | Bacteria | 1095 |
| 60 | Ga0070674_100002026 | 3300005356 | Bacteria | 11109 |
| 61 | Ga0070674_100053105 | 3300005356 | Bacteria | 2796 |
| 62 | Ga0070674_100056484 | 3300005356 | Bacteria | 2722 |
| 63 | Ga0070674_100212106 | 3300005356 | Bacteria | 1501 |
| 64 | Ga0070673_100037233 | 3300005364 | Bacteria | 3705 |
| 65 | Ga0070673_100046009 | 3300005364 | Bacteria | 3387 |
| 66 | Ga0070673_100184639 | 3300005364 | Bacteria | 1787 |
| 67 | Ga0070673_100386636 | 3300005364 | Bacteria | 1248 |
| 68 | Ga0070688_100005393 | 3300005365 | Bacteria | 6730 |
| 69 | Ga0070688_100018452 | 3300005365 | Bacteria | 4025 |
| 70 | Ga0070688_100079337 | 3300005365 | Bacteria | 2120 |
| 71 | Ga0070688_100120457 | 3300005365 | Bacteria | 1757 |
| 72 | Ga0070659_100256257 | 3300005366 | Bacteria | 1451 |
| 73 | Ga0070659_100269598 | 3300005366 | Bacteria | 1414 |
| 74 | Ga0070667_100130204 | 3300005367 | Bacteria | 2195 |
| 75 | Ga0070667_100222310 | 3300005367 | Bacteria | 1681 |
| 76 | Ga0070667_100318711 | 3300005367 | Bacteria | 1403 |
| 77 | Ga0070709_10003714 | 3300005434 | Bacteria | 8201 |
| 78 | Ga0070709_10010860 | 3300005434 | Bacteria | 5056 |
| 79 | Ga0070709_10016287 | 3300005434 | Bacteria | 4242 |
| 80 | Ga0070709_10035409 | 3300005434 | Bacteria | 3033 |
| 81 | Ga0070709_10365416 | 3300005434 | Bacteria | 1069 |
| 82 | Ga0070709_10385356 | 3300005434 | Bacteria | 1043 |
| 83 | Ga0070709_10446297 | 3300005434 | Bacteria | 974 |
| 84 | Ga0070714_100004426 | 3300005435 | Bacteria | 10573 |
| 85 | Ga0070714_100019687 | 3300005435 | Bacteria | 5502 |
| 86 | Ga0070714_100110011 | 3300005435 | Bacteria | 2439 |
| 87 | Ga0070714_100134438 | 3300005435 | Bacteria | 2213 |
| 88 | Ga0070714_100192220 | 3300005435 | Bacteria | 1863 |
| 89 | Ga0070714_100361523 | 3300005435 | Bacteria | 1365 |
| 90 | Ga0070714_100431304 | 3300005435 | Bacteria | 1250 |
| 91 | Ga0070714_100486162 | 3300005435 | Bacteria | 1176 |
| 92 | Ga0070713_100004454 | 3300005436 | Bacteria | 9411 |
| 93 | Ga0070713_100037805 | 3300005436 | Bacteria | 3905 |
| 94 | Ga0070713_100069892 | 3300005436 | Bacteria | 2962 |
| 95 | Ga0070713_100090424 | 3300005436 | Bacteria | 2631 |
| 96 | Ga0070713_100421166 | 3300005436 | Bacteria | 1250 |
| 97 | Ga0070713_100541114 | 3300005436 | Bacteria | 1102 |
| 98 | Ga0070713_100681252 | 3300005436 | Bacteria | 981 |
| 99 | Ga0070710_10004296 | 3300005437 | Bacteria | 6755 |
| 100 | Ga0070710_10007859 | 3300005437 | Bacteria | 5178 |
| 101 | Ga0070710_10101370 | 3300005437 | Bacteria | 1715 |
| 102 | Ga0070701_10009849 | 3300005438 | Bacteria | 4202 |
| 103 | Ga0070711_100013653 | 3300005439 | Bacteria | 5104 |
| 104 | Ga0070711_100079146 | 3300005439 | Bacteria | 2337 |
| 105 | Ga0070711_100081895 | 3300005439 | Bacteria | 2302 |
| 106 | Ga0070711_100209201 | 3300005439 | Bacteria | 1510 |
| 107 | Ga0070711_100623380 | 3300005439 | Bacteria | 902 |
| 108 | Ga0070711_100648559 | 3300005439 | Bacteria | 885 |
| 109 | Ga0070700_100008437 | 3300005441 | Bacteria | 5609 |
| 110 | Ga0070700_100065836 | 3300005441 | Bacteria | 2299 |
| 111 | Ga0070700_100368336 | 3300005441 | Bacteria | 1071 |
| 112 | Ga0070663_100050622 | 3300005455 | Bacteria | 2955 |
| 113 | Ga0070663_100078596 | 3300005455 | Bacteria | 2419 |
| 114 | Ga0070663_100084289 | 3300005455 | Bacteria | 2342 |
| 115 | Ga0070663_100124267 | 3300005455 | Bacteria | 1953 |
| 116 | Ga0070678_100043308 | 3300005456 | Bacteria | 3205 |
| 117 | Ga0070678_100172924 | 3300005456 | Bacteria | 1761 |
| 118 | Ga0070678_100196307 | 3300005456 | Bacteria | 1663 |
| 119 | Ga0070678_100816699 | 3300005456 | Bacteria | 847 |
| 120 | Ga0070662_100161339 | 3300005457 | Bacteria | 1754 |
| 121 | Ga0070681_10008600 | 3300005458 | Bacteria | 10006 |
| 122 | Ga0070681_10056463 | 3300005458 | Bacteria | 3907 |
| 123 | Ga0070681_10073742 | 3300005458 | Bacteria | 3375 |
| 124 | Ga0070681_10093747 | 3300005458 | Bacteria | 2951 |
| 125 | Ga0070681_10130798 | 3300005458 | Bacteria | 2442 |
| 126 | Ga0070681_10449461 | 3300005458 | Bacteria | 1201 |
| 127 | Ga0068867_100027107 | 3300005459 | Bacteria | 4116 |
| 128 | Ga0068867_100398096 | 3300005459 | Bacteria | 1161 |
| 129 | Ga0070685_10013633 | 3300005466 | Bacteria | 4291 |
| 130 | Ga0070698_100495937 | 3300005471 | Bacteria | 1159 |
| 131 | Ga0070698_100671425 | 3300005471 | Bacteria | 978 |
| 132 | Ga0070699_100004951 | 3300005518 | Bacteria | 11749 |
| 133 | Ga0070679_100008568 | 3300005530 | Bacteria | 9635 |
| 134 | Ga0070679_100012111 | 3300005530 | Bacteria | 8239 |
| 135 | Ga0070679_100075408 | 3300005530 | Bacteria | 3362 |
| 136 | Ga0070679_100119920 | 3300005530 | Bacteria | 2615 |
| 137 | Ga0070679_100422188 | 3300005530 | Bacteria | 1279 |
| 138 | Ga0070684_100027940 | 3300005535 | Bacteria | 4768 |
| 139 | Ga0070684_100148121 | 3300005535 | Bacteria | 2125 |
| 140 | Ga0070684_100212676 | 3300005535 | Bacteria | 1762 |
| 141 | Ga0070697_100026984 | 3300005536 | Bacteria | 4593 |
| 142 | Ga0070697_100460557 | 3300005536 | Bacteria | 1108 |
| 143 | Ga0068853_100026288 | 3300005539 | Bacteria | 4887 |
| 144 | Ga0068853_100049178 | 3300005539 | Bacteria | 3623 |
| 145 | Ga0068853_100075350 | 3300005539 | Bacteria | 2944 |
| 146 | Ga0068853_100089098 | 3300005539 | Bacteria | 2710 |
| 147 | Ga0068853_100223183 | 3300005539 | Bacteria | 1722 |
| 148 | Ga0068853_100427623 | 3300005539 | Bacteria | 1243 |
| 149 | Ga0070672_100035470 | 3300005543 | Bacteria | 3792 |
| 150 | Ga0070672_100128515 | 3300005543 | Bacteria | 2081 |
| 151 | Ga0070672_100229123 | 3300005543 | Bacteria | 1560 |
| 152 | Ga0070686_100018490 | 3300005544 | Bacteria | 4091 |
| 153 | Ga0070696_100290547 | 3300005546 | Bacteria | 1249 |
| 154 | Ga0070693_100019524 | 3300005547 | Bacteria | 3555 |
| 155 | Ga0070693_100050777 | 3300005547 | Bacteria | 2372 |
| 156 | Ga0070693_100363524 | 3300005547 | Bacteria | 994 |
| 157 | Ga0070665_100100848 | 3300005548 | Bacteria | 2891 |
| 158 | Ga0070665_100133374 | 3300005548 | Bacteria | 2485 |
| 159 | Ga0070665_100255887 | 3300005548 | Bacteria | 1752 |
| 160 | Ga0070665_100419582 | 3300005548 | Bacteria | 1347 |
| 161 | Ga0070704_100055201 | 3300005549 | Bacteria | 2815 |
| 162 | Ga0070704_100061113 | 3300005549 | Bacteria | 2695 |
| 163 | Ga0068855_100125468 | 3300005563 | Bacteria | 2935 |
| 164 | Ga0068855_100136451 | 3300005563 | Bacteria | 2799 |
| 165 | Ga0068855_100148989 | 3300005563 | Bacteria | 2661 |
| 166 | Ga0068855_100187013 | 3300005563 | Bacteria | 2339 |
| 167 | Ga0068855_100400596 | 3300005563 | Bacteria | 1504 |
| 168 | Ga0068855_100442924 | 3300005563 | Bacteria | 1418 |
| 169 | Ga0068855_100866528 | 3300005563 | Bacteria | 956 |
| 170 | Ga0070664_100221821 | 3300005564 | Bacteria | 1692 |
| 171 | Ga0070664_100311239 | 3300005564 | Bacteria | 1425 |
| 172 | Ga0068857_100123071 | 3300005577 | Bacteria | 2337 |
| 173 | Ga0068857_100316031 | 3300005577 | Bacteria | 1442 |
| 174 | Ga0068854_100008298 | 3300005578 | Bacteria | 6670 |
| 175 | Ga0068854_100017829 | 3300005578 | Bacteria | 4758 |
| 176 | Ga0068854_100175095 | 3300005578 | Bacteria | 1672 |
| 177 | Ga0068856_100006410 | 3300005614 | Bacteria | 11545 |
| 178 | Ga0068856_100019463 | 3300005614 | Bacteria | 6589 |
| 179 | Ga0068856_100077437 | 3300005614 | Bacteria | 3295 |
| 180 | Ga0068856_100097345 | 3300005614 | Bacteria | 2931 |
| 181 | Ga0068856_100492401 | 3300005614 | Bacteria | 1247 |
| 182 | Ga0070702_100026608 | 3300005615 | Bacteria | 3110 |
| 183 | Ga0068852_100016237 | 3300005616 | Bacteria | 5800 |
| 184 | Ga0068852_100108085 | 3300005616 | Bacteria | 2524 |
| 185 | Ga0068852_100260370 | 3300005616 | Bacteria | 1665 |
| 186 | Ga0068852_100708737 | 3300005616 | Bacteria | 1017 |
| 187 | Ga0068859_100046809 | 3300005617 | Bacteria | 4343 |
| 188 | Ga0068859_100178426 | 3300005617 | Bacteria | 2206 |
| 189 | Ga0068859_100316000 | 3300005617 | Bacteria | 1656 |
| 190 | Ga0068859_100401058 | 3300005617 | Bacteria | 1467 |
| 191 | Ga0068859_100591992 | 3300005617 | Bacteria | 1202 |
| 192 | Ga0068859_100757730 | 3300005617 | Bacteria | 1060 |
| 193 | Ga0068864_100030864 | 3300005618 | Bacteria | 4544 |
| 194 | Ga0068864_100193359 | 3300005618 | Bacteria | 1866 |
| 195 | Ga0068864_100378621 | 3300005618 | Bacteria | 1341 |
| 196 | Ga0068866_10155194 | 3300005718 | Bacteria | 1330 |
| 197 | Ga0068866_10187795 | 3300005718 | Bacteria | 1226 |
| 198 | Ga0068861_100038870 | 3300005719 | Bacteria | 3548 |
| 199 | Ga0068861_100621031 | 3300005719 | Bacteria | 994 |
| 200 | Ga0068861_100741690 | 3300005719 | Bacteria | 916 |
| 201 | Ga0068861_100866072 | 3300005719 | Bacteria | 853 |
| 202 | Ga0068851_10003850 | 3300005834 | Bacteria | 6714 |
| 203 | Ga0068851_10042924 | 3300005834 | Bacteria | 2278 |
| 204 | Ga0068870_10002916 | 3300005840 | Bacteria | 7205 |
| 205 | Ga0068870_10120381 | 3300005840 | Bacteria | 1511 |
| 206 | Ga0068863_100025497 | 3300005841 | Bacteria | 5637 |
| 207 | Ga0068858_100074670 | 3300005842 | Bacteria | 3148 |
| 208 | Ga0068858_100088274 | 3300005842 | Bacteria | 2885 |
| 209 | Ga0068860_100003385 | 3300005843 | Bacteria | 16406 |
| 210 | Ga0068860_100734013 | 3300005843 | Bacteria | 999 |
| 211 | Ga0068862_100026407 | 3300005844 | Bacteria | 4880 |
| 212 | Ga0081455_10029463 | 3300005937 | Bacteria | 5005 |
| 213 | Ga0081455_10050468 | 3300005937 | Bacteria | 3578 |
| 214 | Ga0081455_10069468 | 3300005937 | Bacteria | 2929 |
| 215 | Ga0081455_10086007 | 3300005937 | Bacteria | 2562 |
| 216 | Ga0081455_10089463 | 3300005937 | Bacteria | 2498 |
| 217 | Ga0081455_10188683 | 3300005937 | Bacteria | 1555 |
| 218 | Ga0081455_10298241 | 3300005937 | Bacteria | 1158 |
| 219 | Ga0081538_10009993 | 3300005981 | Bacteria | 7826 |
| 220 | Ga0081538_10021985 | 3300005981 | Bacteria | 4635 |
| 221 | Ga0081538_10151176 | 3300005981 | Bacteria | 1051 |
| 222 | Ga0081538_10179447 | 3300005981 | Bacteria | 909 |
| 223 | Ga0081540_1000297 | 3300005983 | Bacteria | 51592 |
| 224 | Ga0081540_1005566 | 3300005983 | Bacteria | 9382 |
| 225 | Ga0081540_1005578 | 3300005983 | Bacteria | 9373 |
| 226 | Ga0081540_1005635 | 3300005983 | Bacteria | 9325 |
| 227 | Ga0081540_1005788 | 3300005983 | Bacteria | 9148 |
| 228 | Ga0081540_1010271 | 3300005983 | Bacteria | 6356 |
| 229 | Ga0081540_1012941 | 3300005983 | Bacteria | 5452 |
| 230 | Ga0081540_1026519 | 3300005983 | Bacteria | 3306 |
| 231 | Ga0081540_1031359 | 3300005983 | Bacteria | 2924 |
| 232 | Ga0081540_1046748 | 3300005983 | Bacteria | 2182 |
| 233 | Ga0081540_1054487 | 3300005983 | Bacteria | 1954 |
| 234 | Ga0081540_1062738 | 3300005983 | Bacteria | 1763 |
| 235 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 236 | Ga0081539_10001098 | 3300005985 | Bacteria | 49182 |
| 237 | Ga0081539_10010784 | 3300005985 | Bacteria | 7355 |
| 238 | Ga0081539_10033511 | 3300005985 | Bacteria | 3125 |
| 239 | Ga0081539_10048626 | 3300005985 | Bacteria | 2411 |
| 240 | Ga0070717_10000959 | 3300006028 | Bacteria | 19227 |
| 241 | Ga0070717_10032149 | 3300006028 | Bacteria | 4226 |
| 242 | Ga0070717_10066690 | 3300006028 | Bacteria | 2994 |
| 243 | Ga0070717_10126720 | 3300006028 | Bacteria | 2192 |
| 244 | Ga0070717_10196019 | 3300006028 | Bacteria | 1767 |
| 245 | Ga0070717_10203536 | 3300006028 | Bacteria | 1735 |
| 246 | Ga0070717_10252148 | 3300006028 | Bacteria | 1559 |
| 247 | Ga0070717_10261306 | 3300006028 | Bacteria | 1532 |
| 248 | Ga0075365_10001973 | 3300006038 | Bacteria | 9695 |
| 249 | Ga0075365_10002915 | 3300006038 | Bacteria | 8635 |
| 250 | Ga0075365_10029444 | 3300006038 | Bacteria | 3510 |
| 251 | Ga0075365_10066978 | 3300006038 | Bacteria | 2410 |
| 252 | Ga0075365_10074576 | 3300006038 | Bacteria | 2288 |
| 253 | Ga0075365_10094709 | 3300006038 | Bacteria | 2038 |
| 254 | Ga0075368_10013948 | 3300006042 | Bacteria | 2958 |
| 255 | Ga0075363_100004089 | 3300006048 | Bacteria | 6322 |
| 256 | Ga0075363_100040761 | 3300006048 | Bacteria | 2448 |
| 257 | Ga0075364_10071316 | 3300006051 | Bacteria | 2288 |
| 258 | Ga0075364_10130779 | 3300006051 | Bacteria | 1684 |
| 259 | Ga0075364_10275501 | 3300006051 | Bacteria | 1144 |
| 260 | Ga0070715_10002654 | 3300006163 | Bacteria | 5535 |
| 261 | Ga0070715_10023346 | 3300006163 | Bacteria | 2422 |
| 262 | Ga0070715_10088665 | 3300006163 | Bacteria | 1418 |
| 263 | Ga0070715_10203114 | 3300006163 | Bacteria | 1008 |
| 264 | Ga0070716_100002220 | 3300006173 | Bacteria | 8943 |
| 265 | Ga0070716_100040223 | 3300006173 | Bacteria | 2600 |
| 266 | Ga0070716_100058529 | 3300006173 | Bacteria | 2218 |
| 267 | Ga0070716_100096426 | 3300006173 | Bacteria | 1802 |
| 268 | Ga0070712_100163364 | 3300006175 | Bacteria | 1721 |
| 269 | Ga0070712_100200928 | 3300006175 | Bacteria | 1566 |
| 270 | Ga0075362_10037679 | 3300006177 | Bacteria | 2121 |
| 271 | Ga0075362_10182958 | 3300006177 | Bacteria | 1016 |
| 272 | Ga0075367_10019167 | 3300006178 | Bacteria | 3790 |
| 273 | Ga0075367_10031100 | 3300006178 | Bacteria | 3065 |
| 274 | Ga0075367_10033542 | 3300006178 | Bacteria | 2960 |
| 275 | Ga0075367_10082992 | 3300006178 | Bacteria | 1941 |
| 276 | Ga0075367_10098026 | 3300006178 | Bacteria | 1789 |
| 277 | Ga0075367_10222384 | 3300006178 | Bacteria | 1182 |
| 278 | Ga0075369_10005998 | 3300006186 | Bacteria | 4573 |
| 279 | Ga0075369_10045879 | 3300006186 | Bacteria | 1880 |
| 280 | Ga0075369_10052741 | 3300006186 | Bacteria | 1763 |
| 281 | Ga0075366_10001342 | 3300006195 | Bacteria | 12294 |
| 282 | Ga0075366_10084870 | 3300006195 | Bacteria | 1893 |
| 283 | Ga0097621_100023761 | 3300006237 | Bacteria | 4776 |
| 284 | Ga0097621_100276690 | 3300006237 | Bacteria | 1477 |
| 285 | Ga0075370_10009275 | 3300006353 | Bacteria | 5104 |
| 286 | Ga0075370_10019271 | 3300006353 | Bacteria | 3715 |
| 287 | Ga0075370_10102535 | 3300006353 | Bacteria | 1657 |
| 288 | Ga0075370_10140984 | 3300006353 | Bacteria | 1409 |
| 289 | Ga0068871_100071108 | 3300006358 | Bacteria | 2861 |
| 290 | Ga0075428_100014624 | 3300006844 | Bacteria | 8715 |
| 291 | Ga0075428_100158933 | 3300006844 | Bacteria | 2453 |
| 292 | Ga0075428_100364147 | 3300006844 | Bacteria | 1551 |
| 293 | Ga0075428_100367630 | 3300006844 | Bacteria | 1543 |
| 294 | Ga0075428_100421291 | 3300006844 | Bacteria | 1430 |
| 295 | Ga0075430_100000164 | 3300006846 | Bacteria | 43703 |
| 296 | Ga0075430_100184701 | 3300006846 | Bacteria | 1734 |
| 297 | Ga0075431_100033662 | 3300006847 | Bacteria | 5280 |
| 298 | Ga0075431_100073601 | 3300006847 | Bacteria | 3525 |
| 299 | Ga0075433_10246367 | 3300006852 | Bacteria | 1586 |
| 300 | Ga0075434_100013700 | 3300006871 | Bacteria | 7729 |
| 301 | Ga0075434_100233811 | 3300006871 | Bacteria | 1858 |
| 302 | Ga0075429_100190761 | 3300006880 | Bacteria | 1795 |
| 303 | Ga0075429_100336613 | 3300006880 | Bacteria | 1321 |
| 304 | Ga0068865_100019538 | 3300006881 | Bacteria | 4385 |
| 305 | Ga0068865_100712750 | 3300006881 | Bacteria | 858 |
| 306 | Ga0075436_100037967 | 3300006914 | Bacteria | 3325 |
| 307 | Ga0075436_100162870 | 3300006914 | Bacteria | 1573 |
| 308 | Ga0097620_100046812 | 3300006931 | Bacteria | 4343 |
| 309 | Ga0097620_100178423 | 3300006931 | Bacteria | 2206 |
| 310 | Ga0097620_100315980 | 3300006931 | Bacteria | 1656 |
| 311 | Ga0097620_100401085 | 3300006931 | Bacteria | 1467 |
| 312 | Ga0097620_100592027 | 3300006931 | Bacteria | 1202 |
| 313 | Ga0097620_100757757 | 3300006931 | Bacteria | 1060 |
| 314 | Ga0099824_1008875 | 3300006942 | Bacteria | 12635 |
| 315 | Ga0099822_1017500 | 3300006943 | Bacteria | 7646 |
| 316 | Ga0075435_100115860 | 3300007076 | Bacteria | 2231 |
| 317 | Ga0099794_10009521 | 3300007265 | Bacteria | 4090 |
| 318 | Ga0099794_10075640 | 3300007265 | Bacteria | 1655 |
| 319 | Ga0099795_10019465 | 3300007788 | Bacteria | 2198 |
| 320 | Ga0105240_10019788 | 3300009093 | Bacteria | 8990 |
| 321 | Ga0105240_10046064 | 3300009093 | Bacteria | 5528 |
| 322 | Ga0105240_10154772 | 3300009093 | Bacteria | 2728 |
| 323 | Ga0105240_10186062 | 3300009093 | Bacteria | 2446 |
| 324 | Ga0105240_10488420 | 3300009093 | Bacteria | 1371 |
| 325 | Ga0105240_10567384 | 3300009093 | Bacteria | 1254 |
| 326 | Ga0105245_10023790 | 3300009098 | Bacteria | 5378 |
| 327 | Ga0105245_10037769 | 3300009098 | Bacteria | 4294 |
| 328 | Ga0105245_10183787 | 3300009098 | Bacteria | 1999 |
| 329 | Ga0105247_10005771 | 3300009101 | Bacteria | 7752 |
| 330 | Ga0105247_10059249 | 3300009101 | Bacteria | 2370 |
| 331 | Ga0105247_10079666 | 3300009101 | Bacteria | 2062 |
| 332 | Ga0105247_10084624 | 3300009101 | Bacteria | 2004 |
| 333 | Ga0114129_10004595 | 3300009147 | Bacteria | 19485 |
| 334 | Ga0114129_10056443 | 3300009147 | Bacteria | 5500 |
| 335 | Ga0114129_10136649 | 3300009147 | Bacteria | 3363 |
| 336 | Ga0114129_10157307 | 3300009147 | Bacteria | 3107 |
| 337 | Ga0114129_10290517 | 3300009147 | Bacteria | 2182 |
| 338 | Ga0114129_10620096 | 3300009147 | Bacteria | 1399 |
| 339 | Ga0114129_10636286 | 3300009147 | Bacteria | 1378 |
| 340 | Ga0114129_10882658 | 3300009147 | Bacteria | 1134 |
| 341 | Ga0105243_10042458 | 3300009148 | Bacteria | 3560 |
| 342 | Ga0105243_10174079 | 3300009148 | Bacteria | 1867 |
| 343 | Ga0105241_10015112 | 3300009174 | Bacteria | 5655 |
| 344 | Ga0105241_10112672 | 3300009174 | Bacteria | 2180 |
| 345 | Ga0105241_10458000 | 3300009174 | Bacteria | 1129 |
| 346 | Ga0105242_10066376 | 3300009176 | Bacteria | 2979 |
| 347 | Ga0105242_10072541 | 3300009176 | Bacteria | 2860 |
| 348 | Ga0105248_10006264 | 3300009177 | Bacteria | 13045 |
| 349 | Ga0105248_10067991 | 3300009177 | Bacteria | 4000 |
| 350 | Ga0105248_10126024 | 3300009177 | Bacteria | 2889 |
| 351 | Ga0105248_10149282 | 3300009177 | Bacteria | 2637 |
| 352 | Ga0105237_10124757 | 3300009545 | Bacteria | 2569 |
| 353 | Ga0105237_10154163 | 3300009545 | Bacteria | 2294 |
| 354 | Ga0105237_10751541 | 3300009545 | Bacteria | 982 |
| 355 | Ga0105237_10838451 | 3300009545 | Bacteria | 926 |
| 356 | Ga0105238_10025742 | 3300009551 | Bacteria | 5999 |
| 357 | Ga0105238_10028483 | 3300009551 | Bacteria | 5691 |
| 358 | Ga0105238_10151170 | 3300009551 | Bacteria | 2297 |
| 359 | Ga0105238_10289693 | 3300009551 | Bacteria | 1619 |
| 360 | Ga0105249_10023825 | 3300009553 | Bacteria | 5498 |
| 361 | Ga0105249_10193252 | 3300009553 | Bacteria | 1987 |
| 362 | Ga0105249_10297898 | 3300009553 | Bacteria | 1616 |
| 363 | Ga0105249_10454875 | 3300009553 | Bacteria | 1319 |
| 364 | Ga0099796_10011096 | 3300010159 | Bacteria | 2502 |
| 365 | Ga0105239_10129115 | 3300010375 | Bacteria | 2810 |
| 366 | Ga0105239_10157911 | 3300010375 | Bacteria | 2533 |
| 367 | Ga0105239_10192059 | 3300010375 | Bacteria | 2285 |
| 368 | Ga0105246_10055196 | 3300011119 | Bacteria | 2741 |
| 369 | Ga0105246_10058684 | 3300011119 | Bacteria | 2667 |
| 370 | Ga0157370_10133092 | 3300013104 | Bacteria | 2319 |
| 371 | Ga0157369_10004497 | 3300013105 | Bacteria | 16430 |
| 372 | Ga0157369_10139055 | 3300013105 | Bacteria | 2570 |
| 373 | Ga0157369_10150184 | 3300013105 | Bacteria | 2462 |
| 374 | Ga0157374_10041399 | 3300013296 | Bacteria | 4245 |
| 375 | Ga0157378_10152330 | 3300013297 | Bacteria | 2155 |
| 376 | Ga0163162_10009179 | 3300013306 | Bacteria | 9624 |
| 377 | Ga0163162_10053414 | 3300013306 | Bacteria | 4061 |
| 378 | Ga0163162_10069682 | 3300013306 | Bacteria | 3569 |
| 379 | Ga0163162_10353438 | 3300013306 | Bacteria | 1602 |
| 380 | Ga0157372_10101997 | 3300013307 | Bacteria | 3277 |
| 381 | Ga0157375_10196062 | 3300013308 | Bacteria | 2175 |
| 382 | Ga0163163_10010079 | 3300014325 | Bacteria | 8477 |
| 383 | Ga0163163_10033404 | 3300014325 | Bacteria | 4976 |
| 384 | Ga0163163_10097355 | 3300014325 | Bacteria | 2962 |
| 385 | Ga0163163_10120027 | 3300014325 | Bacteria | 2662 |
| 386 | Ga0163163_10176189 | 3300014325 | Bacteria | 2185 |
| 387 | Ga0163163_10206104 | 3300014325 | Bacteria | 2015 |
| 388 | Ga0157380_10118996 | 3300014326 | Bacteria | 2234 |
| 389 | Ga0157380_10328269 | 3300014326 | Bacteria | 1422 |
| 390 | Ga0157380_10588329 | 3300014326 | Bacteria | 1099 |
| 391 | Ga0157377_10359615 | 3300014745 | Bacteria | 979 |
| 392 | Ga0157379_10041001 | 3300014968 | Bacteria | 4133 |
| 393 | Ga0157379_10050265 | 3300014968 | Bacteria | 3721 |
| 394 | Ga0157379_10369775 | 3300014968 | Bacteria | 1314 |
| 395 | Ga0157376_10190593 | 3300014969 | Bacteria | 1880 |
| 396 | Ga0206356_10905645 | 3300020070 | Bacteria | 1124 |
| 397 | Ga0206353_10627821 | 3300020082 | Bacteria | 1922 |
| 398 | Ga0213874_10047226 | 3300021377 | Bacteria | 1309 |
| 399 | Ga0213876_10014482 | 3300021384 | Bacteria | 4177 |
| 400 | Ga0213876_10097578 | 3300021384 | Bacteria | 1557 |
| 401 | Ga0213876_10103081 | 3300021384 | Bacteria | 1513 |
| 402 | Ga0213876_10230774 | 3300021384 | Bacteria | 984 |
| 403 | Ga0213875_10000046 | 3300021388 | Bacteria | 149850 |
| 404 | Ga0213875_10070888 | 3300021388 | Bacteria | 1627 |
| 405 | Ga0213871_10013420 | 3300021441 | Bacteria | 1924 |
| 406 | Ga0209677_100501 | 3300025253 | Bacteria | 22041 |
| 407 | Ga0209148_1000707 | 3300025254 | Bacteria | 26803 |
| 408 | Ga0209233_1009216 | 3300025261 | Bacteria | 3014 |
| 409 | Ga0209233_1013279 | 3300025261 | Bacteria | 2355 |
| 410 | Ga0209455_1005738 | 3300025272 | Bacteria | 3779 |
| 411 | Ga0209564_1000503 | 3300025295 | Bacteria | 64437 |
| 412 | Ga0209564_1007349 | 3300025295 | Bacteria | 5706 |
| 413 | Ga0209758_1001932 | 3300025297 | Bacteria | 22507 |
| 414 | Ga0209758_1006390 | 3300025297 | Bacteria | 8493 |
| 415 | Ga0207656_10047520 | 3300025321 | Bacteria | 1845 |
| 416 | Ga0207656_10137044 | 3300025321 | Bacteria | 1151 |
| 417 | Ga0207682_10000375 | 3300025893 | Bacteria | 20659 |
| 418 | Ga0207682_10060269 | 3300025893 | Bacteria | 1587 |
| 419 | Ga0207682_10141055 | 3300025893 | Bacteria | 1081 |
| 420 | Ga0207692_10001396 | 3300025898 | Bacteria | 9039 |
| 421 | Ga0207692_10007186 | 3300025898 | Bacteria | 4550 |
| 422 | Ga0207692_10008471 | 3300025898 | Bacteria | 4253 |
| 423 | Ga0207692_10030924 | 3300025898 | Bacteria | 2559 |
| 424 | Ga0207692_10096913 | 3300025898 | Bacteria | 1611 |
| 425 | Ga0207642_10024442 | 3300025899 | Bacteria | 2428 |
| 426 | Ga0207710_10028188 | 3300025900 | Bacteria | 2437 |
| 427 | Ga0207710_10076141 | 3300025900 | Bacteria | 1548 |
| 428 | Ga0207710_10277226 | 3300025900 | Bacteria | 843 |
| 429 | Ga0207688_10000839 | 3300025901 | Bacteria | 15435 |
| 430 | Ga0207680_10021253 | 3300025903 | Bacteria | 3509 |
| 431 | Ga0207680_10121229 | 3300025903 | Bacteria | 1710 |
| 432 | Ga0207647_10009009 | 3300025904 | Bacteria | 7112 |
| 433 | Ga0207685_10072336 | 3300025905 | Bacteria | 1401 |
| 434 | Ga0207685_10081022 | 3300025905 | Bacteria | 1343 |
| 435 | Ga0207685_10152194 | 3300025905 | Bacteria | 1048 |
| 436 | Ga0207699_10003881 | 3300025906 | Bacteria | 7143 |
| 437 | Ga0207699_10008131 | 3300025906 | Bacteria | 5162 |
| 438 | Ga0207699_10028722 | 3300025906 | Bacteria | 3094 |
| 439 | Ga0207699_10179507 | 3300025906 | Bacteria | 1422 |
| 440 | Ga0207645_10036084 | 3300025907 | Bacteria | 3174 |
| 441 | Ga0207645_10118776 | 3300025907 | Bacteria | 1715 |
| 442 | Ga0207645_10190813 | 3300025907 | Bacteria | 1346 |
| 443 | Ga0207643_10001734 | 3300025908 | Bacteria | 12227 |
| 444 | Ga0207643_10027690 | 3300025908 | Bacteria | 3144 |
| 445 | Ga0207705_10164151 | 3300025909 | Bacteria | 1670 |
| 446 | Ga0207684_10488553 | 3300025910 | Bacteria | 1056 |
| 447 | Ga0207654_10034713 | 3300025911 | Bacteria | 2804 |
| 448 | Ga0207654_10077069 | 3300025911 | Bacteria | 1997 |
| 449 | Ga0207707_10012323 | 3300025912 | Bacteria | 7431 |
| 450 | Ga0207707_10203347 | 3300025912 | Bacteria | 1727 |
| 451 | Ga0207695_10010535 | 3300025913 | Bacteria | 11305 |
| 452 | Ga0207695_10034396 | 3300025913 | Bacteria | 5512 |
| 453 | Ga0207695_10268122 | 3300025913 | Bacteria | 1604 |
| 454 | Ga0207671_10036138 | 3300025914 | Bacteria | 3662 |
| 455 | Ga0207671_10081896 | 3300025914 | Bacteria | 2421 |
| 456 | Ga0207671_10213050 | 3300025914 | Bacteria | 1512 |
| 457 | Ga0207693_10002986 | 3300025915 | Bacteria | 14649 |
| 458 | Ga0207693_10003096 | 3300025915 | Bacteria | 14328 |
| 459 | Ga0207693_10076294 | 3300025915 | Bacteria | 2625 |
| 460 | Ga0207693_10099279 | 3300025915 | Bacteria | 2283 |
| 461 | Ga0207693_10137592 | 3300025915 | Bacteria | 1920 |
| 462 | Ga0207693_10184986 | 3300025915 | Bacteria | 1640 |
| 463 | Ga0207693_10190349 | 3300025915 | Bacteria | 1615 |
| 464 | Ga0207663_10001112 | 3300025916 | Bacteria | 12359 |
| 465 | Ga0207663_10006227 | 3300025916 | Bacteria | 6087 |
| 466 | Ga0207663_10053350 | 3300025916 | Bacteria | 2525 |
| 467 | Ga0207663_10081982 | 3300025916 | Bacteria | 2114 |
| 468 | Ga0207663_10096743 | 3300025916 | Bacteria | 1973 |
| 469 | Ga0207663_10123988 | 3300025916 | Bacteria | 1774 |
| 470 | Ga0207660_10047951 | 3300025917 | Bacteria | 3022 |
| 471 | Ga0207660_10125890 | 3300025917 | Bacteria | 1946 |
| 472 | Ga0207660_10208695 | 3300025917 | Bacteria | 1528 |
| 473 | Ga0207660_10577084 | 3300025917 | Bacteria | 915 |
| 474 | Ga0207660_10664856 | 3300025917 | Bacteria | 849 |
| 475 | Ga0207662_10005503 | 3300025918 | Bacteria | 6762 |
| 476 | Ga0207649_10070657 | 3300025920 | Bacteria | 2227 |
| 477 | Ga0207649_10221624 | 3300025920 | Bacteria | 1347 |
| 478 | Ga0207649_10458083 | 3300025920 | Bacteria | 964 |
| 479 | Ga0207652_10080298 | 3300025921 | Bacteria | 2851 |
| 480 | Ga0207652_10214316 | 3300025921 | Bacteria | 1734 |
| 481 | Ga0207681_10057307 | 3300025923 | Bacteria | 2662 |
| 482 | Ga0207694_10001415 | 3300025924 | Bacteria | 20567 |
| 483 | Ga0207694_10150520 | 3300025924 | Bacteria | 1874 |
| 484 | Ga0207694_10225647 | 3300025924 | Bacteria | 1529 |
| 485 | Ga0207694_10250582 | 3300025924 | Bacteria | 1449 |
| 486 | Ga0207694_10340932 | 3300025924 | Bacteria | 1239 |
| 487 | Ga0207650_10004899 | 3300025925 | Bacteria | 9136 |
| 488 | Ga0207650_10010889 | 3300025925 | Bacteria | 6250 |
| 489 | Ga0207650_10114790 | 3300025925 | Bacteria | 2089 |
| 490 | Ga0207650_10243427 | 3300025925 | Bacteria | 1454 |
| 491 | Ga0207659_10027231 | 3300025926 | Bacteria | 3867 |
| 492 | Ga0207687_10082377 | 3300025927 | Bacteria | 2328 |
| 493 | Ga0207687_10121567 | 3300025927 | Bacteria | 1954 |
| 494 | Ga0207700_10001919 | 3300025928 | Bacteria | 11831 |
| 495 | Ga0207700_10045351 | 3300025928 | Bacteria | 3243 |
| 496 | Ga0207700_10069647 | 3300025928 | Bacteria | 2701 |
| 497 | Ga0207700_10078221 | 3300025928 | Bacteria | 2572 |
| 498 | Ga0207700_10138152 | 3300025928 | Bacteria | 1999 |
| 499 | Ga0207700_10145765 | 3300025928 | Bacteria | 1951 |
| 500 | Ga0207700_10530218 | 3300025928 | Bacteria | 1044 |
| 501 | Ga0207664_10004154 | 3300025929 | Bacteria | 9774 |
| 502 | Ga0207664_10104244 | 3300025929 | Bacteria | 2348 |
| 503 | Ga0207664_10190664 | 3300025929 | Bacteria | 1764 |
| 504 | Ga0207664_10214542 | 3300025929 | Bacteria | 1667 |
| 505 | Ga0207664_10475437 | 3300025929 | Bacteria | 1117 |
| 506 | Ga0207644_10034357 | 3300025931 | Bacteria | 3547 |
| 507 | Ga0207644_10111136 | 3300025931 | Bacteria | 2072 |
| 508 | Ga0207644_10413194 | 3300025931 | Bacteria | 1104 |
| 509 | Ga0207644_10425936 | 3300025931 | Bacteria | 1088 |
| 510 | Ga0207690_10017134 | 3300025932 | Bacteria | 4419 |
| 511 | Ga0207690_10349275 | 3300025932 | Bacteria | 1169 |
| 512 | Ga0207690_10421288 | 3300025932 | Bacteria | 1068 |
| 513 | Ga0207706_10006114 | 3300025933 | Bacteria | 11182 |
| 514 | Ga0207706_10032501 | 3300025933 | Bacteria | 4646 |
| 515 | Ga0207706_10037090 | 3300025933 | Bacteria | 4329 |
| 516 | Ga0207706_10096017 | 3300025933 | Bacteria | 2607 |
| 517 | Ga0207706_10339310 | 3300025933 | Bacteria | 1307 |
| 518 | Ga0207686_10093767 | 3300025934 | Bacteria | 1989 |
| 519 | Ga0207686_10299875 | 3300025934 | Bacteria | 1193 |
| 520 | Ga0207709_10039181 | 3300025935 | Bacteria | 2829 |
| 521 | Ga0207670_10007476 | 3300025936 | Bacteria | 6097 |
| 522 | Ga0207670_10142767 | 3300025936 | Bacteria | 1767 |
| 523 | Ga0207670_10498351 | 3300025936 | Bacteria | 988 |
| 524 | Ga0207670_10544921 | 3300025936 | Bacteria | 947 |
| 525 | Ga0207669_10012254 | 3300025937 | Bacteria | 4211 |
| 526 | Ga0207669_10026286 | 3300025937 | Bacteria | 3163 |
| 527 | Ga0207669_10075737 | 3300025937 | Bacteria | 2133 |
| 528 | Ga0207669_10121807 | 3300025937 | Bacteria | 1772 |
| 529 | Ga0207669_10272921 | 3300025937 | Bacteria | 1271 |
| 530 | Ga0207669_10300207 | 3300025937 | Bacteria | 1220 |
| 531 | Ga0207704_10015064 | 3300025938 | Bacteria | 3928 |
| 532 | Ga0207704_10267289 | 3300025938 | Bacteria | 1293 |
| 533 | Ga0207665_10000703 | 3300025939 | Bacteria | 22673 |
| 534 | Ga0207665_10009821 | 3300025939 | Bacteria | 6284 |
| 535 | Ga0207665_10065574 | 3300025939 | Bacteria | 2469 |
| 536 | Ga0207665_10136069 | 3300025939 | Bacteria | 1748 |
| 537 | Ga0207665_10210676 | 3300025939 | Bacteria | 1419 |
| 538 | Ga0207665_10442697 | 3300025939 | Bacteria | 996 |
| 539 | Ga0207691_10006906 | 3300025940 | Bacteria | 10950 |
| 540 | Ga0207691_10021094 | 3300025940 | Bacteria | 6155 |
| 541 | Ga0207691_10121514 | 3300025940 | Bacteria | 2314 |
| 542 | Ga0207711_10044345 | 3300025941 | Bacteria | 3796 |
| 543 | Ga0207711_10054787 | 3300025941 | Bacteria | 3423 |
| 544 | Ga0207711_10344799 | 3300025941 | Bacteria | 1379 |
| 545 | Ga0207689_10038013 | 3300025942 | Bacteria | 3988 |
| 546 | Ga0207661_10000171 | 3300025944 | Bacteria | 41708 |
| 547 | Ga0207661_10068266 | 3300025944 | Bacteria | 2894 |
| 548 | Ga0207661_10243036 | 3300025944 | Bacteria | 1598 |
| 549 | Ga0207661_10401476 | 3300025944 | Bacteria | 1243 |
| 550 | Ga0207661_10509489 | 3300025944 | Bacteria | 1100 |
| 551 | Ga0207661_10539116 | 3300025944 | Bacteria | 1068 |
| 552 | Ga0207679_10131412 | 3300025945 | Bacteria | 2009 |
| 553 | Ga0207679_10258225 | 3300025945 | Bacteria | 1485 |
| 554 | Ga0207667_10011741 | 3300025949 | Bacteria | 10158 |
| 555 | Ga0207667_10081060 | 3300025949 | Bacteria | 3362 |
| 556 | Ga0207667_10108767 | 3300025949 | Bacteria | 2859 |
| 557 | Ga0207667_10179288 | 3300025949 | Bacteria | 2176 |
| 558 | Ga0207667_10194588 | 3300025949 | Bacteria | 2080 |
| 559 | Ga0207651_10033989 | 3300025960 | Bacteria | 3296 |
| 560 | Ga0207651_10166959 | 3300025960 | Bacteria | 1732 |
| 561 | Ga0207651_10587453 | 3300025960 | Bacteria | 972 |
| 562 | Ga0207712_10011151 | 3300025961 | Bacteria | 5723 |
| 563 | Ga0207712_10082474 | 3300025961 | Bacteria | 2344 |
| 564 | Ga0207712_10170495 | 3300025961 | Bacteria | 1701 |
| 565 | Ga0207668_10043690 | 3300025972 | Bacteria | 3043 |
| 566 | Ga0207668_10058189 | 3300025972 | Bacteria | 2700 |
| 567 | Ga0207668_10240016 | 3300025972 | Bacteria | 1466 |
| 568 | Ga0207668_10280394 | 3300025972 | Bacteria | 1366 |
| 569 | Ga0207668_10600740 | 3300025972 | Bacteria | 958 |
| 570 | Ga0207640_10033307 | 3300025981 | Bacteria | 3204 |
| 571 | Ga0207640_10072625 | 3300025981 | Bacteria | 2322 |
| 572 | Ga0207658_10056905 | 3300025986 | Bacteria | 2904 |
| 573 | Ga0207658_10646497 | 3300025986 | Bacteria | 953 |
| 574 | Ga0207677_10006968 | 3300026023 | Bacteria | 6216 |
| 575 | Ga0207677_10039289 | 3300026023 | Bacteria | 3111 |
| 576 | Ga0207677_10232394 | 3300026023 | Bacteria | 1486 |
| 577 | Ga0207677_10374114 | 3300026023 | Bacteria | 1200 |
| 578 | Ga0207677_10530235 | 3300026023 | Bacteria | 1023 |
| 579 | Ga0207703_10023677 | 3300026035 | Bacteria | 4829 |
| 580 | Ga0207703_10027837 | 3300026035 | Bacteria | 4452 |
| 581 | Ga0207703_10184364 | 3300026035 | Bacteria | 1844 |
| 582 | Ga0207639_10102445 | 3300026041 | Bacteria | 2317 |
| 583 | Ga0207639_10195435 | 3300026041 | Bacteria | 1731 |
| 584 | Ga0207639_10321210 | 3300026041 | Bacteria | 1375 |
| 585 | Ga0207639_10400428 | 3300026041 | Bacteria | 1236 |
| 586 | Ga0207678_10006661 | 3300026067 | Bacteria | 10240 |
| 587 | Ga0207678_10011116 | 3300026067 | Bacteria | 7907 |
| 588 | Ga0207678_10046631 | 3300026067 | Bacteria | 3747 |
| 589 | Ga0207678_10065486 | 3300026067 | Bacteria | 3120 |
| 590 | Ga0207678_10092860 | 3300026067 | Bacteria | 2579 |
| 591 | Ga0207678_10145531 | 3300026067 | Bacteria | 2022 |
| 592 | Ga0207678_10165456 | 3300026067 | Bacteria | 1888 |
| 593 | Ga0207708_10007716 | 3300026075 | Bacteria | 7966 |
| 594 | Ga0207708_10124482 | 3300026075 | Bacteria | 2011 |
| 595 | Ga0207708_10140391 | 3300026075 | Bacteria | 1895 |
| 596 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 597 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 598 | Ga0207702_10029653 | 3300026078 | Bacteria | 4554 |
| 599 | Ga0207702_10033457 | 3300026078 | Bacteria | 4294 |
| 600 | Ga0207641_10014887 | 3300026088 | Bacteria | 6377 |
| 601 | Ga0207648_10004282 | 3300026089 | Bacteria | 14717 |
| 602 | Ga0207648_10016410 | 3300026089 | Bacteria | 6767 |
| 603 | Ga0207648_10023386 | 3300026089 | Bacteria | 5536 |
| 604 | Ga0207648_10110826 | 3300026089 | Bacteria | 2409 |
| 605 | Ga0207676_10025698 | 3300026095 | Bacteria | 4371 |
| 606 | Ga0207676_10103796 | 3300026095 | Bacteria | 2363 |
| 607 | Ga0207676_10221457 | 3300026095 | Bacteria | 1685 |
| 608 | Ga0207676_10299903 | 3300026095 | Bacteria | 1467 |
| 609 | Ga0207674_10009035 | 3300026116 | Bacteria | 11446 |
| 610 | Ga0207674_10120406 | 3300026116 | Bacteria | 2592 |
| 611 | Ga0207674_10277529 | 3300026116 | Bacteria | 1623 |
| 612 | Ga0207675_100004773 | 3300026118 | Bacteria | 13059 |
| 613 | Ga0207675_100094270 | 3300026118 | Bacteria | 2816 |
| 614 | Ga0207675_100336805 | 3300026118 | Bacteria | 1476 |
| 615 | Ga0207675_100441847 | 3300026118 | Bacteria | 1288 |
| 616 | Ga0207675_100458051 | 3300026118 | Bacteria | 1265 |
| 617 | Ga0207683_10000755 | 3300026121 | Bacteria | 29385 |
| 618 | Ga0207683_10011238 | 3300026121 | Bacteria | 7632 |
| 619 | Ga0207683_10018023 | 3300026121 | Bacteria | 6021 |
| 620 | Ga0207683_10039521 | 3300026121 | Bacteria | 4116 |
| 621 | Ga0207683_10068467 | 3300026121 | Bacteria | 3133 |
| 622 | Ga0207683_10090083 | 3300026121 | Bacteria | 2731 |
| 623 | Ga0207683_10340568 | 3300026121 | Bacteria | 1375 |
| 624 | Ga0207698_10048923 | 3300026142 | Bacteria | 3213 |
| 625 | Ga0207698_10208736 | 3300026142 | Bacteria | 1755 |
| 626 | Ga0207698_10649771 | 3300026142 | Bacteria | 1045 |
| 627 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 628 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 629 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 630 | Ga0209588_1037277 | 3300027671 | Bacteria | 1565 |
| 631 | Ga0268266_10001796 | 3300028379 | Bacteria | 24309 |
| 632 | Ga0268266_10004322 | 3300028379 | Bacteria | 13666 |
| 633 | Ga0268266_10041549 | 3300028379 | Bacteria | 3924 |
| 634 | Ga0268266_10111463 | 3300028379 | Bacteria | 2424 |
| 635 | Ga0268266_10112766 | 3300028379 | Bacteria | 2411 |
| 636 | Ga0268266_10345632 | 3300028379 | Bacteria | 1397 |
| 637 | Ga0268266_10612723 | 3300028379 | Bacteria | 1046 |
| 638 | Ga0268265_10150239 | 3300028380 | Bacteria | 1963 |
| 639 | Ga0268265_10222070 | 3300028380 | Bacteria | 1654 |
| 640 | Ga0268265_10601767 | 3300028380 | Bacteria | 1051 |
| 641 | Ga0268265_10733167 | 3300028380 | Bacteria | 958 |
| 642 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 643 | Ga0268264_10026486 | 3300028381 | Bacteria | 4738 |
| 644 | Ga0268264_10320064 | 3300028381 | Bacteria | 1466 |
| 645 | Ga0268264_10406560 | 3300028381 | Bacteria | 1309 |
| 646 | Ga0268264_10613067 | 3300028381 | Bacteria | 1074 |
| 647 | Ga0265323_10066299 | 3300028653 | Bacteria | 1243 |
| 648 | Ga0265336_10000395 | 3300028666 | Bacteria | 27433 |
| 649 | Ga0307515_10153612 | 3300028794 | Bacteria | 2391 |
| 650 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 651 | Ga0307511_10055883 | 3300030521 | Bacteria | 3093 |
| 652 | Ga0265762_1028335 | 3300030760 | Bacteria | 1054 |
| 653 | Ga0265760_10028324 | 3300031090 | Bacteria | 1643 |
| 654 | Ga0265332_10000310 | 3300031238 | Bacteria | 37390 |
| 655 | Ga0265332_10056299 | 3300031238 | Bacteria | 1685 |
| 656 | Ga0265325_10001089 | 3300031241 | Bacteria | 19547 |
| 657 | Ga0265325_10002716 | 3300031241 | Bacteria | 11818 |
| 658 | Ga0265325_10093724 | 3300031241 | Bacteria | 1477 |
| 659 | Ga0265340_10001987 | 3300031247 | Bacteria | 11699 |
| 660 | Ga0265340_10007979 | 3300031247 | Bacteria | 5736 |
| 661 | Ga0265340_10030886 | 3300031247 | Bacteria | 2683 |
| 662 | Ga0265340_10064416 | 3300031247 | Bacteria | 1747 |
| 663 | Ga0265339_10004193 | 3300031249 | Bacteria | 9881 |
| 664 | Ga0265339_10006147 | 3300031249 | Bacteria | 7913 |
| 665 | Ga0265339_10013334 | 3300031249 | Bacteria | 4984 |
| 666 | Ga0265339_10075724 | 3300031249 | Bacteria | 1786 |
| 667 | Ga0265339_10133034 | 3300031249 | Bacteria | 1270 |
| 668 | Ga0265339_10223069 | 3300031249 | Bacteria | 921 |
| 669 | Ga0265331_10007124 | 3300031250 | Bacteria | 6511 |
| 670 | Ga0265331_10046709 | 3300031250 | Bacteria | 2086 |
| 671 | Ga0265316_10090899 | 3300031344 | Bacteria | 2329 |
| 672 | Ga0265316_10131649 | 3300031344 | Bacteria | 1884 |
| 673 | Ga0265316_10133634 | 3300031344 | Bacteria | 1867 |
| 674 | Ga0307513_10134366 | 3300031456 | Bacteria | 2412 |
| 675 | Ga0307513_10241889 | 3300031456 | Bacteria | 1609 |
| 676 | Ga0307509_10006260 | 3300031507 | Bacteria | 16085 |
| 677 | Ga0307509_10136610 | 3300031507 | Bacteria | 2396 |
| 678 | Ga0307408_100088322 | 3300031548 | Bacteria | 2334 |
| 679 | Ga0307408_100347141 | 3300031548 | Bacteria | 1258 |
| 680 | Ga0265313_10018919 | 3300031595 | Bacteria | 3853 |
| 681 | Ga0265313_10097247 | 3300031595 | Bacteria | 1312 |
| 682 | Ga0307508_10000125 | 3300031616 | Bacteria | 91829 |
| 683 | Ga0307508_10086418 | 3300031616 | Bacteria | 2719 |
| 684 | Ga0316575_10104860 | 3300031665 | Bacteria | 1151 |
| 685 | Ga0316579_10116103 | 3300031691 | Bacteria | 1285 |
| 686 | Ga0265314_10022428 | 3300031711 | Bacteria | 4836 |
| 687 | Ga0265314_10152826 | 3300031711 | Bacteria | 1413 |
| 688 | Ga0265342_10000175 | 3300031712 | Bacteria | 71083 |
| 689 | Ga0265342_10013040 | 3300031712 | Bacteria | 5600 |
| 690 | Ga0265342_10017256 | 3300031712 | Bacteria | 4701 |
| 691 | Ga0265342_10039041 | 3300031712 | Bacteria | 2887 |
| 692 | Ga0316576_10473465 | 3300031727 | Bacteria | 923 |
| 693 | Ga0307516_10039106 | 3300031730 | Bacteria | 4730 |
| 694 | Ga0307516_10077415 | 3300031730 | Bacteria | 3175 |
| 695 | Ga0307516_10260655 | 3300031730 | Bacteria | 1424 |
| 696 | Ga0307413_10470885 | 3300031824 | Bacteria | 1002 |
| 697 | Ga0307412_10330180 | 3300031911 | Bacteria | 1217 |
| 698 | Ga0307416_100136965 | 3300032002 | Bacteria | 2217 |
| 699 | Ga0307416_100229312 | 3300032002 | Bacteria | 1789 |
| 700 | Ga0307416_100542162 | 3300032002 | Bacteria | 1235 |
| 701 | Ga0307414_10327110 | 3300032004 | Bacteria | 1307 |
| 702 | Ga0307411_10430321 | 3300032005 | Bacteria | 1099 |
| 703 | Ga0307415_100340651 | 3300032126 | Bacteria | 1258 |
| 704 | Ga0307510_10094706 | 3300033180 | Bacteria | 2810 |
| 705 | Ga0307510_10238863 | 3300033180 | Bacteria | 1313 |
| 706 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 707 | Ga0373930_0043315 | 3300034816 | Bacteria | 965 |
| 708 | Ga0373940_0057534 | 3300035088 | Bacteria | 1105 |
| 709 | Ga0373944_0008452 | 3300035089 | Bacteria | 2781 |
| 710 | Ga0373951_0033886 | 3300035091 | Bacteria | 1212 |
| 711 | Ga0373952_0024718 | 3300035092 | Bacteria | 1292 |
| 712 | Ga0373923_0010299 | 3300035111 | Bacteria | 3397 |
| 713 | Ga0373923_0082082 | 3300035111 | Bacteria | 1399 |
| 714 | Ga0373923_0091581 | 3300035111 | Bacteria | 1331 |
| 715 | Ga0373932_0023423 | 3300035112 | Bacteria | 1652 |
| 716 | Ga0373936_0001304 | 3300035113 | Bacteria | 9034 |
| 717 | Ga0373936_0004439 | 3300035113 | Bacteria | 5306 |
| 718 | Ga0373936_0169370 | 3300035113 | Bacteria | 954 |
| 719 | Ga0373939_0006221 | 3300035114 | Bacteria | 2872 |
| 720 | Ga0373945_0004834 | 3300035116 | Bacteria | 4291 |
| 721 | Ga0373945_0051161 | 3300035116 | Bacteria | 1519 |
| 722 | Ga0373953_0075990 | 3300035117 | Bacteria | 1391 |
| 723 | Ga0373954_0002374 | 3300035118 | Bacteria | 7874 |
| 724 | Ga0373954_0003435 | 3300035118 | Bacteria | 6717 |
| 725 | Ga0373954_0031099 | 3300035118 | Bacteria | 2463 |
| 726 | Ga0373954_0086208 | 3300035118 | Bacteria | 1504 |
| 727 | Ga0373954_0132503 | 3300035118 | Bacteria | 1214 |
| 728 | Ga0373956_0007265 | 3300035119 | Bacteria | 4461 |
| 729 | Ga0373956_0056583 | 3300035119 | Bacteria | 1771 |
| 730 | Ga0373956_0098807 | 3300035119 | Bacteria | 1352 |
| 731 | Ga0373957_0007813 | 3300035120 | Bacteria | 3436 |
| 732 | Ga0373957_0018156 | 3300035120 | Bacteria | 2459 |
| 733 | Ga0373957_0024301 | 3300035120 | Bacteria | 2175 |
| 734 | Ga0373957_0070135 | 3300035120 | Bacteria | 1369 |
| 735 | Ga0373943_0003366 | 3300035170 | Bacteria | 7267 |
| 736 | Ga0373946_0000442 | 3300035171 | Bacteria | 13617 |
| 737 | Ga0373946_0044695 | 3300035171 | Bacteria | 1829 |
| 738 | Ga0373946_0045305 | 3300035171 | Bacteria | 1819 |
| 739 | Ga0373946_0117914 | 3300035171 | Bacteria | 1209 |
| 740 | Ga0373955_0000590 | 3300035172 | Bacteria | 15443 |
| 741 | Ga0373955_0005428 | 3300035172 | Bacteria | 5729 |
| 742 | Ga0373955_0017758 | 3300035172 | Bacteria | 3525 |
| 743 | Ga0373955_0253440 | 3300035172 | Bacteria | 1055 |
| 744 | Ga0373955_0255113 | 3300035172 | Bacteria | 1052 |
| 745 | Ga0373942_0015083 | 3300035207 | Bacteria | 1878 |
| 746 | Ga0373961_0032870 | 3300035241 | Bacteria | 1458 |
| 747 | Ga0373961_0094157 | 3300035241 | Bacteria | 961 |
| 748 | Ga0373962_0072435 | 3300035242 | Bacteria | 1032 |
| 749 | Ga0316574_0012818 | 3300035398 | Bacteria | 4805 |
| 750 | Ga0373924_0000432 | 3300035410 | Bacteria | 12866 |
| 751 | Ga0373924_0045878 | 3300035410 | Bacteria | 1798 |
| 752 | Ga0373924_0156750 | 3300035410 | Bacteria | 997 |
| 753 | Ga0373931_0087582 | 3300035691 | Bacteria | 1730 |
| 754 | Ga0373931_0092811 | 3300035691 | Bacteria | 1685 |
| 755 | Ga0373931_0206935 | 3300035691 | Bacteria | 1175 |
| 756 | Ga0373931_0217233 | 3300035691 | Bacteria | 1149 |
| 757 | Ga0373935_0000370 | 3300035692 | Bacteria | 23018 |
| 758 | Ga0373935_0144130 | 3300035692 | Bacteria | 1611 |
| 759 | Ga0373935_0285787 | 3300035692 | Bacteria | 1162 |
| 760 | Ga0373927_0006696 | 3300035695 | Bacteria | 7840 |
| 761 | Ga0373927_0012500 | 3300035695 | Bacteria | 5652 |
| 762 | Ga0373927_0014600 | 3300035695 | Bacteria | 5195 |
| 763 | Ga0373927_0044379 | 3300035695 | Bacteria | 2876 |
| 764 | Ga0373927_0203814 | 3300035695 | Bacteria | 1299 |
| 765 | Ga0373927_0440267 | 3300035695 | Bacteria | 860 |
| 766 | Ga0373933_0000180 | 3300035724 | Bacteria | 41838 |
| 767 | Ga0373933_0035942 | 3300035724 | Bacteria | 2897 |
| 768 | Ga0373947_0000476 | 3300035725 | Bacteria | 22980 |
| 769 | Ga0373947_0065531 | 3300035725 | Bacteria | 2216 |
| 770 | Ga0373947_0294705 | 3300035725 | Bacteria | 1080 |
| 771 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 772 | Ga0373937_0052741 | 3300036401 | Bacteria | 3730 |
| 773 | Ga0373937_0087639 | 3300036401 | Bacteria | 2881 |
| 774 | Ga0373937_0145999 | 3300036401 | Bacteria | 2214 |
| 775 | Ga0373937_0207301 | 3300036401 | Bacteria | 1844 |
| 776 | Ga0373937_0863660 | 3300036401 | Bacteria | 853 |
| 777 | Ga0316584_0013475 | 3300036712 | Bacteria | 5788 |
| 778 | Ga0373925_0000194 | 3300037068 | Bacteria | 66124 |
| 779 | Ga0373925_0016628 | 3300037068 | Bacteria | 5329 |
| 780 | Ga0373925_0025690 | 3300037068 | Bacteria | 4306 |
| 781 | Ga0373925_0034596 | 3300037068 | Bacteria | 3725 |
| 782 | Ga0373925_0050640 | 3300037068 | Bacteria | 3098 |
| 783 | Ga0373925_0096908 | 3300037068 | Bacteria | 2262 |
| 784 | Ga0373925_0125709 | 3300037068 | Bacteria | 1995 |
| 785 | Ga0373925_0270426 | 3300037068 | Bacteria | 1367 |
| 786 | Ga0373925_0607456 | 3300037068 | Bacteria | 901 |
| 787 | Ga0395899_0184330 | 3300037312 | Bacteria | 1463 |
| 788 | Ga0395900_0000753 | 3300037418 | Bacteria | 43021 |
| 789 | Ga0395900_0011126 | 3300037418 | Bacteria | 9197 |
| 790 | Ga0395900_0087579 | 3300037418 | Bacteria | 3200 |
| 791 | Ga0395900_0132135 | 3300037418 | Bacteria | 2558 |
| 792 | Ga0395900_0476054 | 3300037418 | Bacteria | 1202 |
| 793 | Ga0395898_0005579 | 3300037466 | Bacteria | 13568 |
| 794 | Ga0395898_0096497 | 3300037466 | Bacteria | 2840 |
| 795 | Ga0395898_0693224 | 3300037466 | Bacteria | 960 |
| 796 | Ga0395905_0060003 | 3300037471 | Bacteria | 3556 |
| 797 | Ga0436364_0463993 | 3300037853 | Bacteria | 3218 |
| 798 | Ga0436364_0538474 | 3300037853 | Bacteria | 1046 |
| 799 | Ga0436364_0683264 | 3300037853 | Bacteria | 5939 |
| 800 | Ga0436364_1040387 | 3300037853 | Bacteria | 1362 |
| 801 | Ga0436364_1234925 | 3300037853 | Bacteria | 2399 |
| 802 | Ga0436364_1536805 | 3300037853 | Bacteria | 6739 |
| 803 | Ga0395901_0059586 | 3300038443 | Bacteria | 3972 |
| 804 | Ga0395901_0092860 | 3300038443 | Bacteria | 3159 |
| 805 | Ga0395901_0464498 | 3300038443 | Bacteria | 1293 |
| 806 | Ga0395901_0667611 | 3300038443 | Bacteria | 1041 |
| 807 | Ga0400486_01881 | 3300038742 | Bacteria | 8378 |
| 808 | Ga0436365_0046146 | 3300039437 | Bacteria | 1357 |
| 809 | Ga0436365_0361138 | 3300039437 | Bacteria | 1007 |
| 810 | Ga0436365_0367024 | 3300039437 | Bacteria | 1321 |
| 811 | Ga0436365_0544636 | 3300039437 | Bacteria | 4040 |
| 812 | Ga0436365_0824804 | 3300039437 | Bacteria | 1242 |
| 813 | Ga0436365_0910473 | 3300039437 | Bacteria | 3481 |
| 814 | Ga0436365_0989626 | 3300039437 | Bacteria | 2539 |
| 815 | Ga0436365_1294996 | 3300039437 | Bacteria | 3181 |
| 816 | Ga0436365_1466687 | 3300039437 | Bacteria | 3240 |
| 817 | Ga0436365_1613283 | 3300039437 | Bacteria | 846 |
| 818 | Ga0436365_1626279 | 3300039437 | Bacteria | 2657 |
| 819 | Ga0436365_1802139 | 3300039437 | Bacteria | 8542 |
| 820 | Ga0436365_1853114 | 3300039437 | Bacteria | 1292 |
| 821 | Ga0436365_1860176 | 3300039437 | Bacteria | 2655 |
| 822 | Ga0436360_0121399 | 3300039438 | Bacteria | 4193 |
| 823 | Ga0436360_1258966 | 3300039438 | Bacteria | 1390 |
| 824 | Ga0436361_0082815 | 3300039447 | Bacteria | 986 |
| 825 | Ga0436361_0735205 | 3300039447 | Bacteria | 1585 |
| 826 | Ga0436363_0068476 | 3300039450 | Bacteria | 2127 |
| 827 | Ga0436363_0351229 | 3300039450 | Bacteria | 2973 |
| 828 | Ga0436363_1392773 | 3300039450 | Bacteria | 3419 |
| 829 | Ga0436363_1532888 | 3300039450 | Bacteria | 1312 |
| 830 | Ga0436363_1646089 | 3300039450 | Bacteria | 1174 |
| 831 | Ga0436362_0588599 | 3300039453 | Bacteria | 1070 |
| 832 | Ga0436362_0854921 | 3300039453 | Bacteria | 1343 |
| 833 | Ga0439465_0040206 | 3300041413 | Bacteria | 1511 |
| 834 | Ga0451853_1217131 | 3300041512 | Bacteria | 1207 |
| 835 | Ga0439434_0096840 | 3300042435 | Bacteria | 948 |
| 836 | Ga0451577_0000804 | 3300042876 | Bacteria | 47207 |
| 837 | Ga0466969_0077486 | 3300044656 | Bacteria | 1591 |
| 838 | Ga0466966_0084873 | 3300044684 | Bacteria | 1969 |
| 839 | Ga0466971_0022633 | 3300044719 | Bacteria | 2801 |
| 840 | Ga0466968_0148538 | 3300044735 | Bacteria | 1076 |
| 841 | Ga0466970_0214017 | 3300044765 | Bacteria | 1074 |
| 842 | Ga0466957_0079650 | 3300044842 | Bacteria | 2039 |
| 843 | Ga0466957_0080487 | 3300044842 | Bacteria | 2028 |
| 844 | Ga0466959_0061808 | 3300045049 | Bacteria | 2723 |
| 845 | Ga0466959_0180583 | 3300045049 | Bacteria | 1476 |
| 846 | Ga0466959_0383088 | 3300045049 | Bacteria | 957 |
| 847 | Ga0451576_0893345 | 3300045051 | Bacteria | 932 |
| 848 | Ga0466967_0060568 | 3300045976 | Bacteria | 3354 |
| 849 | Ga0466967_0402828 | 3300045976 | Bacteria | 1331 |
| 850 | Ga0495592_0000018 | 3300046454 | Bacteria | 140962 |
| 851 | Ga0495592_0007391 | 3300046454 | Bacteria | 8221 |
| 852 | Ga0495592_0068737 | 3300046454 | Bacteria | 2585 |
| 853 | Ga0495592_0161451 | 3300046454 | Bacteria | 1541 |
| 854 | Ga0495603_0017965 | 3300046455 | Bacteria | 4280 |
| 855 | Ga0495603_0113311 | 3300046455 | Bacteria | 1581 |
| 856 | Ga0495603_0158464 | 3300046455 | Bacteria | 1313 |
| 857 | Ga0495603_0234644 | 3300046455 | Bacteria | 1057 |
| 858 | Ga0495590_0017697 | 3300046457 | Bacteria | 2561 |
| 859 | Ga0495590_0032303 | 3300046457 | Bacteria | 1831 |
| 860 | Ga0495629_0004511 | 3300046459 | Bacteria | 10415 |
| 861 | Ga0495629_0021300 | 3300046459 | Bacteria | 4625 |
| 862 | Ga0495629_0126087 | 3300046459 | Bacteria | 1783 |
| 863 | Ga0495638_0017089 | 3300046460 | Bacteria | 4845 |
| 864 | Ga0495638_0044424 | 3300046460 | Bacteria | 2798 |
| 865 | Ga0495641_0096094 | 3300046461 | Bacteria | 1322 |
| 866 | Ga0495651_0002271 | 3300046462 | Bacteria | 14833 |
| 867 | Ga0495651_0009620 | 3300046462 | Bacteria | 7427 |
| 868 | Ga0495651_0018113 | 3300046462 | Bacteria | 5452 |
| 869 | Ga0495651_0045413 | 3300046462 | Bacteria | 3404 |
| 870 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 871 | Ga0495653_0126812 | 3300046463 | Bacteria | 1811 |
| 872 | Ga0495653_0187883 | 3300046463 | Bacteria | 1412 |
| 873 | Ga0495650_0034912 | 3300046471 | Bacteria | 2219 |
| 874 | Ga0495580_0022914 | 3300046472 | Bacteria | 4590 |
| 875 | Ga0495580_0219499 | 3300046472 | Bacteria | 1307 |
| 876 | Ga0495582_0069661 | 3300046473 | Bacteria | 1945 |
| 877 | Ga0495582_0110989 | 3300046473 | Bacteria | 1540 |
| 878 | Ga0495582_0188030 | 3300046473 | Bacteria | 1178 |
| 879 | Ga0495605_0098354 | 3300046474 | Bacteria | 1348 |
| 880 | Ga0495639_0017286 | 3300046475 | Bacteria | 3132 |
| 881 | Ga0495662_0015632 | 3300046476 | Bacteria | 3683 |
| 882 | Ga0495662_0122774 | 3300046476 | Bacteria | 1275 |
| 883 | Ga0495662_0174289 | 3300046476 | Bacteria | 1060 |
| 884 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 885 | Ga0495664_0011721 | 3300046477 | Bacteria | 4949 |
| 886 | Ga0495664_0156048 | 3300046477 | Bacteria | 1385 |
| 887 | Ga0495584_0005969 | 3300046491 | Bacteria | 6415 |
| 888 | Ga0495584_0097225 | 3300046491 | Bacteria | 1487 |
| 889 | Ga0495584_0138620 | 3300046491 | Bacteria | 1235 |
| 890 | Ga0495585_0064951 | 3300046492 | Bacteria | 2000 |
| 891 | Ga0495594_0028740 | 3300046499 | Bacteria | 3001 |
| 892 | Ga0495594_0282177 | 3300046499 | Bacteria | 946 |
| 893 | Ga0495596_0064908 | 3300046500 | Bacteria | 1420 |
| 894 | Ga0495607_0068886 | 3300046501 | Bacteria | 1983 |
| 895 | Ga0495607_0149462 | 3300046501 | Bacteria | 1197 |
| 896 | Ga0495606_0001686 | 3300046507 | Bacteria | 28531 |
| 897 | Ga0495606_0012721 | 3300046507 | Bacteria | 6710 |
| 898 | Ga0495606_0103896 | 3300046507 | Bacteria | 1725 |
| 899 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 900 | Ga0495608_0073007 | 3300046511 | Bacteria | 2238 |
| 901 | Ga0495608_0078676 | 3300046511 | Bacteria | 2144 |
| 902 | Ga0495608_0210193 | 3300046511 | Bacteria | 1223 |
| 903 | Ga0495610_0051049 | 3300046512 | Bacteria | 2015 |
| 904 | Ga0495616_0064266 | 3300046513 | Bacteria | 1791 |
| 905 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 906 | Ga0495618_0002296 | 3300046514 | Bacteria | 12395 |
| 907 | Ga0495618_0068853 | 3300046514 | Bacteria | 2250 |
| 908 | Ga0495618_0199450 | 3300046514 | Bacteria | 1267 |
| 909 | Ga0495618_0219880 | 3300046514 | Bacteria | 1198 |
| 910 | Ga0495620_0017282 | 3300046515 | Bacteria | 3600 |
| 911 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 912 | Ga0495628_0011834 | 3300046516 | Bacteria | 7362 |
| 913 | Ga0495628_0151589 | 3300046516 | Bacteria | 1766 |
| 914 | Ga0495628_0159842 | 3300046516 | Bacteria | 1713 |
| 915 | Ga0495628_0179128 | 3300046516 | Bacteria | 1604 |
| 916 | Ga0495628_0259831 | 3300046516 | Bacteria | 1294 |
| 917 | Ga0495630_0001850 | 3300046517 | Bacteria | 14780 |
| 918 | Ga0495630_0168720 | 3300046517 | Bacteria | 1667 |
| 919 | Ga0495630_0190624 | 3300046517 | Bacteria | 1564 |
| 920 | Ga0495631_0116504 | 3300046518 | Bacteria | 1149 |
| 921 | Ga0495632_0182245 | 3300046519 | Bacteria | 962 |
| 922 | Ga0495648_0002080 | 3300046524 | Bacteria | 18945 |
| 923 | Ga0495663_0065526 | 3300046525 | Bacteria | 1148 |
| 924 | Ga0495663_0089135 | 3300046525 | Bacteria | 1004 |
| 925 | Ga0495666_0169756 | 3300046526 | Bacteria | 1009 |
| 926 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 927 | Ga0495652_0040074 | 3300046529 | Bacteria | 4049 |
| 928 | Ga0495652_0088571 | 3300046529 | Bacteria | 2536 |
| 929 | Ga0495652_0165642 | 3300046529 | Bacteria | 1711 |
| 930 | Ga0495652_0265595 | 3300046529 | Bacteria | 1264 |
| 931 | Ga0495665_0030220 | 3300046531 | Bacteria | 2900 |
| 932 | Ga0495665_0248900 | 3300046531 | Bacteria | 915 |
| 933 | Ga0495640_0000009 | 3300046533 | Bacteria | 217086 |
| 934 | Ga0495640_0004134 | 3300046533 | Bacteria | 11612 |
| 935 | Ga0495640_0015032 | 3300046533 | Bacteria | 5832 |
| 936 | Ga0495640_0028702 | 3300046533 | Bacteria | 4003 |
| 937 | Ga0495640_0045669 | 3300046533 | Bacteria | 3039 |
| 938 | Ga0495640_0197743 | 3300046533 | Bacteria | 1275 |
| 939 | Ga0495586_0016981 | 3300046535 | Bacteria | 3872 |
| 940 | Ga0495586_0113785 | 3300046535 | Bacteria | 1507 |
| 941 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 942 | Ga0495587_0033796 | 3300046536 | Bacteria | 3085 |
| 943 | Ga0495587_0054241 | 3300046536 | Bacteria | 2362 |
| 944 | Ga0495598_0003846 | 3300046537 | Bacteria | 3215 |
| 945 | Ga0495621_0009676 | 3300046539 | Bacteria | 2934 |
| 946 | Ga0495621_0027282 | 3300046539 | Bacteria | 1933 |
| 947 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 948 | Ga0495645_0007861 | 3300046543 | Bacteria | 7418 |
| 949 | Ga0495645_0009133 | 3300046543 | Bacteria | 6926 |
| 950 | Ga0495645_0069213 | 3300046543 | Bacteria | 2547 |
| 951 | Ga0495645_0233748 | 3300046543 | Bacteria | 1230 |
| 952 | Ga0495622_0045681 | 3300046557 | Bacteria | 2035 |
| 953 | Ga0495622_0150699 | 3300046557 | Bacteria | 1052 |
| 954 | Ga0495633_0052795 | 3300046558 | Bacteria | 1914 |
| 955 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 956 | Ga0495667_0027393 | 3300046559 | Bacteria | 3841 |
| 957 | Ga0495656_0051429 | 3300046615 | Bacteria | 1763 |
| 958 | Ga0495656_0066339 | 3300046615 | Bacteria | 1590 |
| 959 | Ga0495668_0114593 | 3300046616 | Bacteria | 1474 |
| 960 | Ga0495634_0000223 | 3300046642 | Bacteria | 53103 |
| 961 | Ga0495634_0007776 | 3300046642 | Bacteria | 8017 |
| 962 | Ga0495634_0030340 | 3300046642 | Bacteria | 3734 |
| 963 | Ga0495634_0034428 | 3300046642 | Bacteria | 3476 |
| 964 | Ga0495634_0066724 | 3300046642 | Bacteria | 2382 |
| 965 | Ga0495634_0076735 | 3300046642 | Bacteria | 2193 |
| 966 | Ga0495634_0407853 | 3300046642 | Bacteria | 806 |
| 967 | Ga0495611_0070545 | 3300046648 | Bacteria | 1597 |
| 968 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 969 | Ga0495635_0012284 | 3300046663 | Bacteria | 5998 |
| 970 | Ga0495635_0033486 | 3300046663 | Bacteria | 3564 |
| 971 | Ga0495635_0071599 | 3300046663 | Bacteria | 2376 |
| 972 | Ga0495635_0079065 | 3300046663 | Bacteria | 2251 |
| 973 | Ga0495635_0091237 | 3300046663 | Bacteria | 2084 |
| 974 | Ga0495635_0361171 | 3300046663 | Bacteria | 968 |
| 975 | Ga0495659_0011400 | 3300046664 | Bacteria | 2865 |
| 976 | Ga0495659_0076698 | 3300046664 | Bacteria | 1261 |
| 977 | Ga0495661_0004641 | 3300046665 | Bacteria | 9884 |
| 978 | Ga0495588_0154998 | 3300046674 | Bacteria | 1211 |
| 979 | Ga0495588_0203304 | 3300046674 | Bacteria | 1046 |
| 980 | Ga0495657_0000058 | 3300046675 | Bacteria | 97827 |
| 981 | Ga0495657_0007247 | 3300046675 | Bacteria | 8593 |
| 982 | Ga0495657_0129828 | 3300046675 | Bacteria | 1579 |
| 983 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 984 | Ga0495599_0019082 | 3300046678 | Bacteria | 4275 |
| 985 | Ga0495623_0000085 | 3300046679 | Bacteria | 55527 |
| 986 | Ga0495623_0028622 | 3300046679 | Bacteria | 3584 |
| 987 | Ga0495623_0077088 | 3300046679 | Bacteria | 2067 |
| 988 | Ga0495623_0116857 | 3300046679 | Bacteria | 1611 |
| 989 | Ga0495646_0000021 | 3300046680 | Bacteria | 115358 |
| 990 | Ga0495646_0019263 | 3300046680 | Bacteria | 4322 |
| 991 | Ga0495646_0223142 | 3300046680 | Bacteria | 1018 |
| 992 | Ga0495647_0021787 | 3300046681 | Bacteria | 2311 |
| 993 | Ga0495647_0022052 | 3300046681 | Bacteria | 2299 |
| 994 | Ga0495658_0025517 | 3300046683 | Bacteria | 3159 |
| 995 | Ga0495658_0028100 | 3300046683 | Bacteria | 3033 |
| 996 | Ga0495658_0263350 | 3300046683 | Bacteria | 1085 |
| 997 | Ga0495613_0121180 | 3300046689 | Bacteria | 1878 |
| 998 | Ga0495613_0123971 | 3300046689 | Bacteria | 1854 |
| 999 | Ga0495613_0180467 | 3300046689 | Bacteria | 1495 |
| 1000 | Ga0495613_0344267 | 3300046689 | Bacteria | 1025 |
| 1001 | Ga0495613_0376692 | 3300046689 | Bacteria | 971 |
| 1002 | Ga0495624_0007573 | 3300046690 | Bacteria | 7619 |
| 1003 | Ga0495624_0062310 | 3300046690 | Bacteria | 2333 |
| 1004 | Ga0495624_0072967 | 3300046690 | Bacteria | 2134 |
| 1005 | Ga0495624_0080796 | 3300046690 | Bacteria | 2014 |
| 1006 | Ga0495624_0316240 | 3300046690 | Bacteria | 941 |
| 1007 | Ga0495670_0026303 | 3300046691 | Bacteria | 2880 |
| 1008 | Ga0495670_0073302 | 3300046691 | Bacteria | 1735 |
| 1009 | Ga0495670_0084771 | 3300046691 | Bacteria | 1617 |
| 1010 | Ga0495671_0099253 | 3300046692 | Bacteria | 1424 |
| 1011 | Ga0495649_0059705 | 3300046694 | Bacteria | 2053 |
| 1012 | Ga0495589_0124507 | 3300046794 | Bacteria | 1240 |
| 1013 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 1014 | Ga0495600_0017611 | 3300046809 | Bacteria | 4547 |
| 1015 | Ga0495600_0020140 | 3300046809 | Bacteria | 4267 |
| 1016 | Ga0495660_0153745 | 3300046810 | Bacteria | 1134 |
| 1017 | Ga0495581_0005192 | 3300047315 | Bacteria | 7535 |
| 1018 | Ga0495581_0015392 | 3300047315 | Bacteria | 4441 |
| 1019 | Ga0495581_0108728 | 3300047315 | Bacteria | 1612 |
| 1020 | Ga0495581_0112270 | 3300047315 | Bacteria | 1585 |
| 1021 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 1022 | Ga0495604_0006128 | 3300047317 | Bacteria | 9545 |
| 1023 | Ga0495604_0020133 | 3300047317 | Bacteria | 5331 |
| 1024 | Ga0495604_0268583 | 3300047317 | Bacteria | 1156 |
| 1025 | Ga0495604_0269476 | 3300047317 | Bacteria | 1154 |
| 1026 | Ga0495636_0212650 | 3300047318 | Bacteria | 886 |
| 1027 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 1028 | Ga0495674_0005473 | 3300047319 | Bacteria | 12199 |
| 1029 | Ga0495674_0201351 | 3300047319 | Bacteria | 1651 |
| 1030 | Ga0495674_0296042 | 3300047319 | Bacteria | 1322 |
| 1031 | Ga0495672_0008564 | 3300047320 | Bacteria | 7527 |
| 1032 | Ga0495672_0124543 | 3300047320 | Bacteria | 1365 |
| 1033 | Ga0495676_0054221 | 3300047321 | Bacteria | 3188 |
| 1034 | Ga0495676_0163092 | 3300047321 | Bacteria | 1575 |
| 1035 | Ga0495676_0313940 | 3300047321 | Bacteria | 1054 |
| 1036 | Ga0495680_0001281 | 3300047322 | Bacteria | 27427 |
| 1037 | Ga0495680_0097431 | 3300047322 | Bacteria | 2195 |
| 1038 | Ga0495680_0191135 | 3300047322 | Bacteria | 1473 |
| 1039 | Ga0495680_0363812 | 3300047322 | Bacteria | 1005 |
| 1040 | Ga0495675_0000096 | 3300047444 | Bacteria | 62617 |
| 1041 | Ga0495675_0063415 | 3300047444 | Bacteria | 2338 |
| 1042 | Ga0495681_0107375 | 3300047470 | Bacteria | 1213 |
| 1043 | Ga0495684_0000084 | 3300047471 | Bacteria | 65600 |
| 1044 | Ga0495684_0000724 | 3300047471 | Bacteria | 26578 |
| 1045 | Ga0495684_0057921 | 3300047471 | Bacteria | 2952 |
| 1046 | Ga0495684_0062950 | 3300047471 | Bacteria | 2821 |
| 1047 | Ga0495684_0170611 | 3300047471 | Bacteria | 1618 |
| 1048 | Ga0495684_0239736 | 3300047471 | Bacteria | 1323 |
| 1049 | Ga0495686_0018833 | 3300047472 | Bacteria | 4623 |
| 1050 | Ga0495686_0075590 | 3300047472 | Bacteria | 2065 |
| 1051 | Ga0495593_0000727 | 3300047673 | Bacteria | 19074 |
| 1052 | Ga0495593_0192672 | 3300047673 | Bacteria | 1025 |
| 1053 | Ga0495602_0000073 | 3300048088 | Bacteria | 98745 |
| 1054 | Ga0495602_0021411 | 3300048088 | Bacteria | 6366 |
| 1055 | Ga0495602_0074922 | 3300048088 | Bacteria | 2874 |
| 1056 | Ga0495602_0085822 | 3300048088 | Bacteria | 2629 |
| 1057 | Ga0495602_0233348 | 3300048088 | Bacteria | 1381 |
| 1058 | Ga0495615_0008934 | 3300048090 | Bacteria | 1953 |
| 1059 | Ga0495615_0020723 | 3300048090 | Bacteria | 1477 |
| 1060 | Ga0496100_0009415 | 3300048903 | Bacteria | 5492 |
| 1061 | Ga0496100_0031044 | 3300048903 | Bacteria | 3318 |
| 1062 | Ga0496100_0032857 | 3300048903 | Bacteria | 3241 |
| 1063 | Ga0496100_0188026 | 3300048903 | Bacteria | 1497 |
| 1064 | Ga0496100_0280409 | 3300048903 | Bacteria | 1242 |
| 1065 | Ga0496101_0022566 | 3300048904 | Bacteria | 4334 |
| 1066 | Ga0496101_0054482 | 3300048904 | Bacteria | 2888 |
| 1067 | Ga0496101_0066385 | 3300048904 | Bacteria | 2631 |
| 1068 | Ga0496101_0066925 | 3300048904 | Bacteria | 2622 |
| 1069 | Ga0496101_0069596 | 3300048904 | Bacteria | 2575 |
| 1070 | Ga0496101_0114285 | 3300048904 | Bacteria | 2035 |
| 1071 | Ga0496101_0116075 | 3300048904 | Bacteria | 2020 |
| 1072 | Ga0496101_0386775 | 3300048904 | Bacteria | 1101 |
| 1073 | Ga0496101_0509849 | 3300048904 | Bacteria | 950 |
| 1074 | Ga0496102_0011175 | 3300048905 | Bacteria | 7733 |
| 1075 | Ga0496102_0023656 | 3300048905 | Bacteria | 5459 |
| 1076 | Ga0496102_0075347 | 3300048905 | Bacteria | 3102 |
| 1077 | Ga0496102_0085995 | 3300048905 | Bacteria | 2904 |
| 1078 | Ga0496102_0105116 | 3300048905 | Bacteria | 2627 |
| 1079 | Ga0496102_0163993 | 3300048905 | Bacteria | 2091 |
| 1080 | Ga0496102_0237816 | 3300048905 | Bacteria | 1717 |
| 1081 | Ga0496102_0337717 | 3300048905 | Bacteria | 1419 |
| 1082 | Ga0496102_0360673 | 3300048905 | Bacteria | 1368 |
| 1083 | Ga0496102_0510332 | 3300048905 | Bacteria | 1125 |
| 1084 | Ga0496102_0691098 | 3300048905 | Bacteria | 943 |
| 1085 | Ga0496103_0005828 | 3300048906 | Bacteria | 7355 |
| 1086 | Ga0496103_0116401 | 3300048906 | Bacteria | 1700 |
| 1087 | Ga0496104_0001003 | 3300048907 | Bacteria | 24153 |
| 1088 | Ga0496104_0003063 | 3300048907 | Bacteria | 14409 |
| 1089 | Ga0496104_0014912 | 3300048907 | Bacteria | 7025 |
| 1090 | Ga0496104_0024353 | 3300048907 | Bacteria | 5568 |
| 1091 | Ga0496104_0039528 | 3300048907 | Bacteria | 4416 |
| 1092 | Ga0496104_0179120 | 3300048907 | Bacteria | 2030 |
| 1093 | Ga0496104_0268839 | 3300048907 | Bacteria | 1617 |
| 1094 | Ga0496104_0466441 | 3300048907 | Bacteria | 1174 |
| 1095 | Ga0496105_0003633 | 3300048908 | Bacteria | 11465 |
| 1096 | Ga0496105_0011042 | 3300048908 | Bacteria | 7119 |
| 1097 | Ga0496105_0023493 | 3300048908 | Bacteria | 5001 |
| 1098 | Ga0496105_0046798 | 3300048908 | Bacteria | 3570 |
| 1099 | Ga0496105_0071620 | 3300048908 | Bacteria | 2864 |
| 1100 | Ga0496105_0168330 | 3300048908 | Bacteria | 1797 |
| 1101 | Ga0496105_0190276 | 3300048908 | Bacteria | 1678 |
| 1102 | Ga0496106_0001280 | 3300048909 | Bacteria | 18862 |
| 1103 | Ga0496106_0004321 | 3300048909 | Bacteria | 10554 |
| 1104 | Ga0496106_0031358 | 3300048909 | Bacteria | 3960 |
| 1105 | Ga0496106_0032992 | 3300048909 | Bacteria | 3861 |
| 1106 | Ga0496106_0065475 | 3300048909 | Bacteria | 2767 |
| 1107 | Ga0496106_0139948 | 3300048909 | Bacteria | 1903 |
| 1108 | Ga0496106_0140463 | 3300048909 | Bacteria | 1899 |
| 1109 | Ga0496106_0207015 | 3300048909 | Bacteria | 1562 |
| 1110 | Ga0496106_0329177 | 3300048909 | Bacteria | 1226 |
| 1111 | Ga0496106_0366507 | 3300048909 | Bacteria | 1157 |
| 1112 | Ga0496107_0023629 | 3300048910 | Bacteria | 4346 |
| 1113 | Ga0496107_0027212 | 3300048910 | Bacteria | 4060 |
| 1114 | Ga0496107_0059834 | 3300048910 | Bacteria | 2757 |
| 1115 | Ga0496107_0248572 | 3300048910 | Bacteria | 1323 |
| 1116 | Ga0496108_0000451 | 3300048911 | Bacteria | 32765 |
| 1117 | Ga0496108_0003585 | 3300048911 | Bacteria | 12437 |
| 1118 | Ga0496108_0079249 | 3300048911 | Bacteria | 2781 |
| 1119 | Ga0496108_0120994 | 3300048911 | Bacteria | 2245 |
| 1120 | Ga0496108_0139762 | 3300048911 | Bacteria | 2086 |
| 1121 | Ga0496108_0206654 | 3300048911 | Bacteria | 1704 |
| 1122 | Ga0496108_0236368 | 3300048911 | Bacteria | 1589 |
| 1123 | Ga0496108_0247318 | 3300048911 | Bacteria | 1551 |
| 1124 | Ga0496108_0290271 | 3300048911 | Bacteria | 1424 |
| 1125 | Ga0496108_0338723 | 3300048911 | Bacteria | 1312 |
| 1126 | Ga0496108_0420318 | 3300048911 | Bacteria | 1167 |
| 1127 | Ga0496108_0693514 | 3300048911 | Bacteria | 883 |
| 1128 | Ga0496109_0000558 | 3300048912 | Bacteria | 31145 |
| 1129 | Ga0496109_0004298 | 3300048912 | Bacteria | 11898 |
| 1130 | Ga0496109_0017610 | 3300048912 | Bacteria | 6265 |
| 1131 | Ga0496109_0041408 | 3300048912 | Bacteria | 4172 |
| 1132 | Ga0496109_0118103 | 3300048912 | Bacteria | 2469 |
| 1133 | Ga0496109_0242824 | 3300048912 | Bacteria | 1695 |
| 1134 | Ga0496109_0327532 | 3300048912 | Bacteria | 1446 |
| 1135 | Ga0496110_0015787 | 3300048913 | Bacteria | 6295 |
| 1136 | Ga0496110_0017400 | 3300048913 | Bacteria | 6013 |
| 1137 | Ga0496110_0095942 | 3300048913 | Bacteria | 2657 |
| 1138 | Ga0496110_0111158 | 3300048913 | Bacteria | 2463 |
| 1139 | Ga0496110_0133773 | 3300048913 | Bacteria | 2240 |
| 1140 | Ga0496110_0166142 | 3300048913 | Bacteria | 2001 |
| 1141 | Ga0496110_0289553 | 3300048913 | Bacteria | 1491 |
| 1142 | Ga0496110_0315894 | 3300048913 | Bacteria | 1423 |
| 1143 | Ga0496110_0385050 | 3300048913 | Bacteria | 1278 |
| 1144 | Ga0496110_0618092 | 3300048913 | Bacteria | 982 |
| 1145 | Ga0496111_0009095 | 3300048914 | Bacteria | 6611 |
| 1146 | Ga0496111_0085324 | 3300048914 | Bacteria | 2309 |
| 1147 | Ga0496111_0144133 | 3300048914 | Bacteria | 1765 |
| 1148 | Ga0496111_0156174 | 3300048914 | Bacteria | 1693 |
| 1149 | Ga0496112_0003249 | 3300048915 | Bacteria | 13400 |
| 1150 | Ga0496112_0049602 | 3300048915 | Bacteria | 4115 |
| 1151 | Ga0496112_0055602 | 3300048915 | Bacteria | 3892 |
| 1152 | Ga0496112_0123797 | 3300048915 | Bacteria | 2557 |
| 1153 | Ga0496112_0133455 | 3300048915 | Bacteria | 2453 |
| 1154 | Ga0496112_0148646 | 3300048915 | Bacteria | 2310 |
| 1155 | Ga0496112_0183184 | 3300048915 | Bacteria | 2058 |
| 1156 | Ga0496112_0212509 | 3300048915 | Bacteria | 1891 |
| 1157 | Ga0496112_0229843 | 3300048915 | Bacteria | 1809 |
| 1158 | Ga0496112_0506737 | 3300048915 | Bacteria | 1142 |
| 1159 | Ga0496113_0009879 | 3300048916 | Bacteria | 6285 |
| 1160 | Ga0496113_0035660 | 3300048916 | Bacteria | 3639 |
| 1161 | Ga0496113_0038460 | 3300048916 | Bacteria | 3518 |
| 1162 | Ga0496113_0051554 | 3300048916 | Bacteria | 3071 |
| 1163 | Ga0496113_0254311 | 3300048916 | Bacteria | 1403 |
| 1164 | Ga0496113_0400697 | 3300048916 | Bacteria | 1102 |
| 1165 | Ga0496114_0019044 | 3300048917 | Bacteria | 5561 |
| 1166 | Ga0496114_0181427 | 3300048917 | Bacteria | 1839 |
| 1167 | Ga0496114_0326089 | 3300048917 | Bacteria | 1357 |
| 1168 | Ga0496114_0468493 | 3300048917 | Bacteria | 1115 |
| 1169 | Ga0496114_0509577 | 3300048917 | Bacteria | 1064 |
| 1170 | Ga0496115_0008727 | 3300048918 | Bacteria | 7514 |
| 1171 | Ga0496115_0014125 | 3300048918 | Bacteria | 6043 |
| 1172 | Ga0496115_0016482 | 3300048918 | Bacteria | 5628 |
| 1173 | Ga0496115_0023060 | 3300048918 | Bacteria | 4828 |
| 1174 | Ga0496115_0028405 | 3300048918 | Bacteria | 4384 |
| 1175 | Ga0496115_0049654 | 3300048918 | Bacteria | 3359 |
| 1176 | Ga0496115_0063285 | 3300048918 | Bacteria | 2984 |
| 1177 | Ga0496115_0076990 | 3300048918 | Bacteria | 2712 |
| 1178 | Ga0496115_0118331 | 3300048918 | Bacteria | 2179 |
| 1179 | Ga0496115_0151874 | 3300048918 | Bacteria | 1913 |
| 1180 | Ga0496115_0271562 | 3300048918 | Bacteria | 1393 |
| 1181 | Ga0496115_0341358 | 3300048918 | Bacteria | 1222 |
| 1182 | Ga0496115_0443580 | 3300048918 | Bacteria | 1049 |
| 1183 | Ga0496115_0464673 | 3300048918 | Bacteria | 1021 |
| 1184 | Ga0496115_0515364 | 3300048918 | Bacteria | 959 |
| 1185 | Ga0496116_0005695 | 3300048919 | Bacteria | 11461 |
| 1186 | Ga0496117_0012118 | 3300048920 | Bacteria | 7645 |
| 1187 | Ga0496117_0155578 | 3300048920 | Bacteria | 1346 |
| 1188 | Ga0496118_0001458 | 3300048921 | Bacteria | 35562 |
| 1189 | Ga0496118_0016977 | 3300048921 | Bacteria | 6648 |
| 1190 | Ga0496118_0040425 | 3300048921 | Bacteria | 3708 |
| 1191 | Ga0496118_0042817 | 3300048921 | Bacteria | 3567 |
| 1192 | Ga0496118_0084764 | 3300048921 | Bacteria | 2209 |
| 1193 | Ga0496118_0241504 | 3300048921 | Bacteria | 1034 |
| 1194 | Ga0496118_0336571 | 3300048921 | Bacteria | 811 |
| 1195 | Ga0496119_0003138 | 3300048922 | Bacteria | 17407 |
| 1196 | Ga0496119_0103754 | 3300048922 | Bacteria | 1592 |
| 1197 | Ga0496119_0107815 | 3300048922 | Bacteria | 1552 |
| 1198 | Ga0496120_0015858 | 3300048923 | Bacteria | 4949 |
| 1199 | Ga0496120_0126500 | 3300048923 | Bacteria | 1314 |
| 1200 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 1201 | Ga0496121_0001525 | 3300048924 | Bacteria | 38839 |
| 1202 | Ga0496121_0002110 | 3300048924 | Bacteria | 31261 |
| 1203 | Ga0496121_0009157 | 3300048924 | Bacteria | 11444 |
| 1204 | Ga0496121_0011985 | 3300048924 | Bacteria | 9532 |
| 1205 | Ga0496121_0014155 | 3300048924 | Bacteria | 8496 |
| 1206 | Ga0496121_0039521 | 3300048924 | Bacteria | 4155 |
| 1207 | Ga0496121_0052038 | 3300048924 | Bacteria | 3443 |
| 1208 | Ga0496121_0163058 | 3300048924 | Bacteria | 1628 |
| 1209 | Ga0496121_0338530 | 3300048924 | Bacteria | 1006 |
| 1210 | Ga0496123_0036461 | 3300048926 | Bacteria | 3487 |
| 1211 | Ga0496124_0002217 | 3300048927 | Bacteria | 25870 |
| 1212 | Ga0496124_0042083 | 3300048927 | Bacteria | 3935 |
| 1213 | Ga0496124_0194246 | 3300048927 | Bacteria | 1550 |
| 1214 | Ga0496124_0376298 | 3300048927 | Bacteria | 995 |
| 1215 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 1216 | Ga0496125_0009421 | 3300048928 | Bacteria | 10037 |
| 1217 | Ga0496125_0024940 | 3300048928 | Bacteria | 5487 |
| 1218 | Ga0496125_0168760 | 3300048928 | Bacteria | 1474 |
| 1219 | Ga0496126_0010429 | 3300048929 | Bacteria | 9736 |
| 1220 | Ga0496126_0016158 | 3300048929 | Bacteria | 7476 |
| 1221 | Ga0496126_0016652 | 3300048929 | Bacteria | 7346 |
| 1222 | Ga0496126_0017576 | 3300048929 | Bacteria | 7125 |
| 1223 | Ga0496126_0020801 | 3300048929 | Bacteria | 6423 |
| 1224 | Ga0496126_0023009 | 3300048929 | Bacteria | 6045 |
| 1225 | Ga0496126_0023765 | 3300048929 | Bacteria | 5934 |
| 1226 | Ga0496126_0026323 | 3300048929 | Bacteria | 5579 |
| 1227 | Ga0496126_0031408 | 3300048929 | Bacteria | 5018 |
| 1228 | Ga0496126_0051578 | 3300048929 | Bacteria | 3744 |
| 1229 | Ga0496126_0063569 | 3300048929 | Bacteria | 3309 |
| 1230 | Ga0496126_0085476 | 3300048929 | Bacteria | 2780 |
| 1231 | Ga0496126_0258195 | 3300048929 | Bacteria | 1450 |
| 1232 | Ga0496126_0404096 | 3300048929 | Bacteria | 1107 |
| 1233 | Ga0495682_0108351 | 3300049460 | Bacteria | 995 |
| 1234 | Ga0501031_0008069 | 3300049568 | Bacteria | 6858 |
| 1235 | Ga0501031_0054785 | 3300049568 | Bacteria | 2598 |
| 1236 | Ga0501031_0090108 | 3300049568 | Bacteria | 2000 |
| 1237 | Ga0501031_0291222 | 3300049568 | Bacteria | 1059 |
| 1238 | Ga0501032_0001954 | 3300049569 | Bacteria | 16232 |
| 1239 | Ga0501032_0011869 | 3300049569 | Bacteria | 6241 |
| 1240 | Ga0501032_0021294 | 3300049569 | Bacteria | 4508 |
| 1241 | Ga0501032_0021620 | 3300049569 | Bacteria | 4472 |
| 1242 | Ga0501032_0061448 | 3300049569 | Bacteria | 2518 |
| 1243 | Ga0501032_0096865 | 3300049569 | Bacteria | 1955 |
| 1244 | Ga0501032_0132292 | 3300049569 | Bacteria | 1645 |
| 1245 | Ga0501032_0168652 | 3300049569 | Bacteria | 1436 |
| 1246 | Ga0501032_0293148 | 3300049569 | Bacteria | 1052 |
| 1247 | Ga0501033_0002836 | 3300049570 | Bacteria | 14522 |
| 1248 | Ga0501033_0014700 | 3300049570 | Bacteria | 5941 |
| 1249 | Ga0501033_0020903 | 3300049570 | Bacteria | 4940 |
| 1250 | Ga0501033_0046459 | 3300049570 | Bacteria | 3228 |
| 1251 | Ga0501033_0046944 | 3300049570 | Bacteria | 3211 |
| 1252 | Ga0501033_0058986 | 3300049570 | Bacteria | 2834 |
| 1253 | Ga0501033_0155119 | 3300049570 | Bacteria | 1650 |
| 1254 | Ga0501033_0170944 | 3300049570 | Bacteria | 1561 |
| 1255 | Ga0501033_0208738 | 3300049570 | Bacteria | 1393 |
| 1256 | Ga0501033_0449577 | 3300049570 | Bacteria | 895 |
| 1257 | Ga0501034_0001164 | 3300049571 | Bacteria | 36430 |
| 1258 | Ga0501034_0020421 | 3300049571 | Bacteria | 6763 |
| 1259 | Ga0501034_0033298 | 3300049571 | Bacteria | 5229 |
| 1260 | Ga0501034_0121101 | 3300049571 | Bacteria | 2603 |
| 1261 | Ga0501034_0134173 | 3300049571 | Bacteria | 2457 |
| 1262 | Ga0501034_0143980 | 3300049571 | Bacteria | 2361 |
| 1263 | Ga0501034_0148564 | 3300049571 | Bacteria | 2320 |
| 1264 | Ga0501034_0150356 | 3300049571 | Bacteria | 2304 |
| 1265 | Ga0501034_0171302 | 3300049571 | Bacteria | 2138 |
| 1266 | Ga0501034_0226278 | 3300049571 | Bacteria | 1821 |
| 1267 | Ga0501034_0229981 | 3300049571 | Bacteria | 1804 |
| 1268 | Ga0501034_0263387 | 3300049571 | Bacteria | 1666 |
| 1269 | Ga0501034_0355461 | 3300049571 | Bacteria | 1393 |
| 1270 | Ga0501034_0363062 | 3300049571 | Bacteria | 1375 |
| 1271 | Ga0501034_0484745 | 3300049571 | Bacteria | 1151 |
| 1272 | Ga0501034_0705014 | 3300049571 | Bacteria | 907 |
| 1273 | Ga0501036_0004082 | 3300049572 | Bacteria | 11750 |
| 1274 | Ga0501036_0019200 | 3300049572 | Bacteria | 5734 |
| 1275 | Ga0501036_0019549 | 3300049572 | Bacteria | 5686 |
| 1276 | Ga0501036_0021130 | 3300049572 | Bacteria | 5466 |
| 1277 | Ga0501036_0048441 | 3300049572 | Bacteria | 3597 |
| 1278 | Ga0501036_0139275 | 3300049572 | Bacteria | 2048 |
| 1279 | Ga0501036_0212497 | 3300049572 | Bacteria | 1625 |
| 1280 | Ga0501036_0212715 | 3300049572 | Bacteria | 1624 |
| 1281 | Ga0501036_0311880 | 3300049572 | Bacteria | 1315 |
| 1282 | Ga0501036_0606017 | 3300049572 | Bacteria | 908 |
| 1283 | Ga0501036_0780449 | 3300049572 | Bacteria | 787 |
| 1284 | Ga0501037_0003537 | 3300049573 | Bacteria | 11343 |
| 1285 | Ga0501037_0005841 | 3300049573 | Bacteria | 8991 |
| 1286 | Ga0501037_0017803 | 3300049573 | Bacteria | 5230 |
| 1287 | Ga0501037_0046499 | 3300049573 | Bacteria | 3182 |
| 1288 | Ga0501037_0051259 | 3300049573 | Bacteria | 3018 |
| 1289 | Ga0501037_0062081 | 3300049573 | Bacteria | 2724 |
| 1290 | Ga0501037_0143591 | 3300049573 | Bacteria | 1708 |
| 1291 | Ga0501037_0267946 | 3300049573 | Bacteria | 1192 |
| 1292 | Ga0501038_0002740 | 3300049574 | Bacteria | 16417 |
| 1293 | Ga0501038_0006198 | 3300049574 | Bacteria | 11061 |
| 1294 | Ga0501038_0018654 | 3300049574 | Bacteria | 6266 |
| 1295 | Ga0501038_0023039 | 3300049574 | Bacteria | 5572 |
| 1296 | Ga0501038_0031994 | 3300049574 | Bacteria | 4645 |
| 1297 | Ga0501038_0081945 | 3300049574 | Bacteria | 2717 |
| 1298 | Ga0501038_0090993 | 3300049574 | Bacteria | 2556 |
| 1299 | Ga0501038_0091798 | 3300049574 | Bacteria | 2543 |
| 1300 | Ga0501038_0120997 | 3300049574 | Bacteria | 2159 |
| 1301 | Ga0501038_0157448 | 3300049574 | Bacteria | 1848 |
| 1302 | Ga0501038_0164147 | 3300049574 | Bacteria | 1803 |
| 1303 | Ga0501038_0223388 | 3300049574 | Bacteria | 1502 |
| 1304 | Ga0501038_0263084 | 3300049574 | Bacteria | 1362 |
| 1305 | Ga0501038_0266641 | 3300049574 | Bacteria | 1351 |
| 1306 | Ga0501038_0300721 | 3300049574 | Bacteria | 1259 |
| 1307 | Ga0501039_0009338 | 3300049575 | Bacteria | 7474 |
| 1308 | Ga0501039_0022255 | 3300049575 | Bacteria | 4866 |
| 1309 | Ga0501039_0081764 | 3300049575 | Bacteria | 2515 |
| 1310 | Ga0501039_0109261 | 3300049575 | Bacteria | 2162 |
| 1311 | Ga0501039_0158349 | 3300049575 | Bacteria | 1779 |
| 1312 | Ga0501039_0274388 | 3300049575 | Bacteria | 1325 |
| 1313 | Ga0501039_0430471 | 3300049575 | Bacteria | 1036 |
| 1314 | Ga0501039_0571526 | 3300049575 | Bacteria | 887 |
| 1315 | Ga0501040_0120309 | 3300049576 | Bacteria | 1842 |
| 1316 | Ga0501041_0076713 | 3300049577 | Bacteria | 2056 |
| 1317 | Ga0501041_0126473 | 3300049577 | Bacteria | 1591 |
| 1318 | Ga0501042_0010994 | 3300049578 | Bacteria | 6092 |
| 1319 | Ga0501042_0012503 | 3300049578 | Bacteria | 5751 |
| 1320 | Ga0501042_0017967 | 3300049578 | Bacteria | 4891 |
| 1321 | Ga0501042_0074867 | 3300049578 | Bacteria | 2423 |
| 1322 | Ga0501042_0473558 | 3300049578 | Bacteria | 909 |
| 1323 | Ga0501043_0006835 | 3300049579 | Bacteria | 9106 |
| 1324 | Ga0501043_0011558 | 3300049579 | Bacteria | 6911 |
| 1325 | Ga0501043_0011619 | 3300049579 | Bacteria | 6893 |
| 1326 | Ga0501043_0011717 | 3300049579 | Bacteria | 6865 |
| 1327 | Ga0501043_0013054 | 3300049579 | Bacteria | 6493 |
| 1328 | Ga0501043_0028696 | 3300049579 | Bacteria | 4368 |
| 1329 | Ga0501043_0036926 | 3300049579 | Bacteria | 3843 |
| 1330 | Ga0501043_0066286 | 3300049579 | Bacteria | 2835 |
| 1331 | Ga0501043_0789610 | 3300049579 | Bacteria | 688 |
| 1332 | Ga0501046_0064616 | 3300049580 | Bacteria | 2856 |
| 1333 | Ga0501046_0093547 | 3300049580 | Bacteria | 2310 |
| 1334 | Ga0501046_0097271 | 3300049580 | Bacteria | 2261 |
| 1335 | Ga0501046_0138831 | 3300049580 | Bacteria | 1840 |
| 1336 | Ga0501046_0141014 | 3300049580 | Bacteria | 1824 |
| 1337 | Ga0501046_0210479 | 3300049580 | Bacteria | 1444 |
| 1338 | Ga0501046_0440589 | 3300049580 | Bacteria | 937 |
| 1339 | Ga0501047_0000459 | 3300049581 | Bacteria | 44977 |
| 1340 | Ga0501047_0017946 | 3300049581 | Bacteria | 6782 |
| 1341 | Ga0501047_0027821 | 3300049581 | Bacteria | 5448 |
| 1342 | Ga0501047_0033478 | 3300049581 | Bacteria | 4960 |
| 1343 | Ga0501047_0067379 | 3300049581 | Bacteria | 3450 |
| 1344 | Ga0501047_0097423 | 3300049581 | Bacteria | 2819 |
| 1345 | Ga0501047_0130507 | 3300049581 | Bacteria | 2393 |
| 1346 | Ga0501047_0217832 | 3300049581 | Bacteria | 1765 |
| 1347 | Ga0501047_0227606 | 3300049581 | Bacteria | 1719 |
| 1348 | Ga0501047_0244786 | 3300049581 | Bacteria | 1643 |
| 1349 | Ga0501047_0362999 | 3300049581 | Bacteria | 1284 |
| 1350 | Ga0501047_0482194 | 3300049581 | Bacteria | 1068 |
| 1351 | Ga0501047_0532842 | 3300049581 | Bacteria | 999 |
| 1352 | Ga0501047_0564595 | 3300049581 | Bacteria | 961 |
| 1353 | Ga0501048_0006170 | 3300049582 | Bacteria | 9124 |
| 1354 | Ga0501048_0025329 | 3300049582 | Bacteria | 4323 |
| 1355 | Ga0501048_0255468 | 3300049582 | Bacteria | 1245 |
| 1356 | Ga0501067_0021596 | 3300049583 | Bacteria | 3562 |
| 1357 | Ga0501067_0035959 | 3300049583 | Bacteria | 2751 |
| 1358 | Ga0501067_0060855 | 3300049583 | Bacteria | 2090 |
| 1359 | Ga0501068_0009003 | 3300049584 | Bacteria | 5570 |
| 1360 | Ga0501068_0050038 | 3300049584 | Bacteria | 2525 |
| 1361 | Ga0501068_0054407 | 3300049584 | Bacteria | 2424 |
| 1362 | Ga0501068_0066912 | 3300049584 | Bacteria | 2188 |
| 1363 | Ga0501068_0207663 | 3300049584 | Bacteria | 1243 |
| 1364 | Ga0501069_0006392 | 3300049585 | Bacteria | 6162 |
| 1365 | Ga0501069_0013979 | 3300049585 | Bacteria | 4288 |
| 1366 | Ga0501069_0061272 | 3300049585 | Bacteria | 2100 |
| 1367 | Ga0501069_0137319 | 3300049585 | Bacteria | 1402 |
| 1368 | Ga0501070_0004886 | 3300049586 | Bacteria | 11453 |
| 1369 | Ga0501070_0020360 | 3300049586 | Bacteria | 5566 |
| 1370 | Ga0501070_0031866 | 3300049586 | Bacteria | 4415 |
| 1371 | Ga0501070_0039798 | 3300049586 | Bacteria | 3920 |
| 1372 | Ga0501070_0102705 | 3300049586 | Bacteria | 2364 |
| 1373 | Ga0501070_0103992 | 3300049586 | Bacteria | 2348 |
| 1374 | Ga0501070_0176529 | 3300049586 | Bacteria | 1758 |
| 1375 | Ga0501070_0196238 | 3300049586 | Bacteria | 1658 |
| 1376 | Ga0501071_0005326 | 3300049587 | Bacteria | 8259 |
| 1377 | Ga0501071_0019248 | 3300049587 | Bacteria | 4736 |
| 1378 | Ga0501071_0057430 | 3300049587 | Bacteria | 2813 |
| 1379 | Ga0501071_0233936 | 3300049587 | Bacteria | 1385 |
| 1380 | Ga0501072_0008657 | 3300049588 | Bacteria | 7724 |
| 1381 | Ga0501072_0008716 | 3300049588 | Bacteria | 7699 |
| 1382 | Ga0501072_0052098 | 3300049588 | Bacteria | 3222 |
| 1383 | Ga0501072_0091966 | 3300049588 | Bacteria | 2409 |
| 1384 | Ga0501072_0227378 | 3300049588 | Bacteria | 1486 |
| 1385 | Ga0501073_0007155 | 3300049589 | Bacteria | 8311 |
| 1386 | Ga0501073_0043909 | 3300049589 | Bacteria | 3151 |
| 1387 | Ga0501073_0085148 | 3300049589 | Bacteria | 2200 |
| 1388 | Ga0501073_0107786 | 3300049589 | Bacteria | 1933 |
| 1389 | Ga0501074_0005374 | 3300049590 | Bacteria | 9216 |
| 1390 | Ga0501074_0034612 | 3300049590 | Bacteria | 3661 |
| 1391 | Ga0501074_0108886 | 3300049590 | Bacteria | 1983 |
| 1392 | Ga0501074_0232754 | 3300049590 | Bacteria | 1311 |
| 1393 | Ga0501074_0276712 | 3300049590 | Bacteria | 1193 |
| 1394 | Ga0501075_0034247 | 3300049591 | Bacteria | 3781 |
| 1395 | Ga0501075_0036537 | 3300049591 | Bacteria | 3667 |
| 1396 | Ga0501075_0388322 | 3300049591 | Bacteria | 1064 |
| 1397 | Ga0501076_0042510 | 3300049592 | Bacteria | 3578 |
| 1398 | Ga0501076_0142250 | 3300049592 | Bacteria | 1949 |
| 1399 | Ga0501076_0258752 | 3300049592 | Bacteria | 1425 |
| 1400 | Ga0501076_0346372 | 3300049592 | Bacteria | 1220 |
| 1401 | Ga0501076_0568361 | 3300049592 | Bacteria | 935 |
| 1402 | Ga0501077_0038583 | 3300049593 | Bacteria | 3042 |
| 1403 | Ga0501079_0025191 | 3300049741 | Bacteria | 4563 |
| 1404 | Ga0501079_0025723 | 3300049741 | Bacteria | 4513 |
| 1405 | Ga0501079_0064159 | 3300049741 | Bacteria | 2833 |
| 1406 | Ga0501079_0066273 | 3300049741 | Bacteria | 2786 |
| 1407 | Ga0501079_0297363 | 3300049741 | Bacteria | 1263 |
| 1408 | Ga0501080_0030655 | 3300049742 | Bacteria | 5011 |
| 1409 | Ga0501080_0043911 | 3300049742 | Bacteria | 4161 |
| 1410 | Ga0501080_0043954 | 3300049742 | Bacteria | 4159 |
| 1411 | Ga0501080_0058203 | 3300049742 | Bacteria | 3597 |
| 1412 | Ga0501080_0091459 | 3300049742 | Bacteria | 2826 |
| 1413 | Ga0501080_0133557 | 3300049742 | Bacteria | 2297 |
| 1414 | Ga0501080_0181143 | 3300049742 | Bacteria | 1938 |
| 1415 | Ga0501080_0218911 | 3300049742 | Bacteria | 1743 |
| 1416 | Ga0501080_0280095 | 3300049742 | Bacteria | 1516 |
| 1417 | Ga0501080_0369480 | 3300049742 | Bacteria | 1293 |
| 1418 | Ga0501080_0373475 | 3300049742 | Bacteria | 1285 |
| 1419 | Ga0501081_0035257 | 3300049743 | Bacteria | 3406 |
| 1420 | Ga0501081_0058062 | 3300049743 | Bacteria | 2677 |
| 1421 | Ga0501081_0089128 | 3300049743 | Bacteria | 2168 |
| 1422 | Ga0501083_0007711 | 3300049744 | Bacteria | 7629 |
| 1423 | Ga0501083_0027167 | 3300049744 | Bacteria | 3950 |
| 1424 | Ga0501083_0104974 | 3300049744 | Bacteria | 1861 |
| 1425 | Ga0501083_0125908 | 3300049744 | Bacteria | 1679 |
| 1426 | Ga0501083_0193282 | 3300049744 | Bacteria | 1328 |
| 1427 | Ga0501035_0018143 | 3300049822 | Bacteria | 6484 |
| 1428 | Ga0501035_0020783 | 3300049822 | Bacteria | 6032 |
| 1429 | Ga0501035_0045393 | 3300049822 | Bacteria | 3953 |
| 1430 | Ga0501035_0049633 | 3300049822 | Bacteria | 3760 |
| 1431 | Ga0501035_0081794 | 3300049822 | Bacteria | 2850 |
| 1432 | Ga0501035_0086966 | 3300049822 | Bacteria | 2754 |
| 1433 | Ga0501035_0159064 | 3300049822 | Bacteria | 1956 |
| 1434 | Ga0501035_0215697 | 3300049822 | Bacteria | 1640 |
| 1435 | Ga0501035_0241991 | 3300049822 | Bacteria | 1534 |
| 1436 | Ga0501035_0334296 | 3300049822 | Bacteria | 1270 |
| 1437 | Ga0501035_0718269 | 3300049822 | Bacteria | 804 |
| 1438 | Ga0501044_0002231 | 3300049823 | Bacteria | 22176 |
| 1439 | Ga0501044_0014745 | 3300049823 | Bacteria | 8425 |
| 1440 | Ga0501044_0018639 | 3300049823 | Bacteria | 7433 |
| 1441 | Ga0501044_0021198 | 3300049823 | Bacteria | 6937 |
| 1442 | Ga0501044_0034684 | 3300049823 | Bacteria | 5289 |
| 1443 | Ga0501044_0039939 | 3300049823 | Bacteria | 4892 |
| 1444 | Ga0501044_0048900 | 3300049823 | Bacteria | 4365 |
| 1445 | Ga0501044_0060711 | 3300049823 | Bacteria | 3869 |
| 1446 | Ga0501044_0087183 | 3300049823 | Bacteria | 3153 |
| 1447 | Ga0501044_0101310 | 3300049823 | Bacteria | 2897 |
| 1448 | Ga0501044_0130947 | 3300049823 | Bacteria | 2502 |
| 1449 | Ga0501044_0159049 | 3300049823 | Bacteria | 2237 |
| 1450 | Ga0501044_0178512 | 3300049823 | Bacteria | 2091 |
| 1451 | Ga0501044_0214366 | 3300049823 | Bacteria | 1878 |
| 1452 | Ga0501044_0353299 | 3300049823 | Bacteria | 1389 |
| 1453 | Ga0501045_0002076 | 3300049824 | Bacteria | 13532 |
| 1454 | Ga0501045_0096301 | 3300049824 | Bacteria | 2190 |
| 1455 | Ga0501045_0295435 | 3300049824 | Bacteria | 1205 |
| 1456 | nmdc:mga03683_83704_c1 | 3300050489 | Bacteria | 1381 |
| 1457 | nmdc:mga03683_90099_c1 | 3300050489 | Bacteria | 1336 |
| 1458 | nmdc:mga03n38_1503_c1 | 3300050490 | Bacteria | 6729 |
| 1459 | nmdc:mga03n38_233632_c1 | 3300050490 | Bacteria | 965 |
| 1460 | nmdc:mga00v17_16115_c1 | 3300050491 | Bacteria | 4209 |
| 1461 | nmdc:mga00v17_40834_c1 | 3300050491 | Bacteria | 2784 |
| 1462 | nmdc:mga00v17_45574_c1 | 3300050491 | Bacteria | 2650 |
| 1463 | nmdc:mga0yw44_111229_c1 | 3300050492 | Bacteria | 1755 |
| 1464 | nmdc:mga0yw44_12558_c1 | 3300050492 | Bacteria | 4421 |
| 1465 | nmdc:mga0yw44_13089_c1 | 3300050492 | Bacteria | 4353 |
| 1466 | nmdc:mga0yw44_136533_c1 | 3300050492 | Bacteria | 1591 |
| 1467 | nmdc:mga0yw44_4562_c1 | 3300050492 | Bacteria | 6380 |
| 1468 | nmdc:mga0yw44_67357_c1 | 3300050492 | Bacteria | 2213 |
| 1469 | nmdc:mga0yw44_7371_c1 | 3300050492 | Bacteria | 5407 |
| 1470 | nmdc:mga0yw44_89468_c1 | 3300050492 | Bacteria | 1943 |
| 1471 | nmdc:mga0k408_170998_c1 | 3300050493 | Bacteria | 1295 |
| 1472 | nmdc:mga0k408_213452_c1 | 3300050493 | Bacteria | 1152 |
| 1473 | nmdc:mga0k408_2577_c1 | 3300050493 | Bacteria | 9620 |
| 1474 | nmdc:mga0k408_319818_c1 | 3300050493 | Bacteria | 926 |
| 1475 | nmdc:mga06z11_44377_c1 | 3300050494 | Bacteria | 2241 |
| 1476 | nmdc:mga06z11_7051_c1 | 3300050494 | Bacteria | 4608 |
| 1477 | nmdc:mga06z11_71486_c1 | 3300050494 | Bacteria | 1837 |
| 1478 | nmdc:mga07m45_210203_c1 | 3300050496 | Bacteria | 1132 |
| 1479 | nmdc:mga07m45_31160_c2 | 3300050496 | Bacteria | 2466 |
| 1480 | nmdc:mga07m45_314260_c1 | 3300050496 | Bacteria | 911 |
| 1481 | nmdc:mga07m45_52290_c1 | 3300050496 | Bacteria | 2306 |
| 1482 | nmdc:mga07m45_8008_c2 | 3300050496 | Bacteria | 4951 |
| 1483 | nmdc:mga05p37_15155_c1 | 3300050507 | Bacteria | 9257 |
| 1484 | nmdc:mga05p37_15592_c1 | 3300050507 | Bacteria | 9133 |
| 1485 | nmdc:mga05p37_228749_c1 | 3300050507 | Bacteria | 2241 |
| 1486 | nmdc:mga05p37_43733_c1 | 3300050507 | Bacteria | 5511 |
| 1487 | nmdc:mga05p37_61857_c1 | 3300050507 | Bacteria | 4608 |
| 1488 | nmdc:mga05p37_75724_c1 | 3300050507 | Bacteria | 4142 |
| 1489 | nmdc:mga09592_163826_c1 | 3300050508 | Bacteria | 1921 |
| 1490 | nmdc:mga09592_347349_c1 | 3300050508 | Bacteria | 1284 |
| 1491 | nmdc:mga0qj67_129757_c1 | 3300050509 | Bacteria | 2041 |
| 1492 | nmdc:mga0qj67_174206_c1 | 3300050509 | Bacteria | 1747 |
| 1493 | nmdc:mga0qj67_23_c1 | 3300050509 | Bacteria | 107313 |
| 1494 | nmdc:mga0qj67_342693_c1 | 3300050509 | Bacteria | 1209 |
| 1495 | nmdc:mga06r32_114845_c1 | 3300050510 | Bacteria | 2651 |
| 1496 | nmdc:mga06r32_180066_c1 | 3300050510 | Bacteria | 2099 |
| 1497 | nmdc:mga06r32_236994_c1 | 3300050510 | Bacteria | 1812 |
| 1498 | nmdc:mga06r32_698987_c1 | 3300050510 | Bacteria | 980 |
| 1499 | nmdc:mga08y16_110431_c1 | 3300050511 | Bacteria | 2863 |
| 1500 | nmdc:mga08y16_207571_c1 | 3300050511 | Bacteria | 2029 |
| 1501 | nmdc:mga08y16_211963_c1 | 3300050511 | Bacteria | 2006 |
| 1502 | nmdc:mga08y16_243991_c1 | 3300050511 | Bacteria | 1856 |
| 1503 | nmdc:mga08y16_739151_c1 | 3300050511 | Bacteria | 981 |
| 1504 | nmdc:mga0n895_398372_c1 | 3300050512 | Bacteria | 1392 |
| 1505 | nmdc:mga0n895_56085_c1 | 3300050512 | Bacteria | 3880 |
| 1506 | nmdc:mga0n895_968228_c1 | 3300050512 | Bacteria | 833 |
| 1507 | nmdc:mga0rr50_311947_c1 | 3300050513 | Bacteria | 1317 |
| 1508 | nmdc:mga08x19_2830_c1 | 3300050514 | Bacteria | 10471 |
| 1509 | nmdc:mga08x19_50181_c1 | 3300050514 | Bacteria | 2677 |
| 1510 | nmdc:mga0a205_145557_c1 | 3300050515 | Bacteria | 2269 |
| 1511 | nmdc:mga0a205_252815_c1 | 3300050515 | Bacteria | 1173 |
| 1512 | nmdc:mga0a205_270132_c1 | 3300050515 | Bacteria | 1577 |
| 1513 | nmdc:mga0sz30_134503_c1 | 3300050516 | Bacteria | 1090 |
| 1514 | nmdc:mga0sz30_142620_c1 | 3300050516 | Bacteria | 1058 |
| 1515 | nmdc:mga0sz30_14398_c1 | 3300050516 | Bacteria | 3112 |
| 1516 | nmdc:mga0sz30_243354_c1 | 3300050516 | Bacteria | 801 |
| 1517 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 1518 | Ga0495601_0039057 | 3300053077 | Bacteria | 2971 |
| 1519 | Ga0495601_0055874 | 3300053077 | Bacteria | 2500 |
| 1520 | Ga0495601_0057707 | 3300053077 | Bacteria | 2459 |
| 1521 | Ga0495601_0065435 | 3300053077 | Bacteria | 2314 |
| 1522 | Ga0495601_0145261 | 3300053077 | Bacteria | 1548 |
| 1523 | Ga0495601_0162009 | 3300053077 | Bacteria | 1462 |
| 1524 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 1525 | Ga0495612_0000377 | 3300053078 | Bacteria | 17864 |
| 1526 | Ga0495612_0025416 | 3300053078 | Bacteria | 2377 |
| 1527 | Ga0495612_0027882 | 3300053078 | Bacteria | 2272 |
| 1528 | Ga0495612_0036305 | 3300053078 | Bacteria | 2000 |
| 1529 | Ga0495612_0050490 | 3300053078 | Bacteria | 1708 |
| 1530 | Ga0500635_0015217 | 3300053080 | Bacteria | 2268 |
| 1531 | Ga0495655_0007211 | 3300053083 | Bacteria | 2057 |
| 1532 | Ga0495655_0028734 | 3300053083 | Bacteria | 1331 |
| 1533 | Ga0495655_0078535 | 3300053083 | Bacteria | 938 |
| 1534 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 1535 | Ga0495595_0063768 | 3300053084 | Bacteria | 1730 |
| 1536 | Ga0495595_0086540 | 3300053084 | Bacteria | 1499 |
| 1537 | Ga0495595_0105047 | 3300053084 | Bacteria | 1366 |
| 1538 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 1539 | Ga0495619_0004501 | 3300053085 | Bacteria | 8901 |
| 1540 | Ga0495619_0016798 | 3300053085 | Bacteria | 4634 |
| 1541 | Ga0495619_0120537 | 3300053085 | Bacteria | 1798 |
| 1542 | Ga0500643_020457 | 3300053087 | Bacteria | 2164 |
| 1543 | Ga0500644_0007090 | 3300053088 | Bacteria | 2904 |
| 1544 | Ga0500651_0052786 | 3300053093 | Bacteria | 2549 |
| 1545 | Ga0500566_0000574 | 3300053094 | Bacteria | 20705 |
| 1546 | Ga0500641_0001161 | 3300053096 | Bacteria | 9380 |
| 1547 | Ga0500648_158849 | 3300053097 | Bacteria | 1192 |
| 1548 | Ga0500650_0003432 | 3300053098 | Bacteria | 5509 |
| 1549 | Ga0500554_002421 | 3300053102 | Bacteria | 3668 |
| 1550 | Ga0500554_008523 | 3300053102 | Bacteria | 2414 |
| 1551 | Ga0500556_0000035 | 3300053104 | Bacteria | 145357 |
| 1552 | Ga0500557_000096 | 3300053105 | Bacteria | 28838 |
| 1553 | Ga0500562_060723 | 3300053108 | Bacteria | 1015 |
| 1554 | Ga0500569_001632 | 3300053109 | Bacteria | 4268 |
| 1555 | Ga0500572_000335 | 3300053111 | Bacteria | 16881 |
| 1556 | Ga0500593_000214 | 3300053117 | Bacteria | 23896 |
| 1557 | Ga0500594_0095949 | 3300053118 | Bacteria | 906 |
| 1558 | Ga0500595_000728 | 3300053119 | Bacteria | 19571 |
| 1559 | Ga0500595_061714 | 3300053119 | Bacteria | 1130 |
| 1560 | Ga0500608_000269 | 3300053122 | Bacteria | 20074 |
| 1561 | Ga0500608_091250 | 3300053122 | Bacteria | 1424 |
| 1562 | Ga0500618_012006 | 3300053125 | Bacteria | 2280 |
| 1563 | Ga0500642_0000027 | 3300053130 | Bacteria | 119688 |
| 1564 | Ga0500642_0000083 | 3300053130 | Bacteria | 50718 |
| 1565 | Ga0500642_0062311 | 3300053130 | Bacteria | 1678 |
| 1566 | Ga0500642_0200788 | 3300053130 | Bacteria | 928 |
| 1567 | Ga0500652_000529 | 3300053131 | Bacteria | 13438 |
| 1568 | Ga0500658_0118352 | 3300053134 | Bacteria | 1172 |
| 1569 | Ga0500559_0000064 | 3300053136 | Bacteria | 85844 |
| 1570 | Ga0500559_0018562 | 3300053136 | Bacteria | 2938 |
| 1571 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 1572 | Ga0500568_0000443 | 3300053139 | Bacteria | 31089 |
| 1573 | Ga0500568_0042567 | 3300053139 | Bacteria | 1819 |
| 1574 | Ga0500568_0073161 | 3300053139 | Bacteria | 1309 |
| 1575 | Ga0500577_0006124 | 3300053142 | Bacteria | 3294 |
| 1576 | Ga0500586_003676 | 3300053145 | Bacteria | 3663 |
| 1577 | Ga0500590_133389 | 3300053148 | Bacteria | 1146 |
| 1578 | Ga0500603_003284 | 3300053150 | Bacteria | 3475 |
| 1579 | Ga0500603_008634 | 3300053150 | Bacteria | 2266 |
| 1580 | Ga0500604_0059408 | 3300053151 | Bacteria | 1197 |
| 1581 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 1582 | Ga0500616_0051631 | 3300053153 | Bacteria | 2166 |
| 1583 | Ga0500622_0003640 | 3300053156 | Bacteria | 10132 |
| 1584 | Ga0500627_0008813 | 3300053158 | Bacteria | 3602 |
| 1585 | Ga0500627_0017323 | 3300053158 | Bacteria | 2829 |
| 1586 | Ga0500634_0107652 | 3300053161 | Bacteria | 1382 |
| 1587 | Ga0500638_007140 | 3300053162 | Bacteria | 4643 |
| 1588 | Ga0500638_135408 | 3300053162 | Bacteria | 1112 |
| 1589 | Ga0500639_062231 | 3300053163 | Bacteria | 1921 |
| 1590 | Ga0500636_0001203 | 3300053177 | Bacteria | 13970 |
| 1591 | Ga0500636_0024967 | 3300053177 | Bacteria | 3532 |
| 1592 | Ga0500636_0103701 | 3300053177 | Bacteria | 1613 |
| 1593 | Ga0500637_0000080 | 3300053178 | Bacteria | 34464 |
| 1594 | Ga0500637_0057596 | 3300053178 | Bacteria | 2221 |
| 1595 | Ga0500637_0213287 | 3300053178 | Bacteria | 1094 |
| 1596 | Ga0500649_119607 | 3300053722 | Bacteria | 1006 |
| 1597 | Ga0500570_088450 | 3300053724 | Bacteria | 1360 |
| 1598 | Ga0500576_032854 | 3300053725 | Bacteria | 2352 |
| 1599 | Ga0500657_105723 | 3300053728 | Bacteria | 1150 |
| 1600 | Ga0500625_026577 | 3300053729 | Bacteria | 2742 |
| 1601 | Ga0500645_015265 | 3300053730 | Bacteria | 2435 |
| 1602 | Ga0500596_009139 | 3300053735 | Bacteria | 1555 |
| 1603 | Ga0501084_0050780 | 3300054114 | Bacteria | 3470 |
| 1604 | Ga0501084_0156725 | 3300054114 | Bacteria | 1920 |
| 1605 | Ga0501084_0208137 | 3300054114 | Bacteria | 1650 |
| 1606 | Ga0501084_0237414 | 3300054114 | Bacteria | 1539 |
| 1607 | Ga0501084_0593749 | 3300054114 | Bacteria | 936 |
| 1608 | Ga0500661_001305 | 3300055283 | Bacteria | 4654 |
| 1609 | Ga0501082_0008815 | 3300060353 | Bacteria | 8699 |
| 1610 | Ga0501082_0078861 | 3300060353 | Bacteria | 2840 |
| 1611 | Ga0501082_0102542 | 3300060353 | Bacteria | 2475 |
| 1612 | Ga0501082_0144600 | 3300060353 | Bacteria | 2064 |
| 1613 | Ga0501082_0238226 | 3300060353 | Bacteria | 1583 |
| 1614 | Ga0501082_0525482 | 3300060353 | Bacteria | 1034 |
| 1615 | Ga0530510_0069935 | 3300061734 | Bacteria | 2547 |
| 1616 | Ga0530510_0090885 | 3300061734 | Bacteria | 2227 |
| 1617 | Ga0530510_0150706 | 3300061734 | Bacteria | 1717 |
| 1618 | Ga0530510_0196700 | 3300061734 | Bacteria | 1497 |
| 1619 | Ga0530510_0239313 | 3300061734 | Bacteria | 1351 |
| 1620 | 2509146536 | 2508501128 | Bacteria | 8613869 |
| 1621 | 2513655382 | 2513237096 | Bacteria | 8722461 |
| 1622 | 2513672531 | 2513237098 | Bacteria | 9902361 |
| 1623 | 2513702471 | 2513237102 | Bacteria | 7703324 |
| 1624 | 2513716787 | 2513237104 | Bacteria | 10034502 |
| 1625 | 2513860054 | 2513237137 | Bacteria | 9558895 |
| 1626 | 2513892410 | 2513237141 | Bacteria | 8496279 |
| 1627 | 2513916540 | 2513237145 | Bacteria | 8979722 |
| 1628 | 2517889869 | 2517572143 | Bacteria | 9484767 |
| 1629 | 2524466685 | 2524023210 | Bacteria | 9029266 |
| 1630 | 2524532943 | 2524023228 | Bacteria | 10118060 |
| 1631 | 2603860655 | 2602042107 | Bacteria | 6226103 |
| 1632 | 2644290242 | 2643221651 | Bacteria | 4798932 |
| 1633 | 2671121107 | 2667528175 | Bacteria | 7532676 |
| 1634 | 2728751736 | 2728368998 | Bacteria | 8720350 |
| 1635 | 2793073401 | 2791355197 | Bacteria | 8420563 |
| 1636 | 2824618912 | 2824617872 | Bacteria | 8814715 |
| 1637 | 2824632928 | 2824626560 | Bacteria | 8813858 |
| 1638 | 2824642627 | 2824635225 | Bacteria | 8785348 |
| 1639 | 2824650875 | 2824644064 | Bacteria | 8743947 |
| 1640 | 2824720727 | 2824714736 | Bacteria | 8717648 |
| 1641 | 2824730671 | 2824723954 | Bacteria | 8758240 |
| 1642 | 2844321368 | 2844315083 | Bacteria | 8138177 |
| 1643 | 2857525614 | 2857524615 | Bacteria | 6615449 |
| 1644 | 2881367755 | 2881364244 | Bacteria | 7710352 |
| 1645 | 2893070662 | 2893066018 | Bacteria | 6158120 |
| 1646 | 2903731442 | 2903727486 | Bacteria | 8281579 |
| 1647 | 2903749011 | 2903748898 | Bacteria | 9972761 |
| 1648 | 2903775927 | 2903768456 | Bacteria | 9749579 |
| 1649 | 2904692694 | 2904690495 | Bacteria | 9412302 |
| 1650 | 2904711210 | |||
| 1651 | 2906607982 | 2906602504 | Bacteria | 8295279 |
| 1652 | 2906612394 | |||
| 1653 | 2906637846 | 2906635258 | Bacteria | 8601019 |
| 1654 | 2906663435 | 2906660503 | Bacteria | 8595048 |
| 1655 | 2908757666 | 2908756301 | Bacteria | 8864324 |
| 1656 | 2919074578 | 2919073203 | Bacteria | 6531949 |
| 1657 | 2922391546 | 2922386360 | Bacteria | 7017218 |
| 1658 | 2922426899 | |||
| 1659 | 2935633060 | 2935630451 | Bacteria | 8169952 |
| 1660 | 2941509638 | 2941507105 | Bacteria | 8166816 |
| 1661 | 2941517467 | 2941515067 | Bacteria | 8166720 |
| 1662 | 2941526580 | 2941523033 | Bacteria | 8169134 |
| 1663 | 3005485976 | 3005483717 | Bacteria | 7877331 |
| 1664 | 3005591798 | 3005587118 | Bacteria | 7794411 |
| 1665 | 3005601720 | 3005594810 | Bacteria | 8716512 |
| 1666 | 8006937398 | 8006933436 | Bacteria | 10410654 |
| 1667 | 8006977427 | 8006973647 | Bacteria | 10679141 |
| 1668 | 8019561228 | 8019555841 | Bacteria | 9642137 |
| 1669 | 8019571318 | 8019565922 | Bacteria | 9639779 |
| 1670 | 8054567645 | 8054563764 | Bacteria | 5592885 |
| 1671 | 8056678903 | 8056673599 | Bacteria | 7871253 |
| 1672 | 8056685485 | 8056681323 | Bacteria | 8472857 |
| 1673 | 8056692023 | 8056689827 | Bacteria | 6712655 |
| 1674 | 8056971817 | 8056967851 | Bacteria | 9038162 |
| 1675 | Ga0105239_10040946 | |||
| 1676 | JGI24739J22299_10004386 | |||
| 1677 | JGI24737J22298_10036272 | |||
| 1678 | JGI24735J21928_10043583 | |||
| 1679 | JGI24744J21845_10016883 | |||
| 1680 | JGI25406J46586_10000123 | |||
| 1681 | JGI25406J46586_10002008 | |||
| 1682 | JGI25406J46586_10011288 | |||
| 1683 | JGI25153J46596_10013220 | |||
| 1684 | JGI25404J52841_10006783 | |||
| 1685 | JGI25404J52841_10029708 | |||
| 1686 | Ga0065165_1077181 | |||
| 1687 | Ga0070676_10160260 | |||
| 1688 | Ga0070676_10469751 | |||
| 1689 | Ga0070683_100652076 | |||
| 1690 | Ga0070690_100015033 | |||
| 1691 | Ga0070690_100035314 | |||
| 1692 | Ga0070690_100097902 | |||
| 1693 | Ga0070690_100325104 | |||
| 1694 | Ga0070670_100015459 | |||
| 1695 | Ga0070670_100018725 | |||
| 1696 | Ga0070670_100022211 | |||
| 1697 | Ga0070670_100028912 | |||
| 1698 | Ga0070677_10003744 | |||
| 1699 | Ga0070666_10044995 | |||
| 1700 | Ga0070666_10066295 | |||
| 1701 | Ga0070666_10148576 | |||
| 1702 | Ga0070680_100173606 | |||
| 1703 | Ga0070680_100264188 | |||
| 1704 | Ga0070680_100287855 | |||
| 1705 | Ga0068868_100015983 | |||
| 1706 | Ga0068868_100040355 | |||
| 1707 | Ga0068868_100080496 | |||
| 1708 | Ga0068868_100509881 | |||
| 1709 | Ga0070660_100112612 | |||
| 1710 | Ga0070660_100166316 | |||
| 1711 | Ga0070689_100003230 | |||
| 1712 | Ga0070689_100012114 | |||
| 1713 | Ga0070689_100013407 | |||
| 1714 | Ga0070689_100017936 | |||
| 1715 | Ga0070691_10030581 | |||
| 1716 | Ga0070687_100005935 | |||
| 1717 | Ga0070687_100183708 | |||
| 1718 | Ga0070661_100076325 | |||
| 1719 | Ga0070661_100229369 | |||
| 1720 | Ga0070661_100259604 | |||
| 1721 | Ga0070661_100339875 | |||
| 1722 | Ga0070668_100155491 | |||
| 1723 | Ga0070668_100277548 | |||
| 1724 | Ga0070669_100203534 | |||
| 1725 | Ga0070669_100258011 | |||
| 1726 | Ga0070675_100013324 | |||
| 1727 | Ga0070675_100049538 | |||
| 1728 | Ga0070675_100267317 | |||
| 1729 | Ga0070675_100373682 | |||
| 1730 | Ga0070675_100405536 | |||
| 1731 | Ga0070671_100001610 | |||
| 1732 | Ga0070671_100007034 | |||
| 1733 | Ga0070671_100457826 | |||
| 1734 | Ga0070674_100002026 | |||
| 1735 | Ga0070674_100053105 | |||
| 1736 | Ga0070674_100056484 | |||
| 1737 | Ga0070674_100212106 | |||
| 1738 | Ga0070673_100037233 | |||
| 1739 | Ga0070673_100046009 | |||
| 1740 | Ga0070673_100184639 | |||
| 1741 | Ga0070673_100386636 | |||
| 1742 | Ga0070688_100005393 | |||
| 1743 | Ga0070688_100018452 | |||
| 1744 | Ga0070688_100079337 | |||
| 1745 | Ga0070688_100120457 | |||
| 1746 | Ga0070659_100256257 | |||
| 1747 | Ga0070659_100269598 | |||
| 1748 | Ga0070667_100130204 | |||
| 1749 | Ga0070667_100222310 | |||
| 1750 | Ga0070667_100318711 | |||
| 1751 | Ga0070709_10003714 | |||
| 1752 | Ga0070709_10010860 | |||
| 1753 | Ga0070709_10016287 | |||
| 1754 | Ga0070709_10035409 | |||
| 1755 | Ga0070709_10365416 | |||
| 1756 | Ga0070709_10385356 | |||
| 1757 | Ga0070709_10446297 | |||
| 1758 | Ga0070714_100004426 | |||
| 1759 | Ga0070714_100019687 | |||
| 1760 | Ga0070714_100110011 | |||
| 1761 | Ga0070714_100134438 | |||
| 1762 | Ga0070714_100192220 | |||
| 1763 | Ga0070714_100361523 | |||
| 1764 | Ga0070714_100431304 | |||
| 1765 | Ga0070714_100486162 | |||
| 1766 | Ga0070713_100004454 | |||
| 1767 | Ga0070713_100037805 | |||
| 1768 | Ga0070713_100069892 | |||
| 1769 | Ga0070713_100090424 | |||
| 1770 | Ga0070713_100421166 | |||
| 1771 | Ga0070713_100541114 | |||
| 1772 | Ga0070713_100681252 | |||
| 1773 | Ga0070710_10004296 | |||
| 1774 | Ga0070710_10007859 | |||
| 1775 | Ga0070710_10101370 | |||
| 1776 | Ga0070701_10009849 | |||
| 1777 | Ga0070711_100013653 | |||
| 1778 | Ga0070711_100079146 | |||
| 1779 | Ga0070711_100081895 | |||
| 1780 | Ga0070711_100209201 | |||
| 1781 | Ga0070711_100623380 | |||
| 1782 | Ga0070711_100648559 | |||
| 1783 | Ga0070700_100008437 | |||
| 1784 | Ga0070700_100065836 | |||
| 1785 | Ga0070700_100368336 | |||
| 1786 | Ga0070663_100050622 | |||
| 1787 | Ga0070663_100078596 | |||
| 1788 | Ga0070663_100084289 | |||
| 1789 | Ga0070663_100124267 | |||
| 1790 | Ga0070678_100043308 | |||
| 1791 | Ga0070678_100172924 | |||
| 1792 | Ga0070678_100196307 | |||
| 1793 | Ga0070678_100816699 | |||
| 1794 | Ga0070662_100161339 | |||
| 1795 | Ga0070681_10008600 | |||
| 1796 | Ga0070681_10056463 | |||
| 1797 | Ga0070681_10073742 | |||
| 1798 | Ga0070681_10093747 | |||
| 1799 | Ga0070681_10130798 | |||
| 1800 | Ga0070681_10449461 | |||
| 1801 | Ga0068867_100027107 | |||
| 1802 | Ga0068867_100398096 | |||
| 1803 | Ga0070685_10013633 | |||
| 1804 | Ga0070698_100495937 | |||
| 1805 | Ga0070698_100671425 | |||
| 1806 | Ga0070699_100004951 | |||
| 1807 | Ga0070679_100008568 | |||
| 1808 | Ga0070679_100012111 | |||
| 1809 | Ga0070679_100075408 | |||
| 1810 | Ga0070679_100119920 | |||
| 1811 | Ga0070679_100422188 | |||
| 1812 | Ga0070684_100027940 | |||
| 1813 | Ga0070684_100148121 | |||
| 1814 | Ga0070684_100212676 | |||
| 1815 | Ga0070697_100026984 | |||
| 1816 | Ga0070697_100460557 | |||
| 1817 | Ga0068853_100026288 | |||
| 1818 | Ga0068853_100049178 | |||
| 1819 | Ga0068853_100075350 | |||
| 1820 | Ga0068853_100089098 | |||
| 1821 | Ga0068853_100223183 | |||
| 1822 | Ga0068853_100427623 | |||
| 1823 | Ga0070672_100035470 | |||
| 1824 | Ga0070672_100128515 | |||
| 1825 | Ga0070672_100229123 | |||
| 1826 | Ga0070686_100018490 | |||
| 1827 | Ga0070696_100290547 | |||
| 1828 | Ga0070693_100019524 | |||
| 1829 | Ga0070693_100050777 | |||
| 1830 | Ga0070693_100363524 | |||
| 1831 | Ga0070665_100100848 | |||
| 1832 | Ga0070665_100133374 | |||
| 1833 | Ga0070665_100255887 | |||
| 1834 | Ga0070665_100419582 | |||
| 1835 | Ga0070704_100055201 | |||
| 1836 | Ga0070704_100061113 | |||
| 1837 | Ga0068855_100125468 | |||
| 1838 | Ga0068855_100136451 | |||
| 1839 | Ga0068855_100148989 | |||
| 1840 | Ga0068855_100187013 | |||
| 1841 | Ga0068855_100400596 | |||
| 1842 | Ga0068855_100442924 | |||
| 1843 | Ga0068855_100866528 | |||
| 1844 | Ga0070664_100221821 | |||
| 1845 | Ga0070664_100311239 | |||
| 1846 | Ga0068857_100123071 | |||
| 1847 | Ga0068857_100316031 | |||
| 1848 | Ga0068854_100008298 | |||
| 1849 | Ga0068854_100017829 | |||
| 1850 | Ga0068854_100175095 | |||
| 1851 | Ga0068856_100006410 | |||
| 1852 | Ga0068856_100019463 | |||
| 1853 | Ga0068856_100077437 | |||
| 1854 | Ga0068856_100097345 | |||
| 1855 | Ga0068856_100492401 | |||
| 1856 | Ga0070702_100026608 | |||
| 1857 | Ga0068852_100016237 | |||
| 1858 | Ga0068852_100108085 | |||
| 1859 | Ga0068852_100260370 | |||
| 1860 | Ga0068852_100708737 | |||
| 1861 | Ga0068859_100046809 | |||
| 1862 | Ga0068859_100178426 | |||
| 1863 | Ga0068859_100316000 | |||
| 1864 | Ga0068859_100401058 | |||
| 1865 | Ga0068859_100591992 | |||
| 1866 | Ga0068859_100757730 | |||
| 1867 | Ga0068864_100030864 | |||
| 1868 | Ga0068864_100193359 | |||
| 1869 | Ga0068864_100378621 | |||
| 1870 | Ga0068866_10155194 | |||
| 1871 | Ga0068866_10187795 | |||
| 1872 | Ga0068861_100038870 | |||
| 1873 | Ga0068861_100621031 | |||
| 1874 | Ga0068861_100741690 | |||
| 1875 | Ga0068861_100866072 | |||
| 1876 | Ga0068851_10003850 | |||
| 1877 | Ga0068851_10042924 | |||
| 1878 | Ga0068870_10002916 | |||
| 1879 | Ga0068870_10120381 | |||
| 1880 | Ga0068863_100025497 | |||
| 1881 | Ga0068858_100074670 | |||
| 1882 | Ga0068858_100088274 | |||
| 1883 | Ga0068860_100003385 | |||
| 1884 | Ga0068860_100734013 | |||
| 1885 | Ga0068862_100026407 | |||
| 1886 | Ga0081455_10029463 | |||
| 1887 | Ga0081455_10050468 | |||
| 1888 | Ga0081455_10069468 | |||
| 1889 | Ga0081455_10086007 | |||
| 1890 | Ga0081455_10089463 | |||
| 1891 | Ga0081455_10188683 | |||
| 1892 | Ga0081455_10298241 | |||
| 1893 | Ga0081538_10009993 | |||
| 1894 | Ga0081538_10021985 | |||
| 1895 | Ga0081538_10151176 | |||
| 1896 | Ga0081538_10179447 | |||
| 1897 | Ga0081540_1000297 | |||
| 1898 | Ga0081540_1005566 | |||
| 1899 | Ga0081540_1005578 | |||
| 1900 | Ga0081540_1005635 | |||
| 1901 | Ga0081540_1005788 | |||
| 1902 | Ga0081540_1010271 | |||
| 1903 | Ga0081540_1012941 | |||
| 1904 | Ga0081540_1026519 | |||
| 1905 | Ga0081540_1031359 | |||
| 1906 | Ga0081540_1046748 | |||
| 1907 | Ga0081540_1054487 | |||
| 1908 | Ga0081540_1062738 | |||
| 1909 | Ga0081539_10000425 | |||
| 1910 | Ga0081539_10001098 | |||
| 1911 | Ga0081539_10010784 | |||
| 1912 | Ga0081539_10033511 | |||
| 1913 | Ga0081539_10048626 | |||
| 1914 | Ga0070717_10000959 | |||
| 1915 | Ga0070717_10032149 | |||
| 1916 | Ga0070717_10066690 | |||
| 1917 | Ga0070717_10126720 | |||
| 1918 | Ga0070717_10196019 | |||
| 1919 | Ga0070717_10203536 | |||
| 1920 | Ga0070717_10252148 | |||
| 1921 | Ga0070717_10261306 | |||
| 1922 | Ga0075365_10001973 | |||
| 1923 | Ga0075365_10002915 | |||
| 1924 | Ga0075365_10029444 | |||
| 1925 | Ga0075365_10066978 | |||
| 1926 | Ga0075365_10074576 | |||
| 1927 | Ga0075365_10094709 | |||
| 1928 | Ga0075368_10013948 | |||
| 1929 | Ga0075363_100004089 | |||
| 1930 | Ga0075363_100040761 | |||
| 1931 | Ga0075364_10071316 | |||
| 1932 | Ga0075364_10130779 | |||
| 1933 | Ga0075364_10275501 | |||
| 1934 | Ga0070715_10002654 | |||
| 1935 | Ga0070715_10023346 | |||
| 1936 | Ga0070715_10088665 | |||
| 1937 | Ga0070715_10203114 | |||
| 1938 | Ga0070716_100002220 | |||
| 1939 | Ga0070716_100040223 | |||
| 1940 | Ga0070716_100058529 | |||
| 1941 | Ga0070716_100096426 | |||
| 1942 | Ga0070712_100163364 | |||
| 1943 | Ga0070712_100200928 | |||
| 1944 | Ga0075362_10037679 | |||
| 1945 | Ga0075362_10182958 | |||
| 1946 | Ga0075367_10019167 | |||
| 1947 | Ga0075367_10031100 | |||
| 1948 | Ga0075367_10033542 | |||
| 1949 | Ga0075367_10082992 | |||
| 1950 | Ga0075367_10098026 | |||
| 1951 | Ga0075367_10222384 | |||
| 1952 | Ga0075369_10005998 | |||
| 1953 | Ga0075369_10045879 | |||
| 1954 | Ga0075369_10052741 | |||
| 1955 | Ga0075366_10001342 | |||
| 1956 | Ga0075366_10084870 | |||
| 1957 | Ga0097621_100023761 | |||
| 1958 | Ga0097621_100276690 | |||
| 1959 | Ga0075370_10009275 | |||
| 1960 | Ga0075370_10019271 | |||
| 1961 | Ga0075370_10102535 | |||
| 1962 | Ga0075370_10140984 | |||
| 1963 | Ga0068871_100071108 | |||
| 1964 | Ga0075428_100014624 | |||
| 1965 | Ga0075428_100158933 | |||
| 1966 | Ga0075428_100364147 | |||
| 1967 | Ga0075428_100367630 | |||
| 1968 | Ga0075428_100421291 | |||
| 1969 | Ga0075430_100000164 | |||
| 1970 | Ga0075430_100184701 | |||
| 1971 | Ga0075431_100033662 | |||
| 1972 | Ga0075431_100073601 | |||
| 1973 | Ga0075433_10246367 | |||
| 1974 | Ga0075434_100013700 | |||
| 1975 | Ga0075434_100233811 | |||
| 1976 | Ga0075429_100190761 | |||
| 1977 | Ga0075429_100336613 | |||
| 1978 | Ga0068865_100019538 | |||
| 1979 | Ga0068865_100712750 | |||
| 1980 | Ga0075436_100037967 | |||
| 1981 | Ga0075436_100162870 | |||
| 1982 | Ga0097620_100046812 | |||
| 1983 | Ga0097620_100178423 | |||
| 1984 | Ga0097620_100315980 | |||
| 1985 | Ga0097620_100401085 | |||
| 1986 | Ga0097620_100592027 | |||
| 1987 | Ga0097620_100757757 | |||
| 1988 | Ga0099824_1008875 | |||
| 1989 | Ga0099822_1017500 | |||
| 1990 | Ga0075435_100115860 | |||
| 1991 | Ga0099794_10009521 | |||
| 1992 | Ga0099794_10075640 | |||
| 1993 | Ga0099795_10019465 | |||
| 1994 | Ga0105240_10019788 | |||
| 1995 | Ga0105240_10046064 | |||
| 1996 | Ga0105240_10154772 | |||
| 1997 | Ga0105240_10186062 | |||
| 1998 | Ga0105240_10488420 | |||
| 1999 | Ga0105240_10567384 | |||
| 2000 | Ga0105245_10023790 | |||
| 2001 | Ga0105245_10037769 | |||
| 2002 | Ga0105245_10183787 | |||
| 2003 | Ga0105247_10005771 | |||
| 2004 | Ga0105247_10059249 | |||
| 2005 | Ga0105247_10079666 | |||
| 2006 | Ga0105247_10084624 | |||
| 2007 | Ga0114129_10004595 | |||
| 2008 | Ga0114129_10056443 | |||
| 2009 | Ga0114129_10136649 | |||
| 2010 | Ga0114129_10157307 | |||
| 2011 | Ga0114129_10290517 | |||
| 2012 | Ga0114129_10620096 | |||
| 2013 | Ga0114129_10636286 | |||
| 2014 | Ga0114129_10882658 | |||
| 2015 | Ga0105243_10042458 | |||
| 2016 | Ga0105243_10174079 | |||
| 2017 | Ga0105241_10015112 | |||
| 2018 | Ga0105241_10112672 | |||
| 2019 | Ga0105241_10458000 | |||
| 2020 | Ga0105242_10066376 | |||
| 2021 | Ga0105242_10072541 | |||
| 2022 | Ga0105248_10006264 | |||
| 2023 | Ga0105248_10067991 | |||
| 2024 | Ga0105248_10126024 | |||
| 2025 | Ga0105248_10149282 | |||
| 2026 | Ga0105237_10124757 | |||
| 2027 | Ga0105237_10154163 | |||
| 2028 | Ga0105237_10751541 | |||
| 2029 | Ga0105237_10838451 | |||
| 2030 | Ga0105238_10025742 | |||
| 2031 | Ga0105238_10028483 | |||
| 2032 | Ga0105238_10151170 | |||
| 2033 | Ga0105238_10289693 | |||
| 2034 | Ga0105249_10023825 | |||
| 2035 | Ga0105249_10193252 | |||
| 2036 | Ga0105249_10297898 | |||
| 2037 | Ga0105249_10454875 | |||
| 2038 | Ga0099796_10011096 | |||
| 2039 | Ga0105239_10129115 | |||
| 2040 | Ga0105239_10157911 | |||
| 2041 | Ga0105239_10192059 | |||
| 2042 | Ga0105246_10055196 | |||
| 2043 | Ga0105246_10058684 | |||
| 2044 | Ga0157370_10133092 | |||
| 2045 | Ga0157369_10004497 | |||
| 2046 | Ga0157369_10139055 | |||
| 2047 | Ga0157369_10150184 | |||
| 2048 | Ga0157374_10041399 | |||
| 2049 | Ga0157378_10152330 | |||
| 2050 | Ga0163162_10009179 | |||
| 2051 | Ga0163162_10053414 | |||
| 2052 | Ga0163162_10069682 | |||
| 2053 | Ga0163162_10353438 | |||
| 2054 | Ga0157372_10101997 | |||
| 2055 | Ga0157375_10196062 | |||
| 2056 | Ga0163163_10010079 | |||
| 2057 | Ga0163163_10033404 | |||
| 2058 | Ga0163163_10097355 | |||
| 2059 | Ga0163163_10120027 | |||
| 2060 | Ga0163163_10176189 | |||
| 2061 | Ga0163163_10206104 | |||
| 2062 | Ga0157380_10118996 | |||
| 2063 | Ga0157380_10328269 | |||
| 2064 | Ga0157380_10588329 | |||
| 2065 | Ga0157377_10359615 | |||
| 2066 | Ga0157379_10041001 | |||
| 2067 | Ga0157379_10050265 | |||
| 2068 | Ga0157379_10369775 | |||
| 2069 | Ga0157376_10190593 | |||
| 2070 | Ga0206356_10905645 | |||
| 2071 | Ga0206353_10627821 | |||
| 2072 | Ga0213874_10047226 | |||
| 2073 | Ga0213876_10014482 | |||
| 2074 | Ga0213876_10097578 | |||
| 2075 | Ga0213876_10103081 | |||
| 2076 | Ga0213876_10230774 | |||
| 2077 | Ga0213875_10000046 | |||
| 2078 | Ga0213875_10070888 | |||
| 2079 | Ga0213871_10013420 | |||
| 2080 | Ga0209677_100501 | |||
| 2081 | Ga0209148_1000707 | |||
| 2082 | Ga0209233_1009216 | |||
| 2083 | Ga0209233_1013279 | |||
| 2084 | Ga0209455_1005738 | |||
| 2085 | Ga0209564_1000503 | |||
| 2086 | Ga0209564_1007349 | |||
| 2087 | Ga0209758_1001932 | |||
| 2088 | Ga0209758_1006390 | |||
| 2089 | Ga0207656_10047520 | |||
| 2090 | Ga0207656_10137044 | |||
| 2091 | Ga0207682_10000375 | |||
| 2092 | Ga0207682_10060269 | |||
| 2093 | Ga0207682_10141055 | |||
| 2094 | Ga0207692_10001396 | |||
| 2095 | Ga0207692_10007186 | |||
| 2096 | Ga0207692_10008471 | |||
| 2097 | Ga0207692_10030924 | |||
| 2098 | Ga0207692_10096913 | |||
| 2099 | Ga0207642_10024442 | |||
| 2100 | Ga0207710_10028188 | |||
| 2101 | Ga0207710_10076141 | |||
| 2102 | Ga0207710_10277226 | |||
| 2103 | Ga0207688_10000839 | |||
| 2104 | Ga0207680_10021253 | |||
| 2105 | Ga0207680_10121229 | |||
| 2106 | Ga0207647_10009009 | |||
| 2107 | Ga0207685_10072336 | |||
| 2108 | Ga0207685_10081022 | |||
| 2109 | Ga0207685_10152194 | |||
| 2110 | Ga0207699_10003881 | |||
| 2111 | Ga0207699_10008131 | |||
| 2112 | Ga0207699_10028722 | |||
| 2113 | Ga0207699_10179507 | |||
| 2114 | Ga0207645_10036084 | |||
| 2115 | Ga0207645_10118776 | |||
| 2116 | Ga0207645_10190813 | |||
| 2117 | Ga0207643_10001734 | |||
| 2118 | Ga0207643_10027690 | |||
| 2119 | Ga0207705_10164151 | |||
| 2120 | Ga0207684_10488553 | |||
| 2121 | Ga0207654_10034713 | |||
| 2122 | Ga0207654_10077069 | |||
| 2123 | Ga0207707_10012323 | |||
| 2124 | Ga0207707_10203347 | |||
| 2125 | Ga0207695_10010535 | |||
| 2126 | Ga0207695_10034396 | |||
| 2127 | Ga0207695_10268122 | |||
| 2128 | Ga0207671_10036138 | |||
| 2129 | Ga0207671_10081896 | |||
| 2130 | Ga0207671_10213050 | |||
| 2131 | Ga0207693_10002986 | |||
| 2132 | Ga0207693_10003096 | |||
| 2133 | Ga0207693_10076294 | |||
| 2134 | Ga0207693_10099279 | |||
| 2135 | Ga0207693_10137592 | |||
| 2136 | Ga0207693_10184986 | |||
| 2137 | Ga0207693_10190349 | |||
| 2138 | Ga0207663_10001112 | |||
| 2139 | Ga0207663_10006227 | |||
| 2140 | Ga0207663_10053350 | |||
| 2141 | Ga0207663_10081982 | |||
| 2142 | Ga0207663_10096743 | |||
| 2143 | Ga0207663_10123988 | |||
| 2144 | Ga0207660_10047951 | |||
| 2145 | Ga0207660_10125890 | |||
| 2146 | Ga0207660_10208695 | |||
| 2147 | Ga0207660_10577084 | |||
| 2148 | Ga0207660_10664856 | |||
| 2149 | Ga0207662_10005503 | |||
| 2150 | Ga0207649_10070657 | |||
| 2151 | Ga0207649_10221624 | |||
| 2152 | Ga0207649_10458083 | |||
| 2153 | Ga0207652_10080298 | |||
| 2154 | Ga0207652_10214316 | |||
| 2155 | Ga0207681_10057307 | |||
| 2156 | Ga0207694_10001415 | |||
| 2157 | Ga0207694_10150520 | |||
| 2158 | Ga0207694_10225647 | |||
| 2159 | Ga0207694_10250582 | |||
| 2160 | Ga0207694_10340932 | |||
| 2161 | Ga0207650_10004899 | |||
| 2162 | Ga0207650_10010889 | |||
| 2163 | Ga0207650_10114790 | |||
| 2164 | Ga0207650_10243427 | |||
| 2165 | Ga0207659_10027231 | |||
| 2166 | Ga0207687_10082377 | |||
| 2167 | Ga0207687_10121567 | |||
| 2168 | Ga0207700_10001919 | |||
| 2169 | Ga0207700_10045351 | |||
| 2170 | Ga0207700_10069647 | |||
| 2171 | Ga0207700_10078221 | |||
| 2172 | Ga0207700_10138152 | |||
| 2173 | Ga0207700_10145765 | |||
| 2174 | Ga0207700_10530218 | |||
| 2175 | Ga0207664_10004154 | |||
| 2176 | Ga0207664_10104244 | |||
| 2177 | Ga0207664_10190664 | |||
| 2178 | Ga0207664_10214542 | |||
| 2179 | Ga0207664_10475437 | |||
| 2180 | Ga0207644_10034357 | |||
| 2181 | Ga0207644_10111136 | |||
| 2182 | Ga0207644_10413194 | |||
| 2183 | Ga0207644_10425936 | |||
| 2184 | Ga0207690_10017134 | |||
| 2185 | Ga0207690_10349275 | |||
| 2186 | Ga0207690_10421288 | |||
| 2187 | Ga0207706_10006114 | |||
| 2188 | Ga0207706_10032501 | |||
| 2189 | Ga0207706_10037090 | |||
| 2190 | Ga0207706_10096017 | |||
| 2191 | Ga0207706_10339310 | |||
| 2192 | Ga0207686_10093767 | |||
| 2193 | Ga0207686_10299875 | |||
| 2194 | Ga0207709_10039181 | |||
| 2195 | Ga0207670_10007476 | |||
| 2196 | Ga0207670_10142767 | |||
| 2197 | Ga0207670_10498351 | |||
| 2198 | Ga0207670_10544921 | |||
| 2199 | Ga0207669_10012254 | |||
| 2200 | Ga0207669_10026286 | |||
| 2201 | Ga0207669_10075737 | |||
| 2202 | Ga0207669_10121807 | |||
| 2203 | Ga0207669_10272921 | |||
| 2204 | Ga0207669_10300207 | |||
| 2205 | Ga0207704_10015064 | |||
| 2206 | Ga0207704_10267289 | |||
| 2207 | Ga0207665_10000703 | |||
| 2208 | Ga0207665_10009821 | |||
| 2209 | Ga0207665_10065574 | |||
| 2210 | Ga0207665_10136069 | |||
| 2211 | Ga0207665_10210676 | |||
| 2212 | Ga0207665_10442697 | |||
| 2213 | Ga0207691_10006906 | |||
| 2214 | Ga0207691_10021094 | |||
| 2215 | Ga0207691_10121514 | |||
| 2216 | Ga0207711_10044345 | |||
| 2217 | Ga0207711_10054787 | |||
| 2218 | Ga0207711_10344799 | |||
| 2219 | Ga0207689_10038013 | |||
| 2220 | Ga0207661_10000171 | |||
| 2221 | Ga0207661_10068266 | |||
| 2222 | Ga0207661_10243036 | |||
| 2223 | Ga0207661_10401476 | |||
| 2224 | Ga0207661_10509489 | |||
| 2225 | Ga0207661_10539116 | |||
| 2226 | Ga0207679_10131412 | |||
| 2227 | Ga0207679_10258225 | |||
| 2228 | Ga0207667_10011741 | |||
| 2229 | Ga0207667_10081060 | |||
| 2230 | Ga0207667_10108767 | |||
| 2231 | Ga0207667_10179288 | |||
| 2232 | Ga0207667_10194588 | |||
| 2233 | Ga0207651_10033989 | |||
| 2234 | Ga0207651_10166959 | |||
| 2235 | Ga0207651_10587453 | |||
| 2236 | Ga0207712_10011151 | |||
| 2237 | Ga0207712_10082474 | |||
| 2238 | Ga0207712_10170495 | |||
| 2239 | Ga0207668_10043690 | |||
| 2240 | Ga0207668_10058189 | |||
| 2241 | Ga0207668_10240016 | |||
| 2242 | Ga0207668_10280394 | |||
| 2243 | Ga0207668_10600740 | |||
| 2244 | Ga0207640_10033307 | |||
| 2245 | Ga0207640_10072625 | |||
| 2246 | Ga0207658_10056905 | |||
| 2247 | Ga0207658_10646497 | |||
| 2248 | Ga0207677_10006968 | |||
| 2249 | Ga0207677_10039289 | |||
| 2250 | Ga0207677_10232394 | |||
| 2251 | Ga0207677_10374114 | |||
| 2252 | Ga0207677_10530235 | |||
| 2253 | Ga0207703_10023677 | |||
| 2254 | Ga0207703_10027837 | |||
| 2255 | Ga0207703_10184364 | |||
| 2256 | Ga0207639_10102445 | |||
| 2257 | Ga0207639_10195435 | |||
| 2258 | Ga0207639_10321210 | |||
| 2259 | Ga0207639_10400428 | |||
| 2260 | Ga0207678_10006661 | |||
| 2261 | Ga0207678_10011116 | |||
| 2262 | Ga0207678_10046631 | |||
| 2263 | Ga0207678_10065486 | |||
| 2264 | Ga0207678_10092860 | |||
| 2265 | Ga0207678_10145531 | |||
| 2266 | Ga0207678_10165456 | |||
| 2267 | Ga0207708_10007716 | |||
| 2268 | Ga0207708_10124482 | |||
| 2269 | Ga0207708_10140391 | |||
| 2270 | Ga0207702_10000003 | |||
| 2271 | Ga0207702_10000014 | |||
| 2272 | Ga0207702_10029653 | |||
| 2273 | Ga0207702_10033457 | |||
| 2274 | Ga0207641_10014887 | |||
| 2275 | Ga0207648_10004282 | |||
| 2276 | Ga0207648_10016410 | |||
| 2277 | Ga0207648_10023386 | |||
| 2278 | Ga0207648_10110826 | |||
| 2279 | Ga0207676_10025698 | |||
| 2280 | Ga0207676_10103796 | |||
| 2281 | Ga0207676_10221457 | |||
| 2282 | Ga0207676_10299903 | |||
| 2283 | Ga0207674_10009035 | |||
| 2284 | Ga0207674_10120406 | |||
| 2285 | Ga0207674_10277529 | |||
| 2286 | Ga0207675_100004773 | |||
| 2287 | Ga0207675_100094270 | |||
| 2288 | Ga0207675_100336805 | |||
| 2289 | Ga0207675_100441847 | |||
| 2290 | Ga0207675_100458051 | |||
| 2291 | Ga0207683_10000755 | |||
| 2292 | Ga0207683_10011238 | |||
| 2293 | Ga0207683_10018023 | |||
| 2294 | Ga0207683_10039521 | |||
| 2295 | Ga0207683_10068467 | |||
| 2296 | Ga0207683_10090083 | |||
| 2297 | Ga0207683_10340568 | |||
| 2298 | Ga0207698_10048923 | |||
| 2299 | Ga0207698_10208736 | |||
| 2300 | Ga0207698_10649771 | |||
| 2301 | Ga0209589_1000005 | |||
| 2302 | Ga0209489_100005 | |||
| 2303 | Ga0209700_100006 | |||
| 2304 | Ga0209588_1037277 | |||
| 2305 | Ga0268266_10001796 | |||
| 2306 | Ga0268266_10004322 | |||
| 2307 | Ga0268266_10041549 | |||
| 2308 | Ga0268266_10111463 | |||
| 2309 | Ga0268266_10112766 | |||
| 2310 | Ga0268266_10345632 | |||
| 2311 | Ga0268266_10612723 | |||
| 2312 | Ga0268265_10150239 | |||
| 2313 | Ga0268265_10222070 | |||
| 2314 | Ga0268265_10601767 | |||
| 2315 | Ga0268265_10733167 | |||
| 2316 | Ga0268264_10000042 | |||
| 2317 | Ga0268264_10026486 | |||
| 2318 | Ga0268264_10320064 | |||
| 2319 | Ga0268264_10406560 | |||
| 2320 | Ga0268264_10613067 | |||
| 2321 | Ga0265323_10066299 | |||
| 2322 | Ga0265336_10000395 | |||
| 2323 | Ga0307515_10153612 | |||
| 2324 | Ga0265338_10000018 | |||
| 2325 | Ga0307511_10055883 | |||
| 2326 | Ga0265762_1028335 | |||
| 2327 | Ga0265760_10028324 | |||
| 2328 | Ga0265332_10000310 | |||
| 2329 | Ga0265332_10056299 | |||
| 2330 | Ga0265325_10001089 | |||
| 2331 | Ga0265325_10002716 | |||
| 2332 | Ga0265325_10093724 | |||
| 2333 | Ga0265340_10001987 | |||
| 2334 | Ga0265340_10007979 | |||
| 2335 | Ga0265340_10030886 | |||
| 2336 | Ga0265340_10064416 | |||
| 2337 | Ga0265339_10004193 | |||
| 2338 | Ga0265339_10006147 | |||
| 2339 | Ga0265339_10013334 | |||
| 2340 | Ga0265339_10075724 | |||
| 2341 | Ga0265339_10133034 | |||
| 2342 | Ga0265339_10223069 | |||
| 2343 | Ga0265331_10007124 | |||
| 2344 | Ga0265331_10046709 | |||
| 2345 | Ga0265316_10090899 | |||
| 2346 | Ga0265316_10131649 | |||
| 2347 | Ga0265316_10133634 | |||
| 2348 | Ga0307513_10134366 | |||
| 2349 | Ga0307513_10241889 | |||
| 2350 | Ga0307509_10006260 | |||
| 2351 | Ga0307509_10136610 | |||
| 2352 | Ga0307408_100088322 | |||
| 2353 | Ga0307408_100347141 | |||
| 2354 | Ga0265313_10018919 | |||
| 2355 | Ga0265313_10097247 | |||
| 2356 | Ga0307508_10000125 | |||
| 2357 | Ga0307508_10086418 | |||
| 2358 | Ga0316575_10104860 | |||
| 2359 | Ga0316579_10116103 | |||
| 2360 | Ga0265314_10022428 | |||
| 2361 | Ga0265314_10152826 | |||
| 2362 | Ga0265342_10000175 | |||
| 2363 | Ga0265342_10013040 | |||
| 2364 | Ga0265342_10017256 | |||
| 2365 | Ga0265342_10039041 | |||
| 2366 | Ga0316576_10473465 | |||
| 2367 | Ga0307516_10039106 | |||
| 2368 | Ga0307516_10077415 | |||
| 2369 | Ga0307516_10260655 | |||
| 2370 | Ga0307413_10470885 | |||
| 2371 | Ga0307412_10330180 | |||
| 2372 | Ga0307416_100136965 | |||
| 2373 | Ga0307416_100229312 | |||
| 2374 | Ga0307416_100542162 | |||
| 2375 | Ga0307414_10327110 | |||
| 2376 | Ga0307411_10430321 | |||
| 2377 | Ga0307415_100340651 | |||
| 2378 | Ga0307510_10094706 | |||
| 2379 | Ga0307510_10238863 | |||
| 2380 | Ga0315911_1000005 | |||
| 2381 | Ga0373930_0043315 | |||
| 2382 | Ga0373940_0057534 | |||
| 2383 | Ga0373944_0008452 | |||
| 2384 | Ga0373951_0033886 | |||
| 2385 | Ga0373952_0024718 | |||
| 2386 | Ga0373923_0010299 | |||
| 2387 | Ga0373923_0082082 | |||
| 2388 | Ga0373923_0091581 | |||
| 2389 | Ga0373932_0023423 | |||
| 2390 | Ga0373936_0001304 | |||
| 2391 | Ga0373936_0004439 | |||
| 2392 | Ga0373936_0169370 | |||
| 2393 | Ga0373939_0006221 | |||
| 2394 | Ga0373945_0004834 | |||
| 2395 | Ga0373945_0051161 | |||
| 2396 | Ga0373953_0075990 | |||
| 2397 | Ga0373954_0002374 | |||
| 2398 | Ga0373954_0003435 | |||
| 2399 | Ga0373954_0031099 | |||
| 2400 | Ga0373954_0086208 | |||
| 2401 | Ga0373954_0132503 | |||
| 2402 | Ga0373956_0007265 | |||
| 2403 | Ga0373956_0056583 | |||
| 2404 | Ga0373956_0098807 | |||
| 2405 | Ga0373957_0007813 | |||
| 2406 | Ga0373957_0018156 | |||
| 2407 | Ga0373957_0024301 | |||
| 2408 | Ga0373957_0070135 | |||
| 2409 | Ga0373943_0003366 | |||
| 2410 | Ga0373946_0000442 | |||
| 2411 | Ga0373946_0044695 | |||
| 2412 | Ga0373946_0045305 | |||
| 2413 | Ga0373946_0117914 | |||
| 2414 | Ga0373955_0000590 | |||
| 2415 | Ga0373955_0005428 | |||
| 2416 | Ga0373955_0017758 | |||
| 2417 | Ga0373955_0253440 | |||
| 2418 | Ga0373955_0255113 | |||
| 2419 | Ga0373942_0015083 | |||
| 2420 | Ga0373961_0032870 | |||
| 2421 | Ga0373961_0094157 | |||
| 2422 | Ga0373962_0072435 | |||
| 2423 | Ga0316574_0012818 | |||
| 2424 | Ga0373924_0000432 | |||
| 2425 | Ga0373924_0045878 | |||
| 2426 | Ga0373924_0156750 | |||
| 2427 | Ga0373931_0087582 | |||
| 2428 | Ga0373931_0092811 | |||
| 2429 | Ga0373931_0206935 | |||
| 2430 | Ga0373931_0217233 | |||
| 2431 | Ga0373935_0000370 | |||
| 2432 | Ga0373935_0144130 | |||
| 2433 | Ga0373935_0285787 | |||
| 2434 | Ga0373927_0006696 | |||
| 2435 | Ga0373927_0012500 | |||
| 2436 | Ga0373927_0014600 | |||
| 2437 | Ga0373927_0044379 | |||
| 2438 | Ga0373927_0203814 | |||
| 2439 | Ga0373927_0440267 | |||
| 2440 | Ga0373933_0000180 | |||
| 2441 | Ga0373933_0035942 | |||
| 2442 | Ga0373947_0000476 | |||
| 2443 | Ga0373947_0065531 | |||
| 2444 | Ga0373947_0294705 | |||
| 2445 | Ga0373937_0000009 | |||
| 2446 | Ga0373937_0052741 | |||
| 2447 | Ga0373937_0087639 | |||
| 2448 | Ga0373937_0145999 | |||
| 2449 | Ga0373937_0207301 | |||
| 2450 | Ga0373937_0863660 | |||
| 2451 | Ga0316584_0013475 | |||
| 2452 | Ga0373925_0000194 | |||
| 2453 | Ga0373925_0016628 | |||
| 2454 | Ga0373925_0025690 | |||
| 2455 | Ga0373925_0034596 | |||
| 2456 | Ga0373925_0050640 | |||
| 2457 | Ga0373925_0096908 | |||
| 2458 | Ga0373925_0125709 | |||
| 2459 | Ga0373925_0270426 | |||
| 2460 | Ga0373925_0607456 | |||
| 2461 | Ga0395899_0184330 | |||
| 2462 | Ga0395900_0000753 | |||
| 2463 | Ga0395900_0011126 | |||
| 2464 | Ga0395900_0087579 | |||
| 2465 | Ga0395900_0132135 | |||
| 2466 | Ga0395900_0476054 | |||
| 2467 | Ga0395898_0005579 | |||
| 2468 | Ga0395898_0096497 | |||
| 2469 | Ga0395898_0693224 | |||
| 2470 | Ga0395905_0060003 | |||
| 2471 | Ga0436364_0463993 | |||
| 2472 | Ga0436364_0538474 | |||
| 2473 | Ga0436364_0683264 | |||
| 2474 | Ga0436364_1040387 | |||
| 2475 | Ga0436364_1234925 | |||
| 2476 | Ga0436364_1536805 | |||
| 2477 | Ga0395901_0059586 | |||
| 2478 | Ga0395901_0092860 | |||
| 2479 | Ga0395901_0464498 | |||
| 2480 | Ga0395901_0667611 | |||
| 2481 | Ga0400486_01881 | |||
| 2482 | Ga0436365_0046146 | |||
| 2483 | Ga0436365_0361138 | |||
| 2484 | Ga0436365_0367024 | |||
| 2485 | Ga0436365_0544636 | |||
| 2486 | Ga0436365_0824804 | |||
| 2487 | Ga0436365_0910473 | |||
| 2488 | Ga0436365_0989626 | |||
| 2489 | Ga0436365_1294996 | |||
| 2490 | Ga0436365_1466687 | |||
| 2491 | Ga0436365_1613283 | |||
| 2492 | Ga0436365_1626279 | |||
| 2493 | Ga0436365_1802139 | |||
| 2494 | Ga0436365_1853114 | |||
| 2495 | Ga0436365_1860176 | |||
| 2496 | Ga0436360_0121399 | |||
| 2497 | Ga0436360_1258966 | |||
| 2498 | Ga0436361_0082815 | |||
| 2499 | Ga0436361_0735205 | |||
| 2500 | Ga0436363_0068476 | |||
| 2501 | Ga0436363_0351229 | |||
| 2502 | Ga0436363_1392773 | |||
| 2503 | Ga0436363_1532888 | |||
| 2504 | Ga0436363_1646089 | |||
| 2505 | Ga0436362_0588599 | |||
| 2506 | Ga0436362_0854921 | |||
| 2507 | Ga0439465_0040206 | |||
| 2508 | Ga0451853_1217131 | |||
| 2509 | Ga0439434_0096840 | |||
| 2510 | Ga0451577_0000804 | |||
| 2511 | Ga0466969_0077486 | |||
| 2512 | Ga0466966_0084873 | |||
| 2513 | Ga0466971_0022633 | |||
| 2514 | Ga0466968_0148538 | |||
| 2515 | Ga0466970_0214017 | |||
| 2516 | Ga0466957_0079650 | |||
| 2517 | Ga0466957_0080487 | |||
| 2518 | Ga0466959_0061808 | |||
| 2519 | Ga0466959_0180583 | |||
| 2520 | Ga0466959_0383088 | |||
| 2521 | Ga0451576_0893345 | |||
| 2522 | Ga0466967_0060568 | |||
| 2523 | Ga0466967_0402828 | |||
| 2524 | Ga0495592_0000018 | |||
| 2525 | Ga0495592_0007391 | |||
| 2526 | Ga0495592_0068737 | |||
| 2527 | Ga0495592_0161451 | |||
| 2528 | Ga0495603_0017965 | |||
| 2529 | Ga0495603_0113311 | |||
| 2530 | Ga0495603_0158464 | |||
| 2531 | Ga0495603_0234644 | |||
| 2532 | Ga0495590_0017697 | |||
| 2533 | Ga0495590_0032303 | |||
| 2534 | Ga0495629_0004511 | |||
| 2535 | Ga0495629_0021300 | |||
| 2536 | Ga0495629_0126087 | |||
| 2537 | Ga0495638_0017089 | |||
| 2538 | Ga0495638_0044424 | |||
| 2539 | Ga0495641_0096094 | |||
| 2540 | Ga0495651_0002271 | |||
| 2541 | Ga0495651_0009620 | |||
| 2542 | Ga0495651_0018113 | |||
| 2543 | Ga0495651_0045413 | |||
| 2544 | Ga0495653_0000032 | |||
| 2545 | Ga0495653_0126812 | |||
| 2546 | Ga0495653_0187883 | |||
| 2547 | Ga0495650_0034912 | |||
| 2548 | Ga0495580_0022914 | |||
| 2549 | Ga0495580_0219499 | |||
| 2550 | Ga0495582_0069661 | |||
| 2551 | Ga0495582_0110989 | |||
| 2552 | Ga0495582_0188030 | |||
| 2553 | Ga0495605_0098354 | |||
| 2554 | Ga0495639_0017286 | |||
| 2555 | Ga0495662_0015632 | |||
| 2556 | Ga0495662_0122774 | |||
| 2557 | Ga0495662_0174289 | |||
| 2558 | Ga0495664_0000010 | |||
| 2559 | Ga0495664_0011721 | |||
| 2560 | Ga0495664_0156048 | |||
| 2561 | Ga0495584_0005969 | |||
| 2562 | Ga0495584_0097225 | |||
| 2563 | Ga0495584_0138620 | |||
| 2564 | Ga0495585_0064951 | |||
| 2565 | Ga0495594_0028740 | |||
| 2566 | Ga0495594_0282177 | |||
| 2567 | Ga0495596_0064908 | |||
| 2568 | Ga0495607_0068886 | |||
| 2569 | Ga0495607_0149462 | |||
| 2570 | Ga0495606_0001686 | |||
| 2571 | Ga0495606_0012721 | |||
| 2572 | Ga0495606_0103896 | |||
| 2573 | Ga0495608_0000008 | |||
| 2574 | Ga0495608_0073007 | |||
| 2575 | Ga0495608_0078676 | |||
| 2576 | Ga0495608_0210193 | |||
| 2577 | Ga0495610_0051049 | |||
| 2578 | Ga0495616_0064266 | |||
| 2579 | Ga0495618_0000002 | |||
| 2580 | Ga0495618_0002296 | |||
| 2581 | Ga0495618_0068853 | |||
| 2582 | Ga0495618_0199450 | |||
| 2583 | Ga0495618_0219880 | |||
| 2584 | Ga0495620_0017282 | |||
| 2585 | Ga0495628_0000009 | |||
| 2586 | Ga0495628_0011834 | |||
| 2587 | Ga0495628_0151589 | |||
| 2588 | Ga0495628_0159842 | |||
| 2589 | Ga0495628_0179128 | |||
| 2590 | Ga0495628_0259831 | |||
| 2591 | Ga0495630_0001850 | |||
| 2592 | Ga0495630_0168720 | |||
| 2593 | Ga0495630_0190624 | |||
| 2594 | Ga0495631_0116504 | |||
| 2595 | Ga0495632_0182245 | |||
| 2596 | Ga0495648_0002080 | |||
| 2597 | Ga0495663_0065526 | |||
| 2598 | Ga0495663_0089135 | |||
| 2599 | Ga0495666_0169756 | |||
| 2600 | Ga0495652_0000011 | |||
| 2601 | Ga0495652_0040074 | |||
| 2602 | Ga0495652_0088571 | |||
| 2603 | Ga0495652_0165642 | |||
| 2604 | Ga0495652_0265595 | |||
| 2605 | Ga0495665_0030220 | |||
| 2606 | Ga0495665_0248900 | |||
| 2607 | Ga0495640_0000009 | |||
| 2608 | Ga0495640_0004134 | |||
| 2609 | Ga0495640_0015032 | |||
| 2610 | Ga0495640_0028702 | |||
| 2611 | Ga0495640_0045669 | |||
| 2612 | Ga0495640_0197743 | |||
| 2613 | Ga0495586_0016981 | |||
| 2614 | Ga0495586_0113785 | |||
| 2615 | Ga0495587_0000006 | |||
| 2616 | Ga0495587_0033796 | |||
| 2617 | Ga0495587_0054241 | |||
| 2618 | Ga0495598_0003846 | |||
| 2619 | Ga0495621_0009676 | |||
| 2620 | Ga0495621_0027282 | |||
| 2621 | Ga0495645_0000010 | |||
| 2622 | Ga0495645_0007861 | |||
| 2623 | Ga0495645_0009133 | |||
| 2624 | Ga0495645_0069213 | |||
| 2625 | Ga0495645_0233748 | |||
| 2626 | Ga0495622_0045681 | |||
| 2627 | Ga0495622_0150699 | |||
| 2628 | Ga0495633_0052795 | |||
| 2629 | Ga0495667_0000005 | |||
| 2630 | Ga0495667_0027393 | |||
| 2631 | Ga0495656_0051429 | |||
| 2632 | Ga0495656_0066339 | |||
| 2633 | Ga0495668_0114593 | |||
| 2634 | Ga0495634_0000223 | |||
| 2635 | Ga0495634_0007776 | |||
| 2636 | Ga0495634_0030340 | |||
| 2637 | Ga0495634_0034428 | |||
| 2638 | Ga0495634_0066724 | |||
| 2639 | Ga0495634_0076735 | |||
| 2640 | Ga0495634_0407853 | |||
| 2641 | Ga0495611_0070545 | |||
| 2642 | Ga0495635_0000008 | |||
| 2643 | Ga0495635_0012284 | |||
| 2644 | Ga0495635_0033486 | |||
| 2645 | Ga0495635_0071599 | |||
| 2646 | Ga0495635_0079065 | |||
| 2647 | Ga0495635_0091237 | |||
| 2648 | Ga0495635_0361171 | |||
| 2649 | Ga0495659_0011400 | |||
| 2650 | Ga0495659_0076698 | |||
| 2651 | Ga0495661_0004641 | |||
| 2652 | Ga0495588_0154998 | |||
| 2653 | Ga0495588_0203304 | |||
| 2654 | Ga0495657_0000058 | |||
| 2655 | Ga0495657_0007247 | |||
| 2656 | Ga0495657_0129828 | |||
| 2657 | Ga0495599_0000007 | |||
| 2658 | Ga0495599_0019082 | |||
| 2659 | Ga0495623_0000085 | |||
| 2660 | Ga0495623_0028622 | |||
| 2661 | Ga0495623_0077088 | |||
| 2662 | Ga0495623_0116857 | |||
| 2663 | Ga0495646_0000021 | |||
| 2664 | Ga0495646_0019263 | |||
| 2665 | Ga0495646_0223142 | |||
| 2666 | Ga0495647_0021787 | |||
| 2667 | Ga0495647_0022052 | |||
| 2668 | Ga0495658_0025517 | |||
| 2669 | Ga0495658_0028100 | |||
| 2670 | Ga0495658_0263350 | |||
| 2671 | Ga0495613_0121180 | |||
| 2672 | Ga0495613_0123971 | |||
| 2673 | Ga0495613_0180467 | |||
| 2674 | Ga0495613_0344267 | |||
| 2675 | Ga0495613_0376692 | |||
| 2676 | Ga0495624_0007573 | |||
| 2677 | Ga0495624_0062310 | |||
| 2678 | Ga0495624_0072967 | |||
| 2679 | Ga0495624_0080796 | |||
| 2680 | Ga0495624_0316240 | |||
| 2681 | Ga0495670_0026303 | |||
| 2682 | Ga0495670_0073302 | |||
| 2683 | Ga0495670_0084771 | |||
| 2684 | Ga0495671_0099253 | |||
| 2685 | Ga0495649_0059705 | |||
| 2686 | Ga0495589_0124507 | |||
| 2687 | Ga0495600_0000001 | |||
| 2688 | Ga0495600_0017611 | |||
| 2689 | Ga0495600_0020140 | |||
| 2690 | Ga0495660_0153745 | |||
| 2691 | Ga0495581_0005192 | |||
| 2692 | Ga0495581_0015392 | |||
| 2693 | Ga0495581_0108728 | |||
| 2694 | Ga0495581_0112270 | |||
| 2695 | Ga0495604_0000012 | |||
| 2696 | Ga0495604_0006128 | |||
| 2697 | Ga0495604_0020133 | |||
| 2698 | Ga0495604_0268583 | |||
| 2699 | Ga0495604_0269476 | |||
| 2700 | Ga0495636_0212650 | |||
| 2701 | Ga0495674_0000011 | |||
| 2702 | Ga0495674_0005473 | |||
| 2703 | Ga0495674_0201351 | |||
| 2704 | Ga0495674_0296042 | |||
| 2705 | Ga0495672_0008564 | |||
| 2706 | Ga0495672_0124543 | |||
| 2707 | Ga0495676_0054221 | |||
| 2708 | Ga0495676_0163092 | |||
| 2709 | Ga0495676_0313940 | |||
| 2710 | Ga0495680_0001281 | |||
| 2711 | Ga0495680_0097431 | |||
| 2712 | Ga0495680_0191135 | |||
| 2713 | Ga0495680_0363812 | |||
| 2714 | Ga0495675_0000096 | |||
| 2715 | Ga0495675_0063415 | |||
| 2716 | Ga0495681_0107375 | |||
| 2717 | Ga0495684_0000084 | |||
| 2718 | Ga0495684_0000724 | |||
| 2719 | Ga0495684_0057921 | |||
| 2720 | Ga0495684_0062950 | |||
| 2721 | Ga0495684_0170611 | |||
| 2722 | Ga0495684_0239736 | |||
| 2723 | Ga0495686_0018833 | |||
| 2724 | Ga0495686_0075590 | |||
| 2725 | Ga0495593_0000727 | |||
| 2726 | Ga0495593_0192672 | |||
| 2727 | Ga0495602_0000073 | |||
| 2728 | Ga0495602_0021411 | |||
| 2729 | Ga0495602_0074922 | |||
| 2730 | Ga0495602_0085822 | |||
| 2731 | Ga0495602_0233348 | |||
| 2732 | Ga0495615_0008934 | |||
| 2733 | Ga0495615_0020723 | |||
| 2734 | Ga0496100_0009415 | |||
| 2735 | Ga0496100_0031044 | |||
| 2736 | Ga0496100_0032857 | |||
| 2737 | Ga0496100_0188026 | |||
| 2738 | Ga0496100_0280409 | |||
| 2739 | Ga0496101_0022566 | |||
| 2740 | Ga0496101_0054482 | |||
| 2741 | Ga0496101_0066385 | |||
| 2742 | Ga0496101_0066925 | |||
| 2743 | Ga0496101_0069596 | |||
| 2744 | Ga0496101_0114285 | |||
| 2745 | Ga0496101_0116075 | |||
| 2746 | Ga0496101_0386775 | |||
| 2747 | Ga0496101_0509849 | |||
| 2748 | Ga0496102_0011175 | |||
| 2749 | Ga0496102_0023656 | |||
| 2750 | Ga0496102_0075347 | |||
| 2751 | Ga0496102_0085995 | |||
| 2752 | Ga0496102_0105116 | |||
| 2753 | Ga0496102_0163993 | |||
| 2754 | Ga0496102_0237816 | |||
| 2755 | Ga0496102_0337717 | |||
| 2756 | Ga0496102_0360673 | |||
| 2757 | Ga0496102_0510332 | |||
| 2758 | Ga0496102_0691098 | |||
| 2759 | Ga0496103_0005828 | |||
| 2760 | Ga0496103_0116401 | |||
| 2761 | Ga0496104_0001003 | |||
| 2762 | Ga0496104_0003063 | |||
| 2763 | Ga0496104_0014912 | |||
| 2764 | Ga0496104_0024353 | |||
| 2765 | Ga0496104_0039528 | |||
| 2766 | Ga0496104_0179120 | |||
| 2767 | Ga0496104_0268839 | |||
| 2768 | Ga0496104_0466441 | |||
| 2769 | Ga0496105_0003633 | |||
| 2770 | Ga0496105_0011042 | |||
| 2771 | Ga0496105_0023493 | |||
| 2772 | Ga0496105_0046798 | |||
| 2773 | Ga0496105_0071620 | |||
| 2774 | Ga0496105_0168330 | |||
| 2775 | Ga0496105_0190276 | |||
| 2776 | Ga0496106_0001280 | |||
| 2777 | Ga0496106_0004321 | |||
| 2778 | Ga0496106_0031358 | |||
| 2779 | Ga0496106_0032992 | |||
| 2780 | Ga0496106_0065475 | |||
| 2781 | Ga0496106_0139948 | |||
| 2782 | Ga0496106_0140463 | |||
| 2783 | Ga0496106_0207015 | |||
| 2784 | Ga0496106_0329177 | |||
| 2785 | Ga0496106_0366507 | |||
| 2786 | Ga0496107_0023629 | |||
| 2787 | Ga0496107_0027212 | |||
| 2788 | Ga0496107_0059834 | |||
| 2789 | Ga0496107_0248572 | |||
| 2790 | Ga0496108_0000451 | |||
| 2791 | Ga0496108_0003585 | |||
| 2792 | Ga0496108_0079249 | |||
| 2793 | Ga0496108_0120994 | |||
| 2794 | Ga0496108_0139762 | |||
| 2795 | Ga0496108_0206654 | |||
| 2796 | Ga0496108_0236368 | |||
| 2797 | Ga0496108_0247318 | |||
| 2798 | Ga0496108_0290271 | |||
| 2799 | Ga0496108_0338723 | |||
| 2800 | Ga0496108_0420318 | |||
| 2801 | Ga0496108_0693514 | |||
| 2802 | Ga0496109_0000558 | |||
| 2803 | Ga0496109_0004298 | |||
| 2804 | Ga0496109_0017610 | |||
| 2805 | Ga0496109_0041408 | |||
| 2806 | Ga0496109_0118103 | |||
| 2807 | Ga0496109_0242824 | |||
| 2808 | Ga0496109_0327532 | |||
| 2809 | Ga0496110_0015787 | |||
| 2810 | Ga0496110_0017400 | |||
| 2811 | Ga0496110_0095942 | |||
| 2812 | Ga0496110_0111158 | |||
| 2813 | Ga0496110_0133773 | |||
| 2814 | Ga0496110_0166142 | |||
| 2815 | Ga0496110_0289553 | |||
| 2816 | Ga0496110_0315894 | |||
| 2817 | Ga0496110_0385050 | |||
| 2818 | Ga0496110_0618092 | |||
| 2819 | Ga0496111_0009095 | |||
| 2820 | Ga0496111_0085324 | |||
| 2821 | Ga0496111_0144133 | |||
| 2822 | Ga0496111_0156174 | |||
| 2823 | Ga0496112_0003249 | |||
| 2824 | Ga0496112_0049602 | |||
| 2825 | Ga0496112_0055602 | |||
| 2826 | Ga0496112_0123797 | |||
| 2827 | Ga0496112_0133455 | |||
| 2828 | Ga0496112_0148646 | |||
| 2829 | Ga0496112_0183184 | |||
| 2830 | Ga0496112_0212509 | |||
| 2831 | Ga0496112_0229843 | |||
| 2832 | Ga0496112_0506737 | |||
| 2833 | Ga0496113_0009879 | |||
| 2834 | Ga0496113_0035660 | |||
| 2835 | Ga0496113_0038460 | |||
| 2836 | Ga0496113_0051554 | |||
| 2837 | Ga0496113_0254311 | |||
| 2838 | Ga0496113_0400697 | |||
| 2839 | Ga0496114_0019044 | |||
| 2840 | Ga0496114_0181427 | |||
| 2841 | Ga0496114_0326089 | |||
| 2842 | Ga0496114_0468493 | |||
| 2843 | Ga0496114_0509577 | |||
| 2844 | Ga0496115_0008727 | |||
| 2845 | Ga0496115_0014125 | |||
| 2846 | Ga0496115_0016482 | |||
| 2847 | Ga0496115_0023060 | |||
| 2848 | Ga0496115_0028405 | |||
| 2849 | Ga0496115_0049654 | |||
| 2850 | Ga0496115_0063285 | |||
| 2851 | Ga0496115_0076990 | |||
| 2852 | Ga0496115_0118331 | |||
| 2853 | Ga0496115_0151874 | |||
| 2854 | Ga0496115_0271562 | |||
| 2855 | Ga0496115_0341358 | |||
| 2856 | Ga0496115_0443580 | |||
| 2857 | Ga0496115_0464673 | |||
| 2858 | Ga0496115_0515364 | |||
| 2859 | Ga0496116_0005695 | |||
| 2860 | Ga0496117_0012118 | |||
| 2861 | Ga0496117_0155578 | |||
| 2862 | Ga0496118_0001458 | |||
| 2863 | Ga0496118_0016977 | |||
| 2864 | Ga0496118_0040425 | |||
| 2865 | Ga0496118_0042817 | |||
| 2866 | Ga0496118_0084764 | |||
| 2867 | Ga0496118_0241504 | |||
| 2868 | Ga0496118_0336571 | |||
| 2869 | Ga0496119_0003138 | |||
| 2870 | Ga0496119_0103754 | |||
| 2871 | Ga0496119_0107815 | |||
| 2872 | Ga0496120_0015858 | |||
| 2873 | Ga0496120_0126500 | |||
| 2874 | Ga0496121_0000146 | |||
| 2875 | Ga0496121_0001525 | |||
| 2876 | Ga0496121_0002110 | |||
| 2877 | Ga0496121_0009157 | |||
| 2878 | Ga0496121_0011985 | |||
| 2879 | Ga0496121_0014155 | |||
| 2880 | Ga0496121_0039521 | |||
| 2881 | Ga0496121_0052038 | |||
| 2882 | Ga0496121_0163058 | |||
| 2883 | Ga0496121_0338530 | |||
| 2884 | Ga0496123_0036461 | |||
| 2885 | Ga0496124_0002217 | |||
| 2886 | Ga0496124_0042083 | |||
| 2887 | Ga0496124_0194246 | |||
| 2888 | Ga0496124_0376298 | |||
| 2889 | Ga0496125_0000099 | |||
| 2890 | Ga0496125_0009421 | |||
| 2891 | Ga0496125_0024940 | |||
| 2892 | Ga0496125_0168760 | |||
| 2893 | Ga0496126_0010429 | |||
| 2894 | Ga0496126_0016158 | |||
| 2895 | Ga0496126_0016652 | |||
| 2896 | Ga0496126_0017576 | |||
| 2897 | Ga0496126_0020801 | |||
| 2898 | Ga0496126_0023009 | |||
| 2899 | Ga0496126_0023765 | |||
| 2900 | Ga0496126_0026323 | |||
| 2901 | Ga0496126_0031408 | |||
| 2902 | Ga0496126_0051578 | |||
| 2903 | Ga0496126_0063569 | |||
| 2904 | Ga0496126_0085476 | |||
| 2905 | Ga0496126_0258195 | |||
| 2906 | Ga0496126_0404096 | |||
| 2907 | Ga0495682_0108351 | |||
| 2908 | Ga0501031_0008069 | |||
| 2909 | Ga0501031_0054785 | |||
| 2910 | Ga0501031_0090108 | |||
| 2911 | Ga0501031_0291222 | |||
| 2912 | Ga0501032_0001954 | |||
| 2913 | Ga0501032_0011869 | |||
| 2914 | Ga0501032_0021294 | |||
| 2915 | Ga0501032_0021620 | |||
| 2916 | Ga0501032_0061448 | |||
| 2917 | Ga0501032_0096865 | |||
| 2918 | Ga0501032_0132292 | |||
| 2919 | Ga0501032_0168652 | |||
| 2920 | Ga0501032_0293148 | |||
| 2921 | Ga0501033_0002836 | |||
| 2922 | Ga0501033_0014700 | |||
| 2923 | Ga0501033_0020903 | |||
| 2924 | Ga0501033_0046459 | |||
| 2925 | Ga0501033_0046944 | |||
| 2926 | Ga0501033_0058986 | |||
| 2927 | Ga0501033_0155119 | |||
| 2928 | Ga0501033_0170944 | |||
| 2929 | Ga0501033_0208738 | |||
| 2930 | Ga0501033_0449577 | |||
| 2931 | Ga0501034_0001164 | |||
| 2932 | Ga0501034_0020421 | |||
| 2933 | Ga0501034_0033298 | |||
| 2934 | Ga0501034_0121101 | |||
| 2935 | Ga0501034_0134173 | |||
| 2936 | Ga0501034_0143980 | |||
| 2937 | Ga0501034_0148564 | |||
| 2938 | Ga0501034_0150356 | |||
| 2939 | Ga0501034_0171302 | |||
| 2940 | Ga0501034_0226278 | |||
| 2941 | Ga0501034_0229981 | |||
| 2942 | Ga0501034_0263387 | |||
| 2943 | Ga0501034_0355461 | |||
| 2944 | Ga0501034_0363062 | |||
| 2945 | Ga0501034_0484745 | |||
| 2946 | Ga0501034_0705014 | |||
| 2947 | Ga0501036_0004082 | |||
| 2948 | Ga0501036_0019200 | |||
| 2949 | Ga0501036_0019549 | |||
| 2950 | Ga0501036_0021130 | |||
| 2951 | Ga0501036_0048441 | |||
| 2952 | Ga0501036_0139275 | |||
| 2953 | Ga0501036_0212497 | |||
| 2954 | Ga0501036_0212715 | |||
| 2955 | Ga0501036_0311880 | |||
| 2956 | Ga0501036_0606017 | |||
| 2957 | Ga0501036_0780449 | |||
| 2958 | Ga0501037_0003537 | |||
| 2959 | Ga0501037_0005841 | |||
| 2960 | Ga0501037_0017803 | |||
| 2961 | Ga0501037_0046499 | |||
| 2962 | Ga0501037_0051259 | |||
| 2963 | Ga0501037_0062081 | |||
| 2964 | Ga0501037_0143591 | |||
| 2965 | Ga0501037_0267946 | |||
| 2966 | Ga0501038_0002740 | |||
| 2967 | Ga0501038_0006198 | |||
| 2968 | Ga0501038_0018654 | |||
| 2969 | Ga0501038_0023039 | |||
| 2970 | Ga0501038_0031994 | |||
| 2971 | Ga0501038_0081945 | |||
| 2972 | Ga0501038_0090993 | |||
| 2973 | Ga0501038_0091798 | |||
| 2974 | Ga0501038_0120997 | |||
| 2975 | Ga0501038_0157448 | |||
| 2976 | Ga0501038_0164147 | |||
| 2977 | Ga0501038_0223388 | |||
| 2978 | Ga0501038_0263084 | |||
| 2979 | Ga0501038_0266641 | |||
| 2980 | Ga0501038_0300721 | |||
| 2981 | Ga0501039_0009338 | |||
| 2982 | Ga0501039_0022255 | |||
| 2983 | Ga0501039_0081764 | |||
| 2984 | Ga0501039_0109261 | |||
| 2985 | Ga0501039_0158349 | |||
| 2986 | Ga0501039_0274388 | |||
| 2987 | Ga0501039_0430471 | |||
| 2988 | Ga0501039_0571526 | |||
| 2989 | Ga0501040_0120309 | |||
| 2990 | Ga0501041_0076713 | |||
| 2991 | Ga0501041_0126473 | |||
| 2992 | Ga0501042_0010994 | |||
| 2993 | Ga0501042_0012503 | |||
| 2994 | Ga0501042_0017967 | |||
| 2995 | Ga0501042_0074867 | |||
| 2996 | Ga0501042_0473558 | |||
| 2997 | Ga0501043_0006835 | |||
| 2998 | Ga0501043_0011558 | |||
| 2999 | Ga0501043_0011619 | |||
| 3000 | Ga0501043_0011717 | |||
| 3001 | Ga0501043_0013054 | |||
| 3002 | Ga0501043_0028696 | |||
| 3003 | Ga0501043_0036926 | |||
| 3004 | Ga0501043_0066286 | |||
| 3005 | Ga0501043_0789610 | |||
| 3006 | Ga0501046_0064616 | |||
| 3007 | Ga0501046_0093547 | |||
| 3008 | Ga0501046_0097271 | |||
| 3009 | Ga0501046_0138831 | |||
| 3010 | Ga0501046_0141014 | |||
| 3011 | Ga0501046_0210479 | |||
| 3012 | Ga0501046_0440589 | |||
| 3013 | Ga0501047_0000459 | |||
| 3014 | Ga0501047_0017946 | |||
| 3015 | Ga0501047_0027821 | |||
| 3016 | Ga0501047_0033478 | |||
| 3017 | Ga0501047_0067379 | |||
| 3018 | Ga0501047_0097423 | |||
| 3019 | Ga0501047_0130507 | |||
| 3020 | Ga0501047_0217832 | |||
| 3021 | Ga0501047_0227606 | |||
| 3022 | Ga0501047_0244786 | |||
| 3023 | Ga0501047_0362999 | |||
| 3024 | Ga0501047_0482194 | |||
| 3025 | Ga0501047_0532842 | |||
| 3026 | Ga0501047_0564595 | |||
| 3027 | Ga0501048_0006170 | |||
| 3028 | Ga0501048_0025329 | |||
| 3029 | Ga0501048_0255468 | |||
| 3030 | Ga0501067_0021596 | |||
| 3031 | Ga0501067_0035959 | |||
| 3032 | Ga0501067_0060855 | |||
| 3033 | Ga0501068_0009003 | |||
| 3034 | Ga0501068_0050038 | |||
| 3035 | Ga0501068_0054407 | |||
| 3036 | Ga0501068_0066912 | |||
| 3037 | Ga0501068_0207663 | |||
| 3038 | Ga0501069_0006392 | |||
| 3039 | Ga0501069_0013979 | |||
| 3040 | Ga0501069_0061272 | |||
| 3041 | Ga0501069_0137319 | |||
| 3042 | Ga0501070_0004886 | |||
| 3043 | Ga0501070_0020360 | |||
| 3044 | Ga0501070_0031866 | |||
| 3045 | Ga0501070_0039798 | |||
| 3046 | Ga0501070_0102705 | |||
| 3047 | Ga0501070_0103992 | |||
| 3048 | Ga0501070_0176529 | |||
| 3049 | Ga0501070_0196238 | |||
| 3050 | Ga0501071_0005326 | |||
| 3051 | Ga0501071_0019248 | |||
| 3052 | Ga0501071_0057430 | |||
| 3053 | Ga0501071_0233936 | |||
| 3054 | Ga0501072_0008657 | |||
| 3055 | Ga0501072_0008716 | |||
| 3056 | Ga0501072_0052098 | |||
| 3057 | Ga0501072_0091966 | |||
| 3058 | Ga0501072_0227378 | |||
| 3059 | Ga0501073_0007155 | |||
| 3060 | Ga0501073_0043909 | |||
| 3061 | Ga0501073_0085148 | |||
| 3062 | Ga0501073_0107786 | |||
| 3063 | Ga0501074_0005374 | |||
| 3064 | Ga0501074_0034612 | |||
| 3065 | Ga0501074_0108886 | |||
| 3066 | Ga0501074_0232754 | |||
| 3067 | Ga0501074_0276712 | |||
| 3068 | Ga0501075_0034247 | |||
| 3069 | Ga0501075_0036537 | |||
| 3070 | Ga0501075_0388322 | |||
| 3071 | Ga0501076_0042510 | |||
| 3072 | Ga0501076_0142250 | |||
| 3073 | Ga0501076_0258752 | |||
| 3074 | Ga0501076_0346372 | |||
| 3075 | Ga0501076_0568361 | |||
| 3076 | Ga0501077_0038583 | |||
| 3077 | Ga0501079_0025191 | |||
| 3078 | Ga0501079_0025723 | |||
| 3079 | Ga0501079_0064159 | |||
| 3080 | Ga0501079_0066273 | |||
| 3081 | Ga0501079_0297363 | |||
| 3082 | Ga0501080_0030655 | |||
| 3083 | Ga0501080_0043911 | |||
| 3084 | Ga0501080_0043954 | |||
| 3085 | Ga0501080_0058203 | |||
| 3086 | Ga0501080_0091459 | |||
| 3087 | Ga0501080_0133557 | |||
| 3088 | Ga0501080_0181143 | |||
| 3089 | Ga0501080_0218911 | |||
| 3090 | Ga0501080_0280095 | |||
| 3091 | Ga0501080_0369480 | |||
| 3092 | Ga0501080_0373475 | |||
| 3093 | Ga0501081_0035257 | |||
| 3094 | Ga0501081_0058062 | |||
| 3095 | Ga0501081_0089128 | |||
| 3096 | Ga0501083_0007711 | |||
| 3097 | Ga0501083_0027167 | |||
| 3098 | Ga0501083_0104974 | |||
| 3099 | Ga0501083_0125908 | |||
| 3100 | Ga0501083_0193282 | |||
| 3101 | Ga0501035_0018143 | |||
| 3102 | Ga0501035_0020783 | |||
| 3103 | Ga0501035_0045393 | |||
| 3104 | Ga0501035_0049633 | |||
| 3105 | Ga0501035_0081794 | |||
| 3106 | Ga0501035_0086966 | |||
| 3107 | Ga0501035_0159064 | |||
| 3108 | Ga0501035_0215697 | |||
| 3109 | Ga0501035_0241991 | |||
| 3110 | Ga0501035_0334296 | |||
| 3111 | Ga0501035_0718269 | |||
| 3112 | Ga0501044_0002231 | |||
| 3113 | Ga0501044_0014745 | |||
| 3114 | Ga0501044_0018639 | |||
| 3115 | Ga0501044_0021198 | |||
| 3116 | Ga0501044_0034684 | |||
| 3117 | Ga0501044_0039939 | |||
| 3118 | Ga0501044_0048900 | |||
| 3119 | Ga0501044_0060711 | |||
| 3120 | Ga0501044_0087183 | |||
| 3121 | Ga0501044_0101310 | |||
| 3122 | Ga0501044_0130947 | |||
| 3123 | Ga0501044_0159049 | |||
| 3124 | Ga0501044_0178512 | |||
| 3125 | Ga0501044_0214366 | |||
| 3126 | Ga0501044_0353299 | |||
| 3127 | Ga0501045_0002076 | |||
| 3128 | Ga0501045_0096301 | |||
| 3129 | Ga0501045_0295435 | |||
| 3130 | nmdc:mga03683_83704_c1 | |||
| 3131 | nmdc:mga03683_90099_c1 | |||
| 3132 | nmdc:mga03n38_1503_c1 | |||
| 3133 | nmdc:mga03n38_233632_c1 | |||
| 3134 | nmdc:mga00v17_16115_c1 | |||
| 3135 | nmdc:mga00v17_40834_c1 | |||
| 3136 | nmdc:mga00v17_45574_c1 | |||
| 3137 | nmdc:mga0yw44_111229_c1 | |||
| 3138 | nmdc:mga0yw44_12558_c1 | |||
| 3139 | nmdc:mga0yw44_13089_c1 | |||
| 3140 | nmdc:mga0yw44_136533_c1 | |||
| 3141 | nmdc:mga0yw44_4562_c1 | |||
| 3142 | nmdc:mga0yw44_67357_c1 | |||
| 3143 | nmdc:mga0yw44_7371_c1 | |||
| 3144 | nmdc:mga0yw44_89468_c1 | |||
| 3145 | nmdc:mga0k408_170998_c1 | |||
| 3146 | nmdc:mga0k408_213452_c1 | |||
| 3147 | nmdc:mga0k408_2577_c1 | |||
| 3148 | nmdc:mga0k408_319818_c1 | |||
| 3149 | nmdc:mga06z11_44377_c1 | |||
| 3150 | nmdc:mga06z11_7051_c1 | |||
| 3151 | nmdc:mga06z11_71486_c1 | |||
| 3152 | nmdc:mga07m45_210203_c1 | |||
| 3153 | nmdc:mga07m45_31160_c2 | |||
| 3154 | nmdc:mga07m45_314260_c1 | |||
| 3155 | nmdc:mga07m45_52290_c1 | |||
| 3156 | nmdc:mga07m45_8008_c2 | |||
| 3157 | nmdc:mga05p37_15155_c1 | |||
| 3158 | nmdc:mga05p37_15592_c1 | |||
| 3159 | nmdc:mga05p37_228749_c1 | |||
| 3160 | nmdc:mga05p37_43733_c1 | |||
| 3161 | nmdc:mga05p37_61857_c1 | |||
| 3162 | nmdc:mga05p37_75724_c1 | |||
| 3163 | nmdc:mga09592_163826_c1 | |||
| 3164 | nmdc:mga09592_347349_c1 | |||
| 3165 | nmdc:mga0qj67_129757_c1 | |||
| 3166 | nmdc:mga0qj67_174206_c1 | |||
| 3167 | nmdc:mga0qj67_23_c1 | |||
| 3168 | nmdc:mga0qj67_342693_c1 | |||
| 3169 | nmdc:mga06r32_114845_c1 | |||
| 3170 | nmdc:mga06r32_180066_c1 | |||
| 3171 | nmdc:mga06r32_236994_c1 | |||
| 3172 | nmdc:mga06r32_698987_c1 | |||
| 3173 | nmdc:mga08y16_110431_c1 | |||
| 3174 | nmdc:mga08y16_207571_c1 | |||
| 3175 | nmdc:mga08y16_211963_c1 | |||
| 3176 | nmdc:mga08y16_243991_c1 | |||
| 3177 | nmdc:mga08y16_739151_c1 | |||
| 3178 | nmdc:mga0n895_398372_c1 | |||
| 3179 | nmdc:mga0n895_56085_c1 | |||
| 3180 | nmdc:mga0n895_968228_c1 | |||
| 3181 | nmdc:mga0rr50_311947_c1 | |||
| 3182 | nmdc:mga08x19_2830_c1 | |||
| 3183 | nmdc:mga08x19_50181_c1 | |||
| 3184 | nmdc:mga0a205_145557_c1 | |||
| 3185 | nmdc:mga0a205_252815_c1 | |||
| 3186 | nmdc:mga0a205_270132_c1 | |||
| 3187 | nmdc:mga0sz30_134503_c1 | |||
| 3188 | nmdc:mga0sz30_142620_c1 | |||
| 3189 | nmdc:mga0sz30_14398_c1 | |||
| 3190 | nmdc:mga0sz30_243354_c1 | |||
| 3191 | Ga0495601_0000009 | |||
| 3192 | Ga0495601_0039057 | |||
| 3193 | Ga0495601_0055874 | |||
| 3194 | Ga0495601_0057707 | |||
| 3195 | Ga0495601_0065435 | |||
| 3196 | Ga0495601_0145261 | |||
| 3197 | Ga0495601_0162009 | |||
| 3198 | Ga0495612_0000019 | |||
| 3199 | Ga0495612_0000377 | |||
| 3200 | Ga0495612_0025416 | |||
| 3201 | Ga0495612_0027882 | |||
| 3202 | Ga0495612_0036305 | |||
| 3203 | Ga0495612_0050490 | |||
| 3204 | Ga0500635_0015217 | |||
| 3205 | Ga0495655_0007211 | |||
| 3206 | Ga0495655_0028734 | |||
| 3207 | Ga0495655_0078535 | |||
| 3208 | Ga0495595_0000015 | |||
| 3209 | Ga0495595_0063768 | |||
| 3210 | Ga0495595_0086540 | |||
| 3211 | Ga0495595_0105047 | |||
| 3212 | Ga0495619_0000012 | |||
| 3213 | Ga0495619_0004501 | |||
| 3214 | Ga0495619_0016798 | |||
| 3215 | Ga0495619_0120537 | |||
| 3216 | Ga0500643_020457 | |||
| 3217 | Ga0500644_0007090 | |||
| 3218 | Ga0500651_0052786 | |||
| 3219 | Ga0500566_0000574 | |||
| 3220 | Ga0500641_0001161 | |||
| 3221 | Ga0500648_158849 | |||
| 3222 | Ga0500650_0003432 | |||
| 3223 | Ga0500554_002421 | |||
| 3224 | Ga0500554_008523 | |||
| 3225 | Ga0500556_0000035 | |||
| 3226 | Ga0500557_000096 | |||
| 3227 | Ga0500562_060723 | |||
| 3228 | Ga0500569_001632 | |||
| 3229 | Ga0500572_000335 | |||
| 3230 | Ga0500593_000214 | |||
| 3231 | Ga0500594_0095949 | |||
| 3232 | Ga0500595_000728 | |||
| 3233 | Ga0500595_061714 | |||
| 3234 | Ga0500608_000269 | |||
| 3235 | Ga0500608_091250 | |||
| 3236 | Ga0500618_012006 | |||
| 3237 | Ga0500642_0000027 | |||
| 3238 | Ga0500642_0000083 | |||
| 3239 | Ga0500642_0062311 | |||
| 3240 | Ga0500642_0200788 | |||
| 3241 | Ga0500652_000529 | |||
| 3242 | Ga0500658_0118352 | |||
| 3243 | Ga0500559_0000064 | |||
| 3244 | Ga0500559_0018562 | |||
| 3245 | Ga0500568_0000004 | |||
| 3246 | Ga0500568_0000443 | |||
| 3247 | Ga0500568_0042567 | |||
| 3248 | Ga0500568_0073161 | |||
| 3249 | Ga0500577_0006124 | |||
| 3250 | Ga0500586_003676 | |||
| 3251 | Ga0500590_133389 | |||
| 3252 | Ga0500603_003284 | |||
| 3253 | Ga0500603_008634 | |||
| 3254 | Ga0500604_0059408 | |||
| 3255 | Ga0500616_0000054 | |||
| 3256 | Ga0500616_0051631 | |||
| 3257 | Ga0500622_0003640 | |||
| 3258 | Ga0500627_0008813 | |||
| 3259 | Ga0500627_0017323 | |||
| 3260 | Ga0500634_0107652 | |||
| 3261 | Ga0500638_007140 | |||
| 3262 | Ga0500638_135408 | |||
| 3263 | Ga0500639_062231 | |||
| 3264 | Ga0500636_0001203 | |||
| 3265 | Ga0500636_0024967 | |||
| 3266 | Ga0500636_0103701 | |||
| 3267 | Ga0500637_0000080 | |||
| 3268 | Ga0500637_0057596 | |||
| 3269 | Ga0500637_0213287 | |||
| 3270 | Ga0500649_119607 | |||
| 3271 | Ga0500570_088450 | |||
| 3272 | Ga0500576_032854 | |||
| 3273 | Ga0500657_105723 | |||
| 3274 | Ga0500625_026577 | |||
| 3275 | Ga0500645_015265 | |||
| 3276 | Ga0500596_009139 | |||
| 3277 | Ga0501084_0050780 | |||
| 3278 | Ga0501084_0156725 | |||
| 3279 | Ga0501084_0208137 | |||
| 3280 | Ga0501084_0237414 | |||
| 3281 | Ga0501084_0593749 | |||
| 3282 | Ga0500661_001305 | |||
| 3283 | Ga0501082_0008815 | |||
| 3284 | Ga0501082_0078861 | |||
| 3285 | Ga0501082_0102542 | |||
| 3286 | Ga0501082_0144600 | |||
| 3287 | Ga0501082_0238226 | |||
| 3288 | Ga0501082_0525482 | |||
| 3289 | Ga0530510_0069935 | |||
| 3290 | Ga0530510_0090885 | |||
| 3291 | Ga0530510_0150706 | |||
| 3292 | Ga0530510_0196700 | |||
| 3293 | Ga0530510_0239313 | |||
| 3294 | 2509146536 | |||
| 3295 | 2513655382 | |||
| 3296 | 2513672531 | |||
| 3297 | 2513702471 | |||
| 3298 | 2513716787 | |||
| 3299 | 2513860054 | |||
| 3300 | 2513892410 | |||
| 3301 | 2513916540 | |||
| 3302 | 2517889869 | |||
| 3303 | 2524466685 | |||
| 3304 | 2524532943 | |||
| 3305 | 2603860655 | |||
| 3306 | 2644290242 | |||
| 3307 | 2671121107 | |||
| 3308 | 2728751736 | |||
| 3309 | 2793073401 | |||
| 3310 | 2824618912 | |||
| 3311 | 2824632928 | |||
| 3312 | 2824642627 | |||
| 3313 | 2824650875 | |||
| 3314 | 2824720727 | |||
| 3315 | 2824730671 | |||
| 3316 | 2844321368 | |||
| 3317 | 2857525614 | |||
| 3318 | 2881367755 | |||
| 3319 | 2893070662 | |||
| 3320 | 2903731442 | |||
| 3321 | 2903749011 | |||
| 3322 | 2903775927 | |||
| 3323 | 2904692694 | |||
| 3324 | 2904711210 | |||
| 3325 | 2906607982 | |||
| 3326 | 2906612394 | |||
| 3327 | 2906637846 | |||
| 3328 | 2906663435 | |||
| 3329 | 2908757666 | |||
| 3330 | 2919074578 | |||
| 3331 | 2922391546 | |||
| 3332 | 2922426899 | |||
| 3333 | 2935633060 | |||
| 3334 | 2941509638 | |||
| 3335 | 2941517467 | |||
| 3336 | 2941526580 | |||
| 3337 | 3005485976 | |||
| 3338 | 3005591798 | |||
| 3339 | 3005601720 | |||
| 3340 | 8006937398 | |||
| 3341 | 8006977427 | |||
| 3342 | 8019561228 | |||
| 3343 | 8019571318 | |||
| 3344 | 8054567645 | |||
| 3345 | 8056678903 | |||
| 3346 | 8056685485 | |||
| 3347 | 8056692023 | |||
| 3348 | 8056971817 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyo-assembly1.cif.gz_B | psabc from streptococcus pneumoniae in complex with fab | 0.9404 | 2 | 224 |
| 2nq2-assembly1.cif.gz_D | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.8946 | 2 | 226 |
| 7kyo-assembly1.cif.gz_B | psabc from streptococcus pneumoniae in complex with fab | 0.8942 | 2 | 224 |
| 2nq2-assembly1.cif.gz_C | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.8824 | 2 | 226 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8799 | 2 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P15031_2_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9239 | 2 | 223 | 3.40.50.300 |
| af_Q58429_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9102 | 2 | 218 | 3.40.50.300 |
| af_Q2G072_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8939 | 2 | 224 | 3.40.50.300 |
| af_P23878_8_259_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8917 | 1 | 224 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8914 | 2 | 206 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3VVJ0-F1-model_v4 | deleted | 0.943 | 2 | 188 |
|
| AF-A0A1J4MZI6-F1-model_v4 | ABC transporter | 0.9312 | 2 | 226 |
GO:0005524
GO:0005886 GO:0006826 GO:0016887 |
| AF-A0A2T0V6S8-F1-model_v4 | Zinc/manganese transport system ATP-binding protein | 0.9175 | 2 | 206 |
GO:0005524
GO:0016887 |
| AF-A0A3A4U7V5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9142 | 21 | 223 |
GO:0005524
GO:0016887 |
| AF-A0A1H5GCX7-F1-model_v4 | Iron complex transport system ATP-binding protein | 0.9115 | 2 | 226 |
GO:0005524
GO:0016887 |