F495288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1674 | 696 | 3348 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0602091|Ga0436361_0602091_290_1003 |
| Length | 237 |
| Sequence | MKRRLEADMEPELNLPAPYTPHVGFVAAFGACRMIAIVRGIKPAEAVAHGRALYEAGFRIIEVPLNSPQPLDSIAALREALPEDAMIGAGTVLTTARVRDVREAGGEVIVMPHADIDVILAAKLQGLACVPGVATPTEAFAALGHGADALKMFPAEQLGPAVTKAWRAVIPPVVPLLPVGGVKPDNMGPQLAAGASGFGLGSALYKPGQDAAATRANALAFIEGWRVTQLGMHGAQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 129 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 130 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 149 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 150 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 151 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 156 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 157 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 158 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 254 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 257 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 258 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 260 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 263 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 264 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 265 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 266 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 267 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 269 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 272 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 274 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 292 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 293 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 294 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 295 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 296 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 297 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 300 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 301 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 302 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 303 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 304 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 305 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 306 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 307 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 308 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 309 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 310 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 311 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 312 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 313 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 314 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 315 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 316 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 317 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 318 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 319 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 320 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 321 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 322 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 323 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 324 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 325 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 332 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 333 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 334 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 422 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 425 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 428 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 429 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 430 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 431 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 434 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 435 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 436 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 437 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 438 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 476 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 479 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 481 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 482 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 483 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 486 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 488 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 494 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 495 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 499 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 501 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 504 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 505 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 506 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 510 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 511 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 512 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 513 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 514 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 515 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 516 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 517 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 518 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 519 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 520 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 521 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 522 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 523 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 524 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 525 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 526 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 527 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 528 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 529 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 530 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 531 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 532 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 533 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 534 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 535 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 536 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 537 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 538 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 539 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 540 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 541 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 542 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 543 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 544 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 545 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 546 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 547 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 548 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 549 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 550 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 551 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 552 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 553 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 554 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 555 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 556 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 557 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 558 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 559 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 560 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 561 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 562 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 563 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 564 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 565 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 566 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 567 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 568 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 569 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 570 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 571 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 572 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 573 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 574 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 575 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 576 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 577 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 578 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 579 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 580 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 581 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 582 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 583 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 584 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 585 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 586 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 587 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 588 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 589 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 590 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 591 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 592 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 593 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 594 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 595 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 596 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 597 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 598 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 599 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 600 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 601 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 602 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 603 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 604 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 605 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 606 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 607 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 608 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 609 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 610 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 611 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 612 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 613 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 614 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 615 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 616 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 617 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 618 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 619 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 620 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 621 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 622 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 623 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 624 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 625 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 626 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 627 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 628 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 629 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 630 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 631 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 632 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 633 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 634 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 635 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 636 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 637 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 638 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 639 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 640 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 641 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 642 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 643 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 644 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 645 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 646 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 647 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 648 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 649 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 650 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 651 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 652 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 653 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 654 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 655 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 656 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 657 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 658 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 659 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 660 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 661 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 662 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 663 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 664 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 665 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 666 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 667 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 668 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 669 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 670 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 671 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 672 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 673 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 674 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 675 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 676 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 677 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 678 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 679 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 680 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 681 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 682 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 683 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 684 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 685 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 686 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 687 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 688 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 689 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 690 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 691 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 692 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 693 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 694 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 695 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 696 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.65 |
| Metatranscriptomes | 0.18 |
| Isolates | 11.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 10.39 |
| Nodule | 1.14 |
| Rhizoplane | 3.58 |
| Rhizosphere | 72.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0602091 | 3300039447 | Bacteria | 1223 |
| 2 | SwRhRL2b_contig_656453 | 2162886007 | Bacteria | 2013 |
| 3 | JGI24739J22299_10001818 | 3300001989 | Bacteria | 8134 |
| 4 | JGI24737J22298_10091662 | 3300001990 | Bacteria | 901 |
| 5 | JGI24735J21928_10000175 | 3300002067 | Bacteria | 22763 |
| 6 | JGI24735J21928_10001426 | 3300002067 | Bacteria | 8447 |
| 7 | JGI25162J39368_1000063 | 3300002737 | Bacteria | 134747 |
| 8 | JGI25162J39368_1000287 | 3300002737 | Bacteria | 47192 |
| 9 | JGI25158J39367_1004817 | 3300002739 | Bacteria | 2010 |
| 10 | JGI25157J39369_1000217 | 3300002741 | Bacteria | 47210 |
| 11 | JGI25157J39369_1008628 | 3300002741 | Bacteria | 1409 |
| 12 | JGI25163J39215_1000677 | 3300002771 | Bacteria | 9056 |
| 13 | JGI25163J39215_1002287 | 3300002771 | Bacteria | 2080 |
| 14 | JGI25164J39214_1000672 | 3300002772 | Bacteria | 13810 |
| 15 | JGI25164J39214_1004989 | 3300002772 | Bacteria | 1473 |
| 16 | JGI25159J45721_1004581 | 3300002987 | Bacteria | 4548 |
| 17 | JGI25151J46595_10000338 | 3300003187 | Bacteria | 50270 |
| 18 | JGI25165J46597_1000069 | 3300003214 | Bacteria | 195460 |
| 19 | JGI25165J46597_1000388 | 3300003214 | Bacteria | 47192 |
| 20 | rootH1_10093753 | 3300003316 | Bacteria | 2008 |
| 21 | rootH2_10007026 | 3300003320 | Bacteria | 3234 |
| 22 | rootH2_10077057 | 3300003320 | Bacteria | 1527 |
| 23 | rootL2_10039617 | 3300003322 | Bacteria | 3957 |
| 24 | rootH1_10009337 | 3300003323 | Bacteria | 14683 |
| 25 | rootH1_10071821 | 3300003323 | Bacteria | 3001 |
| 26 | rootH1_10074923 | 3300003323 | Bacteria | 2899 |
| 27 | rootH1_10105829 | 3300003323 | Bacteria | 2883 |
| 28 | rootH1_10249875 | 3300003323 | Bacteria | 1124 |
| 29 | JGI25161J50226_1000201 | 3300003374 | Bacteria | 39071 |
| 30 | Ga0055538_1000034 | 3300003751 | Bacteria | 195460 |
| 31 | Ga0055538_1004584 | 3300003751 | Bacteria | 1544 |
| 32 | Ga0055539_1000044 | 3300003752 | Bacteria | 195460 |
| 33 | Ga0055533_1000055 | 3300003756 | Bacteria | 195460 |
| 34 | Ga0055525_1000066 | 3300003759 | Bacteria | 195460 |
| 35 | Ga0055535_1000335 | 3300003761 | Bacteria | 47184 |
| 36 | Ga0055535_1000978 | 3300003761 | Bacteria | 18662 |
| 37 | Ga0055535_1019184 | 3300003761 | Bacteria | 873 |
| 38 | Ga0055542_1000363 | 3300003762 | Bacteria | 47192 |
| 39 | Ga0055542_1001209 | 3300003762 | Bacteria | 14546 |
| 40 | Ga0055529_1000391 | 3300003763 | Bacteria | 47192 |
| 41 | Ga0055529_1000610 | 3300003763 | Bacteria | 27246 |
| 42 | Ga0055529_1000975 | 3300003763 | Bacteria | 14385 |
| 43 | Ga0055529_1005226 | 3300003763 | Bacteria | 1897 |
| 44 | Ga0055529_1015679 | 3300003763 | Bacteria | 955 |
| 45 | Ga0055526_1000116 | 3300003771 | Bacteria | 70518 |
| 46 | Ga0055526_1000487 | 3300003771 | Bacteria | 31529 |
| 47 | Ga0055526_1006469 | 3300003771 | Bacteria | 6351 |
| 48 | Ga0055537_1000035 | 3300003773 | Bacteria | 96274 |
| 49 | Ga0055524_1021726 | 3300003775 | Bacteria | 2117 |
| 50 | Ga0055524_1025753 | 3300003775 | Bacteria | 1834 |
| 51 | Ga0055524_1053959 | 3300003775 | Bacteria | 885 |
| 52 | Ga0055536_1000103 | 3300003781 | Bacteria | 73706 |
| 53 | Ga0055536_1002169 | 3300003781 | Bacteria | 11186 |
| 54 | Ga0055536_1041914 | 3300003781 | Bacteria | 1075 |
| 55 | Ga0055534_1000104 | 3300003784 | Bacteria | 64767 |
| 56 | Ga0055534_1000158 | 3300003784 | Bacteria | 50846 |
| 57 | Ga0055534_1000325 | 3300003784 | Bacteria | 31562 |
| 58 | Ga0055528_1000058 | 3300003790 | Bacteria | 88086 |
| 59 | Ga0055530_10001374 | 3300003791 | Bacteria | 18030 |
| 60 | Ga0055530_10007126 | 3300003791 | Bacteria | 4791 |
| 61 | Ga0055540_1010062 | 3300003792 | Bacteria | 3184 |
| 62 | Ga0055531_10006687 | 3300003794 | Bacteria | 6463 |
| 63 | Ga0055531_10014117 | 3300003794 | Bacteria | 3623 |
| 64 | Ga0055531_10023407 | 3300003794 | Bacteria | 2318 |
| 65 | Ga0055531_10067287 | 3300003794 | Bacteria | 842 |
| 66 | Ga0055541_1000032 | 3300003841 | Bacteria | 195460 |
| 67 | Ga0058692_1000009 | 3300003856 | Bacteria | 349545 |
| 68 | Ga0055543_1000103 | 3300004625 | Bacteria | 73828 |
| 69 | Ga0065165_1000224 | 3300005262 | Bacteria | 99359 |
| 70 | Ga0065165_1000854 | 3300005262 | Bacteria | 39869 |
| 71 | Ga0065714_10007829 | 3300005288 | Bacteria | 3380 |
| 72 | Ga0065714_10012581 | 3300005288 | Bacteria | 2772 |
| 73 | Ga0065714_10069716 | 3300005288 | Bacteria | 4094 |
| 74 | Ga0065704_10009257 | 3300005289 | Bacteria | 4670 |
| 75 | Ga0065704_10118926 | 3300005289 | Bacteria | 1808 |
| 76 | Ga0065704_10264331 | 3300005289 | Bacteria | 956 |
| 77 | Ga0065712_10000132 | 3300005290 | Bacteria | 73390 |
| 78 | Ga0065712_10090203 | 3300005290 | Bacteria | 2403 |
| 79 | Ga0065707_10082092 | 3300005295 | Bacteria | 22240 |
| 80 | Ga0070658_10014131 | 3300005327 | Bacteria | 6410 |
| 81 | Ga0070658_10123076 | 3300005327 | Bacteria | 2156 |
| 82 | Ga0070658_10173891 | 3300005327 | Bacteria | 1810 |
| 83 | Ga0070676_10000184 | 3300005328 | Bacteria | 25832 |
| 84 | Ga0070676_10016033 | 3300005328 | Bacteria | 4138 |
| 85 | Ga0070676_10086903 | 3300005328 | Bacteria | 1908 |
| 86 | Ga0070676_10155529 | 3300005328 | Bacteria | 1467 |
| 87 | Ga0070683_100002328 | 3300005329 | Bacteria | 15073 |
| 88 | Ga0070683_100031670 | 3300005329 | Bacteria | 4812 |
| 89 | Ga0070683_100115303 | 3300005329 | Bacteria | 2536 |
| 90 | Ga0070683_100140189 | 3300005329 | Bacteria | 2291 |
| 91 | Ga0070683_100510519 | 3300005329 | Bacteria | 1149 |
| 92 | Ga0070690_100096094 | 3300005330 | Bacteria | 1958 |
| 93 | Ga0070670_100005054 | 3300005331 | Bacteria | 11101 |
| 94 | Ga0070670_100026223 | 3300005331 | Bacteria | 5017 |
| 95 | Ga0070670_100128471 | 3300005331 | Bacteria | 2187 |
| 96 | Ga0070670_100265249 | 3300005331 | Bacteria | 1498 |
| 97 | Ga0070677_10000379 | 3300005333 | Bacteria | 15666 |
| 98 | Ga0070677_10022599 | 3300005333 | Bacteria | 2318 |
| 99 | Ga0070677_10070743 | 3300005333 | Bacteria | 1467 |
| 100 | Ga0068869_100028286 | 3300005334 | Bacteria | 3917 |
| 101 | Ga0068869_100225786 | 3300005334 | Bacteria | 1486 |
| 102 | Ga0070666_10012374 | 3300005335 | Bacteria | 5379 |
| 103 | Ga0070680_100003334 | 3300005336 | Bacteria | 11980 |
| 104 | Ga0070680_100124199 | 3300005336 | Bacteria | 2156 |
| 105 | Ga0070680_100269382 | 3300005336 | Bacteria | 1442 |
| 106 | Ga0070682_100003944 | 3300005337 | Bacteria | 8239 |
| 107 | Ga0070682_100014112 | 3300005337 | Bacteria | 4613 |
| 108 | Ga0068868_100002077 | 3300005338 | Bacteria | 13773 |
| 109 | Ga0068868_100023967 | 3300005338 | Bacteria | 4625 |
| 110 | Ga0068868_100026781 | 3300005338 | Bacteria | 4396 |
| 111 | Ga0068868_100418855 | 3300005338 | Bacteria | 1159 |
| 112 | Ga0068868_100647819 | 3300005338 | Bacteria | 940 |
| 113 | Ga0070660_100001110 | 3300005339 | Bacteria | 18135 |
| 114 | Ga0070660_100078997 | 3300005339 | Bacteria | 2581 |
| 115 | Ga0070660_100114547 | 3300005339 | Bacteria | 2148 |
| 116 | Ga0070661_100085612 | 3300005344 | Bacteria | 2329 |
| 117 | Ga0070661_100120919 | 3300005344 | Bacteria | 1961 |
| 118 | Ga0070668_100004033 | 3300005347 | Bacteria | 10859 |
| 119 | Ga0070668_100060509 | 3300005347 | Bacteria | 2933 |
| 120 | Ga0070668_100067315 | 3300005347 | Bacteria | 2782 |
| 121 | Ga0070668_100094228 | 3300005347 | Bacteria | 2363 |
| 122 | Ga0070668_100167475 | 3300005347 | Bacteria | 1787 |
| 123 | Ga0070668_100275083 | 3300005347 | Bacteria | 1405 |
| 124 | Ga0070668_100336190 | 3300005347 | Bacteria | 1275 |
| 125 | Ga0070668_100410165 | 3300005347 | Bacteria | 1158 |
| 126 | Ga0070669_100020760 | 3300005353 | Bacteria | 4692 |
| 127 | Ga0070669_100136133 | 3300005353 | Bacteria | 1889 |
| 128 | Ga0070669_100764828 | 3300005353 | Bacteria | 819 |
| 129 | Ga0070675_100004329 | 3300005354 | Bacteria | 10827 |
| 130 | Ga0070675_100010835 | 3300005354 | Bacteria | 7127 |
| 131 | Ga0070675_100075645 | 3300005354 | Bacteria | 2799 |
| 132 | Ga0070675_100251931 | 3300005354 | Bacteria | 1546 |
| 133 | Ga0070675_100918528 | 3300005354 | Bacteria | 802 |
| 134 | Ga0070671_100043865 | 3300005355 | Bacteria | 3716 |
| 135 | Ga0070671_100049086 | 3300005355 | Bacteria | 3511 |
| 136 | Ga0070671_100074400 | 3300005355 | Bacteria | 2838 |
| 137 | Ga0070674_100006415 | 3300005356 | Bacteria | 6860 |
| 138 | Ga0070674_100185045 | 3300005356 | Bacteria | 1598 |
| 139 | Ga0070674_100228228 | 3300005356 | Bacteria | 1452 |
| 140 | Ga0070673_100019406 | 3300005364 | Bacteria | 4879 |
| 141 | Ga0070673_100021478 | 3300005364 | Bacteria | 4681 |
| 142 | Ga0070673_100073974 | 3300005364 | Bacteria | 2744 |
| 143 | Ga0070673_100087809 | 3300005364 | Bacteria | 2535 |
| 144 | Ga0070688_100382213 | 3300005365 | Bacteria | 1038 |
| 145 | Ga0070688_100832145 | 3300005365 | Bacteria | 724 |
| 146 | Ga0070688_100844682 | 3300005365 | Bacteria | 719 |
| 147 | Ga0070659_100062514 | 3300005366 | Bacteria | 2944 |
| 148 | Ga0070659_100318943 | 3300005366 | Bacteria | 1299 |
| 149 | Ga0070659_100548394 | 3300005366 | Bacteria | 989 |
| 150 | Ga0070659_100770255 | 3300005366 | Bacteria | 836 |
| 151 | Ga0070667_100018980 | 3300005367 | Bacteria | 5701 |
| 152 | Ga0070667_100101645 | 3300005367 | Bacteria | 2484 |
| 153 | Ga0070667_100153202 | 3300005367 | Bacteria | 2026 |
| 154 | Ga0070667_100260558 | 3300005367 | Bacteria | 1552 |
| 155 | Ga0070714_100601099 | 3300005435 | Bacteria | 1056 |
| 156 | Ga0070713_100111919 | 3300005436 | Bacteria | 2381 |
| 157 | Ga0070710_10021874 | 3300005437 | Bacteria | 3338 |
| 158 | Ga0070711_100438177 | 3300005439 | Bacteria | 1068 |
| 159 | Ga0070700_100798855 | 3300005441 | Bacteria | 760 |
| 160 | Ga0070663_100013698 | 3300005455 | Bacteria | 5182 |
| 161 | Ga0070663_100248073 | 3300005455 | Bacteria | 1408 |
| 162 | Ga0070663_100403662 | 3300005455 | Bacteria | 1118 |
| 163 | Ga0070663_100464896 | 3300005455 | Bacteria | 1045 |
| 164 | Ga0070678_100342825 | 3300005456 | Bacteria | 1282 |
| 165 | Ga0070678_100927899 | 3300005456 | Bacteria | 797 |
| 166 | Ga0070662_100009714 | 3300005457 | Bacteria | 6296 |
| 167 | Ga0070662_100029289 | 3300005457 | Bacteria | 3842 |
| 168 | Ga0070662_100074443 | 3300005457 | Bacteria | 2512 |
| 169 | Ga0070662_100264729 | 3300005457 | Bacteria | 1386 |
| 170 | Ga0070662_100274238 | 3300005457 | Bacteria | 1363 |
| 171 | Ga0070681_10211816 | 3300005458 | Bacteria | 1854 |
| 172 | Ga0070681_10238260 | 3300005458 | Bacteria | 1733 |
| 173 | Ga0070681_10308196 | 3300005458 | Bacteria | 1493 |
| 174 | Ga0068867_100021598 | 3300005459 | Bacteria | 4595 |
| 175 | Ga0070685_10031687 | 3300005466 | Bacteria | 2956 |
| 176 | Ga0070685_10345998 | 3300005466 | Bacteria | 1015 |
| 177 | Ga0070699_100470317 | 3300005518 | Bacteria | 1140 |
| 178 | Ga0070679_100119972 | 3300005530 | Bacteria | 2615 |
| 179 | Ga0070679_100153527 | 3300005530 | Bacteria | 2278 |
| 180 | Ga0070679_100156262 | 3300005530 | Bacteria | 2255 |
| 181 | Ga0070679_100225783 | 3300005530 | Bacteria | 1833 |
| 182 | Ga0070679_100466101 | 3300005530 | Bacteria | 1208 |
| 183 | Ga0070684_100001235 | 3300005535 | Bacteria | 18342 |
| 184 | Ga0070684_100027746 | 3300005535 | Bacteria | 4782 |
| 185 | Ga0070684_100057175 | 3300005535 | Bacteria | 3405 |
| 186 | Ga0070684_100147827 | 3300005535 | Bacteria | 2128 |
| 187 | Ga0070684_100218756 | 3300005535 | Bacteria | 1738 |
| 188 | Ga0068853_100035810 | 3300005539 | Bacteria | 4218 |
| 189 | Ga0070672_100024644 | 3300005543 | Bacteria | 4450 |
| 190 | Ga0070672_100039537 | 3300005543 | Bacteria | 3614 |
| 191 | Ga0070672_100083942 | 3300005543 | Bacteria | 2557 |
| 192 | Ga0070672_100107480 | 3300005543 | Bacteria | 2270 |
| 193 | Ga0070672_100113189 | 3300005543 | Bacteria | 2214 |
| 194 | Ga0070672_100201041 | 3300005543 | Bacteria | 1666 |
| 195 | Ga0070672_100318529 | 3300005543 | Bacteria | 1322 |
| 196 | Ga0070672_100372234 | 3300005543 | Bacteria | 1221 |
| 197 | Ga0070696_100186255 | 3300005546 | Bacteria | 1542 |
| 198 | Ga0070693_100172707 | 3300005547 | Bacteria | 1386 |
| 199 | Ga0070665_100012164 | 3300005548 | Bacteria | 8676 |
| 200 | Ga0070665_100024403 | 3300005548 | Bacteria | 6089 |
| 201 | Ga0070665_100459856 | 3300005548 | Bacteria | 1283 |
| 202 | Ga0070665_100534549 | 3300005548 | Bacteria | 1184 |
| 203 | Ga0070665_100560054 | 3300005548 | Bacteria | 1155 |
| 204 | Ga0070665_100575002 | 3300005548 | Bacteria | 1139 |
| 205 | Ga0068855_100003248 | 3300005563 | Bacteria | 19878 |
| 206 | Ga0068855_100012376 | 3300005563 | Bacteria | 10305 |
| 207 | Ga0068855_100051713 | 3300005563 | Bacteria | 4839 |
| 208 | Ga0068855_100132342 | 3300005563 | Bacteria | 2847 |
| 209 | Ga0068855_100183432 | 3300005563 | Bacteria | 2365 |
| 210 | Ga0068855_100602645 | 3300005563 | Bacteria | 1184 |
| 211 | Ga0070664_100055289 | 3300005564 | Bacteria | 3369 |
| 212 | Ga0070664_100169074 | 3300005564 | Bacteria | 1939 |
| 213 | Ga0070664_100178464 | 3300005564 | Bacteria | 1887 |
| 214 | Ga0070664_100190283 | 3300005564 | Bacteria | 1828 |
| 215 | Ga0070664_100418747 | 3300005564 | Bacteria | 1227 |
| 216 | Ga0070664_100486035 | 3300005564 | Bacteria | 1137 |
| 217 | Ga0068857_100008513 | 3300005577 | Bacteria | 8870 |
| 218 | Ga0068857_100051007 | 3300005577 | Bacteria | 3670 |
| 219 | Ga0068857_100063861 | 3300005577 | Bacteria | 3273 |
| 220 | Ga0068857_100182706 | 3300005577 | Bacteria | 1909 |
| 221 | Ga0068857_100365287 | 3300005577 | Bacteria | 1338 |
| 222 | Ga0068854_100000699 | 3300005578 | Bacteria | 19878 |
| 223 | Ga0068854_100001438 | 3300005578 | Bacteria | 14407 |
| 224 | Ga0068854_100006866 | 3300005578 | Bacteria | 7259 |
| 225 | Ga0068854_100162955 | 3300005578 | Bacteria | 1729 |
| 226 | Ga0068854_100437129 | 3300005578 | Bacteria | 1090 |
| 227 | Ga0068854_100523259 | 3300005578 | Bacteria | 1002 |
| 228 | Ga0068854_100779783 | 3300005578 | Bacteria | 831 |
| 229 | Ga0068856_100016100 | 3300005614 | Bacteria | 7228 |
| 230 | Ga0068856_100768637 | 3300005614 | Bacteria | 983 |
| 231 | Ga0068852_100045673 | 3300005616 | Bacteria | 3727 |
| 232 | Ga0068852_100049791 | 3300005616 | Bacteria | 3586 |
| 233 | Ga0068852_100113902 | 3300005616 | Bacteria | 2463 |
| 234 | Ga0068852_100286449 | 3300005616 | Bacteria | 1590 |
| 235 | Ga0068852_100704958 | 3300005616 | Bacteria | 1020 |
| 236 | Ga0068859_100011168 | 3300005617 | Bacteria | 9029 |
| 237 | Ga0068859_100014157 | 3300005617 | Bacteria | 7998 |
| 238 | Ga0068859_100071933 | 3300005617 | Bacteria | 3494 |
| 239 | Ga0068859_100233165 | 3300005617 | Bacteria | 1929 |
| 240 | Ga0068864_100006939 | 3300005618 | Bacteria | 9292 |
| 241 | Ga0068864_100014348 | 3300005618 | Bacteria | 6581 |
| 242 | Ga0068864_100020963 | 3300005618 | Bacteria | 5473 |
| 243 | Ga0068864_100035586 | 3300005618 | Bacteria | 4240 |
| 244 | Ga0068866_10176571 | 3300005718 | Unclassified | 1258 |
| 245 | Ga0068861_100001967 | 3300005719 | Bacteria | 13242 |
| 246 | Ga0068861_100098554 | 3300005719 | Bacteria | 2320 |
| 247 | Ga0068861_100099116 | 3300005719 | Bacteria | 2314 |
| 248 | Ga0068861_101011004 | 3300005719 | Bacteria | 794 |
| 249 | Ga0068851_10015815 | 3300005834 | Bacteria | 3601 |
| 250 | Ga0068851_10065197 | 3300005834 | Bacteria | 1874 |
| 251 | Ga0068851_10209105 | 3300005834 | Bacteria | 1092 |
| 252 | Ga0068870_10027147 | 3300005840 | Bacteria | 2861 |
| 253 | Ga0068870_10124361 | 3300005840 | Bacteria | 1490 |
| 254 | Ga0068863_100012433 | 3300005841 | Bacteria | 8219 |
| 255 | Ga0068863_100037327 | 3300005841 | Bacteria | 4626 |
| 256 | Ga0068863_100151663 | 3300005841 | Bacteria | 2218 |
| 257 | Ga0068863_100241408 | 3300005841 | Bacteria | 1744 |
| 258 | Ga0068863_100276828 | 3300005841 | Bacteria | 1625 |
| 259 | Ga0068863_100278780 | 3300005841 | Bacteria | 1619 |
| 260 | Ga0068863_100336788 | 3300005841 | Bacteria | 1467 |
| 261 | Ga0068863_100500118 | 3300005841 | Bacteria | 1197 |
| 262 | Ga0068863_100518383 | 3300005841 | Bacteria | 1175 |
| 263 | Ga0068863_100623364 | 3300005841 | Bacteria | 1068 |
| 264 | Ga0068858_100139654 | 3300005842 | Bacteria | 2274 |
| 265 | Ga0068858_100485410 | 3300005842 | Bacteria | 1193 |
| 266 | Ga0068860_100014126 | 3300005843 | Bacteria | 7830 |
| 267 | Ga0068860_100018457 | 3300005843 | Bacteria | 6785 |
| 268 | Ga0068860_100230298 | 3300005843 | Bacteria | 1801 |
| 269 | Ga0068860_100272470 | 3300005843 | Bacteria | 1652 |
| 270 | Ga0068860_100275885 | 3300005843 | Unclassified | 1642 |
| 271 | Ga0068860_100408596 | 3300005843 | Bacteria | 1344 |
| 272 | Ga0068862_100015603 | 3300005844 | Bacteria | 6310 |
| 273 | Ga0068862_100073069 | 3300005844 | Unclassified | 2964 |
| 274 | Ga0075363_100279879 | 3300006048 | Bacteria | 965 |
| 275 | Ga0075364_10320929 | 3300006051 | Bacteria | 1055 |
| 276 | Ga0075364_10426602 | 3300006051 | Bacteria | 905 |
| 277 | Ga0075364_10570376 | 3300006051 | Bacteria | 773 |
| 278 | Ga0075432_10000316 | 3300006058 | Bacteria | 13593 |
| 279 | Ga0075432_10103215 | 3300006058 | Bacteria | 1055 |
| 280 | Ga0075362_10000923 | 3300006177 | Bacteria | 8934 |
| 281 | Ga0075369_10119616 | 3300006186 | Bacteria | 1191 |
| 282 | Ga0075366_10009494 | 3300006195 | Bacteria | 5431 |
| 283 | Ga0097621_100386334 | 3300006237 | Bacteria | 1251 |
| 284 | Ga0097621_100457433 | 3300006237 | Bacteria | 1151 |
| 285 | Ga0097621_100516321 | 3300006237 | Bacteria | 1084 |
| 286 | Ga0068871_100080037 | 3300006358 | Bacteria | 2704 |
| 287 | Ga0068871_100829103 | 3300006358 | Unclassified | 854 |
| 288 | Ga0075428_100647354 | 3300006844 | Bacteria | 1127 |
| 289 | Ga0075428_101084647 | 3300006844 | Bacteria | 846 |
| 290 | Ga0068865_100047329 | 3300006881 | Bacteria | 2955 |
| 291 | Ga0068865_100227731 | 3300006881 | Bacteria | 1461 |
| 292 | Ga0075436_100119814 | 3300006914 | Bacteria | 1840 |
| 293 | Ga0097620_100011168 | 3300006931 | Bacteria | 9029 |
| 294 | Ga0097620_100014159 | 3300006931 | Bacteria | 7998 |
| 295 | Ga0097620_100071933 | 3300006931 | Bacteria | 3494 |
| 296 | Ga0097620_100233177 | 3300006931 | Bacteria | 1929 |
| 297 | Ga0079104_1021663 | 3300006946 | Bacteria | 1746 |
| 298 | Ga0105251_10002617 | 3300009011 | Bacteria | 13912 |
| 299 | Ga0105251_10004604 | 3300009011 | Bacteria | 9313 |
| 300 | Ga0105251_10032844 | 3300009011 | Bacteria | 2582 |
| 301 | Ga0105251_10056938 | 3300009011 | Bacteria | 1849 |
| 302 | Ga0105244_10002401 | 3300009036 | Bacteria | 14159 |
| 303 | Ga0105244_10120692 | 3300009036 | Bacteria | 1269 |
| 304 | Ga0105244_10148471 | 3300009036 | Bacteria | 1124 |
| 305 | Ga0105250_10000550 | 3300009092 | Bacteria | 25618 |
| 306 | Ga0105250_10002212 | 3300009092 | Bacteria | 9912 |
| 307 | Ga0105250_10026587 | 3300009092 | Bacteria | 2332 |
| 308 | Ga0105250_10287560 | 3300009092 | Bacteria | 708 |
| 309 | Ga0105240_10001607 | 3300009093 | Bacteria | 38298 |
| 310 | Ga0105240_10005342 | 3300009093 | Bacteria | 19161 |
| 311 | Ga0105240_10017316 | 3300009093 | Bacteria | 9714 |
| 312 | Ga0105240_10020280 | 3300009093 | Bacteria | 8873 |
| 313 | Ga0105240_10023104 | 3300009093 | Bacteria | 8233 |
| 314 | Ga0105240_10224191 | 3300009093 | Bacteria | 2188 |
| 315 | Ga0105240_10322835 | 3300009093 | Bacteria | 1759 |
| 316 | Ga0105240_10381595 | 3300009093 | Bacteria | 1592 |
| 317 | Ga0105240_10405876 | 3300009093 | Bacteria | 1534 |
| 318 | Ga0105240_10648266 | 3300009093 | Bacteria | 1158 |
| 319 | Ga0105240_11392873 | 3300009093 | Bacteria | 737 |
| 320 | Ga0111539_10640115 | 3300009094 | Bacteria | 1238 |
| 321 | Ga0105245_10257272 | 3300009098 | Bacteria | 1698 |
| 322 | Ga0105245_10320485 | 3300009098 | Bacteria | 1527 |
| 323 | Ga0105247_10018162 | 3300009101 | Bacteria | 4218 |
| 324 | Ga0105247_10267118 | 3300009101 | Bacteria | 1175 |
| 325 | Ga0105243_10001011 | 3300009148 | Bacteria | 25990 |
| 326 | Ga0105243_10051347 | 3300009148 | Bacteria | 3261 |
| 327 | Ga0105242_10358512 | 3300009176 | Bacteria | 1349 |
| 328 | Ga0105242_10421815 | 3300009176 | Bacteria | 1250 |
| 329 | Ga0105248_10257694 | 3300009177 | Bacteria | 1964 |
| 330 | Ga0105248_10334437 | 3300009177 | Bacteria | 1705 |
| 331 | Ga0105248_11132222 | 3300009177 | Bacteria | 885 |
| 332 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 333 | Ga0105237_10000136 | 3300009545 | Bacteria | 103269 |
| 334 | Ga0105237_10058621 | 3300009545 | Bacteria | 3853 |
| 335 | Ga0105237_10188719 | 3300009545 | Bacteria | 2061 |
| 336 | Ga0105238_10036529 | 3300009551 | Bacteria | 4995 |
| 337 | Ga0105238_10261347 | 3300009551 | Bacteria | 1710 |
| 338 | Ga0105238_10777598 | 3300009551 | Bacteria | 972 |
| 339 | Ga0105249_10096119 | 3300009553 | Bacteria | 2779 |
| 340 | Ga0105239_10011357 | 3300010375 | Bacteria | 9936 |
| 341 | Ga0105239_10061307 | 3300010375 | Bacteria | 4128 |
| 342 | Ga0105246_10000322 | 3300011119 | Bacteria | 25369 |
| 343 | Ga0105246_10002126 | 3300011119 | Bacteria | 11943 |
| 344 | Ga0105246_10023561 | 3300011119 | Bacteria | 3985 |
| 345 | Ga0105246_10567655 | 3300011119 | Bacteria | 975 |
| 346 | Ga0157345_1000091 | 3300012498 | Bacteria | 19224 |
| 347 | Ga0157314_1000581 | 3300012500 | Bacteria | 3371 |
| 348 | Ga0157347_1002954 | 3300012502 | Bacteria | 1494 |
| 349 | Ga0157373_10000568 | 3300013100 | Bacteria | 28815 |
| 350 | Ga0157373_10003664 | 3300013100 | Bacteria | 11614 |
| 351 | Ga0157373_10009218 | 3300013100 | Bacteria | 7299 |
| 352 | Ga0157373_10085097 | 3300013100 | Bacteria | 2229 |
| 353 | Ga0157373_10113106 | 3300013100 | Bacteria | 1907 |
| 354 | Ga0157373_10638965 | 3300013100 | Bacteria | 777 |
| 355 | Ga0157371_10016582 | 3300013102 | Bacteria | 5494 |
| 356 | Ga0157371_10216135 | 3300013102 | Bacteria | 1376 |
| 357 | Ga0157371_10377801 | 3300013102 | Bacteria | 1034 |
| 358 | Ga0157370_10077206 | 3300013104 | Bacteria | 3138 |
| 359 | Ga0157370_10281370 | 3300013104 | Bacteria | 1537 |
| 360 | Ga0157370_10322545 | 3300013104 | Bacteria | 1425 |
| 361 | Ga0157369_10001737 | 3300013105 | Bacteria | 26487 |
| 362 | Ga0157369_10001978 | 3300013105 | Bacteria | 24687 |
| 363 | Ga0157369_10025617 | 3300013105 | Bacteria | 6545 |
| 364 | Ga0157369_10047946 | 3300013105 | Bacteria | 4637 |
| 365 | Ga0157369_10147301 | 3300013105 | Bacteria | 2489 |
| 366 | Ga0157369_10170224 | 3300013105 | Bacteria | 2295 |
| 367 | Ga0157369_10255746 | 3300013105 | Bacteria | 1827 |
| 368 | Ga0157369_10604876 | 3300013105 | Bacteria | 1131 |
| 369 | Ga0157369_10646301 | 3300013105 | Bacteria | 1091 |
| 370 | Ga0157369_10833279 | 3300013105 | Bacteria | 947 |
| 371 | Ga0157374_10000055 | 3300013296 | Bacteria | 120079 |
| 372 | Ga0157374_10003393 | 3300013296 | Bacteria | 13392 |
| 373 | Ga0157374_10388709 | 3300013296 | Bacteria | 1390 |
| 374 | Ga0157378_10285618 | 3300013297 | Bacteria | 1592 |
| 375 | Ga0163162_10083329 | 3300013306 | Bacteria | 3271 |
| 376 | Ga0163162_10162708 | 3300013306 | Bacteria | 2354 |
| 377 | Ga0163162_10258243 | 3300013306 | Bacteria | 1874 |
| 378 | Ga0163162_10578767 | 3300013306 | Bacteria | 1250 |
| 379 | Ga0157372_10001079 | 3300013307 | Bacteria | 29711 |
| 380 | Ga0157372_10055049 | 3300013307 | Bacteria | 4441 |
| 381 | Ga0157372_10131453 | 3300013307 | Bacteria | 2880 |
| 382 | Ga0157372_10220879 | 3300013307 | Bacteria | 2196 |
| 383 | Ga0157372_10437604 | 3300013307 | Bacteria | 1524 |
| 384 | Ga0157372_10477804 | 3300013307 | Bacteria | 1453 |
| 385 | Ga0157372_10527871 | 3300013307 | Bacteria | 1376 |
| 386 | Ga0157372_10544429 | 3300013307 | Bacteria | 1353 |
| 387 | Ga0157375_10007393 | 3300013308 | Bacteria | 9615 |
| 388 | Ga0157375_10012489 | 3300013308 | Bacteria | 7538 |
| 389 | Ga0157375_10106507 | 3300013308 | Bacteria | 2895 |
| 390 | Ga0157375_10350854 | 3300013308 | Bacteria | 1641 |
| 391 | Ga0157375_10699769 | 3300013308 | Bacteria | 1167 |
| 392 | Ga0157375_11107539 | 3300013308 | Bacteria | 927 |
| 393 | Ga0163163_10012181 | 3300014325 | Bacteria | 7828 |
| 394 | Ga0157380_10006526 | 3300014326 | Bacteria | 8227 |
| 395 | Ga0157380_10125069 | 3300014326 | Bacteria | 2184 |
| 396 | Ga0182008_10001995 | 3300014497 | Bacteria | 13100 |
| 397 | Ga0182008_10009442 | 3300014497 | Bacteria | 5263 |
| 398 | Ga0182008_10036444 | 3300014497 | Bacteria | 2461 |
| 399 | Ga0182008_10038233 | 3300014497 | Bacteria | 2400 |
| 400 | Ga0182008_10112878 | 3300014497 | Bacteria | 1347 |
| 401 | Ga0157377_10395201 | 3300014745 | Bacteria | 940 |
| 402 | Ga0157379_10007766 | 3300014968 | Bacteria | 9290 |
| 403 | Ga0157379_10126591 | 3300014968 | Bacteria | 2298 |
| 404 | Ga0157376_10069963 | 3300014969 | Bacteria | 2977 |
| 405 | Ga0157376_10111105 | 3300014969 | Bacteria | 2413 |
| 406 | Ga0157376_10159234 | 3300014969 | Bacteria | 2045 |
| 407 | Ga0157376_10918310 | 3300014969 | Bacteria | 894 |
| 408 | Ga0182006_1000967 | 3300015261 | Bacteria | 19035 |
| 409 | Ga0182006_1002514 | 3300015261 | Bacteria | 9969 |
| 410 | Ga0182006_1006793 | 3300015261 | Bacteria | 5279 |
| 411 | Ga0182006_1009331 | 3300015261 | Bacteria | 4401 |
| 412 | Ga0182006_1020584 | 3300015261 | Bacteria | 2762 |
| 413 | Ga0182006_1104194 | 3300015261 | Bacteria | 1003 |
| 414 | Ga0182006_1134970 | 3300015261 | Bacteria | 847 |
| 415 | Ga0182005_1000289 | 3300015265 | Bacteria | 31434 |
| 416 | Ga0182005_1041459 | 3300015265 | Bacteria | 1252 |
| 417 | Ga0182005_1042136 | 3300015265 | Bacteria | 1241 |
| 418 | Ga0183365_10004 | 3300015684 | Bacteria | 333304 |
| 419 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 420 | Ga0183360_11919 | 3300015689 | Bacteria | 757 |
| 421 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 422 | Ga0163161_10071262 | 3300017792 | Bacteria | 2543 |
| 423 | Ga0163161_10087295 | 3300017792 | Bacteria | 2304 |
| 424 | Ga0163161_10144012 | 3300017792 | Bacteria | 1806 |
| 425 | Ga0163161_10160712 | 3300017792 | Bacteria | 1713 |
| 426 | Ga0163161_10192938 | 3300017792 | Bacteria | 1567 |
| 427 | Ga0163161_10599252 | 3300017792 | Bacteria | 908 |
| 428 | Ga0163161_10603799 | 3300017792 | Bacteria | 905 |
| 429 | Ga0163161_10784277 | 3300017792 | Bacteria | 800 |
| 430 | Ga0206356_11616746 | 3300020070 | Bacteria | 3414 |
| 431 | Ga0206354_10931273 | 3300020081 | Bacteria | 1474 |
| 432 | Ga0213872_10001316 | 3300021361 | Bacteria | 16470 |
| 433 | Ga0213875_10023663 | 3300021388 | Bacteria | 2933 |
| 434 | Ga0228598_1000332 | 3300024227 | Bacteria | 9268 |
| 435 | Ga0209435_106429 | 3300025206 | Bacteria | 1308 |
| 436 | Ga0209760_100340 | 3300025207 | Bacteria | 13643 |
| 437 | Ga0209760_101173 | 3300025207 | Bacteria | 2947 |
| 438 | Ga0209436_100301 | 3300025208 | Bacteria | 22729 |
| 439 | Ga0209784_100049 | 3300025224 | Bacteria | 195512 |
| 440 | Ga0209784_100164 | 3300025224 | Bacteria | 57421 |
| 441 | Ga0209566_100061 | 3300025225 | Bacteria | 195512 |
| 442 | Ga0209566_102109 | 3300025225 | Bacteria | 4082 |
| 443 | Ga0209674_100069 | 3300025226 | Bacteria | 243948 |
| 444 | Ga0209672_102388 | 3300025228 | Bacteria | 4672 |
| 445 | Ga0209672_102751 | 3300025228 | Bacteria | 4055 |
| 446 | Ga0209672_103395 | 3300025228 | Bacteria | 3314 |
| 447 | Ga0209672_112054 | 3300025228 | Bacteria | 1089 |
| 448 | Ga0209563_100083 | 3300025230 | Bacteria | 195512 |
| 449 | Ga0207427_100084 | 3300025231 | Bacteria | 142663 |
| 450 | Ga0207427_101954 | 3300025231 | Bacteria | 6328 |
| 451 | Ga0207427_103135 | 3300025231 | Bacteria | 3710 |
| 452 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 453 | Ga0209437_100091 | 3300025233 | Bacteria | 243344 |
| 454 | Ga0209437_100924 | 3300025233 | Bacteria | 11174 |
| 455 | Ga0209258_100034 | 3300025242 | Bacteria | 437372 |
| 456 | Ga0209258_100071 | 3300025242 | Bacteria | 278319 |
| 457 | Ga0209258_100459 | 3300025242 | Bacteria | 44386 |
| 458 | Ga0209258_100792 | 3300025242 | Bacteria | 18794 |
| 459 | Ga0209258_101200 | 3300025242 | Bacteria | 10284 |
| 460 | Ga0209258_103464 | 3300025242 | Bacteria | 3390 |
| 461 | Ga0209646_1000895 | 3300025246 | Bacteria | 9727 |
| 462 | Ga0209646_1001788 | 3300025246 | Bacteria | 5375 |
| 463 | Ga0209026_1000187 | 3300025250 | Bacteria | 90872 |
| 464 | Ga0209026_1000223 | 3300025250 | Bacteria | 77328 |
| 465 | Ga0209677_100039 | 3300025253 | Bacteria | 243974 |
| 466 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 467 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 468 | Ga0209148_1004832 | 3300025254 | Bacteria | 3213 |
| 469 | Ga0209759_1001491 | 3300025256 | Bacteria | 12985 |
| 470 | Ga0209759_1001499 | 3300025256 | Bacteria | 12890 |
| 471 | Ga0209759_1001939 | 3300025256 | Bacteria | 10058 |
| 472 | Ga0209759_1003025 | 3300025256 | Bacteria | 6937 |
| 473 | Ga0209759_1003373 | 3300025256 | Bacteria | 6411 |
| 474 | Ga0209129_1002340 | 3300025258 | Bacteria | 9382 |
| 475 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 476 | Ga0209233_1000115 | 3300025261 | Bacteria | 243344 |
| 477 | Ga0209233_1020535 | 3300025261 | Bacteria | 1730 |
| 478 | Ga0209233_1023887 | 3300025261 | Bacteria | 1538 |
| 479 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 480 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 481 | Ga0209455_1000054 | 3300025272 | Bacteria | 358936 |
| 482 | Ga0209455_1000427 | 3300025272 | Bacteria | 32971 |
| 483 | Ga0209455_1000628 | 3300025272 | Bacteria | 21902 |
| 484 | Ga0209455_1003037 | 3300025272 | Bacteria | 6141 |
| 485 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 486 | Ga0209673_1007680 | 3300025273 | Bacteria | 4916 |
| 487 | Ga0209130_1000044 | 3300025284 | Bacteria | 241110 |
| 488 | Ga0209130_1000188 | 3300025284 | Bacteria | 86963 |
| 489 | Ga0209130_1002498 | 3300025284 | Bacteria | 9091 |
| 490 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 491 | Ga0209675_1000078 | 3300025291 | Bacteria | 156111 |
| 492 | Ga0209675_1007119 | 3300025291 | Bacteria | 4349 |
| 493 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 494 | Ga0209676_1000345 | 3300025292 | Bacteria | 88051 |
| 495 | Ga0209676_1000440 | 3300025292 | Bacteria | 71013 |
| 496 | Ga0209676_1004038 | 3300025292 | Bacteria | 8449 |
| 497 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 498 | Ga0209025_1038002 | 3300025294 | Bacteria | 2125 |
| 499 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 500 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 501 | Ga0209564_1000202 | 3300025295 | Bacteria | 136555 |
| 502 | Ga0209758_1001007 | 3300025297 | Bacteria | 37395 |
| 503 | Ga0209758_1048733 | 3300025297 | Bacteria | 1502 |
| 504 | Ga0209758_1066634 | 3300025297 | Bacteria | 1156 |
| 505 | Ga0209050_1001731 | 3300025298 | Bacteria | 21722 |
| 506 | Ga0209050_1002704 | 3300025298 | Bacteria | 14408 |
| 507 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 508 | Ga0209256_1001832 | 3300025299 | Bacteria | 19843 |
| 509 | Ga0209256_1008649 | 3300025299 | Bacteria | 4663 |
| 510 | Ga0209256_1010324 | 3300025299 | Bacteria | 3931 |
| 511 | Ga0207426_1049454 | 3300025302 | Bacteria | 1258 |
| 512 | Ga0209051_1000979 | 3300025303 | Bacteria | 27790 |
| 513 | Ga0209051_1005522 | 3300025303 | Bacteria | 7372 |
| 514 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 515 | Ga0209257_1000121 | 3300025304 | Bacteria | 222588 |
| 516 | Ga0209257_1000356 | 3300025304 | Bacteria | 93656 |
| 517 | Ga0209257_1000452 | 3300025304 | Bacteria | 77144 |
| 518 | Ga0209257_1001064 | 3300025304 | Bacteria | 36288 |
| 519 | Ga0209257_1028082 | 3300025304 | Bacteria | 1858 |
| 520 | Ga0209257_1068871 | 3300025304 | Bacteria | 939 |
| 521 | Ga0207697_10017549 | 3300025315 | Bacteria | 2941 |
| 522 | Ga0207697_10038369 | 3300025315 | Bacteria | 1964 |
| 523 | Ga0207656_10079257 | 3300025321 | Bacteria | 1473 |
| 524 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 525 | Ga0207696_1001780 | 3300025711 | Bacteria | 11122 |
| 526 | Ga0207655_1000603 | 3300025728 | Bacteria | 43527 |
| 527 | Ga0207655_1000772 | 3300025728 | Bacteria | 35772 |
| 528 | Ga0207655_1003483 | 3300025728 | Bacteria | 11691 |
| 529 | Ga0207655_1004427 | 3300025728 | Bacteria | 9962 |
| 530 | Ga0207655_1012890 | 3300025728 | Bacteria | 4840 |
| 531 | Ga0207655_1014595 | 3300025728 | Bacteria | 4429 |
| 532 | Ga0207655_1029630 | 3300025728 | Bacteria | 2559 |
| 533 | Ga0207713_1001400 | 3300025735 | Bacteria | 19498 |
| 534 | Ga0207713_1003713 | 3300025735 | Bacteria | 10262 |
| 535 | Ga0207713_1017174 | 3300025735 | Bacteria | 3641 |
| 536 | Ga0207682_10001014 | 3300025893 | Bacteria | 13035 |
| 537 | Ga0207682_10182826 | 3300025893 | Bacteria | 958 |
| 538 | Ga0207710_10017120 | 3300025900 | Bacteria | 3072 |
| 539 | Ga0207680_10033556 | 3300025903 | Bacteria | 2929 |
| 540 | Ga0207680_10036168 | 3300025903 | Bacteria | 2842 |
| 541 | Ga0207680_10438600 | 3300025903 | Bacteria | 926 |
| 542 | Ga0207647_10002310 | 3300025904 | Bacteria | 14530 |
| 543 | Ga0207647_10003842 | 3300025904 | Bacteria | 11237 |
| 544 | Ga0207647_10005179 | 3300025904 | Bacteria | 9593 |
| 545 | Ga0207645_10000428 | 3300025907 | Bacteria | 34870 |
| 546 | Ga0207645_10018585 | 3300025907 | Bacteria | 4569 |
| 547 | Ga0207645_10025328 | 3300025907 | Bacteria | 3839 |
| 548 | Ga0207643_10028023 | 3300025908 | Bacteria | 3125 |
| 549 | Ga0207643_10057340 | 3300025908 | Bacteria | 2217 |
| 550 | Ga0207705_10171889 | 3300025909 | Bacteria | 1632 |
| 551 | Ga0207705_10205601 | 3300025909 | Bacteria | 1492 |
| 552 | Ga0207705_10220760 | 3300025909 | Bacteria | 1440 |
| 553 | Ga0207705_10234864 | 3300025909 | Bacteria | 1395 |
| 554 | Ga0207707_10052033 | 3300025912 | Bacteria | 3566 |
| 555 | Ga0207707_10303155 | 3300025912 | Bacteria | 1381 |
| 556 | Ga0207695_10001702 | 3300025913 | Bacteria | 35225 |
| 557 | Ga0207695_10003515 | 3300025913 | Bacteria | 21943 |
| 558 | Ga0207695_10007231 | 3300025913 | Bacteria | 14184 |
| 559 | Ga0207695_10012415 | 3300025913 | Bacteria | 10229 |
| 560 | Ga0207695_10021072 | 3300025913 | Bacteria | 7444 |
| 561 | Ga0207695_10242701 | 3300025913 | Bacteria | 1702 |
| 562 | Ga0207695_10313859 | 3300025913 | Bacteria | 1458 |
| 563 | Ga0207671_10000059 | 3300025914 | Bacteria | 179761 |
| 564 | Ga0207671_10000135 | 3300025914 | Bacteria | 112401 |
| 565 | Ga0207671_10000713 | 3300025914 | Bacteria | 42635 |
| 566 | Ga0207671_10004409 | 3300025914 | Bacteria | 13488 |
| 567 | Ga0207671_10223289 | 3300025914 | Bacteria | 1476 |
| 568 | Ga0207671_10269649 | 3300025914 | Bacteria | 1341 |
| 569 | Ga0207660_10154998 | 3300025917 | Bacteria | 1763 |
| 570 | Ga0207657_10009078 | 3300025919 | Bacteria | 10037 |
| 571 | Ga0207657_10067795 | 3300025919 | Bacteria | 3033 |
| 572 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 573 | Ga0207649_10019952 | 3300025920 | Bacteria | 3838 |
| 574 | Ga0207649_10123389 | 3300025920 | Bacteria | 1749 |
| 575 | Ga0207649_10159895 | 3300025920 | Bacteria | 1560 |
| 576 | Ga0207649_10213836 | 3300025920 | Bacteria | 1369 |
| 577 | Ga0207649_10272468 | 3300025920 | Bacteria | 1227 |
| 578 | Ga0207652_10530962 | 3300025921 | Bacteria | 1058 |
| 579 | Ga0207681_10073391 | 3300025923 | Bacteria | 2393 |
| 580 | Ga0207694_10042761 | 3300025924 | Bacteria | 3496 |
| 581 | Ga0207650_10034174 | 3300025925 | Bacteria | 3686 |
| 582 | Ga0207650_10124175 | 3300025925 | Bacteria | 2013 |
| 583 | Ga0207650_10263864 | 3300025925 | Bacteria | 1398 |
| 584 | Ga0207659_10131071 | 3300025926 | Bacteria | 1935 |
| 585 | Ga0207687_10043694 | 3300025927 | Bacteria | 3089 |
| 586 | Ga0207687_10186128 | 3300025927 | Bacteria | 1612 |
| 587 | Ga0207700_10260945 | 3300025928 | Bacteria | 1483 |
| 588 | Ga0207664_10044849 | 3300025929 | Bacteria | 3464 |
| 589 | Ga0207664_10563071 | 3300025929 | Bacteria | 1023 |
| 590 | Ga0207644_10070897 | 3300025931 | Bacteria | 2548 |
| 591 | Ga0207644_10087503 | 3300025931 | Bacteria | 2315 |
| 592 | Ga0207644_10323607 | 3300025931 | Bacteria | 1247 |
| 593 | Ga0207690_10014282 | 3300025932 | Bacteria | 4795 |
| 594 | Ga0207690_10096449 | 3300025932 | Bacteria | 2103 |
| 595 | Ga0207706_10057627 | 3300025933 | Bacteria | 3422 |
| 596 | Ga0207706_10094002 | 3300025933 | Bacteria | 2637 |
| 597 | Ga0207706_10133108 | 3300025933 | Bacteria | 2187 |
| 598 | Ga0207706_10138154 | 3300025933 | Bacteria | 2144 |
| 599 | Ga0207706_10588517 | 3300025933 | Bacteria | 956 |
| 600 | Ga0207686_10001532 | 3300025934 | Bacteria | 13024 |
| 601 | Ga0207686_10607395 | 3300025934 | Bacteria | 861 |
| 602 | Ga0207709_10065230 | 3300025935 | Bacteria | 2289 |
| 603 | Ga0207670_10565835 | 3300025936 | Bacteria | 930 |
| 604 | Ga0207669_10544061 | 3300025937 | Bacteria | 936 |
| 605 | Ga0207704_10010676 | 3300025938 | Bacteria | 4489 |
| 606 | Ga0207704_10115126 | 3300025938 | Bacteria | 1827 |
| 607 | Ga0207691_10000127 | 3300025940 | Bacteria | 69355 |
| 608 | Ga0207691_10004858 | 3300025940 | Bacteria | 12997 |
| 609 | Ga0207691_10071976 | 3300025940 | Bacteria | 3118 |
| 610 | Ga0207691_10133688 | 3300025940 | Bacteria | 2189 |
| 611 | Ga0207691_10172497 | 3300025940 | Bacteria | 1893 |
| 612 | Ga0207691_10234026 | 3300025940 | Bacteria | 1590 |
| 613 | Ga0207689_10262507 | 3300025942 | Bacteria | 1429 |
| 614 | Ga0207661_10003004 | 3300025944 | Bacteria | 11670 |
| 615 | Ga0207661_10041845 | 3300025944 | Bacteria | 3609 |
| 616 | Ga0207661_10091582 | 3300025944 | Bacteria | 2533 |
| 617 | Ga0207661_10102213 | 3300025944 | Bacteria | 2409 |
| 618 | Ga0207661_10227205 | 3300025944 | Bacteria | 1651 |
| 619 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 620 | Ga0207679_10007435 | 3300025945 | Bacteria | 6949 |
| 621 | Ga0207679_10055251 | 3300025945 | Bacteria | 2926 |
| 622 | Ga0207679_10153761 | 3300025945 | Bacteria | 1876 |
| 623 | Ga0207679_10246545 | 3300025945 | Bacteria | 1516 |
| 624 | Ga0207679_11229545 | 3300025945 | Unclassified | 687 |
| 625 | Ga0207667_10000292 | 3300025949 | Bacteria | 69279 |
| 626 | Ga0207667_10000486 | 3300025949 | Bacteria | 52631 |
| 627 | Ga0207667_10009358 | 3300025949 | Bacteria | 11553 |
| 628 | Ga0207667_10055825 | 3300025949 | Bacteria | 4150 |
| 629 | Ga0207667_10121940 | 3300025949 | Bacteria | 2686 |
| 630 | Ga0207667_10471054 | 3300025949 | Bacteria | 1275 |
| 631 | Ga0207651_10341407 | 3300025960 | Bacteria | 1258 |
| 632 | Ga0207651_10452334 | 3300025960 | Bacteria | 1102 |
| 633 | Ga0207668_10021890 | 3300025972 | Bacteria | 4082 |
| 634 | Ga0207668_10122115 | 3300025972 | Bacteria | 1974 |
| 635 | Ga0207668_10124149 | 3300025972 | Bacteria | 1960 |
| 636 | Ga0207668_10223889 | 3300025972 | Bacteria | 1512 |
| 637 | Ga0207668_10356560 | 3300025972 | Bacteria | 1224 |
| 638 | Ga0207668_10469968 | 3300025972 | Bacteria | 1077 |
| 639 | Ga0207668_10620511 | 3300025972 | Bacteria | 943 |
| 640 | Ga0207640_10000471 | 3300025981 | Bacteria | 24571 |
| 641 | Ga0207640_10000670 | 3300025981 | Bacteria | 19993 |
| 642 | Ga0207640_10018115 | 3300025981 | Bacteria | 4132 |
| 643 | Ga0207640_10021026 | 3300025981 | Bacteria | 3882 |
| 644 | Ga0207640_10053029 | 3300025981 | Bacteria | 2645 |
| 645 | Ga0207640_10182581 | 3300025981 | Bacteria | 1574 |
| 646 | Ga0207658_10044979 | 3300025986 | Bacteria | 3216 |
| 647 | Ga0207658_10059775 | 3300025986 | Bacteria | 2841 |
| 648 | Ga0207658_10065595 | 3300025986 | Bacteria | 2727 |
| 649 | Ga0207658_10117646 | 3300025986 | Bacteria | 2113 |
| 650 | Ga0207677_10026161 | 3300026023 | Bacteria | 3654 |
| 651 | Ga0207677_10088036 | 3300026023 | Bacteria | 2250 |
| 652 | Ga0207677_10892240 | 3300026023 | Bacteria | 801 |
| 653 | Ga0207703_10132703 | 3300026035 | Bacteria | 2153 |
| 654 | Ga0207703_10536907 | 3300026035 | Bacteria | 1102 |
| 655 | Ga0207703_10553092 | 3300026035 | Bacteria | 1085 |
| 656 | Ga0207703_10931067 | 3300026035 | Bacteria | 832 |
| 657 | Ga0207639_10193654 | 3300026041 | Bacteria | 1738 |
| 658 | Ga0207678_10000969 | 3300026067 | Bacteria | 26231 |
| 659 | Ga0207678_10032281 | 3300026067 | Bacteria | 4563 |
| 660 | Ga0207678_10143379 | 3300026067 | Bacteria | 2039 |
| 661 | Ga0207678_10145112 | 3300026067 | Bacteria | 2026 |
| 662 | Ga0207678_10724564 | 3300026067 | Bacteria | 876 |
| 663 | Ga0207708_10235273 | 3300026075 | Bacteria | 1472 |
| 664 | Ga0207702_11166583 | 3300026078 | Bacteria | 764 |
| 665 | Ga0207641_10049260 | 3300026088 | Bacteria | 3559 |
| 666 | Ga0207641_10173981 | 3300026088 | Bacteria | 1967 |
| 667 | Ga0207641_10265698 | 3300026088 | Bacteria | 1608 |
| 668 | Ga0207641_10323837 | 3300026088 | Bacteria | 1462 |
| 669 | Ga0207641_10331629 | 3300026088 | Bacteria | 1445 |
| 670 | Ga0207641_10346093 | 3300026088 | Bacteria | 1416 |
| 671 | Ga0207641_10365360 | 3300026088 | Bacteria | 1379 |
| 672 | Ga0207641_10877082 | 3300026088 | Unclassified | 890 |
| 673 | Ga0207641_11113180 | 3300026088 | Bacteria | 788 |
| 674 | Ga0207648_10004283 | 3300026089 | Bacteria | 14715 |
| 675 | Ga0207648_10011720 | 3300026089 | Bacteria | 8244 |
| 676 | Ga0207648_10023017 | 3300026089 | Bacteria | 5587 |
| 677 | Ga0207648_10265180 | 3300026089 | Bacteria | 1533 |
| 678 | Ga0207676_10032072 | 3300026095 | Bacteria | 3956 |
| 679 | Ga0207676_10048307 | 3300026095 | Bacteria | 3303 |
| 680 | Ga0207676_10170681 | 3300026095 | Bacteria | 1895 |
| 681 | Ga0207674_10000298 | 3300026116 | Bacteria | 62902 |
| 682 | Ga0207674_10010196 | 3300026116 | Bacteria | 10673 |
| 683 | Ga0207674_10011014 | 3300026116 | Bacteria | 10169 |
| 684 | Ga0207674_10155541 | 3300026116 | Bacteria | 2242 |
| 685 | Ga0207675_100012815 | 3300026118 | Bacteria | 7834 |
| 686 | Ga0207675_100029062 | 3300026118 | Bacteria | 5151 |
| 687 | Ga0207675_100075242 | 3300026118 | Bacteria | 3161 |
| 688 | Ga0207675_100162337 | 3300026118 | Bacteria | 2132 |
| 689 | Ga0207675_100862005 | 3300026118 | Bacteria | 921 |
| 690 | Ga0207683_10000009 | 3300026121 | Bacteria | 150281 |
| 691 | Ga0207698_10008277 | 3300026142 | Bacteria | 6567 |
| 692 | Ga0207698_10019529 | 3300026142 | Bacteria | 4642 |
| 693 | Ga0207698_10046054 | 3300026142 | Bacteria | 3290 |
| 694 | Ga0207698_10140636 | 3300026142 | Bacteria | 2079 |
| 695 | Ga0207698_10215874 | 3300026142 | Bacteria | 1730 |
| 696 | Ga0207698_10388092 | 3300026142 | Bacteria | 1331 |
| 697 | Ga0207698_10711551 | 3300026142 | Bacteria | 1000 |
| 698 | Ga0209281_1013031 | 3300027111 | Bacteria | 1806 |
| 699 | Ga0209371_1000023 | 3300027312 | Bacteria | 519553 |
| 700 | Ga0207428_10015977 | 3300027907 | Bacteria | 6471 |
| 701 | Ga0207428_10203634 | 3300027907 | Bacteria | 1489 |
| 702 | Ga0268266_10005005 | 3300028379 | Bacteria | 12518 |
| 703 | Ga0268266_10060827 | 3300028379 | Bacteria | 3256 |
| 704 | Ga0268266_10172820 | 3300028379 | Bacteria | 1962 |
| 705 | Ga0268266_10297171 | 3300028379 | Bacteria | 1505 |
| 706 | Ga0268266_10922761 | 3300028379 | Bacteria | 845 |
| 707 | Ga0268266_11010465 | 3300028379 | Bacteria | 805 |
| 708 | Ga0268265_10289752 | 3300028380 | Bacteria | 1469 |
| 709 | Ga0268264_10058224 | 3300028381 | Bacteria | 3235 |
| 710 | Ga0268264_10070210 | 3300028381 | Bacteria | 2965 |
| 711 | Ga0268264_10081212 | 3300028381 | Bacteria | 2770 |
| 712 | Ga0268264_10643278 | 3300028381 | Bacteria | 1049 |
| 713 | Ga0268264_10678496 | 3300028381 | Bacteria | 1022 |
| 714 | Ga0307517_10005849 | 3300028786 | Bacteria | 18395 |
| 715 | Ga0307517_10010226 | 3300028786 | Bacteria | 13164 |
| 716 | Ga0307517_10104066 | 3300028786 | Bacteria | 2213 |
| 717 | Ga0307517_10217316 | 3300028786 | Bacteria | 1167 |
| 718 | Ga0307515_10013824 | 3300028794 | Bacteria | 15040 |
| 719 | Ga0307515_10133079 | 3300028794 | Bacteria | 2723 |
| 720 | Ga0265338_10000118 | 3300028800 | Bacteria | 146710 |
| 721 | Ga0268256_1000023 | 3300030500 | Bacteria | 519631 |
| 722 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 723 | Ga0316177_1104169 | 3300030731 | Bacteria | 1494 |
| 724 | Ga0316181_1003769 | 3300030744 | Bacteria | 2103 |
| 725 | Ga0265332_10020812 | 3300031238 | Bacteria | 2897 |
| 726 | Ga0265340_10063801 | 3300031247 | Bacteria | 1757 |
| 727 | Ga0265316_10205203 | 3300031344 | Bacteria | 1460 |
| 728 | Ga0307513_10020408 | 3300031456 | Bacteria | 7861 |
| 729 | Ga0307513_10052805 | 3300031456 | Bacteria | 4374 |
| 730 | Ga0307513_10086379 | 3300031456 | Bacteria | 3216 |
| 731 | Ga0307513_10117764 | 3300031456 | Bacteria | 2633 |
| 732 | Ga0307513_10138965 | 3300031456 | Bacteria | 2359 |
| 733 | Ga0307513_10350485 | 3300031456 | Unclassified | 1224 |
| 734 | Ga0307509_10000052 | 3300031507 | Bacteria | 164947 |
| 735 | Ga0307509_10003622 | 3300031507 | Bacteria | 23190 |
| 736 | Ga0307509_10023567 | 3300031507 | Bacteria | 6906 |
| 737 | Ga0307509_10034645 | 3300031507 | Bacteria | 5545 |
| 738 | Ga0307509_10067060 | 3300031507 | Bacteria | 3761 |
| 739 | Ga0307509_10147362 | 3300031507 | Bacteria | 2276 |
| 740 | Ga0307408_100000194 | 3300031548 | Bacteria | 65753 |
| 741 | Ga0307408_100020906 | 3300031548 | Bacteria | 4423 |
| 742 | Ga0307408_100100941 | 3300031548 | Bacteria | 2198 |
| 743 | Ga0307408_100190230 | 3300031548 | Bacteria | 1653 |
| 744 | Ga0307508_10002365 | 3300031616 | Bacteria | 19947 |
| 745 | Ga0307508_10442277 | 3300031616 | Bacteria | 892 |
| 746 | Ga0307508_10481723 | 3300031616 | Bacteria | 834 |
| 747 | Ga0307514_10012360 | 3300031649 | Bacteria | 7101 |
| 748 | Ga0307516_10007666 | 3300031730 | Bacteria | 12353 |
| 749 | Ga0307516_10063274 | 3300031730 | Bacteria | 3582 |
| 750 | Ga0307516_10134536 | 3300031730 | Bacteria | 2248 |
| 751 | Ga0307516_10167955 | 3300031730 | Bacteria | 1937 |
| 752 | Ga0307516_10251391 | 3300031730 | Bacteria | 1462 |
| 753 | Ga0307516_10653191 | 3300031730 | Bacteria | 707 |
| 754 | Ga0307405_10164241 | 3300031731 | Bacteria | 1576 |
| 755 | Ga0307405_10301078 | 3300031731 | Bacteria | 1216 |
| 756 | Ga0307413_10025015 | 3300031824 | Bacteria | 3265 |
| 757 | Ga0307413_10226532 | 3300031824 | Bacteria | 1369 |
| 758 | Ga0307410_10080021 | 3300031852 | Bacteria | 2291 |
| 759 | Ga0307410_10306209 | 3300031852 | Bacteria | 1255 |
| 760 | Ga0307406_10130772 | 3300031901 | Bacteria | 1762 |
| 761 | Ga0307406_10539633 | 3300031901 | Bacteria | 952 |
| 762 | Ga0307407_10005761 | 3300031903 | Bacteria | 5417 |
| 763 | Ga0307407_10133122 | 3300031903 | Bacteria | 1594 |
| 764 | Ga0307412_10047860 | 3300031911 | Bacteria | 2809 |
| 765 | Ga0307409_100037068 | 3300031995 | Bacteria | 3591 |
| 766 | Ga0307409_100075501 | 3300031995 | Bacteria | 2699 |
| 767 | Ga0307409_100207555 | 3300031995 | Bacteria | 1758 |
| 768 | Ga0307409_100536681 | 3300031995 | Bacteria | 1146 |
| 769 | Ga0307416_100019933 | 3300032002 | Bacteria | 4769 |
| 770 | Ga0307416_100068548 | 3300032002 | Bacteria | 2932 |
| 771 | Ga0307416_100307980 | 3300032002 | Bacteria | 1578 |
| 772 | Ga0307414_10112044 | 3300032004 | Bacteria | 2079 |
| 773 | Ga0307414_10236516 | 3300032004 | Bacteria | 1509 |
| 774 | Ga0307414_10510780 | 3300032004 | Bacteria | 1065 |
| 775 | Ga0307507_10092396 | 3300033179 | Bacteria | 2583 |
| 776 | Ga0307507_10117726 | 3300033179 | Bacteria | 2140 |
| 777 | Ga0307510_10000118 | 3300033180 | Bacteria | 63011 |
| 778 | Ga0307510_10014576 | 3300033180 | Bacteria | 9303 |
| 779 | Ga0307510_10088730 | 3300033180 | Bacteria | 2950 |
| 780 | Ga0307510_10120543 | 3300033180 | Bacteria | 2329 |
| 781 | Ga0307510_10145502 | 3300033180 | Bacteria | 2003 |
| 782 | Ga0307510_10184103 | 3300033180 | Bacteria | 1646 |
| 783 | Ga0373940_0087971 | 3300035088 | Bacteria | 927 |
| 784 | Ga0373951_0081722 | 3300035091 | Bacteria | 837 |
| 785 | Ga0373932_0054478 | 3300035112 | Bacteria | 1197 |
| 786 | Ga0373931_0072019 | 3300035691 | Bacteria | 1889 |
| 787 | Ga0373931_0239671 | 3300035691 | Bacteria | 1099 |
| 788 | Ga0373947_0163753 | 3300035725 | Bacteria | 1439 |
| 789 | Ga0373947_0420280 | 3300035725 | Bacteria | 903 |
| 790 | Ga0373947_0721919 | 3300035725 | Bacteria | 680 |
| 791 | Ga0373937_0025086 | 3300036401 | Bacteria | 5382 |
| 792 | Ga0373937_0341074 | 3300036401 | Bacteria | 1419 |
| 793 | Ga0373925_0212396 | 3300037068 | Bacteria | 1542 |
| 794 | Ga0373925_0254489 | 3300037068 | Bacteria | 1409 |
| 795 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 796 | Ga0395899_0005005 | 3300037312 | Bacteria | 10313 |
| 797 | Ga0395899_0010317 | 3300037312 | Bacteria | 7162 |
| 798 | Ga0395899_0012450 | 3300037312 | Bacteria | 6517 |
| 799 | Ga0395899_0195356 | 3300037312 | Bacteria | 1414 |
| 800 | Ga0395900_0002549 | 3300037418 | Bacteria | 19963 |
| 801 | Ga0395900_0006267 | 3300037418 | Bacteria | 12412 |
| 802 | Ga0395900_0092457 | 3300037418 | Bacteria | 3108 |
| 803 | Ga0395900_0124178 | 3300037418 | Bacteria | 2647 |
| 804 | Ga0395898_0005884 | 3300037466 | Bacteria | 13184 |
| 805 | Ga0395898_0110701 | 3300037466 | Bacteria | 2632 |
| 806 | Ga0395898_0508189 | 3300037466 | Bacteria | 1146 |
| 807 | Ga0395898_0626058 | 3300037466 | Bacteria | 1018 |
| 808 | Ga0395905_0000136 | 3300037471 | Bacteria | 121009 |
| 809 | Ga0395905_0001886 | 3300037471 | Bacteria | 24164 |
| 810 | Ga0395905_0055632 | 3300037471 | Bacteria | 3703 |
| 811 | Ga0395905_0147935 | 3300037471 | Bacteria | 2210 |
| 812 | Ga0436364_0034966 | 3300037853 | Bacteria | 762 |
| 813 | Ga0436364_0389486 | 3300037853 | Bacteria | 795 |
| 814 | Ga0436364_0471363 | 3300037853 | Bacteria | 869 |
| 815 | Ga0436364_1529296 | 3300037853 | Bacteria | 12470 |
| 816 | Ga0395901_0001400 | 3300038443 | Bacteria | 25196 |
| 817 | Ga0395901_0003633 | 3300038443 | Bacteria | 15561 |
| 818 | Ga0395901_0003670 | 3300038443 | Bacteria | 15482 |
| 819 | Ga0395901_0630531 | 3300038443 | Bacteria | 1078 |
| 820 | Ga0237819_00624 | 3300038705 | Bacteria | 11567 |
| 821 | Ga0237819_07641 | 3300038705 | Bacteria | 1540 |
| 822 | Ga0400483_000346 | 3300039062 | Bacteria | 4820 |
| 823 | Ga0400483_020937 | 3300039062 | Bacteria | 11125 |
| 824 | Ga0400483_095196 | 3300039062 | Bacteria | 15889 |
| 825 | Ga0400483_163079 | 3300039062 | Bacteria | 1305 |
| 826 | Ga0400483_171786 | 3300039062 | Bacteria | 5041 |
| 827 | Ga0400483_248084 | 3300039062 | Bacteria | 9234 |
| 828 | Ga0400483_248289 | 3300039062 | Bacteria | 9961 |
| 829 | Ga0436361_0821396 | 3300039447 | Bacteria | 16496 |
| 830 | Ga0436362_0202120 | 3300039453 | Bacteria | 1813 |
| 831 | Ga0439438_004655 | 3300041405 | Bacteria | 5215 |
| 832 | Ga0439447_002799 | 3300041407 | Bacteria | 6291 |
| 833 | Ga0439466_0004451 | 3300041411 | Bacteria | 5392 |
| 834 | Ga0439431_0010973 | 3300041997 | Bacteria | 2064 |
| 835 | Ga0439448_0023985 | 3300042005 | Bacteria | 1906 |
| 836 | Ga0439432_016961 | 3300042006 | Bacteria | 2447 |
| 837 | Ga0439449_0065883 | 3300042007 | Bacteria | 1336 |
| 838 | Ga0439451_000445 | 3300042009 | Bacteria | 8055 |
| 839 | Ga0439451_004420 | 3300042009 | Bacteria | 2855 |
| 840 | Ga0439452_000485 | 3300042010 | Bacteria | 22057 |
| 841 | Ga0439452_019785 | 3300042010 | Bacteria | 1774 |
| 842 | Ga0439462_0032484 | 3300042015 | Bacteria | 1383 |
| 843 | Ga0439463_002054 | 3300042016 | Bacteria | 5222 |
| 844 | Ga0439463_025189 | 3300042016 | Bacteria | 1492 |
| 845 | Ga0439463_057533 | 3300042016 | Bacteria | 993 |
| 846 | Ga0450911_001553 | 3300042115 | Bacteria | 5205 |
| 847 | Ga0450911_003577 | 3300042115 | Bacteria | 2707 |
| 848 | Ga0450913_008653 | 3300042117 | Bacteria | 787 |
| 849 | Ga0450890_000729 | 3300042127 | Bacteria | 4769 |
| 850 | Ga0450891_003745 | 3300042129 | Bacteria | 1451 |
| 851 | Ga0450903_014414 | 3300042138 | Bacteria | 1250 |
| 852 | Ga0450907_009459 | 3300042146 | Bacteria | 1616 |
| 853 | Ga0439446_0087263 | 3300042156 | Bacteria | 973 |
| 854 | Ga0439446_0169028 | 3300042156 | Bacteria | 726 |
| 855 | Ga0439435_0112338 | 3300042436 | Unclassified | 847 |
| 856 | Ga0439464_0004285 | 3300042439 | Bacteria | 3644 |
| 857 | Ga0439460_0004154 | 3300042461 | Bacteria | 3524 |
| 858 | Ga0451577_0000561 | 3300042876 | Bacteria | 60402 |
| 859 | Ga0466969_0002544 | 3300044656 | Bacteria | 9741 |
| 860 | Ga0466969_0017277 | 3300044656 | Bacteria | 3770 |
| 861 | Ga0466969_0034736 | 3300044656 | Bacteria | 2553 |
| 862 | Ga0466972_0062241 | 3300044658 | Bacteria | 1788 |
| 863 | Ga0466972_0137285 | 3300044658 | Bacteria | 1151 |
| 864 | Ga0466982_0000044 | 3300044672 | Bacteria | 38923 |
| 865 | Ga0466965_0016690 | 3300044683 | Bacteria | 3498 |
| 866 | Ga0466966_0000701 | 3300044684 | Bacteria | 21320 |
| 867 | Ga0466966_0002676 | 3300044684 | Bacteria | 11672 |
| 868 | Ga0466961_0002712 | 3300044693 | Bacteria | 11005 |
| 869 | Ga0466961_0003965 | 3300044693 | Bacteria | 9260 |
| 870 | Ga0466961_0070693 | 3300044693 | Bacteria | 2215 |
| 871 | Ga0466963_0240141 | 3300044694 | Bacteria | 1270 |
| 872 | Ga0466964_0022707 | 3300044706 | Bacteria | 2436 |
| 873 | Ga0466964_0052165 | 3300044706 | Bacteria | 1681 |
| 874 | Ga0453684_0532631 | 3300044712 | Bacteria | 1296 |
| 875 | Ga0466971_0004296 | 3300044719 | Bacteria | 6142 |
| 876 | Ga0466971_0090701 | 3300044719 | Bacteria | 1399 |
| 877 | Ga0466971_0210867 | 3300044719 | Bacteria | 919 |
| 878 | Ga0466968_0008215 | 3300044735 | Bacteria | 3992 |
| 879 | Ga0466968_0068779 | 3300044735 | Bacteria | 1538 |
| 880 | Ga0466970_0003084 | 3300044765 | Bacteria | 8089 |
| 881 | Ga0466970_0013349 | 3300044765 | Bacteria | 4211 |
| 882 | Ga0466970_0179059 | 3300044765 | Bacteria | 1176 |
| 883 | Ga0466970_0381209 | 3300044765 | Unclassified | 803 |
| 884 | Ga0466957_0004013 | 3300044842 | Bacteria | 8140 |
| 885 | Ga0466960_0030336 | 3300044901 | Bacteria | 2487 |
| 886 | Ga0466959_0000100 | 3300045049 | Bacteria | 54979 |
| 887 | Ga0466959_0020575 | 3300045049 | Bacteria | 4862 |
| 888 | Ga0466959_0139992 | 3300045049 | Bacteria | 1711 |
| 889 | Ga0466959_0167906 | 3300045049 | Bacteria | 1540 |
| 890 | Ga0466959_0288700 | 3300045049 | Bacteria | 1125 |
| 891 | Ga0466959_0436775 | 3300045049 | Bacteria | 888 |
| 892 | Ga0451576_0097798 | 3300045051 | Bacteria | 3052 |
| 893 | Ga0451576_0132455 | 3300045051 | Bacteria | 2599 |
| 894 | Ga0451576_0220133 | 3300045051 | Bacteria | 1982 |
| 895 | Ga0466958_0006453 | 3300045836 | Bacteria | 6384 |
| 896 | Ga0466958_0287134 | 3300045836 | Bacteria | 1055 |
| 897 | Ga0466967_0111240 | 3300045976 | Bacteria | 2517 |
| 898 | Ga0466967_0205699 | 3300045976 | Bacteria | 1866 |
| 899 | Ga0466967_0356071 | 3300045976 | Bacteria | 1417 |
| 900 | Ga0495617_086552 | 3300046452 | Bacteria | 1024 |
| 901 | Ga0495617_093614 | 3300046452 | Bacteria | 979 |
| 902 | Ga0495627_002371 | 3300046453 | Bacteria | 9195 |
| 903 | Ga0495627_003650 | 3300046453 | Bacteria | 6678 |
| 904 | Ga0495627_004572 | 3300046453 | Bacteria | 5752 |
| 905 | Ga0495592_0000142 | 3300046454 | Bacteria | 63571 |
| 906 | Ga0495592_0140582 | 3300046454 | Bacteria | 1680 |
| 907 | Ga0495592_0435252 | 3300046454 | Bacteria | 824 |
| 908 | Ga0495603_0090152 | 3300046455 | Bacteria | 1793 |
| 909 | Ga0495590_0053594 | 3300046457 | Bacteria | 1408 |
| 910 | Ga0495590_0075190 | 3300046457 | Bacteria | 1188 |
| 911 | Ga0495591_000037 | 3300046458 | Bacteria | 158323 |
| 912 | Ga0495591_000960 | 3300046458 | Bacteria | 19699 |
| 913 | Ga0495591_001346 | 3300046458 | Bacteria | 15427 |
| 914 | Ga0495591_001506 | 3300046458 | Bacteria | 14373 |
| 915 | Ga0495591_001756 | 3300046458 | Bacteria | 12889 |
| 916 | Ga0495591_002170 | 3300046458 | Bacteria | 11235 |
| 917 | Ga0495591_002395 | 3300046458 | Bacteria | 10486 |
| 918 | Ga0495591_007687 | 3300046458 | Bacteria | 4537 |
| 919 | Ga0495591_047522 | 3300046458 | Bacteria | 1187 |
| 920 | Ga0495629_0309896 | 3300046459 | Bacteria | 1080 |
| 921 | Ga0495638_0000048 | 3300046460 | Bacteria | 209787 |
| 922 | Ga0495638_0000116 | 3300046460 | Bacteria | 128087 |
| 923 | Ga0495638_0000609 | 3300046460 | Bacteria | 40051 |
| 924 | Ga0495638_0004826 | 3300046460 | Bacteria | 10156 |
| 925 | Ga0495638_0005132 | 3300046460 | Bacteria | 9801 |
| 926 | Ga0495638_0005434 | 3300046460 | Bacteria | 9478 |
| 927 | Ga0495638_0006182 | 3300046460 | Bacteria | 8746 |
| 928 | Ga0495638_0006896 | 3300046460 | Bacteria | 8198 |
| 929 | Ga0495638_0009403 | 3300046460 | Bacteria | 6867 |
| 930 | Ga0495638_0014627 | 3300046460 | Bacteria | 5295 |
| 931 | Ga0495638_0051434 | 3300046460 | Bacteria | 2569 |
| 932 | Ga0495638_0065460 | 3300046460 | Bacteria | 2237 |
| 933 | Ga0495638_0089304 | 3300046460 | Bacteria | 1859 |
| 934 | Ga0495638_0175133 | 3300046460 | Bacteria | 1228 |
| 935 | Ga0495651_0001526 | 3300046462 | Bacteria | 17899 |
| 936 | Ga0495651_0017466 | 3300046462 | Bacteria | 5556 |
| 937 | Ga0495653_0010928 | 3300046463 | Bacteria | 7434 |
| 938 | Ga0495653_0046847 | 3300046463 | Bacteria | 3346 |
| 939 | Ga0495653_0207640 | 3300046463 | Bacteria | 1325 |
| 940 | Ga0495650_0000064 | 3300046471 | Bacteria | 275412 |
| 941 | Ga0495650_0000174 | 3300046471 | Bacteria | 142519 |
| 942 | Ga0495650_0001163 | 3300046471 | Bacteria | 28128 |
| 943 | Ga0495650_0005976 | 3300046471 | Bacteria | 7710 |
| 944 | Ga0495650_0011700 | 3300046471 | Bacteria | 4778 |
| 945 | Ga0495582_0028785 | 3300046473 | Bacteria | 3049 |
| 946 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 947 | Ga0495605_0000849 | 3300046474 | Bacteria | 21311 |
| 948 | Ga0495605_0002810 | 3300046474 | Bacteria | 10584 |
| 949 | Ga0495605_0013595 | 3300046474 | Bacteria | 4479 |
| 950 | Ga0495605_0019669 | 3300046474 | Bacteria | 3603 |
| 951 | Ga0495605_0033210 | 3300046474 | Bacteria | 2622 |
| 952 | Ga0495605_0069943 | 3300046474 | Bacteria | 1660 |
| 953 | Ga0495639_0037023 | 3300046475 | Unclassified | 2187 |
| 954 | Ga0495639_0063650 | 3300046475 | Bacteria | 1694 |
| 955 | Ga0495664_0355824 | 3300046477 | Bacteria | 881 |
| 956 | Ga0495584_0002037 | 3300046491 | Bacteria | 11614 |
| 957 | Ga0495584_0003914 | 3300046491 | Bacteria | 8049 |
| 958 | Ga0495584_0019260 | 3300046491 | Bacteria | 3466 |
| 959 | Ga0495584_0048988 | 3300046491 | Bacteria | 2129 |
| 960 | Ga0495584_0095941 | 3300046491 | Bacteria | 1497 |
| 961 | Ga0495584_0212467 | 3300046491 | Bacteria | 983 |
| 962 | Ga0495585_0002685 | 3300046492 | Bacteria | 12473 |
| 963 | Ga0495585_0013417 | 3300046492 | Bacteria | 4795 |
| 964 | Ga0495585_0192600 | 3300046492 | Bacteria | 1042 |
| 965 | Ga0495594_0001898 | 3300046499 | Bacteria | 10887 |
| 966 | Ga0495594_0067344 | 3300046499 | Bacteria | 1987 |
| 967 | Ga0495596_0003157 | 3300046500 | Bacteria | 8489 |
| 968 | Ga0495607_0000149 | 3300046501 | Bacteria | 73673 |
| 969 | Ga0495607_0001076 | 3300046501 | Bacteria | 24950 |
| 970 | Ga0495607_0001283 | 3300046501 | Bacteria | 22484 |
| 971 | Ga0495607_0001388 | 3300046501 | Bacteria | 21548 |
| 972 | Ga0495607_0009553 | 3300046501 | Bacteria | 6554 |
| 973 | Ga0495607_0018552 | 3300046501 | Bacteria | 4434 |
| 974 | Ga0495607_0021322 | 3300046501 | Bacteria | 4078 |
| 975 | Ga0495607_0040702 | 3300046501 | Bacteria | 2764 |
| 976 | Ga0495607_0060814 | 3300046501 | Bacteria | 2148 |
| 977 | Ga0495607_0061381 | 3300046501 | Bacteria | 2136 |
| 978 | Ga0495607_0061828 | 3300046501 | Bacteria | 2126 |
| 979 | Ga0495607_0112849 | 3300046501 | Bacteria | 1438 |
| 980 | Ga0495607_0189239 | 3300046501 | Bacteria | 1026 |
| 981 | Ga0495607_0190950 | 3300046501 | Bacteria | 1020 |
| 982 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 983 | Ga0495583_0000271 | 3300046506 | Bacteria | 85085 |
| 984 | Ga0495583_0003346 | 3300046506 | Bacteria | 12366 |
| 985 | Ga0495583_0003399 | 3300046506 | Bacteria | 12174 |
| 986 | Ga0495583_0004619 | 3300046506 | Bacteria | 9731 |
| 987 | Ga0495583_0005967 | 3300046506 | Bacteria | 8081 |
| 988 | Ga0495583_0007992 | 3300046506 | Bacteria | 6542 |
| 989 | Ga0495583_0017345 | 3300046506 | Bacteria | 3825 |
| 990 | Ga0495583_0091190 | 3300046506 | Bacteria | 1311 |
| 991 | Ga0495606_0000042 | 3300046507 | Bacteria | 215099 |
| 992 | Ga0495606_0000094 | 3300046507 | Bacteria | 151840 |
| 993 | Ga0495606_0000415 | 3300046507 | Bacteria | 71371 |
| 994 | Ga0495606_0004342 | 3300046507 | Bacteria | 14233 |
| 995 | Ga0495606_0006710 | 3300046507 | Bacteria | 10546 |
| 996 | Ga0495606_0010458 | 3300046507 | Bacteria | 7697 |
| 997 | Ga0495606_0014490 | 3300046507 | Bacteria | 6147 |
| 998 | Ga0495606_0024275 | 3300046507 | Bacteria | 4373 |
| 999 | Ga0495606_0036664 | 3300046507 | Bacteria | 3337 |
| 1000 | Ga0495606_0039111 | 3300046507 | Bacteria | 3202 |
| 1001 | Ga0495606_0052325 | 3300046507 | Bacteria | 2656 |
| 1002 | Ga0495606_0088236 | 3300046507 | Bacteria | 1912 |
| 1003 | Ga0495606_0169291 | 3300046507 | Bacteria | 1269 |
| 1004 | Ga0495608_0014841 | 3300046511 | Bacteria | 5405 |
| 1005 | Ga0495608_0214098 | 3300046511 | Bacteria | 1210 |
| 1006 | Ga0495610_0002926 | 3300046512 | Bacteria | 13804 |
| 1007 | Ga0495610_0011761 | 3300046512 | Bacteria | 5316 |
| 1008 | Ga0495610_0019341 | 3300046512 | Bacteria | 3815 |
| 1009 | Ga0495610_0021121 | 3300046512 | Bacteria | 3587 |
| 1010 | Ga0495610_0026266 | 3300046512 | Bacteria | 3111 |
| 1011 | Ga0495610_0034583 | 3300046512 | Bacteria | 2602 |
| 1012 | Ga0495610_0053459 | 3300046512 | Bacteria | 1956 |
| 1013 | Ga0495610_0083878 | 3300046512 | Bacteria | 1457 |
| 1014 | Ga0495610_0132491 | 3300046512 | Bacteria | 1081 |
| 1015 | Ga0495616_0006962 | 3300046513 | Bacteria | 6809 |
| 1016 | Ga0495616_0013952 | 3300046513 | Bacteria | 4514 |
| 1017 | Ga0495616_0049861 | 3300046513 | Bacteria | 2096 |
| 1018 | Ga0495616_0257611 | 3300046513 | Bacteria | 747 |
| 1019 | Ga0495618_0117375 | 3300046514 | Bacteria | 1704 |
| 1020 | Ga0495618_0489653 | 3300046514 | Bacteria | 742 |
| 1021 | Ga0495620_0000322 | 3300046515 | Bacteria | 33867 |
| 1022 | Ga0495620_0000370 | 3300046515 | Bacteria | 30870 |
| 1023 | Ga0495620_0000712 | 3300046515 | Bacteria | 20529 |
| 1024 | Ga0495620_0004434 | 3300046515 | Bacteria | 7912 |
| 1025 | Ga0495620_0015211 | 3300046515 | Bacteria | 3889 |
| 1026 | Ga0495620_0029580 | 3300046515 | Bacteria | 2532 |
| 1027 | Ga0495620_0041274 | 3300046515 | Bacteria | 2025 |
| 1028 | Ga0495620_0073965 | 3300046515 | Bacteria | 1389 |
| 1029 | Ga0495620_0120267 | 3300046515 | Bacteria | 1035 |
| 1030 | Ga0495628_0019455 | 3300046516 | Bacteria | 5612 |
| 1031 | Ga0495628_0023111 | 3300046516 | Bacteria | 5105 |
| 1032 | Ga0495628_0043863 | 3300046516 | Bacteria | 3560 |
| 1033 | Ga0495630_0302918 | 3300046517 | Bacteria | 1221 |
| 1034 | Ga0495630_0343695 | 3300046517 | Bacteria | 1142 |
| 1035 | Ga0495631_0009296 | 3300046518 | Bacteria | 4915 |
| 1036 | Ga0495631_0013326 | 3300046518 | Bacteria | 3992 |
| 1037 | Ga0495631_0058600 | 3300046518 | Bacteria | 1674 |
| 1038 | Ga0495631_0077096 | 3300046518 | Bacteria | 1438 |
| 1039 | Ga0495632_0000839 | 3300046519 | Bacteria | 27070 |
| 1040 | Ga0495632_0002490 | 3300046519 | Bacteria | 13979 |
| 1041 | Ga0495632_0003654 | 3300046519 | Bacteria | 10796 |
| 1042 | Ga0495632_0007029 | 3300046519 | Bacteria | 7136 |
| 1043 | Ga0495632_0017521 | 3300046519 | Bacteria | 3950 |
| 1044 | Ga0495632_0068575 | 3300046519 | Bacteria | 1709 |
| 1045 | Ga0495632_0076860 | 3300046519 | Bacteria | 1596 |
| 1046 | Ga0495632_0112566 | 3300046519 | Bacteria | 1277 |
| 1047 | Ga0495632_0244946 | 3300046519 | Bacteria | 805 |
| 1048 | Ga0495637_0000518 | 3300046520 | Bacteria | 27995 |
| 1049 | Ga0495637_0002120 | 3300046520 | Bacteria | 11144 |
| 1050 | Ga0495637_0002498 | 3300046520 | Bacteria | 10150 |
| 1051 | Ga0495637_0006632 | 3300046520 | Bacteria | 5795 |
| 1052 | Ga0495637_0011157 | 3300046520 | Bacteria | 4322 |
| 1053 | Ga0495637_0013035 | 3300046520 | Bacteria | 3958 |
| 1054 | Ga0495637_0054447 | 3300046520 | Bacteria | 1662 |
| 1055 | Ga0495637_0090531 | 3300046520 | Bacteria | 1207 |
| 1056 | Ga0495637_0098999 | 3300046520 | Bacteria | 1141 |
| 1057 | Ga0495643_0001985 | 3300046522 | Bacteria | 17133 |
| 1058 | Ga0495643_0027906 | 3300046522 | Bacteria | 3168 |
| 1059 | Ga0495643_0072791 | 3300046522 | Bacteria | 1801 |
| 1060 | Ga0495643_0228252 | 3300046522 | Bacteria | 879 |
| 1061 | Ga0495643_0273125 | 3300046522 | Bacteria | 780 |
| 1062 | Ga0495644_0003319 | 3300046523 | Bacteria | 6361 |
| 1063 | Ga0495644_0022555 | 3300046523 | Bacteria | 2399 |
| 1064 | Ga0495648_0003291 | 3300046524 | Bacteria | 14274 |
| 1065 | Ga0495648_0009523 | 3300046524 | Bacteria | 7506 |
| 1066 | Ga0495648_0012087 | 3300046524 | Bacteria | 6462 |
| 1067 | Ga0495648_0015690 | 3300046524 | Bacteria | 5487 |
| 1068 | Ga0495648_0021890 | 3300046524 | Bacteria | 4415 |
| 1069 | Ga0495648_0021980 | 3300046524 | Bacteria | 4404 |
| 1070 | Ga0495648_0034583 | 3300046524 | Bacteria | 3286 |
| 1071 | Ga0495648_0085577 | 3300046524 | Bacteria | 1780 |
| 1072 | Ga0495648_0328987 | 3300046524 | Bacteria | 705 |
| 1073 | Ga0495663_0037378 | 3300046525 | Unclassified | 1464 |
| 1074 | Ga0495666_0002123 | 3300046526 | Bacteria | 9831 |
| 1075 | Ga0495666_0015904 | 3300046526 | Bacteria | 3747 |
| 1076 | Ga0495642_0001683 | 3300046528 | Bacteria | 9580 |
| 1077 | Ga0495652_0003383 | 3300046529 | Bacteria | 15774 |
| 1078 | Ga0495652_0014655 | 3300046529 | Bacteria | 7030 |
| 1079 | Ga0495652_0018360 | 3300046529 | Bacteria | 6237 |
| 1080 | Ga0495652_0062372 | 3300046529 | Bacteria | 3143 |
| 1081 | Ga0495654_0009795 | 3300046530 | Bacteria | 5236 |
| 1082 | Ga0495654_0010614 | 3300046530 | Bacteria | 5005 |
| 1083 | Ga0495654_0010779 | 3300046530 | Bacteria | 4965 |
| 1084 | Ga0495654_0018508 | 3300046530 | Bacteria | 3649 |
| 1085 | Ga0495654_0027630 | 3300046530 | Bacteria | 2907 |
| 1086 | Ga0495654_0045750 | 3300046530 | Bacteria | 2158 |
| 1087 | Ga0495654_0054388 | 3300046530 | Bacteria | 1942 |
| 1088 | Ga0495654_0138228 | 3300046530 | Bacteria | 1088 |
| 1089 | Ga0495586_0090429 | 3300046535 | Bacteria | 1690 |
| 1090 | Ga0495587_0096907 | 3300046536 | Bacteria | 1701 |
| 1091 | Ga0495609_0000115 | 3300046538 | Bacteria | 93419 |
| 1092 | Ga0495609_0000395 | 3300046538 | Bacteria | 36677 |
| 1093 | Ga0495609_0001220 | 3300046538 | Bacteria | 17715 |
| 1094 | Ga0495609_0027036 | 3300046538 | Bacteria | 2623 |
| 1095 | Ga0495609_0089017 | 3300046538 | Bacteria | 1343 |
| 1096 | Ga0495609_0104390 | 3300046538 | Bacteria | 1226 |
| 1097 | Ga0495597_0001034 | 3300046542 | Bacteria | 21263 |
| 1098 | Ga0495597_0003290 | 3300046542 | Bacteria | 9561 |
| 1099 | Ga0495597_0009290 | 3300046542 | Bacteria | 4866 |
| 1100 | Ga0495597_0038735 | 3300046542 | Bacteria | 2136 |
| 1101 | Ga0495645_0041759 | 3300046543 | Bacteria | 3344 |
| 1102 | Ga0495645_0146948 | 3300046543 | Bacteria | 1641 |
| 1103 | Ga0495645_0234638 | 3300046543 | Bacteria | 1227 |
| 1104 | Ga0495622_0001521 | 3300046557 | Bacteria | 11587 |
| 1105 | Ga0495622_0010711 | 3300046557 | Bacteria | 4231 |
| 1106 | Ga0495622_0015667 | 3300046557 | Bacteria | 3524 |
| 1107 | Ga0495633_0001693 | 3300046558 | Bacteria | 16578 |
| 1108 | Ga0495633_0003880 | 3300046558 | Bacteria | 9752 |
| 1109 | Ga0495633_0018744 | 3300046558 | Bacteria | 3510 |
| 1110 | Ga0495633_0104180 | 3300046558 | Bacteria | 1316 |
| 1111 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 1112 | Ga0495668_0000034 | 3300046616 | Bacteria | 254171 |
| 1113 | Ga0495668_0003196 | 3300046616 | Bacteria | 12548 |
| 1114 | Ga0495668_0018558 | 3300046616 | Bacteria | 4019 |
| 1115 | Ga0495668_0045515 | 3300046616 | Bacteria | 2440 |
| 1116 | Ga0495611_0000736 | 3300046648 | Bacteria | 18466 |
| 1117 | Ga0495611_0000932 | 3300046648 | Bacteria | 15712 |
| 1118 | Ga0495611_0004344 | 3300046648 | Bacteria | 6144 |
| 1119 | Ga0495611_0011566 | 3300046648 | Bacteria | 3743 |
| 1120 | Ga0495611_0118484 | 3300046648 | Bacteria | 1234 |
| 1121 | Ga0495625_0000672 | 3300046660 | Bacteria | 48741 |
| 1122 | Ga0495625_0001328 | 3300046660 | Bacteria | 30717 |
| 1123 | Ga0495625_0002338 | 3300046660 | Bacteria | 20719 |
| 1124 | Ga0495625_0003330 | 3300046660 | Bacteria | 16184 |
| 1125 | Ga0495625_0007862 | 3300046660 | Bacteria | 9187 |
| 1126 | Ga0495625_0013918 | 3300046660 | Bacteria | 6441 |
| 1127 | Ga0495625_0015980 | 3300046660 | Bacteria | 5920 |
| 1128 | Ga0495625_0029666 | 3300046660 | Bacteria | 4087 |
| 1129 | Ga0495625_0034457 | 3300046660 | Bacteria | 3737 |
| 1130 | Ga0495625_0058185 | 3300046660 | Bacteria | 2747 |
| 1131 | Ga0495625_0125368 | 3300046660 | Bacteria | 1744 |
| 1132 | Ga0495625_0327292 | 3300046660 | Bacteria | 974 |
| 1133 | Ga0495635_0142949 | 3300046663 | Bacteria | 1629 |
| 1134 | Ga0495659_0003001 | 3300046664 | Bacteria | 5412 |
| 1135 | Ga0495661_0000205 | 3300046665 | Bacteria | 68743 |
| 1136 | Ga0495661_0000437 | 3300046665 | Bacteria | 44095 |
| 1137 | Ga0495661_0000685 | 3300046665 | Bacteria | 33805 |
| 1138 | Ga0495661_0001817 | 3300046665 | Bacteria | 17115 |
| 1139 | Ga0495661_0015865 | 3300046665 | Bacteria | 5014 |
| 1140 | Ga0495661_0021833 | 3300046665 | Bacteria | 4167 |
| 1141 | Ga0495661_0030083 | 3300046665 | Bacteria | 3460 |
| 1142 | Ga0495661_0050094 | 3300046665 | Bacteria | 2530 |
| 1143 | Ga0495661_0117772 | 3300046665 | Bacteria | 1471 |
| 1144 | Ga0495661_0170983 | 3300046665 | Bacteria | 1159 |
| 1145 | Ga0495588_0386856 | 3300046674 | Bacteria | 734 |
| 1146 | Ga0495657_0078730 | 3300046675 | Bacteria | 2136 |
| 1147 | Ga0495657_0169271 | 3300046675 | Bacteria | 1346 |
| 1148 | Ga0495599_0065919 | 3300046678 | Bacteria | 2262 |
| 1149 | Ga0495599_0092568 | 3300046678 | Bacteria | 1886 |
| 1150 | Ga0495623_0006272 | 3300046679 | Bacteria | 7731 |
| 1151 | Ga0495623_0011011 | 3300046679 | Bacteria | 5853 |
| 1152 | Ga0495623_0117161 | 3300046679 | Bacteria | 1608 |
| 1153 | Ga0495646_0031113 | 3300046680 | Bacteria | 3329 |
| 1154 | Ga0495646_0167151 | 3300046680 | Bacteria | 1214 |
| 1155 | Ga0495669_0005645 | 3300046684 | Bacteria | 5222 |
| 1156 | Ga0495624_0008471 | 3300046690 | Bacteria | 7167 |
| 1157 | Ga0495624_0008919 | 3300046690 | Bacteria | 6971 |
| 1158 | Ga0495624_0090273 | 3300046690 | Bacteria | 1890 |
| 1159 | Ga0495624_0205268 | 3300046690 | Bacteria | 1196 |
| 1160 | Ga0495670_0007244 | 3300046691 | Bacteria | 5455 |
| 1161 | Ga0495670_0037571 | 3300046691 | Bacteria | 2413 |
| 1162 | Ga0495670_0149284 | 3300046691 | Bacteria | 1225 |
| 1163 | Ga0495671_0003674 | 3300046692 | Bacteria | 9339 |
| 1164 | Ga0495671_0004465 | 3300046692 | Bacteria | 8360 |
| 1165 | Ga0495671_0004983 | 3300046692 | Bacteria | 7824 |
| 1166 | Ga0495671_0007822 | 3300046692 | Bacteria | 6049 |
| 1167 | Ga0495671_0015205 | 3300046692 | Bacteria | 4130 |
| 1168 | Ga0495671_0015406 | 3300046692 | Bacteria | 4095 |
| 1169 | Ga0495671_0034356 | 3300046692 | Bacteria | 2578 |
| 1170 | Ga0495671_0104254 | 3300046692 | Bacteria | 1385 |
| 1171 | Ga0495671_0115800 | 3300046692 | Bacteria | 1308 |
| 1172 | Ga0495671_0121301 | 3300046692 | Bacteria | 1275 |
| 1173 | Ga0495649_0000813 | 3300046694 | Bacteria | 25176 |
| 1174 | Ga0495649_0001962 | 3300046694 | Bacteria | 14916 |
| 1175 | Ga0495649_0011895 | 3300046694 | Bacteria | 5085 |
| 1176 | Ga0495649_0023047 | 3300046694 | Bacteria | 3478 |
| 1177 | Ga0495649_0047497 | 3300046694 | Bacteria | 2334 |
| 1178 | Ga0495649_0055434 | 3300046694 | Bacteria | 2141 |
| 1179 | Ga0495649_0070460 | 3300046694 | Bacteria | 1874 |
| 1180 | Ga0495649_0084108 | 3300046694 | Bacteria | 1699 |
| 1181 | Ga0495649_0098503 | 3300046694 | Bacteria | 1555 |
| 1182 | Ga0495649_0211595 | 3300046694 | Bacteria | 1004 |
| 1183 | Ga0495649_0358682 | 3300046694 | Bacteria | 736 |
| 1184 | Ga0495589_0003822 | 3300046794 | Bacteria | 8093 |
| 1185 | Ga0495589_0006874 | 3300046794 | Bacteria | 5981 |
| 1186 | Ga0495589_0009064 | 3300046794 | Bacteria | 5173 |
| 1187 | Ga0495600_0005056 | 3300046809 | Bacteria | 7922 |
| 1188 | Ga0495600_0022072 | 3300046809 | Bacteria | 4084 |
| 1189 | Ga0495600_0115827 | 3300046809 | Bacteria | 1744 |
| 1190 | Ga0495600_0447738 | 3300046809 | Bacteria | 799 |
| 1191 | Ga0495660_0001767 | 3300046810 | Bacteria | 14330 |
| 1192 | Ga0495660_0002709 | 3300046810 | Bacteria | 11186 |
| 1193 | Ga0495660_0003160 | 3300046810 | Bacteria | 10257 |
| 1194 | Ga0495660_0006768 | 3300046810 | Bacteria | 6759 |
| 1195 | Ga0495660_0011688 | 3300046810 | Bacteria | 5092 |
| 1196 | Ga0495660_0028243 | 3300046810 | Bacteria | 3171 |
| 1197 | Ga0495660_0043308 | 3300046810 | Bacteria | 2483 |
| 1198 | Ga0495660_0079486 | 3300046810 | Bacteria | 1722 |
| 1199 | Ga0495660_0093520 | 3300046810 | Bacteria | 1558 |
| 1200 | Ga0495660_0093707 | 3300046810 | Bacteria | 1556 |
| 1201 | Ga0495660_0187273 | 3300046810 | Bacteria | 997 |
| 1202 | Ga0495660_0251164 | 3300046810 | Bacteria | 820 |
| 1203 | Ga0495604_0015148 | 3300047317 | Bacteria | 6153 |
| 1204 | Ga0495636_0002862 | 3300047318 | Bacteria | 6662 |
| 1205 | Ga0495674_0371631 | 3300047319 | Bacteria | 1158 |
| 1206 | Ga0495674_0752674 | 3300047319 | Bacteria | 761 |
| 1207 | Ga0495672_0003648 | 3300047320 | Bacteria | 13034 |
| 1208 | Ga0495672_0008206 | 3300047320 | Bacteria | 7744 |
| 1209 | Ga0495672_0008237 | 3300047320 | Bacteria | 7727 |
| 1210 | Ga0495672_0012356 | 3300047320 | Bacteria | 5962 |
| 1211 | Ga0495672_0029446 | 3300047320 | Bacteria | 3458 |
| 1212 | Ga0495672_0029976 | 3300047320 | Bacteria | 3419 |
| 1213 | Ga0495672_0035502 | 3300047320 | Bacteria | 3070 |
| 1214 | Ga0495672_0044459 | 3300047320 | Bacteria | 2664 |
| 1215 | Ga0495672_0085170 | 3300047320 | Bacteria | 1752 |
| 1216 | Ga0495676_0000171 | 3300047321 | Bacteria | 50588 |
| 1217 | Ga0495676_0005618 | 3300047321 | Bacteria | 11494 |
| 1218 | Ga0495676_0019092 | 3300047321 | Bacteria | 6035 |
| 1219 | Ga0495676_0287743 | 3300047321 | Bacteria | 1111 |
| 1220 | Ga0495680_0013577 | 3300047322 | Bacteria | 7098 |
| 1221 | Ga0495680_0195899 | 3300047322 | Bacteria | 1451 |
| 1222 | Ga0495680_0245429 | 3300047322 | Bacteria | 1270 |
| 1223 | Ga0495680_0590021 | 3300047322 | Bacteria | 744 |
| 1224 | Ga0495683_0000507 | 3300047323 | Bacteria | 30072 |
| 1225 | Ga0495683_0002187 | 3300047323 | Bacteria | 11984 |
| 1226 | Ga0495683_0004452 | 3300047323 | Bacteria | 7955 |
| 1227 | Ga0495683_0060803 | 3300047323 | Bacteria | 1871 |
| 1228 | Ga0495683_0112566 | 3300047323 | Bacteria | 1298 |
| 1229 | Ga0495687_014652 | 3300047443 | Bacteria | 4022 |
| 1230 | Ga0495675_0160520 | 3300047444 | Bacteria | 1384 |
| 1231 | Ga0495679_000119 | 3300047446 | Bacteria | 69255 |
| 1232 | Ga0495679_000616 | 3300047446 | Bacteria | 24020 |
| 1233 | Ga0495679_005316 | 3300047446 | Bacteria | 5728 |
| 1234 | Ga0495679_005487 | 3300047446 | Bacteria | 5616 |
| 1235 | Ga0495679_011231 | 3300047446 | Bacteria | 3470 |
| 1236 | Ga0495673_0002146 | 3300047469 | Bacteria | 14327 |
| 1237 | Ga0495673_0003396 | 3300047469 | Bacteria | 10517 |
| 1238 | Ga0495673_0004684 | 3300047469 | Bacteria | 8491 |
| 1239 | Ga0495673_0006738 | 3300047469 | Bacteria | 6713 |
| 1240 | Ga0495673_0014086 | 3300047469 | Bacteria | 4169 |
| 1241 | Ga0495673_0015086 | 3300047469 | Bacteria | 3993 |
| 1242 | Ga0495673_0016949 | 3300047469 | Bacteria | 3712 |
| 1243 | Ga0495673_0021460 | 3300047469 | Bacteria | 3187 |
| 1244 | Ga0495673_0032777 | 3300047469 | Bacteria | 2417 |
| 1245 | Ga0495673_0071120 | 3300047469 | Bacteria | 1463 |
| 1246 | Ga0495673_0087608 | 3300047469 | Bacteria | 1277 |
| 1247 | Ga0495673_0092902 | 3300047469 | Bacteria | 1230 |
| 1248 | Ga0495673_0106155 | 3300047469 | Bacteria | 1128 |
| 1249 | Ga0495681_0006275 | 3300047470 | Bacteria | 7830 |
| 1250 | Ga0495681_0007039 | 3300047470 | Bacteria | 7263 |
| 1251 | Ga0495681_0011334 | 3300047470 | Bacteria | 5316 |
| 1252 | Ga0495681_0016651 | 3300047470 | Bacteria | 4110 |
| 1253 | Ga0495681_0018332 | 3300047470 | Bacteria | 3859 |
| 1254 | Ga0495681_0021522 | 3300047470 | Bacteria | 3472 |
| 1255 | Ga0495681_0022687 | 3300047470 | Bacteria | 3352 |
| 1256 | Ga0495681_0028069 | 3300047470 | Bacteria | 2901 |
| 1257 | Ga0495681_0106035 | 3300047470 | Bacteria | 1222 |
| 1258 | Ga0495684_0239586 | 3300047471 | Bacteria | 1324 |
| 1259 | Ga0495686_0004625 | 3300047472 | Bacteria | 11194 |
| 1260 | Ga0495686_0013186 | 3300047472 | Bacteria | 5748 |
| 1261 | Ga0495686_0049354 | 3300047472 | Bacteria | 2648 |
| 1262 | Ga0495686_0145655 | 3300047472 | Bacteria | 1394 |
| 1263 | Ga0495686_0150339 | 3300047472 | Bacteria | 1367 |
| 1264 | Ga0495686_0350079 | 3300047472 | Bacteria | 803 |
| 1265 | Ga0495593_0005528 | 3300047673 | Bacteria | 7462 |
| 1266 | Ga0495593_0036138 | 3300047673 | Bacteria | 2680 |
| 1267 | Ga0495602_0035542 | 3300048088 | Bacteria | 4646 |
| 1268 | Ga0495602_0052798 | 3300048088 | Bacteria | 3606 |
| 1269 | Ga0495602_0189543 | 3300048088 | Bacteria | 1578 |
| 1270 | Ga0495602_0339293 | 3300048088 | Bacteria | 1087 |
| 1271 | Ga0495602_0502137 | 3300048088 | Bacteria | 848 |
| 1272 | Ga0495626_0000123 | 3300048091 | Bacteria | 100704 |
| 1273 | Ga0495626_0003485 | 3300048091 | Bacteria | 10079 |
| 1274 | Ga0495626_0009762 | 3300048091 | Bacteria | 5168 |
| 1275 | Ga0495626_0040937 | 3300048091 | Bacteria | 2185 |
| 1276 | Ga0495626_0052685 | 3300048091 | Bacteria | 1875 |
| 1277 | Ga0495626_0055747 | 3300048091 | Bacteria | 1810 |
| 1278 | Ga0496100_0481852 | 3300048903 | Bacteria | 954 |
| 1279 | Ga0496101_0540725 | 3300048904 | Bacteria | 921 |
| 1280 | Ga0496102_0062552 | 3300048905 | Bacteria | 3408 |
| 1281 | Ga0496102_0296561 | 3300048905 | Bacteria | 1524 |
| 1282 | Ga0496103_0077612 | 3300048906 | Bacteria | 2085 |
| 1283 | Ga0496106_0265042 | 3300048909 | Bacteria | 1375 |
| 1284 | Ga0496108_0358924 | 3300048911 | Bacteria | 1272 |
| 1285 | Ga0496108_0382610 | 3300048911 | Bacteria | 1229 |
| 1286 | Ga0496110_0229455 | 3300048913 | Bacteria | 1688 |
| 1287 | Ga0496110_0270918 | 3300048913 | Bacteria | 1546 |
| 1288 | Ga0496112_0001839 | 3300048915 | Bacteria | 16699 |
| 1289 | Ga0496112_0043323 | 3300048915 | Bacteria | 4406 |
| 1290 | Ga0496112_0526048 | 3300048915 | Bacteria | 1117 |
| 1291 | Ga0496113_0021787 | 3300048916 | Bacteria | 4525 |
| 1292 | Ga0496113_0031793 | 3300048916 | Bacteria | 3833 |
| 1293 | Ga0496113_0156192 | 3300048916 | Bacteria | 1802 |
| 1294 | Ga0496114_0205139 | 3300048917 | Bacteria | 1728 |
| 1295 | Ga0496115_0000272 | 3300048918 | Bacteria | 45410 |
| 1296 | Ga0496115_0000603 | 3300048918 | Bacteria | 27521 |
| 1297 | Ga0496115_0060115 | 3300048918 | Bacteria | 3061 |
| 1298 | Ga0496115_0077865 | 3300048918 | Bacteria | 2697 |
| 1299 | Ga0496115_0148277 | 3300048918 | Bacteria | 1936 |
| 1300 | Ga0496115_0494381 | 3300048918 | Bacteria | 984 |
| 1301 | Ga0496116_0001261 | 3300048919 | Bacteria | 29306 |
| 1302 | Ga0496116_0009203 | 3300048919 | Bacteria | 8455 |
| 1303 | Ga0496116_0065947 | 3300048919 | Bacteria | 2319 |
| 1304 | Ga0496117_0007562 | 3300048920 | Bacteria | 10581 |
| 1305 | Ga0496117_0013964 | 3300048920 | Bacteria | 6959 |
| 1306 | Ga0496117_0043017 | 3300048920 | Bacteria | 3290 |
| 1307 | Ga0496117_0275142 | 3300048920 | Bacteria | 904 |
| 1308 | Ga0496118_0000110 | 3300048921 | Bacteria | 152891 |
| 1309 | Ga0496118_0106046 | 3300048921 | Bacteria | 1881 |
| 1310 | Ga0496118_0202860 | 3300048921 | Bacteria | 1172 |
| 1311 | Ga0496118_0212095 | 3300048921 | Bacteria | 1135 |
| 1312 | Ga0496119_0018322 | 3300048922 | Bacteria | 5222 |
| 1313 | Ga0496121_0003265 | 3300048924 | Bacteria | 23309 |
| 1314 | Ga0496121_0007177 | 3300048924 | Bacteria | 13499 |
| 1315 | Ga0496121_0022646 | 3300048924 | Bacteria | 6083 |
| 1316 | Ga0496121_0023406 | 3300048924 | Bacteria | 5950 |
| 1317 | Ga0496121_0027767 | 3300048924 | Bacteria | 5287 |
| 1318 | Ga0496121_0049083 | 3300048924 | Bacteria | 3583 |
| 1319 | Ga0496121_0073761 | 3300048924 | Bacteria | 2733 |
| 1320 | Ga0496121_0157459 | 3300048924 | Bacteria | 1665 |
| 1321 | Ga0496121_0298633 | 3300048924 | Bacteria | 1094 |
| 1322 | Ga0496121_0495183 | 3300048924 | Bacteria | 777 |
| 1323 | Ga0496122_0000156 | 3300048925 | Bacteria | 160178 |
| 1324 | Ga0496122_0000203 | 3300048925 | Bacteria | 132679 |
| 1325 | Ga0496122_0001639 | 3300048925 | Bacteria | 34793 |
| 1326 | Ga0496122_0001861 | 3300048925 | Bacteria | 32176 |
| 1327 | Ga0496122_0005055 | 3300048925 | Bacteria | 15939 |
| 1328 | Ga0496122_0031343 | 3300048925 | Bacteria | 4427 |
| 1329 | Ga0496122_0039759 | 3300048925 | Bacteria | 3746 |
| 1330 | Ga0496122_0040203 | 3300048925 | Bacteria | 3721 |
| 1331 | Ga0496122_0080009 | 3300048925 | Bacteria | 2281 |
| 1332 | Ga0496122_0125128 | 3300048925 | Bacteria | 1647 |
| 1333 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 1334 | Ga0496123_0000164 | 3300048926 | Bacteria | 132565 |
| 1335 | Ga0496123_0001205 | 3300048926 | Bacteria | 37836 |
| 1336 | Ga0496123_0001590 | 3300048926 | Bacteria | 30876 |
| 1337 | Ga0496123_0007317 | 3300048926 | Bacteria | 10466 |
| 1338 | Ga0496123_0008731 | 3300048926 | Bacteria | 9251 |
| 1339 | Ga0496123_0035809 | 3300048926 | Bacteria | 3530 |
| 1340 | Ga0496123_0080573 | 3300048926 | Bacteria | 1983 |
| 1341 | Ga0496123_0112383 | 3300048926 | Bacteria | 1553 |
| 1342 | Ga0496123_0155192 | 3300048926 | Bacteria | 1228 |
| 1343 | Ga0496123_0316871 | 3300048926 | Bacteria | 738 |
| 1344 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 1345 | Ga0496124_0000625 | 3300048927 | Bacteria | 58974 |
| 1346 | Ga0496124_0004834 | 3300048927 | Bacteria | 15491 |
| 1347 | Ga0496124_0014633 | 3300048927 | Bacteria | 7575 |
| 1348 | Ga0496124_0034319 | 3300048927 | Bacteria | 4454 |
| 1349 | Ga0496124_0038440 | 3300048927 | Bacteria | 4156 |
| 1350 | Ga0496124_0204851 | 3300048927 | Bacteria | 1497 |
| 1351 | Ga0496124_0231951 | 3300048927 | Bacteria | 1379 |
| 1352 | Ga0496124_0381799 | 3300048927 | Bacteria | 985 |
| 1353 | Ga0496124_0430146 | 3300048927 | Bacteria | 906 |
| 1354 | Ga0496125_0000144 | 3300048928 | Bacteria | 156270 |
| 1355 | Ga0496125_0000453 | 3300048928 | Bacteria | 74032 |
| 1356 | Ga0496125_0003794 | 3300048928 | Bacteria | 17970 |
| 1357 | Ga0496125_0028662 | 3300048928 | Bacteria | 5022 |
| 1358 | Ga0496126_0012736 | 3300048929 | Bacteria | 8596 |
| 1359 | Ga0496126_0033969 | 3300048929 | Bacteria | 4796 |
| 1360 | Ga0496126_0097693 | 3300048929 | Bacteria | 2573 |
| 1361 | Ga0496126_0169439 | 3300048929 | Bacteria | 1861 |
| 1362 | Ga0496126_0423695 | 3300048929 | Bacteria | 1075 |
| 1363 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 1364 | Ga0495678_003152 | 3300049459 | Bacteria | 10408 |
| 1365 | Ga0495678_003293 | 3300049459 | Bacteria | 10086 |
| 1366 | Ga0495678_003507 | 3300049459 | Bacteria | 9650 |
| 1367 | Ga0495678_013660 | 3300049459 | Bacteria | 3801 |
| 1368 | Ga0495678_014347 | 3300049459 | Bacteria | 3686 |
| 1369 | Ga0495678_014358 | 3300049459 | Bacteria | 3684 |
| 1370 | Ga0495678_018085 | 3300049459 | Bacteria | 3177 |
| 1371 | Ga0495678_032830 | 3300049459 | Bacteria | 2147 |
| 1372 | Ga0495678_035839 | 3300049459 | Bacteria | 2030 |
| 1373 | Ga0495678_105558 | 3300049459 | Bacteria | 969 |
| 1374 | Ga0495682_0000586 | 3300049460 | Bacteria | 24744 |
| 1375 | Ga0495682_0002009 | 3300049460 | Bacteria | 10039 |
| 1376 | Ga0495682_0005889 | 3300049460 | Bacteria | 5031 |
| 1377 | Ga0501032_0497113 | 3300049569 | Bacteria | 780 |
| 1378 | Ga0501033_0005599 | 3300049570 | Bacteria | 9920 |
| 1379 | Ga0501033_0219951 | 3300049570 | Bacteria | 1352 |
| 1380 | Ga0501034_0001143 | 3300049571 | Bacteria | 36925 |
| 1381 | Ga0501034_0007022 | 3300049571 | Bacteria | 12011 |
| 1382 | Ga0501034_0013846 | 3300049571 | Bacteria | 8302 |
| 1383 | Ga0501034_0022920 | 3300049571 | Bacteria | 6362 |
| 1384 | Ga0501034_0144429 | 3300049571 | Bacteria | 2357 |
| 1385 | Ga0501034_0153669 | 3300049571 | Bacteria | 2276 |
| 1386 | Ga0501034_0579291 | 3300049571 | Bacteria | 1029 |
| 1387 | Ga0501036_0015983 | 3300049572 | Bacteria | 6269 |
| 1388 | Ga0501038_0044736 | 3300049574 | Bacteria | 3845 |
| 1389 | Ga0501039_0002412 | 3300049575 | Bacteria | 13907 |
| 1390 | Ga0501039_0305875 | 3300049575 | Bacteria | 1250 |
| 1391 | Ga0501040_0034026 | 3300049576 | Bacteria | 3453 |
| 1392 | Ga0501041_0029168 | 3300049577 | Bacteria | 3328 |
| 1393 | Ga0501042_0005080 | 3300049578 | Bacteria | 8442 |
| 1394 | Ga0501042_0133279 | 3300049578 | Bacteria | 1791 |
| 1395 | Ga0501043_0003327 | 3300049579 | Bacteria | 13249 |
| 1396 | Ga0501043_0075596 | 3300049579 | Bacteria | 2646 |
| 1397 | Ga0501043_0486007 | 3300049579 | Bacteria | 924 |
| 1398 | Ga0501046_0012903 | 3300049580 | Bacteria | 7105 |
| 1399 | Ga0501047_0039535 | 3300049581 | Bacteria | 4562 |
| 1400 | Ga0501047_0053424 | 3300049581 | Bacteria | 3907 |
| 1401 | Ga0501047_0080968 | 3300049581 | Bacteria | 3122 |
| 1402 | Ga0501068_0000930 | 3300049584 | Bacteria | 15380 |
| 1403 | Ga0501070_0079142 | 3300049586 | Bacteria | 2720 |
| 1404 | Ga0501070_0264244 | 3300049586 | Bacteria | 1406 |
| 1405 | Ga0501071_0467023 | 3300049587 | Bacteria | 966 |
| 1406 | Ga0501072_0010165 | 3300049588 | Bacteria | 7167 |
| 1407 | Ga0501072_0381629 | 3300049588 | Bacteria | 1118 |
| 1408 | Ga0501073_0044984 | 3300049589 | Bacteria | 3111 |
| 1409 | Ga0501073_0064473 | 3300049589 | Bacteria | 2555 |
| 1410 | Ga0501074_0058162 | 3300049590 | Bacteria | 2785 |
| 1411 | Ga0501076_0008593 | 3300049592 | Bacteria | 7491 |
| 1412 | Ga0501076_0377147 | 3300049592 | Bacteria | 1166 |
| 1413 | Ga0501077_0007696 | 3300049593 | Bacteria | 6648 |
| 1414 | Ga0501077_0489887 | 3300049593 | Bacteria | 788 |
| 1415 | Ga0501257_050780 | 3300049686 | Bacteria | 1034 |
| 1416 | Ga0501079_0188946 | 3300049741 | Bacteria | 1607 |
| 1417 | Ga0501080_0020448 | 3300049742 | Bacteria | 6128 |
| 1418 | Ga0501080_0136946 | 3300049742 | Unclassified | 2265 |
| 1419 | Ga0501080_0494998 | 3300049742 | Bacteria | 1093 |
| 1420 | Ga0501081_0020291 | 3300049743 | Bacteria | 4429 |
| 1421 | Ga0501083_0238302 | 3300049744 | Bacteria | 1184 |
| 1422 | Ga0501241_004812 | 3300049758 | Bacteria | 2521 |
| 1423 | Ga0501035_0004258 | 3300049822 | Bacteria | 13582 |
| 1424 | Ga0501035_0024656 | 3300049822 | Bacteria | 5515 |
| 1425 | Ga0501035_0155649 | 3300049822 | Bacteria | 1981 |
| 1426 | Ga0501035_0416739 | 3300049822 | Bacteria | 1115 |
| 1427 | Ga0501044_0002363 | 3300049823 | Bacteria | 21502 |
| 1428 | Ga0501044_0069914 | 3300049823 | Bacteria | 3573 |
| 1429 | Ga0501044_0072183 | 3300049823 | Bacteria | 3510 |
| 1430 | Ga0501044_0278560 | 3300049823 | Bacteria | 1607 |
| 1431 | Ga0501044_0331238 | 3300049823 | Bacteria | 1445 |
| 1432 | Ga0501045_0012036 | 3300049824 | Bacteria | 6083 |
| 1433 | Ga0501045_0224852 | 3300049824 | Bacteria | 1397 |
| 1434 | nmdc:mga03683_3195_c1 | 3300050489 | Bacteria | 5235 |
| 1435 | nmdc:mga0k408_19404_c1 | 3300050493 | Bacteria | 3800 |
| 1436 | nmdc:mga07m45_13908_c2 | 3300050496 | Bacteria | 1571 |
| 1437 | nmdc:mga0qj67_116626_c1 | 3300050509 | Bacteria | 2158 |
| 1438 | nmdc:mga0sz30_118006_c1 | 3300050516 | Bacteria | 1165 |
| 1439 | Ga0495601_0053137 | 3300053077 | Bacteria | 2560 |
| 1440 | Ga0495601_0090848 | 3300053077 | Bacteria | 1965 |
| 1441 | Ga0495601_0090990 | 3300053077 | Bacteria | 1964 |
| 1442 | Ga0495601_0666155 | 3300053077 | Bacteria | 665 |
| 1443 | Ga0500635_0004850 | 3300053080 | Bacteria | 3489 |
| 1444 | Ga0495595_0073684 | 3300053084 | Bacteria | 1617 |
| 1445 | Ga0495619_0395030 | 3300053085 | Bacteria | 955 |
| 1446 | Ga0500643_000498 | 3300053087 | Bacteria | 28188 |
| 1447 | Ga0500644_0001114 | 3300053088 | Bacteria | 7914 |
| 1448 | Ga0500644_0064461 | 3300053088 | Bacteria | 1302 |
| 1449 | Ga0500646_0105160 | 3300053090 | Bacteria | 891 |
| 1450 | Ga0500583_0043969 | 3300053092 | Bacteria | 2043 |
| 1451 | Ga0500583_0142876 | 3300053092 | Bacteria | 1190 |
| 1452 | Ga0500555_028482 | 3300053103 | Unclassified | 1591 |
| 1453 | Ga0500594_0019363 | 3300053118 | Bacteria | 1686 |
| 1454 | Ga0500595_001126 | 3300053119 | Bacteria | 14807 |
| 1455 | Ga0500607_049700 | 3300053121 | Bacteria | 2238 |
| 1456 | Ga0500608_001477 | 3300053122 | Bacteria | 8402 |
| 1457 | Ga0500617_060103 | 3300053124 | Bacteria | 1684 |
| 1458 | Ga0500618_019033 | 3300053125 | Bacteria | 1693 |
| 1459 | Ga0500642_0293386 | 3300053130 | Bacteria | 736 |
| 1460 | Ga0500658_0012753 | 3300053134 | Bacteria | 3103 |
| 1461 | Ga0500559_0001341 | 3300053136 | Bacteria | 14123 |
| 1462 | Ga0500559_0010104 | 3300053136 | Bacteria | 4062 |
| 1463 | Ga0500559_0143991 | 3300053136 | Bacteria | 1117 |
| 1464 | Ga0500564_114763 | 3300053138 | Bacteria | 1179 |
| 1465 | Ga0500568_0058092 | 3300053139 | Bacteria | 1504 |
| 1466 | Ga0500573_0000071 | 3300053140 | Bacteria | 59706 |
| 1467 | Ga0500573_0094310 | 3300053140 | Bacteria | 1688 |
| 1468 | Ga0500574_005083 | 3300053141 | Bacteria | 2527 |
| 1469 | Ga0500577_0298617 | 3300053142 | Bacteria | 703 |
| 1470 | Ga0500588_0110221 | 3300053146 | Bacteria | 959 |
| 1471 | Ga0500600_0005717 | 3300053149 | Bacteria | 7357 |
| 1472 | Ga0500616_0024107 | 3300053153 | Bacteria | 3386 |
| 1473 | Ga0500622_0001100 | 3300053156 | Bacteria | 22485 |
| 1474 | Ga0500622_0173085 | 3300053156 | Bacteria | 1003 |
| 1475 | Ga0500627_0346951 | 3300053158 | Bacteria | 641 |
| 1476 | Ga0500636_0035697 | 3300053177 | Bacteria | 2941 |
| 1477 | Ga0500611_089672 | 3300053727 | Bacteria | 781 |
| 1478 | Ga0500645_007540 | 3300053730 | Bacteria | 3778 |
| 1479 | Ga0500552_000300 | 3300053733 | Bacteria | 4486 |
| 1480 | Ga0501084_0008983 | 3300054114 | Bacteria | 8264 |
| 1481 | Ga0587111_0004128 | 3300060346 | Bacteria | 2134 |
| 1482 | Ga0501082_0315950 | 3300060353 | Bacteria | 1361 |
| 1483 | Ga0501082_0464469 | 3300060353 | Bacteria | 1106 |
| 1484 | Ga0466962_0002025 | 3300061719 | Bacteria | 9565 |
| 1485 | Ga0466962_0043341 | 3300061719 | Bacteria | 2153 |
| 1486 | Ga0530510_0019831 | 3300061734 | Bacteria | 4778 |
| 1487 | Ga0530510_0333456 | 3300061734 | Bacteria | 1138 |
| 1488 | 2501070871 | 2501025501 | Bacteria | 7768574 |
| 1489 | 2501078568 | 2501025502 | Bacteria | 9641094 |
| 1490 | 2501413700 | 2501025504 | Bacteria | 8008976 |
| 1491 | 2510282948 | 2510065053 | Bacteria | 5005518 |
| 1492 | 2510293622 | 2510065055 | Bacteria | 5037935 |
| 1493 | 2510310772 | 2510065058 | Bacteria | 5005894 |
| 1494 | 2511089625 | 2510917013 | Bacteria | 9951648 |
| 1495 | 2511095029 | 2510917014 | Bacteria | 8296963 |
| 1496 | 2511104685 | 2510917015 | Bacteria | 7950052 |
| 1497 | 2511256746 | 2511231004 | Bacteria | 6669789 |
| 1498 | 2511287653 | 2511231010 | Bacteria | 6373152 |
| 1499 | 2511294081 | 2511231011 | Bacteria | 6149768 |
| 1500 | 2511303121 | 2511231012 | Bacteria | 6738011 |
| 1501 | 2511319887 | 2511231015 | Bacteria | 6598026 |
| 1502 | 2511327730 | 2511231016 | Bacteria | 6704427 |
| 1503 | 2511331593 | 2511231017 | Bacteria | 6503007 |
| 1504 | 2511340314 | 2511231018 | Bacteria | 6436256 |
| 1505 | 2511344956 | 2511231019 | Bacteria | 6520662 |
| 1506 | 2511348646 | 2511231020 | Bacteria | 6115223 |
| 1507 | 2511360794 | 2511231022 | Bacteria | 6719296 |
| 1508 | 2511371090 | 2511231023 | Bacteria | 6808468 |
| 1509 | 2511410727 | 2511231031 | Bacteria | 6558529 |
| 1510 | 2511826113 | 2511231156 | Bacteria | 6845832 |
| 1511 | 2512035163 | 2511231221 | Bacteria | 6846400 |
| 1512 | 2513551450 | 2513237082 | Bacteria | 8640282 |
| 1513 | 2513560100 | 2513237083 | Bacteria | 8410967 |
| 1514 | 2516016857 | 2515154189 | Bacteria | 9629850 |
| 1515 | 2523107000 | 2522572158 | Bacteria | 6514390 |
| 1516 | 2597866972 | 2597489889 | Bacteria | 6297495 |
| 1517 | 2599326628 | 2599185155 | Bacteria | 5827168 |
| 1518 | 2599504338 | 2599185188 | Bacteria | 6164180 |
| 1519 | 2599613628 | 2599185212 | Bacteria | 6765997 |
| 1520 | 2599773002 | 2599185248 | Bacteria | 6696816 |
| 1521 | 2599879345 | 2599185288 | Bacteria | 6666191 |
| 1522 | 2599889369 | 2599185289 | Bacteria | 6778765 |
| 1523 | 2599900767 | 2599185291 | Bacteria | 6775623 |
| 1524 | 2599933401 | 2599185300 | Bacteria | 6062622 |
| 1525 | 2599944146 | 2599185302 | Bacteria | 5954930 |
| 1526 | 2599948709 | 2599185303 | Bacteria | 6512725 |
| 1527 | 2599956364 | 2599185304 | Bacteria | 5951361 |
| 1528 | 2599963412 | 2599185305 | Bacteria | 6748700 |
| 1529 | 2599966542 | 2599185306 | Bacteria | 6637356 |
| 1530 | 2599970517 | 2599185307 | Bacteria | 6194719 |
| 1531 | 2599977679 | 2599185308 | Bacteria | 6621546 |
| 1532 | 2599985058 | 2599185309 | Bacteria | 5969593 |
| 1533 | 2599989316 | 2599185310 | Bacteria | 6014457 |
| 1534 | 2599994229 | 2599185311 | Bacteria | 6354990 |
| 1535 | 2600000288 | 2599185312 | Bacteria | 5912071 |
| 1536 | 2600011848 | 2599185314 | Bacteria | 6621749 |
| 1537 | 2600019337 | 2599185315 | Bacteria | 6771107 |
| 1538 | 2600023524 | 2599185316 | Bacteria | 6320029 |
| 1539 | 2600030674 | 2599185317 | Bacteria | 6435722 |
| 1540 | 2600037031 | 2599185318 | Bacteria | 6961590 |
| 1541 | 2600042454 | 2599185319 | Bacteria | 6637840 |
| 1542 | 2600049550 | 2599185320 | Bacteria | 5963263 |
| 1543 | 2600053847 | 2599185321 | Bacteria | 6764560 |
| 1544 | 2600060517 | 2599185322 | Bacteria | 6763055 |
| 1545 | 2600065616 | 2599185323 | Bacteria | 6688755 |
| 1546 | 2600070775 | 2599185324 | Bacteria | 6590677 |
| 1547 | 2600078301 | 2599185325 | Bacteria | 6324919 |
| 1548 | 2600227499 | 2599185359 | Bacteria | 4772316 |
| 1549 | 2600360481 | 2600254930 | Bacteria | 6431253 |
| 1550 | 2601624908 | 2600255283 | Bacteria | 6061572 |
| 1551 | 2601693299 | 2600255296 | Bacteria | 5784754 |
| 1552 | 2621296521 | 2619619299 | Bacteria | 6649820 |
| 1553 | 2624482029 | 2623620443 | Bacteria | 6427864 |
| 1554 | 2643789496 | 2643221554 | Bacteria | 6603920 |
| 1555 | 2643845072 | 2643221565 | Bacteria | 6216018 |
| 1556 | 2643865505 | 2643221570 | Bacteria | 5103772 |
| 1557 | 2643873515 | 2643221571 | Bacteria | 6228673 |
| 1558 | 2643895807 | 2643221577 | Bacteria | 3710843 |
| 1559 | 2643992044 | 2643221596 | Bacteria | 5006805 |
| 1560 | 2644063252 | 2643221609 | Bacteria | 6756331 |
| 1561 | 2644071735 | 2643221611 | Bacteria | 6820941 |
| 1562 | 2644286253 | 2643221650 | Bacteria | 7029547 |
| 1563 | 2644301090 | 2643221654 | Bacteria | 5273570 |
| 1564 | 2644477999 | 2643221685 | Bacteria | 3673288 |
| 1565 | 2644649451 | 2643221717 | Bacteria | 5676132 |
| 1566 | 2671093677 | 2667528170 | Bacteria | 6786960 |
| 1567 | 2671129093 | 2667528176 | Bacteria | 6724917 |
| 1568 | 2671695356 | 2671180139 | Bacteria | 4196045 |
| 1569 | 2678264449 | 2675903515 | Bacteria | 6580491 |
| 1570 | 2718635272 | 2718217725 | Bacteria | 5758958 |
| 1571 | 2738673467 | 2738541265 | Bacteria | 6594665 |
| 1572 | 2738688496 | 2738541271 | Bacteria | 5657310 |
| 1573 | 2738751860 | 2738541282 | Bacteria | 6593925 |
| 1574 | 2738807569 | 2738541294 | Bacteria | 6925949 |
| 1575 | 2738860901 | 2738541303 | Bacteria | 6591772 |
| 1576 | 2738894929 | 2738541309 | Bacteria | 6926455 |
| 1577 | 2739264228 | 2738543016 | Bacteria | 5657564 |
| 1578 | 2739284892 | 2738543020 | Bacteria | 5718238 |
| 1579 | 2739290206 | 2738543021 | Bacteria | 5718241 |
| 1580 | 2739315061 | 2738543025 | Bacteria | 6600348 |
| 1581 | 2739733513 | 2739367700 | Bacteria | 4747630 |
| 1582 | 2739792210 | 2739367756 | Bacteria | 4553612 |
| 1583 | 2745004903 | 2744054620 | Bacteria | 6551379 |
| 1584 | 2765578237 | 2765235840 | Bacteria | 4663337 |
| 1585 | 2774129007 | 2773857672 | Bacteria | 4993178 |
| 1586 | 2774132930 | 2773857673 | Bacteria | 6513460 |
| 1587 | 2784263206 | 2784132063 | Bacteria | 6262788 |
| 1588 | 2794595962 | 2791355520 | Bacteria | 5948615 |
| 1589 | 2808856905 | 2808606361 | Bacteria | 6136259 |
| 1590 | 2808924261 | 2808606376 | Bacteria | 6248667 |
| 1591 | 2808936976 | 2808606378 | Bacteria | 6177535 |
| 1592 | 2808946354 | 2808606380 | Bacteria | 6248705 |
| 1593 | 2808965328 | 2808606383 | Bacteria | 6138645 |
| 1594 | 2808980119 | 2808606385 | Bacteria | 6711065 |
| 1595 | 2808995839 | 2808606388 | Bacteria | 6706662 |
| 1596 | 2809000184 | 2808606389 | Bacteria | 6138126 |
| 1597 | 2809218873 | 2808606445 | Bacteria | 6057339 |
| 1598 | 2817488000 | 2816332298 | Bacteria | 6852809 |
| 1599 | 2819543539 | 2818991436 | Bacteria | 5376622 |
| 1600 | 2819655767 | 2818991456 | Bacteria | 6123676 |
| 1601 | 2819716083 | 2818991466 | Bacteria | 4748179 |
| 1602 | 2825656609 | 2825651385 | Bacteria | 6715909 |
| 1603 | 2826583068 | 2826581358 | Bacteria | 5963467 |
| 1604 | 2842776991 | 2842775625 | Bacteria | 5587290 |
| 1605 | 2842782426 | 2842780639 | Bacteria | 4337790 |
| 1606 | 2842817526 | 2842815866 | Bacteria | 5947510 |
| 1607 | 2842850677 | 2842849001 | Bacteria | 5924277 |
| 1608 | 2842859300 | 2842854478 | Bacteria | 6143501 |
| 1609 | 2848298180 | 2848297114 | Bacteria | 3608511 |
| 1610 | 2852616657 | 2852612431 | Bacteria | 6885235 |
| 1611 | 2852657290 | 2852653556 | Bacteria | 4050083 |
| 1612 | 2852663017 | 2852657418 | Bacteria | 6472974 |
| 1613 | 2852671625 | 2852667396 | Bacteria | 6885555 |
| 1614 | 2856293324 | 2856287931 | Bacteria | 7223934 |
| 1615 | 2857366557 | 2857357740 | Bacteria | 9937880 |
| 1616 | 2857443924 | 2857442823 | Bacteria | 4562550 |
| 1617 | 2860868025 | 2860867994 | Bacteria | 5645326 |
| 1618 | 2879163333 | 2879163058 | Bacteria | 4223965 |
| 1619 | 2879164124 | 2879163058 | Bacteria | 4223965 |
| 1620 | 2880234631 | 2880230671 | Bacteria | 6140320 |
| 1621 | 2883094613 | 2883087390 | Bacteria | 9532701 |
| 1622 | 2884412791 | 2884411467 | Bacteria | 5246714 |
| 1623 | 2884963330 | 2884960567 | Bacteria | 5437054 |
| 1624 | 2894775022 | 2894772417 | Bacteria | 5305674 |
| 1625 | 2899275640 | 2899275550 | Bacteria | 3958688 |
| 1626 | 2904434671 | 2904434214 | Bacteria | 6230908 |
| 1627 | 2904455291 | 2904449895 | Bacteria | 6927402 |
| 1628 | 2904461324 | 2904456579 | Bacteria | 6819253 |
| 1629 | 2904521230 | 2904518522 | Bacteria | 6068986 |
| 1630 | 2904555284 | 2904550169 | Bacteria | 6221258 |
| 1631 | 2913040926 | 2913036834 | Bacteria | 6704877 |
| 1632 | 2917836877 | 2917832318 | Bacteria | 5346010 |
| 1633 | 2919125914 | 2919125081 | Bacteria | 5385106 |
| 1634 | 2919460967 | 2919456309 | Bacteria | 6586567 |
| 1635 | 2919466868 | 2919462493 | Bacteria | 5817112 |
| 1636 | 2919487275 | 2919481497 | Bacteria | 6907839 |
| 1637 | 2923589963 | 2923586266 | Bacteria | 6565975 |
| 1638 | 2928528143 | 2928526807 | Bacteria | 4760224 |
| 1639 | 2928966808 | 2928963466 | Bacteria | 5165703 |
| 1640 | 2928971350 | 2928968154 | Bacteria | 4633371 |
| 1641 | 2928973921 | 2928972540 | Bacteria | 3058286 |
| 1642 | 2929148425 | 2929144301 | Bacteria | 6622272 |
| 1643 | 2929189908 | 2929189879 | Bacteria | 5930554 |
| 1644 | 2929204315 | 2929199973 | Bacteria | 7260745 |
| 1645 | 2931374159 | 2931369376 | Bacteria | 6847892 |
| 1646 | 2939623926 | 2939622612 | Bacteria | 4698046 |
| 1647 | 2939637519 | 2939636861 | Bacteria | 6297853 |
| 1648 | 2946012923 | 2946006987 | Bacteria | 6705746 |
| 1649 | 2946028213 | 2946027586 | Bacteria | 6049274 |
| 1650 | 2947234734 | 2947233263 | Bacteria | 6439278 |
| 1651 | 2969308785 | 2969304461 | Bacteria | 6601805 |
| 1652 | 2974302578 | 2974298342 | Bacteria | 4840922 |
| 1653 | 2977241119 | 2977240413 | Bacteria | 3191065 |
| 1654 | 2984290602 | 2984286254 | Bacteria | 6702062 |
| 1655 | 2984499836 | 2984499530 | Bacteria | 5020881 |
| 1656 | 2984506267 | 2984504281 | Bacteria | 5262371 |
| 1657 | 2988730026 | 2988728565 | Bacteria | 6124362 |
| 1658 | 3000865581 | 3000865235 | Bacteria | 3106258 |
| 1659 | 3007315895 | 3007315729 | Bacteria | 5076637 |
| 1660 | 3007400967 | 3007395558 | Bacteria | 6755444 |
| 1661 | 3007515729 | 3007511990 | Bacteria | 6481491 |
| 1662 | 3007617863 | 3007614139 | Bacteria | 6053559 |
| 1663 | 3007619929 | 3007619802 | Bacteria | 6411688 |
| 1664 | 3007858925 | 3007855910 | Bacteria | 5637581 |
| 1665 | 3007865519 | 3007861166 | Bacteria | 6045338 |
| 1666 | 643602444 | 643348564 | Bacteria | 8839022 |
| 1667 | 8003015638 | 8003014200 | Bacteria | 4059994 |
| 1668 | 8003957365 | 8003955200 | Bacteria | 8601927 |
| 1669 | 8016731742 | 8016728285 | Bacteria | 5263933 |
| 1670 | 8034965120 | 8034962539 | Bacteria | 4884839 |
| 1671 | 8054503576 | 8054503363 | Bacteria | 6101651 |
| 1672 | 8056127469 | 8056125926 | Bacteria | 6228218 |
| 1673 | 8056144946 | 8056143049 | Bacteria | 6307666 |
| 1674 | 8056180094 | 8056177738 | Bacteria | 6748268 |
| 1675 | Ga0436361_0602091 | |||
| 1676 | SwRhRL2b_contig_656453 | |||
| 1677 | JGI24739J22299_10001818 | |||
| 1678 | JGI24737J22298_10091662 | |||
| 1679 | JGI24735J21928_10000175 | |||
| 1680 | JGI24735J21928_10001426 | |||
| 1681 | JGI25162J39368_1000063 | |||
| 1682 | JGI25162J39368_1000287 | |||
| 1683 | JGI25158J39367_1004817 | |||
| 1684 | JGI25157J39369_1000217 | |||
| 1685 | JGI25157J39369_1008628 | |||
| 1686 | JGI25163J39215_1000677 | |||
| 1687 | JGI25163J39215_1002287 | |||
| 1688 | JGI25164J39214_1000672 | |||
| 1689 | JGI25164J39214_1004989 | |||
| 1690 | JGI25159J45721_1004581 | |||
| 1691 | JGI25151J46595_10000338 | |||
| 1692 | JGI25165J46597_1000069 | |||
| 1693 | JGI25165J46597_1000388 | |||
| 1694 | rootH1_10093753 | |||
| 1695 | rootH2_10007026 | |||
| 1696 | rootH2_10077057 | |||
| 1697 | rootL2_10039617 | |||
| 1698 | rootH1_10009337 | |||
| 1699 | rootH1_10071821 | |||
| 1700 | rootH1_10074923 | |||
| 1701 | rootH1_10105829 | |||
| 1702 | rootH1_10249875 | |||
| 1703 | JGI25161J50226_1000201 | |||
| 1704 | Ga0055538_1000034 | |||
| 1705 | Ga0055538_1004584 | |||
| 1706 | Ga0055539_1000044 | |||
| 1707 | Ga0055533_1000055 | |||
| 1708 | Ga0055525_1000066 | |||
| 1709 | Ga0055535_1000335 | |||
| 1710 | Ga0055535_1000978 | |||
| 1711 | Ga0055535_1019184 | |||
| 1712 | Ga0055542_1000363 | |||
| 1713 | Ga0055542_1001209 | |||
| 1714 | Ga0055529_1000391 | |||
| 1715 | Ga0055529_1000610 | |||
| 1716 | Ga0055529_1000975 | |||
| 1717 | Ga0055529_1005226 | |||
| 1718 | Ga0055529_1015679 | |||
| 1719 | Ga0055526_1000116 | |||
| 1720 | Ga0055526_1000487 | |||
| 1721 | Ga0055526_1006469 | |||
| 1722 | Ga0055537_1000035 | |||
| 1723 | Ga0055524_1021726 | |||
| 1724 | Ga0055524_1025753 | |||
| 1725 | Ga0055524_1053959 | |||
| 1726 | Ga0055536_1000103 | |||
| 1727 | Ga0055536_1002169 | |||
| 1728 | Ga0055536_1041914 | |||
| 1729 | Ga0055534_1000104 | |||
| 1730 | Ga0055534_1000158 | |||
| 1731 | Ga0055534_1000325 | |||
| 1732 | Ga0055528_1000058 | |||
| 1733 | Ga0055530_10001374 | |||
| 1734 | Ga0055530_10007126 | |||
| 1735 | Ga0055540_1010062 | |||
| 1736 | Ga0055531_10006687 | |||
| 1737 | Ga0055531_10014117 | |||
| 1738 | Ga0055531_10023407 | |||
| 1739 | Ga0055531_10067287 | |||
| 1740 | Ga0055541_1000032 | |||
| 1741 | Ga0058692_1000009 | |||
| 1742 | Ga0055543_1000103 | |||
| 1743 | Ga0065165_1000224 | |||
| 1744 | Ga0065165_1000854 | |||
| 1745 | Ga0065714_10007829 | |||
| 1746 | Ga0065714_10012581 | |||
| 1747 | Ga0065714_10069716 | |||
| 1748 | Ga0065704_10009257 | |||
| 1749 | Ga0065704_10118926 | |||
| 1750 | Ga0065704_10264331 | |||
| 1751 | Ga0065712_10000132 | |||
| 1752 | Ga0065712_10090203 | |||
| 1753 | Ga0065707_10082092 | |||
| 1754 | Ga0070658_10014131 | |||
| 1755 | Ga0070658_10123076 | |||
| 1756 | Ga0070658_10173891 | |||
| 1757 | Ga0070676_10000184 | |||
| 1758 | Ga0070676_10016033 | |||
| 1759 | Ga0070676_10086903 | |||
| 1760 | Ga0070676_10155529 | |||
| 1761 | Ga0070683_100002328 | |||
| 1762 | Ga0070683_100031670 | |||
| 1763 | Ga0070683_100115303 | |||
| 1764 | Ga0070683_100140189 | |||
| 1765 | Ga0070683_100510519 | |||
| 1766 | Ga0070690_100096094 | |||
| 1767 | Ga0070670_100005054 | |||
| 1768 | Ga0070670_100026223 | |||
| 1769 | Ga0070670_100128471 | |||
| 1770 | Ga0070670_100265249 | |||
| 1771 | Ga0070677_10000379 | |||
| 1772 | Ga0070677_10022599 | |||
| 1773 | Ga0070677_10070743 | |||
| 1774 | Ga0068869_100028286 | |||
| 1775 | Ga0068869_100225786 | |||
| 1776 | Ga0070666_10012374 | |||
| 1777 | Ga0070680_100003334 | |||
| 1778 | Ga0070680_100124199 | |||
| 1779 | Ga0070680_100269382 | |||
| 1780 | Ga0070682_100003944 | |||
| 1781 | Ga0070682_100014112 | |||
| 1782 | Ga0068868_100002077 | |||
| 1783 | Ga0068868_100023967 | |||
| 1784 | Ga0068868_100026781 | |||
| 1785 | Ga0068868_100418855 | |||
| 1786 | Ga0068868_100647819 | |||
| 1787 | Ga0070660_100001110 | |||
| 1788 | Ga0070660_100078997 | |||
| 1789 | Ga0070660_100114547 | |||
| 1790 | Ga0070661_100085612 | |||
| 1791 | Ga0070661_100120919 | |||
| 1792 | Ga0070668_100004033 | |||
| 1793 | Ga0070668_100060509 | |||
| 1794 | Ga0070668_100067315 | |||
| 1795 | Ga0070668_100094228 | |||
| 1796 | Ga0070668_100167475 | |||
| 1797 | Ga0070668_100275083 | |||
| 1798 | Ga0070668_100336190 | |||
| 1799 | Ga0070668_100410165 | |||
| 1800 | Ga0070669_100020760 | |||
| 1801 | Ga0070669_100136133 | |||
| 1802 | Ga0070669_100764828 | |||
| 1803 | Ga0070675_100004329 | |||
| 1804 | Ga0070675_100010835 | |||
| 1805 | Ga0070675_100075645 | |||
| 1806 | Ga0070675_100251931 | |||
| 1807 | Ga0070675_100918528 | |||
| 1808 | Ga0070671_100043865 | |||
| 1809 | Ga0070671_100049086 | |||
| 1810 | Ga0070671_100074400 | |||
| 1811 | Ga0070674_100006415 | |||
| 1812 | Ga0070674_100185045 | |||
| 1813 | Ga0070674_100228228 | |||
| 1814 | Ga0070673_100019406 | |||
| 1815 | Ga0070673_100021478 | |||
| 1816 | Ga0070673_100073974 | |||
| 1817 | Ga0070673_100087809 | |||
| 1818 | Ga0070688_100382213 | |||
| 1819 | Ga0070688_100832145 | |||
| 1820 | Ga0070688_100844682 | |||
| 1821 | Ga0070659_100062514 | |||
| 1822 | Ga0070659_100318943 | |||
| 1823 | Ga0070659_100548394 | |||
| 1824 | Ga0070659_100770255 | |||
| 1825 | Ga0070667_100018980 | |||
| 1826 | Ga0070667_100101645 | |||
| 1827 | Ga0070667_100153202 | |||
| 1828 | Ga0070667_100260558 | |||
| 1829 | Ga0070714_100601099 | |||
| 1830 | Ga0070713_100111919 | |||
| 1831 | Ga0070710_10021874 | |||
| 1832 | Ga0070711_100438177 | |||
| 1833 | Ga0070700_100798855 | |||
| 1834 | Ga0070663_100013698 | |||
| 1835 | Ga0070663_100248073 | |||
| 1836 | Ga0070663_100403662 | |||
| 1837 | Ga0070663_100464896 | |||
| 1838 | Ga0070678_100342825 | |||
| 1839 | Ga0070678_100927899 | |||
| 1840 | Ga0070662_100009714 | |||
| 1841 | Ga0070662_100029289 | |||
| 1842 | Ga0070662_100074443 | |||
| 1843 | Ga0070662_100264729 | |||
| 1844 | Ga0070662_100274238 | |||
| 1845 | Ga0070681_10211816 | |||
| 1846 | Ga0070681_10238260 | |||
| 1847 | Ga0070681_10308196 | |||
| 1848 | Ga0068867_100021598 | |||
| 1849 | Ga0070685_10031687 | |||
| 1850 | Ga0070685_10345998 | |||
| 1851 | Ga0070699_100470317 | |||
| 1852 | Ga0070679_100119972 | |||
| 1853 | Ga0070679_100153527 | |||
| 1854 | Ga0070679_100156262 | |||
| 1855 | Ga0070679_100225783 | |||
| 1856 | Ga0070679_100466101 | |||
| 1857 | Ga0070684_100001235 | |||
| 1858 | Ga0070684_100027746 | |||
| 1859 | Ga0070684_100057175 | |||
| 1860 | Ga0070684_100147827 | |||
| 1861 | Ga0070684_100218756 | |||
| 1862 | Ga0068853_100035810 | |||
| 1863 | Ga0070672_100024644 | |||
| 1864 | Ga0070672_100039537 | |||
| 1865 | Ga0070672_100083942 | |||
| 1866 | Ga0070672_100107480 | |||
| 1867 | Ga0070672_100113189 | |||
| 1868 | Ga0070672_100201041 | |||
| 1869 | Ga0070672_100318529 | |||
| 1870 | Ga0070672_100372234 | |||
| 1871 | Ga0070696_100186255 | |||
| 1872 | Ga0070693_100172707 | |||
| 1873 | Ga0070665_100012164 | |||
| 1874 | Ga0070665_100024403 | |||
| 1875 | Ga0070665_100459856 | |||
| 1876 | Ga0070665_100534549 | |||
| 1877 | Ga0070665_100560054 | |||
| 1878 | Ga0070665_100575002 | |||
| 1879 | Ga0068855_100003248 | |||
| 1880 | Ga0068855_100012376 | |||
| 1881 | Ga0068855_100051713 | |||
| 1882 | Ga0068855_100132342 | |||
| 1883 | Ga0068855_100183432 | |||
| 1884 | Ga0068855_100602645 | |||
| 1885 | Ga0070664_100055289 | |||
| 1886 | Ga0070664_100169074 | |||
| 1887 | Ga0070664_100178464 | |||
| 1888 | Ga0070664_100190283 | |||
| 1889 | Ga0070664_100418747 | |||
| 1890 | Ga0070664_100486035 | |||
| 1891 | Ga0068857_100008513 | |||
| 1892 | Ga0068857_100051007 | |||
| 1893 | Ga0068857_100063861 | |||
| 1894 | Ga0068857_100182706 | |||
| 1895 | Ga0068857_100365287 | |||
| 1896 | Ga0068854_100000699 | |||
| 1897 | Ga0068854_100001438 | |||
| 1898 | Ga0068854_100006866 | |||
| 1899 | Ga0068854_100162955 | |||
| 1900 | Ga0068854_100437129 | |||
| 1901 | Ga0068854_100523259 | |||
| 1902 | Ga0068854_100779783 | |||
| 1903 | Ga0068856_100016100 | |||
| 1904 | Ga0068856_100768637 | |||
| 1905 | Ga0068852_100045673 | |||
| 1906 | Ga0068852_100049791 | |||
| 1907 | Ga0068852_100113902 | |||
| 1908 | Ga0068852_100286449 | |||
| 1909 | Ga0068852_100704958 | |||
| 1910 | Ga0068859_100011168 | |||
| 1911 | Ga0068859_100014157 | |||
| 1912 | Ga0068859_100071933 | |||
| 1913 | Ga0068859_100233165 | |||
| 1914 | Ga0068864_100006939 | |||
| 1915 | Ga0068864_100014348 | |||
| 1916 | Ga0068864_100020963 | |||
| 1917 | Ga0068864_100035586 | |||
| 1918 | Ga0068866_10176571 | |||
| 1919 | Ga0068861_100001967 | |||
| 1920 | Ga0068861_100098554 | |||
| 1921 | Ga0068861_100099116 | |||
| 1922 | Ga0068861_101011004 | |||
| 1923 | Ga0068851_10015815 | |||
| 1924 | Ga0068851_10065197 | |||
| 1925 | Ga0068851_10209105 | |||
| 1926 | Ga0068870_10027147 | |||
| 1927 | Ga0068870_10124361 | |||
| 1928 | Ga0068863_100012433 | |||
| 1929 | Ga0068863_100037327 | |||
| 1930 | Ga0068863_100151663 | |||
| 1931 | Ga0068863_100241408 | |||
| 1932 | Ga0068863_100276828 | |||
| 1933 | Ga0068863_100278780 | |||
| 1934 | Ga0068863_100336788 | |||
| 1935 | Ga0068863_100500118 | |||
| 1936 | Ga0068863_100518383 | |||
| 1937 | Ga0068863_100623364 | |||
| 1938 | Ga0068858_100139654 | |||
| 1939 | Ga0068858_100485410 | |||
| 1940 | Ga0068860_100014126 | |||
| 1941 | Ga0068860_100018457 | |||
| 1942 | Ga0068860_100230298 | |||
| 1943 | Ga0068860_100272470 | |||
| 1944 | Ga0068860_100275885 | |||
| 1945 | Ga0068860_100408596 | |||
| 1946 | Ga0068862_100015603 | |||
| 1947 | Ga0068862_100073069 | |||
| 1948 | Ga0075363_100279879 | |||
| 1949 | Ga0075364_10320929 | |||
| 1950 | Ga0075364_10426602 | |||
| 1951 | Ga0075364_10570376 | |||
| 1952 | Ga0075432_10000316 | |||
| 1953 | Ga0075432_10103215 | |||
| 1954 | Ga0075362_10000923 | |||
| 1955 | Ga0075369_10119616 | |||
| 1956 | Ga0075366_10009494 | |||
| 1957 | Ga0097621_100386334 | |||
| 1958 | Ga0097621_100457433 | |||
| 1959 | Ga0097621_100516321 | |||
| 1960 | Ga0068871_100080037 | |||
| 1961 | Ga0068871_100829103 | |||
| 1962 | Ga0075428_100647354 | |||
| 1963 | Ga0075428_101084647 | |||
| 1964 | Ga0068865_100047329 | |||
| 1965 | Ga0068865_100227731 | |||
| 1966 | Ga0075436_100119814 | |||
| 1967 | Ga0097620_100011168 | |||
| 1968 | Ga0097620_100014159 | |||
| 1969 | Ga0097620_100071933 | |||
| 1970 | Ga0097620_100233177 | |||
| 1971 | Ga0079104_1021663 | |||
| 1972 | Ga0105251_10002617 | |||
| 1973 | Ga0105251_10004604 | |||
| 1974 | Ga0105251_10032844 | |||
| 1975 | Ga0105251_10056938 | |||
| 1976 | Ga0105244_10002401 | |||
| 1977 | Ga0105244_10120692 | |||
| 1978 | Ga0105244_10148471 | |||
| 1979 | Ga0105250_10000550 | |||
| 1980 | Ga0105250_10002212 | |||
| 1981 | Ga0105250_10026587 | |||
| 1982 | Ga0105250_10287560 | |||
| 1983 | Ga0105240_10001607 | |||
| 1984 | Ga0105240_10005342 | |||
| 1985 | Ga0105240_10017316 | |||
| 1986 | Ga0105240_10020280 | |||
| 1987 | Ga0105240_10023104 | |||
| 1988 | Ga0105240_10224191 | |||
| 1989 | Ga0105240_10322835 | |||
| 1990 | Ga0105240_10381595 | |||
| 1991 | Ga0105240_10405876 | |||
| 1992 | Ga0105240_10648266 | |||
| 1993 | Ga0105240_11392873 | |||
| 1994 | Ga0111539_10640115 | |||
| 1995 | Ga0105245_10257272 | |||
| 1996 | Ga0105245_10320485 | |||
| 1997 | Ga0105247_10018162 | |||
| 1998 | Ga0105247_10267118 | |||
| 1999 | Ga0105243_10001011 | |||
| 2000 | Ga0105243_10051347 | |||
| 2001 | Ga0105242_10358512 | |||
| 2002 | Ga0105242_10421815 | |||
| 2003 | Ga0105248_10257694 | |||
| 2004 | Ga0105248_10334437 | |||
| 2005 | Ga0105248_11132222 | |||
| 2006 | Ga0105237_10000036 | |||
| 2007 | Ga0105237_10000136 | |||
| 2008 | Ga0105237_10058621 | |||
| 2009 | Ga0105237_10188719 | |||
| 2010 | Ga0105238_10036529 | |||
| 2011 | Ga0105238_10261347 | |||
| 2012 | Ga0105238_10777598 | |||
| 2013 | Ga0105249_10096119 | |||
| 2014 | Ga0105239_10011357 | |||
| 2015 | Ga0105239_10061307 | |||
| 2016 | Ga0105246_10000322 | |||
| 2017 | Ga0105246_10002126 | |||
| 2018 | Ga0105246_10023561 | |||
| 2019 | Ga0105246_10567655 | |||
| 2020 | Ga0157345_1000091 | |||
| 2021 | Ga0157314_1000581 | |||
| 2022 | Ga0157347_1002954 | |||
| 2023 | Ga0157373_10000568 | |||
| 2024 | Ga0157373_10003664 | |||
| 2025 | Ga0157373_10009218 | |||
| 2026 | Ga0157373_10085097 | |||
| 2027 | Ga0157373_10113106 | |||
| 2028 | Ga0157373_10638965 | |||
| 2029 | Ga0157371_10016582 | |||
| 2030 | Ga0157371_10216135 | |||
| 2031 | Ga0157371_10377801 | |||
| 2032 | Ga0157370_10077206 | |||
| 2033 | Ga0157370_10281370 | |||
| 2034 | Ga0157370_10322545 | |||
| 2035 | Ga0157369_10001737 | |||
| 2036 | Ga0157369_10001978 | |||
| 2037 | Ga0157369_10025617 | |||
| 2038 | Ga0157369_10047946 | |||
| 2039 | Ga0157369_10147301 | |||
| 2040 | Ga0157369_10170224 | |||
| 2041 | Ga0157369_10255746 | |||
| 2042 | Ga0157369_10604876 | |||
| 2043 | Ga0157369_10646301 | |||
| 2044 | Ga0157369_10833279 | |||
| 2045 | Ga0157374_10000055 | |||
| 2046 | Ga0157374_10003393 | |||
| 2047 | Ga0157374_10388709 | |||
| 2048 | Ga0157378_10285618 | |||
| 2049 | Ga0163162_10083329 | |||
| 2050 | Ga0163162_10162708 | |||
| 2051 | Ga0163162_10258243 | |||
| 2052 | Ga0163162_10578767 | |||
| 2053 | Ga0157372_10001079 | |||
| 2054 | Ga0157372_10055049 | |||
| 2055 | Ga0157372_10131453 | |||
| 2056 | Ga0157372_10220879 | |||
| 2057 | Ga0157372_10437604 | |||
| 2058 | Ga0157372_10477804 | |||
| 2059 | Ga0157372_10527871 | |||
| 2060 | Ga0157372_10544429 | |||
| 2061 | Ga0157375_10007393 | |||
| 2062 | Ga0157375_10012489 | |||
| 2063 | Ga0157375_10106507 | |||
| 2064 | Ga0157375_10350854 | |||
| 2065 | Ga0157375_10699769 | |||
| 2066 | Ga0157375_11107539 | |||
| 2067 | Ga0163163_10012181 | |||
| 2068 | Ga0157380_10006526 | |||
| 2069 | Ga0157380_10125069 | |||
| 2070 | Ga0182008_10001995 | |||
| 2071 | Ga0182008_10009442 | |||
| 2072 | Ga0182008_10036444 | |||
| 2073 | Ga0182008_10038233 | |||
| 2074 | Ga0182008_10112878 | |||
| 2075 | Ga0157377_10395201 | |||
| 2076 | Ga0157379_10007766 | |||
| 2077 | Ga0157379_10126591 | |||
| 2078 | Ga0157376_10069963 | |||
| 2079 | Ga0157376_10111105 | |||
| 2080 | Ga0157376_10159234 | |||
| 2081 | Ga0157376_10918310 | |||
| 2082 | Ga0182006_1000967 | |||
| 2083 | Ga0182006_1002514 | |||
| 2084 | Ga0182006_1006793 | |||
| 2085 | Ga0182006_1009331 | |||
| 2086 | Ga0182006_1020584 | |||
| 2087 | Ga0182006_1104194 | |||
| 2088 | Ga0182006_1134970 | |||
| 2089 | Ga0182005_1000289 | |||
| 2090 | Ga0182005_1041459 | |||
| 2091 | Ga0182005_1042136 | |||
| 2092 | Ga0183365_10004 | |||
| 2093 | Ga0183368_1007 | |||
| 2094 | Ga0183360_11919 | |||
| 2095 | Ga0183363_1007 | |||
| 2096 | Ga0163161_10071262 | |||
| 2097 | Ga0163161_10087295 | |||
| 2098 | Ga0163161_10144012 | |||
| 2099 | Ga0163161_10160712 | |||
| 2100 | Ga0163161_10192938 | |||
| 2101 | Ga0163161_10599252 | |||
| 2102 | Ga0163161_10603799 | |||
| 2103 | Ga0163161_10784277 | |||
| 2104 | Ga0206356_11616746 | |||
| 2105 | Ga0206354_10931273 | |||
| 2106 | Ga0213872_10001316 | |||
| 2107 | Ga0213875_10023663 | |||
| 2108 | Ga0228598_1000332 | |||
| 2109 | Ga0209435_106429 | |||
| 2110 | Ga0209760_100340 | |||
| 2111 | Ga0209760_101173 | |||
| 2112 | Ga0209436_100301 | |||
| 2113 | Ga0209784_100049 | |||
| 2114 | Ga0209784_100164 | |||
| 2115 | Ga0209566_100061 | |||
| 2116 | Ga0209566_102109 | |||
| 2117 | Ga0209674_100069 | |||
| 2118 | Ga0209672_102388 | |||
| 2119 | Ga0209672_102751 | |||
| 2120 | Ga0209672_103395 | |||
| 2121 | Ga0209672_112054 | |||
| 2122 | Ga0209563_100083 | |||
| 2123 | Ga0207427_100084 | |||
| 2124 | Ga0207427_101954 | |||
| 2125 | Ga0207427_103135 | |||
| 2126 | Ga0209437_100037 | |||
| 2127 | Ga0209437_100091 | |||
| 2128 | Ga0209437_100924 | |||
| 2129 | Ga0209258_100034 | |||
| 2130 | Ga0209258_100071 | |||
| 2131 | Ga0209258_100459 | |||
| 2132 | Ga0209258_100792 | |||
| 2133 | Ga0209258_101200 | |||
| 2134 | Ga0209258_103464 | |||
| 2135 | Ga0209646_1000895 | |||
| 2136 | Ga0209646_1001788 | |||
| 2137 | Ga0209026_1000187 | |||
| 2138 | Ga0209026_1000223 | |||
| 2139 | Ga0209677_100039 | |||
| 2140 | Ga0209148_1000001 | |||
| 2141 | Ga0209148_1000002 | |||
| 2142 | Ga0209148_1004832 | |||
| 2143 | Ga0209759_1001491 | |||
| 2144 | Ga0209759_1001499 | |||
| 2145 | Ga0209759_1001939 | |||
| 2146 | Ga0209759_1003025 | |||
| 2147 | Ga0209759_1003373 | |||
| 2148 | Ga0209129_1002340 | |||
| 2149 | Ga0209233_1000002 | |||
| 2150 | Ga0209233_1000115 | |||
| 2151 | Ga0209233_1020535 | |||
| 2152 | Ga0209233_1023887 | |||
| 2153 | Ga0209565_1000009 | |||
| 2154 | Ga0209455_1000030 | |||
| 2155 | Ga0209455_1000054 | |||
| 2156 | Ga0209455_1000427 | |||
| 2157 | Ga0209455_1000628 | |||
| 2158 | Ga0209455_1003037 | |||
| 2159 | Ga0209673_1000036 | |||
| 2160 | Ga0209673_1007680 | |||
| 2161 | Ga0209130_1000044 | |||
| 2162 | Ga0209130_1000188 | |||
| 2163 | Ga0209130_1002498 | |||
| 2164 | Ga0209675_1000013 | |||
| 2165 | Ga0209675_1000078 | |||
| 2166 | Ga0209675_1007119 | |||
| 2167 | Ga0209676_1000121 | |||
| 2168 | Ga0209676_1000345 | |||
| 2169 | Ga0209676_1000440 | |||
| 2170 | Ga0209676_1004038 | |||
| 2171 | Ga0209025_1000051 | |||
| 2172 | Ga0209025_1038002 | |||
| 2173 | Ga0209564_1000122 | |||
| 2174 | Ga0209564_1000133 | |||
| 2175 | Ga0209564_1000202 | |||
| 2176 | Ga0209758_1001007 | |||
| 2177 | Ga0209758_1048733 | |||
| 2178 | Ga0209758_1066634 | |||
| 2179 | Ga0209050_1001731 | |||
| 2180 | Ga0209050_1002704 | |||
| 2181 | Ga0209256_1000106 | |||
| 2182 | Ga0209256_1001832 | |||
| 2183 | Ga0209256_1008649 | |||
| 2184 | Ga0209256_1010324 | |||
| 2185 | Ga0207426_1049454 | |||
| 2186 | Ga0209051_1000979 | |||
| 2187 | Ga0209051_1005522 | |||
| 2188 | Ga0209257_1000065 | |||
| 2189 | Ga0209257_1000121 | |||
| 2190 | Ga0209257_1000356 | |||
| 2191 | Ga0209257_1000452 | |||
| 2192 | Ga0209257_1001064 | |||
| 2193 | Ga0209257_1028082 | |||
| 2194 | Ga0209257_1068871 | |||
| 2195 | Ga0207697_10017549 | |||
| 2196 | Ga0207697_10038369 | |||
| 2197 | Ga0207656_10079257 | |||
| 2198 | Ga0207696_1000165 | |||
| 2199 | Ga0207696_1001780 | |||
| 2200 | Ga0207655_1000603 | |||
| 2201 | Ga0207655_1000772 | |||
| 2202 | Ga0207655_1003483 | |||
| 2203 | Ga0207655_1004427 | |||
| 2204 | Ga0207655_1012890 | |||
| 2205 | Ga0207655_1014595 | |||
| 2206 | Ga0207655_1029630 | |||
| 2207 | Ga0207713_1001400 | |||
| 2208 | Ga0207713_1003713 | |||
| 2209 | Ga0207713_1017174 | |||
| 2210 | Ga0207682_10001014 | |||
| 2211 | Ga0207682_10182826 | |||
| 2212 | Ga0207710_10017120 | |||
| 2213 | Ga0207680_10033556 | |||
| 2214 | Ga0207680_10036168 | |||
| 2215 | Ga0207680_10438600 | |||
| 2216 | Ga0207647_10002310 | |||
| 2217 | Ga0207647_10003842 | |||
| 2218 | Ga0207647_10005179 | |||
| 2219 | Ga0207645_10000428 | |||
| 2220 | Ga0207645_10018585 | |||
| 2221 | Ga0207645_10025328 | |||
| 2222 | Ga0207643_10028023 | |||
| 2223 | Ga0207643_10057340 | |||
| 2224 | Ga0207705_10171889 | |||
| 2225 | Ga0207705_10205601 | |||
| 2226 | Ga0207705_10220760 | |||
| 2227 | Ga0207705_10234864 | |||
| 2228 | Ga0207707_10052033 | |||
| 2229 | Ga0207707_10303155 | |||
| 2230 | Ga0207695_10001702 | |||
| 2231 | Ga0207695_10003515 | |||
| 2232 | Ga0207695_10007231 | |||
| 2233 | Ga0207695_10012415 | |||
| 2234 | Ga0207695_10021072 | |||
| 2235 | Ga0207695_10242701 | |||
| 2236 | Ga0207695_10313859 | |||
| 2237 | Ga0207671_10000059 | |||
| 2238 | Ga0207671_10000135 | |||
| 2239 | Ga0207671_10000713 | |||
| 2240 | Ga0207671_10004409 | |||
| 2241 | Ga0207671_10223289 | |||
| 2242 | Ga0207671_10269649 | |||
| 2243 | Ga0207660_10154998 | |||
| 2244 | Ga0207657_10009078 | |||
| 2245 | Ga0207657_10067795 | |||
| 2246 | Ga0207649_10000007 | |||
| 2247 | Ga0207649_10019952 | |||
| 2248 | Ga0207649_10123389 | |||
| 2249 | Ga0207649_10159895 | |||
| 2250 | Ga0207649_10213836 | |||
| 2251 | Ga0207649_10272468 | |||
| 2252 | Ga0207652_10530962 | |||
| 2253 | Ga0207681_10073391 | |||
| 2254 | Ga0207694_10042761 | |||
| 2255 | Ga0207650_10034174 | |||
| 2256 | Ga0207650_10124175 | |||
| 2257 | Ga0207650_10263864 | |||
| 2258 | Ga0207659_10131071 | |||
| 2259 | Ga0207687_10043694 | |||
| 2260 | Ga0207687_10186128 | |||
| 2261 | Ga0207700_10260945 | |||
| 2262 | Ga0207664_10044849 | |||
| 2263 | Ga0207664_10563071 | |||
| 2264 | Ga0207644_10070897 | |||
| 2265 | Ga0207644_10087503 | |||
| 2266 | Ga0207644_10323607 | |||
| 2267 | Ga0207690_10014282 | |||
| 2268 | Ga0207690_10096449 | |||
| 2269 | Ga0207706_10057627 | |||
| 2270 | Ga0207706_10094002 | |||
| 2271 | Ga0207706_10133108 | |||
| 2272 | Ga0207706_10138154 | |||
| 2273 | Ga0207706_10588517 | |||
| 2274 | Ga0207686_10001532 | |||
| 2275 | Ga0207686_10607395 | |||
| 2276 | Ga0207709_10065230 | |||
| 2277 | Ga0207670_10565835 | |||
| 2278 | Ga0207669_10544061 | |||
| 2279 | Ga0207704_10010676 | |||
| 2280 | Ga0207704_10115126 | |||
| 2281 | Ga0207691_10000127 | |||
| 2282 | Ga0207691_10004858 | |||
| 2283 | Ga0207691_10071976 | |||
| 2284 | Ga0207691_10133688 | |||
| 2285 | Ga0207691_10172497 | |||
| 2286 | Ga0207691_10234026 | |||
| 2287 | Ga0207689_10262507 | |||
| 2288 | Ga0207661_10003004 | |||
| 2289 | Ga0207661_10041845 | |||
| 2290 | Ga0207661_10091582 | |||
| 2291 | Ga0207661_10102213 | |||
| 2292 | Ga0207661_10227205 | |||
| 2293 | Ga0207679_10000013 | |||
| 2294 | Ga0207679_10007435 | |||
| 2295 | Ga0207679_10055251 | |||
| 2296 | Ga0207679_10153761 | |||
| 2297 | Ga0207679_10246545 | |||
| 2298 | Ga0207679_11229545 | |||
| 2299 | Ga0207667_10000292 | |||
| 2300 | Ga0207667_10000486 | |||
| 2301 | Ga0207667_10009358 | |||
| 2302 | Ga0207667_10055825 | |||
| 2303 | Ga0207667_10121940 | |||
| 2304 | Ga0207667_10471054 | |||
| 2305 | Ga0207651_10341407 | |||
| 2306 | Ga0207651_10452334 | |||
| 2307 | Ga0207668_10021890 | |||
| 2308 | Ga0207668_10122115 | |||
| 2309 | Ga0207668_10124149 | |||
| 2310 | Ga0207668_10223889 | |||
| 2311 | Ga0207668_10356560 | |||
| 2312 | Ga0207668_10469968 | |||
| 2313 | Ga0207668_10620511 | |||
| 2314 | Ga0207640_10000471 | |||
| 2315 | Ga0207640_10000670 | |||
| 2316 | Ga0207640_10018115 | |||
| 2317 | Ga0207640_10021026 | |||
| 2318 | Ga0207640_10053029 | |||
| 2319 | Ga0207640_10182581 | |||
| 2320 | Ga0207658_10044979 | |||
| 2321 | Ga0207658_10059775 | |||
| 2322 | Ga0207658_10065595 | |||
| 2323 | Ga0207658_10117646 | |||
| 2324 | Ga0207677_10026161 | |||
| 2325 | Ga0207677_10088036 | |||
| 2326 | Ga0207677_10892240 | |||
| 2327 | Ga0207703_10132703 | |||
| 2328 | Ga0207703_10536907 | |||
| 2329 | Ga0207703_10553092 | |||
| 2330 | Ga0207703_10931067 | |||
| 2331 | Ga0207639_10193654 | |||
| 2332 | Ga0207678_10000969 | |||
| 2333 | Ga0207678_10032281 | |||
| 2334 | Ga0207678_10143379 | |||
| 2335 | Ga0207678_10145112 | |||
| 2336 | Ga0207678_10724564 | |||
| 2337 | Ga0207708_10235273 | |||
| 2338 | Ga0207702_11166583 | |||
| 2339 | Ga0207641_10049260 | |||
| 2340 | Ga0207641_10173981 | |||
| 2341 | Ga0207641_10265698 | |||
| 2342 | Ga0207641_10323837 | |||
| 2343 | Ga0207641_10331629 | |||
| 2344 | Ga0207641_10346093 | |||
| 2345 | Ga0207641_10365360 | |||
| 2346 | Ga0207641_10877082 | |||
| 2347 | Ga0207641_11113180 | |||
| 2348 | Ga0207648_10004283 | |||
| 2349 | Ga0207648_10011720 | |||
| 2350 | Ga0207648_10023017 | |||
| 2351 | Ga0207648_10265180 | |||
| 2352 | Ga0207676_10032072 | |||
| 2353 | Ga0207676_10048307 | |||
| 2354 | Ga0207676_10170681 | |||
| 2355 | Ga0207674_10000298 | |||
| 2356 | Ga0207674_10010196 | |||
| 2357 | Ga0207674_10011014 | |||
| 2358 | Ga0207674_10155541 | |||
| 2359 | Ga0207675_100012815 | |||
| 2360 | Ga0207675_100029062 | |||
| 2361 | Ga0207675_100075242 | |||
| 2362 | Ga0207675_100162337 | |||
| 2363 | Ga0207675_100862005 | |||
| 2364 | Ga0207683_10000009 | |||
| 2365 | Ga0207698_10008277 | |||
| 2366 | Ga0207698_10019529 | |||
| 2367 | Ga0207698_10046054 | |||
| 2368 | Ga0207698_10140636 | |||
| 2369 | Ga0207698_10215874 | |||
| 2370 | Ga0207698_10388092 | |||
| 2371 | Ga0207698_10711551 | |||
| 2372 | Ga0209281_1013031 | |||
| 2373 | Ga0209371_1000023 | |||
| 2374 | Ga0207428_10015977 | |||
| 2375 | Ga0207428_10203634 | |||
| 2376 | Ga0268266_10005005 | |||
| 2377 | Ga0268266_10060827 | |||
| 2378 | Ga0268266_10172820 | |||
| 2379 | Ga0268266_10297171 | |||
| 2380 | Ga0268266_10922761 | |||
| 2381 | Ga0268266_11010465 | |||
| 2382 | Ga0268265_10289752 | |||
| 2383 | Ga0268264_10058224 | |||
| 2384 | Ga0268264_10070210 | |||
| 2385 | Ga0268264_10081212 | |||
| 2386 | Ga0268264_10643278 | |||
| 2387 | Ga0268264_10678496 | |||
| 2388 | Ga0307517_10005849 | |||
| 2389 | Ga0307517_10010226 | |||
| 2390 | Ga0307517_10104066 | |||
| 2391 | Ga0307517_10217316 | |||
| 2392 | Ga0307515_10013824 | |||
| 2393 | Ga0307515_10133079 | |||
| 2394 | Ga0265338_10000118 | |||
| 2395 | Ga0268256_1000023 | |||
| 2396 | Ga0268256_1000050 | |||
| 2397 | Ga0316177_1104169 | |||
| 2398 | Ga0316181_1003769 | |||
| 2399 | Ga0265332_10020812 | |||
| 2400 | Ga0265340_10063801 | |||
| 2401 | Ga0265316_10205203 | |||
| 2402 | Ga0307513_10020408 | |||
| 2403 | Ga0307513_10052805 | |||
| 2404 | Ga0307513_10086379 | |||
| 2405 | Ga0307513_10117764 | |||
| 2406 | Ga0307513_10138965 | |||
| 2407 | Ga0307513_10350485 | |||
| 2408 | Ga0307509_10000052 | |||
| 2409 | Ga0307509_10003622 | |||
| 2410 | Ga0307509_10023567 | |||
| 2411 | Ga0307509_10034645 | |||
| 2412 | Ga0307509_10067060 | |||
| 2413 | Ga0307509_10147362 | |||
| 2414 | Ga0307408_100000194 | |||
| 2415 | Ga0307408_100020906 | |||
| 2416 | Ga0307408_100100941 | |||
| 2417 | Ga0307408_100190230 | |||
| 2418 | Ga0307508_10002365 | |||
| 2419 | Ga0307508_10442277 | |||
| 2420 | Ga0307508_10481723 | |||
| 2421 | Ga0307514_10012360 | |||
| 2422 | Ga0307516_10007666 | |||
| 2423 | Ga0307516_10063274 | |||
| 2424 | Ga0307516_10134536 | |||
| 2425 | Ga0307516_10167955 | |||
| 2426 | Ga0307516_10251391 | |||
| 2427 | Ga0307516_10653191 | |||
| 2428 | Ga0307405_10164241 | |||
| 2429 | Ga0307405_10301078 | |||
| 2430 | Ga0307413_10025015 | |||
| 2431 | Ga0307413_10226532 | |||
| 2432 | Ga0307410_10080021 | |||
| 2433 | Ga0307410_10306209 | |||
| 2434 | Ga0307406_10130772 | |||
| 2435 | Ga0307406_10539633 | |||
| 2436 | Ga0307407_10005761 | |||
| 2437 | Ga0307407_10133122 | |||
| 2438 | Ga0307412_10047860 | |||
| 2439 | Ga0307409_100037068 | |||
| 2440 | Ga0307409_100075501 | |||
| 2441 | Ga0307409_100207555 | |||
| 2442 | Ga0307409_100536681 | |||
| 2443 | Ga0307416_100019933 | |||
| 2444 | Ga0307416_100068548 | |||
| 2445 | Ga0307416_100307980 | |||
| 2446 | Ga0307414_10112044 | |||
| 2447 | Ga0307414_10236516 | |||
| 2448 | Ga0307414_10510780 | |||
| 2449 | Ga0307507_10092396 | |||
| 2450 | Ga0307507_10117726 | |||
| 2451 | Ga0307510_10000118 | |||
| 2452 | Ga0307510_10014576 | |||
| 2453 | Ga0307510_10088730 | |||
| 2454 | Ga0307510_10120543 | |||
| 2455 | Ga0307510_10145502 | |||
| 2456 | Ga0307510_10184103 | |||
| 2457 | Ga0373940_0087971 | |||
| 2458 | Ga0373951_0081722 | |||
| 2459 | Ga0373932_0054478 | |||
| 2460 | Ga0373931_0072019 | |||
| 2461 | Ga0373931_0239671 | |||
| 2462 | Ga0373947_0163753 | |||
| 2463 | Ga0373947_0420280 | |||
| 2464 | Ga0373947_0721919 | |||
| 2465 | Ga0373937_0025086 | |||
| 2466 | Ga0373937_0341074 | |||
| 2467 | Ga0373925_0212396 | |||
| 2468 | Ga0373925_0254489 | |||
| 2469 | Ga0395899_0000012 | |||
| 2470 | Ga0395899_0005005 | |||
| 2471 | Ga0395899_0010317 | |||
| 2472 | Ga0395899_0012450 | |||
| 2473 | Ga0395899_0195356 | |||
| 2474 | Ga0395900_0002549 | |||
| 2475 | Ga0395900_0006267 | |||
| 2476 | Ga0395900_0092457 | |||
| 2477 | Ga0395900_0124178 | |||
| 2478 | Ga0395898_0005884 | |||
| 2479 | Ga0395898_0110701 | |||
| 2480 | Ga0395898_0508189 | |||
| 2481 | Ga0395898_0626058 | |||
| 2482 | Ga0395905_0000136 | |||
| 2483 | Ga0395905_0001886 | |||
| 2484 | Ga0395905_0055632 | |||
| 2485 | Ga0395905_0147935 | |||
| 2486 | Ga0436364_0034966 | |||
| 2487 | Ga0436364_0389486 | |||
| 2488 | Ga0436364_0471363 | |||
| 2489 | Ga0436364_1529296 | |||
| 2490 | Ga0395901_0001400 | |||
| 2491 | Ga0395901_0003633 | |||
| 2492 | Ga0395901_0003670 | |||
| 2493 | Ga0395901_0630531 | |||
| 2494 | Ga0237819_00624 | |||
| 2495 | Ga0237819_07641 | |||
| 2496 | Ga0400483_000346 | |||
| 2497 | Ga0400483_020937 | |||
| 2498 | Ga0400483_095196 | |||
| 2499 | Ga0400483_163079 | |||
| 2500 | Ga0400483_171786 | |||
| 2501 | Ga0400483_248084 | |||
| 2502 | Ga0400483_248289 | |||
| 2503 | Ga0436361_0821396 | |||
| 2504 | Ga0436362_0202120 | |||
| 2505 | Ga0439438_004655 | |||
| 2506 | Ga0439447_002799 | |||
| 2507 | Ga0439466_0004451 | |||
| 2508 | Ga0439431_0010973 | |||
| 2509 | Ga0439448_0023985 | |||
| 2510 | Ga0439432_016961 | |||
| 2511 | Ga0439449_0065883 | |||
| 2512 | Ga0439451_000445 | |||
| 2513 | Ga0439451_004420 | |||
| 2514 | Ga0439452_000485 | |||
| 2515 | Ga0439452_019785 | |||
| 2516 | Ga0439462_0032484 | |||
| 2517 | Ga0439463_002054 | |||
| 2518 | Ga0439463_025189 | |||
| 2519 | Ga0439463_057533 | |||
| 2520 | Ga0450911_001553 | |||
| 2521 | Ga0450911_003577 | |||
| 2522 | Ga0450913_008653 | |||
| 2523 | Ga0450890_000729 | |||
| 2524 | Ga0450891_003745 | |||
| 2525 | Ga0450903_014414 | |||
| 2526 | Ga0450907_009459 | |||
| 2527 | Ga0439446_0087263 | |||
| 2528 | Ga0439446_0169028 | |||
| 2529 | Ga0439435_0112338 | |||
| 2530 | Ga0439464_0004285 | |||
| 2531 | Ga0439460_0004154 | |||
| 2532 | Ga0451577_0000561 | |||
| 2533 | Ga0466969_0002544 | |||
| 2534 | Ga0466969_0017277 | |||
| 2535 | Ga0466969_0034736 | |||
| 2536 | Ga0466972_0062241 | |||
| 2537 | Ga0466972_0137285 | |||
| 2538 | Ga0466982_0000044 | |||
| 2539 | Ga0466965_0016690 | |||
| 2540 | Ga0466966_0000701 | |||
| 2541 | Ga0466966_0002676 | |||
| 2542 | Ga0466961_0002712 | |||
| 2543 | Ga0466961_0003965 | |||
| 2544 | Ga0466961_0070693 | |||
| 2545 | Ga0466963_0240141 | |||
| 2546 | Ga0466964_0022707 | |||
| 2547 | Ga0466964_0052165 | |||
| 2548 | Ga0453684_0532631 | |||
| 2549 | Ga0466971_0004296 | |||
| 2550 | Ga0466971_0090701 | |||
| 2551 | Ga0466971_0210867 | |||
| 2552 | Ga0466968_0008215 | |||
| 2553 | Ga0466968_0068779 | |||
| 2554 | Ga0466970_0003084 | |||
| 2555 | Ga0466970_0013349 | |||
| 2556 | Ga0466970_0179059 | |||
| 2557 | Ga0466970_0381209 | |||
| 2558 | Ga0466957_0004013 | |||
| 2559 | Ga0466960_0030336 | |||
| 2560 | Ga0466959_0000100 | |||
| 2561 | Ga0466959_0020575 | |||
| 2562 | Ga0466959_0139992 | |||
| 2563 | Ga0466959_0167906 | |||
| 2564 | Ga0466959_0288700 | |||
| 2565 | Ga0466959_0436775 | |||
| 2566 | Ga0451576_0097798 | |||
| 2567 | Ga0451576_0132455 | |||
| 2568 | Ga0451576_0220133 | |||
| 2569 | Ga0466958_0006453 | |||
| 2570 | Ga0466958_0287134 | |||
| 2571 | Ga0466967_0111240 | |||
| 2572 | Ga0466967_0205699 | |||
| 2573 | Ga0466967_0356071 | |||
| 2574 | Ga0495617_086552 | |||
| 2575 | Ga0495617_093614 | |||
| 2576 | Ga0495627_002371 | |||
| 2577 | Ga0495627_003650 | |||
| 2578 | Ga0495627_004572 | |||
| 2579 | Ga0495592_0000142 | |||
| 2580 | Ga0495592_0140582 | |||
| 2581 | Ga0495592_0435252 | |||
| 2582 | Ga0495603_0090152 | |||
| 2583 | Ga0495590_0053594 | |||
| 2584 | Ga0495590_0075190 | |||
| 2585 | Ga0495591_000037 | |||
| 2586 | Ga0495591_000960 | |||
| 2587 | Ga0495591_001346 | |||
| 2588 | Ga0495591_001506 | |||
| 2589 | Ga0495591_001756 | |||
| 2590 | Ga0495591_002170 | |||
| 2591 | Ga0495591_002395 | |||
| 2592 | Ga0495591_007687 | |||
| 2593 | Ga0495591_047522 | |||
| 2594 | Ga0495629_0309896 | |||
| 2595 | Ga0495638_0000048 | |||
| 2596 | Ga0495638_0000116 | |||
| 2597 | Ga0495638_0000609 | |||
| 2598 | Ga0495638_0004826 | |||
| 2599 | Ga0495638_0005132 | |||
| 2600 | Ga0495638_0005434 | |||
| 2601 | Ga0495638_0006182 | |||
| 2602 | Ga0495638_0006896 | |||
| 2603 | Ga0495638_0009403 | |||
| 2604 | Ga0495638_0014627 | |||
| 2605 | Ga0495638_0051434 | |||
| 2606 | Ga0495638_0065460 | |||
| 2607 | Ga0495638_0089304 | |||
| 2608 | Ga0495638_0175133 | |||
| 2609 | Ga0495651_0001526 | |||
| 2610 | Ga0495651_0017466 | |||
| 2611 | Ga0495653_0010928 | |||
| 2612 | Ga0495653_0046847 | |||
| 2613 | Ga0495653_0207640 | |||
| 2614 | Ga0495650_0000064 | |||
| 2615 | Ga0495650_0000174 | |||
| 2616 | Ga0495650_0001163 | |||
| 2617 | Ga0495650_0005976 | |||
| 2618 | Ga0495650_0011700 | |||
| 2619 | Ga0495582_0028785 | |||
| 2620 | Ga0495605_0000036 | |||
| 2621 | Ga0495605_0000849 | |||
| 2622 | Ga0495605_0002810 | |||
| 2623 | Ga0495605_0013595 | |||
| 2624 | Ga0495605_0019669 | |||
| 2625 | Ga0495605_0033210 | |||
| 2626 | Ga0495605_0069943 | |||
| 2627 | Ga0495639_0037023 | |||
| 2628 | Ga0495639_0063650 | |||
| 2629 | Ga0495664_0355824 | |||
| 2630 | Ga0495584_0002037 | |||
| 2631 | Ga0495584_0003914 | |||
| 2632 | Ga0495584_0019260 | |||
| 2633 | Ga0495584_0048988 | |||
| 2634 | Ga0495584_0095941 | |||
| 2635 | Ga0495584_0212467 | |||
| 2636 | Ga0495585_0002685 | |||
| 2637 | Ga0495585_0013417 | |||
| 2638 | Ga0495585_0192600 | |||
| 2639 | Ga0495594_0001898 | |||
| 2640 | Ga0495594_0067344 | |||
| 2641 | Ga0495596_0003157 | |||
| 2642 | Ga0495607_0000149 | |||
| 2643 | Ga0495607_0001076 | |||
| 2644 | Ga0495607_0001283 | |||
| 2645 | Ga0495607_0001388 | |||
| 2646 | Ga0495607_0009553 | |||
| 2647 | Ga0495607_0018552 | |||
| 2648 | Ga0495607_0021322 | |||
| 2649 | Ga0495607_0040702 | |||
| 2650 | Ga0495607_0060814 | |||
| 2651 | Ga0495607_0061381 | |||
| 2652 | Ga0495607_0061828 | |||
| 2653 | Ga0495607_0112849 | |||
| 2654 | Ga0495607_0189239 | |||
| 2655 | Ga0495607_0190950 | |||
| 2656 | Ga0495583_0000028 | |||
| 2657 | Ga0495583_0000271 | |||
| 2658 | Ga0495583_0003346 | |||
| 2659 | Ga0495583_0003399 | |||
| 2660 | Ga0495583_0004619 | |||
| 2661 | Ga0495583_0005967 | |||
| 2662 | Ga0495583_0007992 | |||
| 2663 | Ga0495583_0017345 | |||
| 2664 | Ga0495583_0091190 | |||
| 2665 | Ga0495606_0000042 | |||
| 2666 | Ga0495606_0000094 | |||
| 2667 | Ga0495606_0000415 | |||
| 2668 | Ga0495606_0004342 | |||
| 2669 | Ga0495606_0006710 | |||
| 2670 | Ga0495606_0010458 | |||
| 2671 | Ga0495606_0014490 | |||
| 2672 | Ga0495606_0024275 | |||
| 2673 | Ga0495606_0036664 | |||
| 2674 | Ga0495606_0039111 | |||
| 2675 | Ga0495606_0052325 | |||
| 2676 | Ga0495606_0088236 | |||
| 2677 | Ga0495606_0169291 | |||
| 2678 | Ga0495608_0014841 | |||
| 2679 | Ga0495608_0214098 | |||
| 2680 | Ga0495610_0002926 | |||
| 2681 | Ga0495610_0011761 | |||
| 2682 | Ga0495610_0019341 | |||
| 2683 | Ga0495610_0021121 | |||
| 2684 | Ga0495610_0026266 | |||
| 2685 | Ga0495610_0034583 | |||
| 2686 | Ga0495610_0053459 | |||
| 2687 | Ga0495610_0083878 | |||
| 2688 | Ga0495610_0132491 | |||
| 2689 | Ga0495616_0006962 | |||
| 2690 | Ga0495616_0013952 | |||
| 2691 | Ga0495616_0049861 | |||
| 2692 | Ga0495616_0257611 | |||
| 2693 | Ga0495618_0117375 | |||
| 2694 | Ga0495618_0489653 | |||
| 2695 | Ga0495620_0000322 | |||
| 2696 | Ga0495620_0000370 | |||
| 2697 | Ga0495620_0000712 | |||
| 2698 | Ga0495620_0004434 | |||
| 2699 | Ga0495620_0015211 | |||
| 2700 | Ga0495620_0029580 | |||
| 2701 | Ga0495620_0041274 | |||
| 2702 | Ga0495620_0073965 | |||
| 2703 | Ga0495620_0120267 | |||
| 2704 | Ga0495628_0019455 | |||
| 2705 | Ga0495628_0023111 | |||
| 2706 | Ga0495628_0043863 | |||
| 2707 | Ga0495630_0302918 | |||
| 2708 | Ga0495630_0343695 | |||
| 2709 | Ga0495631_0009296 | |||
| 2710 | Ga0495631_0013326 | |||
| 2711 | Ga0495631_0058600 | |||
| 2712 | Ga0495631_0077096 | |||
| 2713 | Ga0495632_0000839 | |||
| 2714 | Ga0495632_0002490 | |||
| 2715 | Ga0495632_0003654 | |||
| 2716 | Ga0495632_0007029 | |||
| 2717 | Ga0495632_0017521 | |||
| 2718 | Ga0495632_0068575 | |||
| 2719 | Ga0495632_0076860 | |||
| 2720 | Ga0495632_0112566 | |||
| 2721 | Ga0495632_0244946 | |||
| 2722 | Ga0495637_0000518 | |||
| 2723 | Ga0495637_0002120 | |||
| 2724 | Ga0495637_0002498 | |||
| 2725 | Ga0495637_0006632 | |||
| 2726 | Ga0495637_0011157 | |||
| 2727 | Ga0495637_0013035 | |||
| 2728 | Ga0495637_0054447 | |||
| 2729 | Ga0495637_0090531 | |||
| 2730 | Ga0495637_0098999 | |||
| 2731 | Ga0495643_0001985 | |||
| 2732 | Ga0495643_0027906 | |||
| 2733 | Ga0495643_0072791 | |||
| 2734 | Ga0495643_0228252 | |||
| 2735 | Ga0495643_0273125 | |||
| 2736 | Ga0495644_0003319 | |||
| 2737 | Ga0495644_0022555 | |||
| 2738 | Ga0495648_0003291 | |||
| 2739 | Ga0495648_0009523 | |||
| 2740 | Ga0495648_0012087 | |||
| 2741 | Ga0495648_0015690 | |||
| 2742 | Ga0495648_0021890 | |||
| 2743 | Ga0495648_0021980 | |||
| 2744 | Ga0495648_0034583 | |||
| 2745 | Ga0495648_0085577 | |||
| 2746 | Ga0495648_0328987 | |||
| 2747 | Ga0495663_0037378 | |||
| 2748 | Ga0495666_0002123 | |||
| 2749 | Ga0495666_0015904 | |||
| 2750 | Ga0495642_0001683 | |||
| 2751 | Ga0495652_0003383 | |||
| 2752 | Ga0495652_0014655 | |||
| 2753 | Ga0495652_0018360 | |||
| 2754 | Ga0495652_0062372 | |||
| 2755 | Ga0495654_0009795 | |||
| 2756 | Ga0495654_0010614 | |||
| 2757 | Ga0495654_0010779 | |||
| 2758 | Ga0495654_0018508 | |||
| 2759 | Ga0495654_0027630 | |||
| 2760 | Ga0495654_0045750 | |||
| 2761 | Ga0495654_0054388 | |||
| 2762 | Ga0495654_0138228 | |||
| 2763 | Ga0495586_0090429 | |||
| 2764 | Ga0495587_0096907 | |||
| 2765 | Ga0495609_0000115 | |||
| 2766 | Ga0495609_0000395 | |||
| 2767 | Ga0495609_0001220 | |||
| 2768 | Ga0495609_0027036 | |||
| 2769 | Ga0495609_0089017 | |||
| 2770 | Ga0495609_0104390 | |||
| 2771 | Ga0495597_0001034 | |||
| 2772 | Ga0495597_0003290 | |||
| 2773 | Ga0495597_0009290 | |||
| 2774 | Ga0495597_0038735 | |||
| 2775 | Ga0495645_0041759 | |||
| 2776 | Ga0495645_0146948 | |||
| 2777 | Ga0495645_0234638 | |||
| 2778 | Ga0495622_0001521 | |||
| 2779 | Ga0495622_0010711 | |||
| 2780 | Ga0495622_0015667 | |||
| 2781 | Ga0495633_0001693 | |||
| 2782 | Ga0495633_0003880 | |||
| 2783 | Ga0495633_0018744 | |||
| 2784 | Ga0495633_0104180 | |||
| 2785 | Ga0495668_0000025 | |||
| 2786 | Ga0495668_0000034 | |||
| 2787 | Ga0495668_0003196 | |||
| 2788 | Ga0495668_0018558 | |||
| 2789 | Ga0495668_0045515 | |||
| 2790 | Ga0495611_0000736 | |||
| 2791 | Ga0495611_0000932 | |||
| 2792 | Ga0495611_0004344 | |||
| 2793 | Ga0495611_0011566 | |||
| 2794 | Ga0495611_0118484 | |||
| 2795 | Ga0495625_0000672 | |||
| 2796 | Ga0495625_0001328 | |||
| 2797 | Ga0495625_0002338 | |||
| 2798 | Ga0495625_0003330 | |||
| 2799 | Ga0495625_0007862 | |||
| 2800 | Ga0495625_0013918 | |||
| 2801 | Ga0495625_0015980 | |||
| 2802 | Ga0495625_0029666 | |||
| 2803 | Ga0495625_0034457 | |||
| 2804 | Ga0495625_0058185 | |||
| 2805 | Ga0495625_0125368 | |||
| 2806 | Ga0495625_0327292 | |||
| 2807 | Ga0495635_0142949 | |||
| 2808 | Ga0495659_0003001 | |||
| 2809 | Ga0495661_0000205 | |||
| 2810 | Ga0495661_0000437 | |||
| 2811 | Ga0495661_0000685 | |||
| 2812 | Ga0495661_0001817 | |||
| 2813 | Ga0495661_0015865 | |||
| 2814 | Ga0495661_0021833 | |||
| 2815 | Ga0495661_0030083 | |||
| 2816 | Ga0495661_0050094 | |||
| 2817 | Ga0495661_0117772 | |||
| 2818 | Ga0495661_0170983 | |||
| 2819 | Ga0495588_0386856 | |||
| 2820 | Ga0495657_0078730 | |||
| 2821 | Ga0495657_0169271 | |||
| 2822 | Ga0495599_0065919 | |||
| 2823 | Ga0495599_0092568 | |||
| 2824 | Ga0495623_0006272 | |||
| 2825 | Ga0495623_0011011 | |||
| 2826 | Ga0495623_0117161 | |||
| 2827 | Ga0495646_0031113 | |||
| 2828 | Ga0495646_0167151 | |||
| 2829 | Ga0495669_0005645 | |||
| 2830 | Ga0495624_0008471 | |||
| 2831 | Ga0495624_0008919 | |||
| 2832 | Ga0495624_0090273 | |||
| 2833 | Ga0495624_0205268 | |||
| 2834 | Ga0495670_0007244 | |||
| 2835 | Ga0495670_0037571 | |||
| 2836 | Ga0495670_0149284 | |||
| 2837 | Ga0495671_0003674 | |||
| 2838 | Ga0495671_0004465 | |||
| 2839 | Ga0495671_0004983 | |||
| 2840 | Ga0495671_0007822 | |||
| 2841 | Ga0495671_0015205 | |||
| 2842 | Ga0495671_0015406 | |||
| 2843 | Ga0495671_0034356 | |||
| 2844 | Ga0495671_0104254 | |||
| 2845 | Ga0495671_0115800 | |||
| 2846 | Ga0495671_0121301 | |||
| 2847 | Ga0495649_0000813 | |||
| 2848 | Ga0495649_0001962 | |||
| 2849 | Ga0495649_0011895 | |||
| 2850 | Ga0495649_0023047 | |||
| 2851 | Ga0495649_0047497 | |||
| 2852 | Ga0495649_0055434 | |||
| 2853 | Ga0495649_0070460 | |||
| 2854 | Ga0495649_0084108 | |||
| 2855 | Ga0495649_0098503 | |||
| 2856 | Ga0495649_0211595 | |||
| 2857 | Ga0495649_0358682 | |||
| 2858 | Ga0495589_0003822 | |||
| 2859 | Ga0495589_0006874 | |||
| 2860 | Ga0495589_0009064 | |||
| 2861 | Ga0495600_0005056 | |||
| 2862 | Ga0495600_0022072 | |||
| 2863 | Ga0495600_0115827 | |||
| 2864 | Ga0495600_0447738 | |||
| 2865 | Ga0495660_0001767 | |||
| 2866 | Ga0495660_0002709 | |||
| 2867 | Ga0495660_0003160 | |||
| 2868 | Ga0495660_0006768 | |||
| 2869 | Ga0495660_0011688 | |||
| 2870 | Ga0495660_0028243 | |||
| 2871 | Ga0495660_0043308 | |||
| 2872 | Ga0495660_0079486 | |||
| 2873 | Ga0495660_0093520 | |||
| 2874 | Ga0495660_0093707 | |||
| 2875 | Ga0495660_0187273 | |||
| 2876 | Ga0495660_0251164 | |||
| 2877 | Ga0495604_0015148 | |||
| 2878 | Ga0495636_0002862 | |||
| 2879 | Ga0495674_0371631 | |||
| 2880 | Ga0495674_0752674 | |||
| 2881 | Ga0495672_0003648 | |||
| 2882 | Ga0495672_0008206 | |||
| 2883 | Ga0495672_0008237 | |||
| 2884 | Ga0495672_0012356 | |||
| 2885 | Ga0495672_0029446 | |||
| 2886 | Ga0495672_0029976 | |||
| 2887 | Ga0495672_0035502 | |||
| 2888 | Ga0495672_0044459 | |||
| 2889 | Ga0495672_0085170 | |||
| 2890 | Ga0495676_0000171 | |||
| 2891 | Ga0495676_0005618 | |||
| 2892 | Ga0495676_0019092 | |||
| 2893 | Ga0495676_0287743 | |||
| 2894 | Ga0495680_0013577 | |||
| 2895 | Ga0495680_0195899 | |||
| 2896 | Ga0495680_0245429 | |||
| 2897 | Ga0495680_0590021 | |||
| 2898 | Ga0495683_0000507 | |||
| 2899 | Ga0495683_0002187 | |||
| 2900 | Ga0495683_0004452 | |||
| 2901 | Ga0495683_0060803 | |||
| 2902 | Ga0495683_0112566 | |||
| 2903 | Ga0495687_014652 | |||
| 2904 | Ga0495675_0160520 | |||
| 2905 | Ga0495679_000119 | |||
| 2906 | Ga0495679_000616 | |||
| 2907 | Ga0495679_005316 | |||
| 2908 | Ga0495679_005487 | |||
| 2909 | Ga0495679_011231 | |||
| 2910 | Ga0495673_0002146 | |||
| 2911 | Ga0495673_0003396 | |||
| 2912 | Ga0495673_0004684 | |||
| 2913 | Ga0495673_0006738 | |||
| 2914 | Ga0495673_0014086 | |||
| 2915 | Ga0495673_0015086 | |||
| 2916 | Ga0495673_0016949 | |||
| 2917 | Ga0495673_0021460 | |||
| 2918 | Ga0495673_0032777 | |||
| 2919 | Ga0495673_0071120 | |||
| 2920 | Ga0495673_0087608 | |||
| 2921 | Ga0495673_0092902 | |||
| 2922 | Ga0495673_0106155 | |||
| 2923 | Ga0495681_0006275 | |||
| 2924 | Ga0495681_0007039 | |||
| 2925 | Ga0495681_0011334 | |||
| 2926 | Ga0495681_0016651 | |||
| 2927 | Ga0495681_0018332 | |||
| 2928 | Ga0495681_0021522 | |||
| 2929 | Ga0495681_0022687 | |||
| 2930 | Ga0495681_0028069 | |||
| 2931 | Ga0495681_0106035 | |||
| 2932 | Ga0495684_0239586 | |||
| 2933 | Ga0495686_0004625 | |||
| 2934 | Ga0495686_0013186 | |||
| 2935 | Ga0495686_0049354 | |||
| 2936 | Ga0495686_0145655 | |||
| 2937 | Ga0495686_0150339 | |||
| 2938 | Ga0495686_0350079 | |||
| 2939 | Ga0495593_0005528 | |||
| 2940 | Ga0495593_0036138 | |||
| 2941 | Ga0495602_0035542 | |||
| 2942 | Ga0495602_0052798 | |||
| 2943 | Ga0495602_0189543 | |||
| 2944 | Ga0495602_0339293 | |||
| 2945 | Ga0495602_0502137 | |||
| 2946 | Ga0495626_0000123 | |||
| 2947 | Ga0495626_0003485 | |||
| 2948 | Ga0495626_0009762 | |||
| 2949 | Ga0495626_0040937 | |||
| 2950 | Ga0495626_0052685 | |||
| 2951 | Ga0495626_0055747 | |||
| 2952 | Ga0496100_0481852 | |||
| 2953 | Ga0496101_0540725 | |||
| 2954 | Ga0496102_0062552 | |||
| 2955 | Ga0496102_0296561 | |||
| 2956 | Ga0496103_0077612 | |||
| 2957 | Ga0496106_0265042 | |||
| 2958 | Ga0496108_0358924 | |||
| 2959 | Ga0496108_0382610 | |||
| 2960 | Ga0496110_0229455 | |||
| 2961 | Ga0496110_0270918 | |||
| 2962 | Ga0496112_0001839 | |||
| 2963 | Ga0496112_0043323 | |||
| 2964 | Ga0496112_0526048 | |||
| 2965 | Ga0496113_0021787 | |||
| 2966 | Ga0496113_0031793 | |||
| 2967 | Ga0496113_0156192 | |||
| 2968 | Ga0496114_0205139 | |||
| 2969 | Ga0496115_0000272 | |||
| 2970 | Ga0496115_0000603 | |||
| 2971 | Ga0496115_0060115 | |||
| 2972 | Ga0496115_0077865 | |||
| 2973 | Ga0496115_0148277 | |||
| 2974 | Ga0496115_0494381 | |||
| 2975 | Ga0496116_0001261 | |||
| 2976 | Ga0496116_0009203 | |||
| 2977 | Ga0496116_0065947 | |||
| 2978 | Ga0496117_0007562 | |||
| 2979 | Ga0496117_0013964 | |||
| 2980 | Ga0496117_0043017 | |||
| 2981 | Ga0496117_0275142 | |||
| 2982 | Ga0496118_0000110 | |||
| 2983 | Ga0496118_0106046 | |||
| 2984 | Ga0496118_0202860 | |||
| 2985 | Ga0496118_0212095 | |||
| 2986 | Ga0496119_0018322 | |||
| 2987 | Ga0496121_0003265 | |||
| 2988 | Ga0496121_0007177 | |||
| 2989 | Ga0496121_0022646 | |||
| 2990 | Ga0496121_0023406 | |||
| 2991 | Ga0496121_0027767 | |||
| 2992 | Ga0496121_0049083 | |||
| 2993 | Ga0496121_0073761 | |||
| 2994 | Ga0496121_0157459 | |||
| 2995 | Ga0496121_0298633 | |||
| 2996 | Ga0496121_0495183 | |||
| 2997 | Ga0496122_0000156 | |||
| 2998 | Ga0496122_0000203 | |||
| 2999 | Ga0496122_0001639 | |||
| 3000 | Ga0496122_0001861 | |||
| 3001 | Ga0496122_0005055 | |||
| 3002 | Ga0496122_0031343 | |||
| 3003 | Ga0496122_0039759 | |||
| 3004 | Ga0496122_0040203 | |||
| 3005 | Ga0496122_0080009 | |||
| 3006 | Ga0496122_0125128 | |||
| 3007 | Ga0496123_0000087 | |||
| 3008 | Ga0496123_0000164 | |||
| 3009 | Ga0496123_0001205 | |||
| 3010 | Ga0496123_0001590 | |||
| 3011 | Ga0496123_0007317 | |||
| 3012 | Ga0496123_0008731 | |||
| 3013 | Ga0496123_0035809 | |||
| 3014 | Ga0496123_0080573 | |||
| 3015 | Ga0496123_0112383 | |||
| 3016 | Ga0496123_0155192 | |||
| 3017 | Ga0496123_0316871 | |||
| 3018 | Ga0496124_0000006 | |||
| 3019 | Ga0496124_0000625 | |||
| 3020 | Ga0496124_0004834 | |||
| 3021 | Ga0496124_0014633 | |||
| 3022 | Ga0496124_0034319 | |||
| 3023 | Ga0496124_0038440 | |||
| 3024 | Ga0496124_0204851 | |||
| 3025 | Ga0496124_0231951 | |||
| 3026 | Ga0496124_0381799 | |||
| 3027 | Ga0496124_0430146 | |||
| 3028 | Ga0496125_0000144 | |||
| 3029 | Ga0496125_0000453 | |||
| 3030 | Ga0496125_0003794 | |||
| 3031 | Ga0496125_0028662 | |||
| 3032 | Ga0496126_0012736 | |||
| 3033 | Ga0496126_0033969 | |||
| 3034 | Ga0496126_0097693 | |||
| 3035 | Ga0496126_0169439 | |||
| 3036 | Ga0496126_0423695 | |||
| 3037 | Ga0495678_000020 | |||
| 3038 | Ga0495678_003152 | |||
| 3039 | Ga0495678_003293 | |||
| 3040 | Ga0495678_003507 | |||
| 3041 | Ga0495678_013660 | |||
| 3042 | Ga0495678_014347 | |||
| 3043 | Ga0495678_014358 | |||
| 3044 | Ga0495678_018085 | |||
| 3045 | Ga0495678_032830 | |||
| 3046 | Ga0495678_035839 | |||
| 3047 | Ga0495678_105558 | |||
| 3048 | Ga0495682_0000586 | |||
| 3049 | Ga0495682_0002009 | |||
| 3050 | Ga0495682_0005889 | |||
| 3051 | Ga0501032_0497113 | |||
| 3052 | Ga0501033_0005599 | |||
| 3053 | Ga0501033_0219951 | |||
| 3054 | Ga0501034_0001143 | |||
| 3055 | Ga0501034_0007022 | |||
| 3056 | Ga0501034_0013846 | |||
| 3057 | Ga0501034_0022920 | |||
| 3058 | Ga0501034_0144429 | |||
| 3059 | Ga0501034_0153669 | |||
| 3060 | Ga0501034_0579291 | |||
| 3061 | Ga0501036_0015983 | |||
| 3062 | Ga0501038_0044736 | |||
| 3063 | Ga0501039_0002412 | |||
| 3064 | Ga0501039_0305875 | |||
| 3065 | Ga0501040_0034026 | |||
| 3066 | Ga0501041_0029168 | |||
| 3067 | Ga0501042_0005080 | |||
| 3068 | Ga0501042_0133279 | |||
| 3069 | Ga0501043_0003327 | |||
| 3070 | Ga0501043_0075596 | |||
| 3071 | Ga0501043_0486007 | |||
| 3072 | Ga0501046_0012903 | |||
| 3073 | Ga0501047_0039535 | |||
| 3074 | Ga0501047_0053424 | |||
| 3075 | Ga0501047_0080968 | |||
| 3076 | Ga0501068_0000930 | |||
| 3077 | Ga0501070_0079142 | |||
| 3078 | Ga0501070_0264244 | |||
| 3079 | Ga0501071_0467023 | |||
| 3080 | Ga0501072_0010165 | |||
| 3081 | Ga0501072_0381629 | |||
| 3082 | Ga0501073_0044984 | |||
| 3083 | Ga0501073_0064473 | |||
| 3084 | Ga0501074_0058162 | |||
| 3085 | Ga0501076_0008593 | |||
| 3086 | Ga0501076_0377147 | |||
| 3087 | Ga0501077_0007696 | |||
| 3088 | Ga0501077_0489887 | |||
| 3089 | Ga0501257_050780 | |||
| 3090 | Ga0501079_0188946 | |||
| 3091 | Ga0501080_0020448 | |||
| 3092 | Ga0501080_0136946 | |||
| 3093 | Ga0501080_0494998 | |||
| 3094 | Ga0501081_0020291 | |||
| 3095 | Ga0501083_0238302 | |||
| 3096 | Ga0501241_004812 | |||
| 3097 | Ga0501035_0004258 | |||
| 3098 | Ga0501035_0024656 | |||
| 3099 | Ga0501035_0155649 | |||
| 3100 | Ga0501035_0416739 | |||
| 3101 | Ga0501044_0002363 | |||
| 3102 | Ga0501044_0069914 | |||
| 3103 | Ga0501044_0072183 | |||
| 3104 | Ga0501044_0278560 | |||
| 3105 | Ga0501044_0331238 | |||
| 3106 | Ga0501045_0012036 | |||
| 3107 | Ga0501045_0224852 | |||
| 3108 | nmdc:mga03683_3195_c1 | |||
| 3109 | nmdc:mga0k408_19404_c1 | |||
| 3110 | nmdc:mga07m45_13908_c2 | |||
| 3111 | nmdc:mga0qj67_116626_c1 | |||
| 3112 | nmdc:mga0sz30_118006_c1 | |||
| 3113 | Ga0495601_0053137 | |||
| 3114 | Ga0495601_0090848 | |||
| 3115 | Ga0495601_0090990 | |||
| 3116 | Ga0495601_0666155 | |||
| 3117 | Ga0500635_0004850 | |||
| 3118 | Ga0495595_0073684 | |||
| 3119 | Ga0495619_0395030 | |||
| 3120 | Ga0500643_000498 | |||
| 3121 | Ga0500644_0001114 | |||
| 3122 | Ga0500644_0064461 | |||
| 3123 | Ga0500646_0105160 | |||
| 3124 | Ga0500583_0043969 | |||
| 3125 | Ga0500583_0142876 | |||
| 3126 | Ga0500555_028482 | |||
| 3127 | Ga0500594_0019363 | |||
| 3128 | Ga0500595_001126 | |||
| 3129 | Ga0500607_049700 | |||
| 3130 | Ga0500608_001477 | |||
| 3131 | Ga0500617_060103 | |||
| 3132 | Ga0500618_019033 | |||
| 3133 | Ga0500642_0293386 | |||
| 3134 | Ga0500658_0012753 | |||
| 3135 | Ga0500559_0001341 | |||
| 3136 | Ga0500559_0010104 | |||
| 3137 | Ga0500559_0143991 | |||
| 3138 | Ga0500564_114763 | |||
| 3139 | Ga0500568_0058092 | |||
| 3140 | Ga0500573_0000071 | |||
| 3141 | Ga0500573_0094310 | |||
| 3142 | Ga0500574_005083 | |||
| 3143 | Ga0500577_0298617 | |||
| 3144 | Ga0500588_0110221 | |||
| 3145 | Ga0500600_0005717 | |||
| 3146 | Ga0500616_0024107 | |||
| 3147 | Ga0500622_0001100 | |||
| 3148 | Ga0500622_0173085 | |||
| 3149 | Ga0500627_0346951 | |||
| 3150 | Ga0500636_0035697 | |||
| 3151 | Ga0500611_089672 | |||
| 3152 | Ga0500645_007540 | |||
| 3153 | Ga0500552_000300 | |||
| 3154 | Ga0501084_0008983 | |||
| 3155 | Ga0587111_0004128 | |||
| 3156 | Ga0501082_0315950 | |||
| 3157 | Ga0501082_0464469 | |||
| 3158 | Ga0466962_0002025 | |||
| 3159 | Ga0466962_0043341 | |||
| 3160 | Ga0530510_0019831 | |||
| 3161 | Ga0530510_0333456 | |||
| 3162 | 2501070871 | |||
| 3163 | 2501078568 | |||
| 3164 | 2501413700 | |||
| 3165 | 2510282948 | |||
| 3166 | 2510293622 | |||
| 3167 | 2510310772 | |||
| 3168 | 2511089625 | |||
| 3169 | 2511095029 | |||
| 3170 | 2511104685 | |||
| 3171 | 2511256746 | |||
| 3172 | 2511287653 | |||
| 3173 | 2511294081 | |||
| 3174 | 2511303121 | |||
| 3175 | 2511319887 | |||
| 3176 | 2511327730 | |||
| 3177 | 2511331593 | |||
| 3178 | 2511340314 | |||
| 3179 | 2511344956 | |||
| 3180 | 2511348646 | |||
| 3181 | 2511360794 | |||
| 3182 | 2511371090 | |||
| 3183 | 2511410727 | |||
| 3184 | 2511826113 | |||
| 3185 | 2512035163 | |||
| 3186 | 2513551450 | |||
| 3187 | 2513560100 | |||
| 3188 | 2516016857 | |||
| 3189 | 2523107000 | |||
| 3190 | 2597866972 | |||
| 3191 | 2599326628 | |||
| 3192 | 2599504338 | |||
| 3193 | 2599613628 | |||
| 3194 | 2599773002 | |||
| 3195 | 2599879345 | |||
| 3196 | 2599889369 | |||
| 3197 | 2599900767 | |||
| 3198 | 2599933401 | |||
| 3199 | 2599944146 | |||
| 3200 | 2599948709 | |||
| 3201 | 2599956364 | |||
| 3202 | 2599963412 | |||
| 3203 | 2599966542 | |||
| 3204 | 2599970517 | |||
| 3205 | 2599977679 | |||
| 3206 | 2599985058 | |||
| 3207 | 2599989316 | |||
| 3208 | 2599994229 | |||
| 3209 | 2600000288 | |||
| 3210 | 2600011848 | |||
| 3211 | 2600019337 | |||
| 3212 | 2600023524 | |||
| 3213 | 2600030674 | |||
| 3214 | 2600037031 | |||
| 3215 | 2600042454 | |||
| 3216 | 2600049550 | |||
| 3217 | 2600053847 | |||
| 3218 | 2600060517 | |||
| 3219 | 2600065616 | |||
| 3220 | 2600070775 | |||
| 3221 | 2600078301 | |||
| 3222 | 2600227499 | |||
| 3223 | 2600360481 | |||
| 3224 | 2601624908 | |||
| 3225 | 2601693299 | |||
| 3226 | 2621296521 | |||
| 3227 | 2624482029 | |||
| 3228 | 2643789496 | |||
| 3229 | 2643845072 | |||
| 3230 | 2643865505 | |||
| 3231 | 2643873515 | |||
| 3232 | 2643895807 | |||
| 3233 | 2643992044 | |||
| 3234 | 2644063252 | |||
| 3235 | 2644071735 | |||
| 3236 | 2644286253 | |||
| 3237 | 2644301090 | |||
| 3238 | 2644477999 | |||
| 3239 | 2644649451 | |||
| 3240 | 2671093677 | |||
| 3241 | 2671129093 | |||
| 3242 | 2671695356 | |||
| 3243 | 2678264449 | |||
| 3244 | 2718635272 | |||
| 3245 | 2738673467 | |||
| 3246 | 2738688496 | |||
| 3247 | 2738751860 | |||
| 3248 | 2738807569 | |||
| 3249 | 2738860901 | |||
| 3250 | 2738894929 | |||
| 3251 | 2739264228 | |||
| 3252 | 2739284892 | |||
| 3253 | 2739290206 | |||
| 3254 | 2739315061 | |||
| 3255 | 2739733513 | |||
| 3256 | 2739792210 | |||
| 3257 | 2745004903 | |||
| 3258 | 2765578237 | |||
| 3259 | 2774129007 | |||
| 3260 | 2774132930 | |||
| 3261 | 2784263206 | |||
| 3262 | 2794595962 | |||
| 3263 | 2808856905 | |||
| 3264 | 2808924261 | |||
| 3265 | 2808936976 | |||
| 3266 | 2808946354 | |||
| 3267 | 2808965328 | |||
| 3268 | 2808980119 | |||
| 3269 | 2808995839 | |||
| 3270 | 2809000184 | |||
| 3271 | 2809218873 | |||
| 3272 | 2817488000 | |||
| 3273 | 2819543539 | |||
| 3274 | 2819655767 | |||
| 3275 | 2819716083 | |||
| 3276 | 2825656609 | |||
| 3277 | 2826583068 | |||
| 3278 | 2842776991 | |||
| 3279 | 2842782426 | |||
| 3280 | 2842817526 | |||
| 3281 | 2842850677 | |||
| 3282 | 2842859300 | |||
| 3283 | 2848298180 | |||
| 3284 | 2852616657 | |||
| 3285 | 2852657290 | |||
| 3286 | 2852663017 | |||
| 3287 | 2852671625 | |||
| 3288 | 2856293324 | |||
| 3289 | 2857366557 | |||
| 3290 | 2857443924 | |||
| 3291 | 2860868025 | |||
| 3292 | 2879163333 | |||
| 3293 | 2879164124 | |||
| 3294 | 2880234631 | |||
| 3295 | 2883094613 | |||
| 3296 | 2884412791 | |||
| 3297 | 2884963330 | |||
| 3298 | 2894775022 | |||
| 3299 | 2899275640 | |||
| 3300 | 2904434671 | |||
| 3301 | 2904455291 | |||
| 3302 | 2904461324 | |||
| 3303 | 2904521230 | |||
| 3304 | 2904555284 | |||
| 3305 | 2913040926 | |||
| 3306 | 2917836877 | |||
| 3307 | 2919125914 | |||
| 3308 | 2919460967 | |||
| 3309 | 2919466868 | |||
| 3310 | 2919487275 | |||
| 3311 | 2923589963 | |||
| 3312 | 2928528143 | |||
| 3313 | 2928966808 | |||
| 3314 | 2928971350 | |||
| 3315 | 2928973921 | |||
| 3316 | 2929148425 | |||
| 3317 | 2929189908 | |||
| 3318 | 2929204315 | |||
| 3319 | 2931374159 | |||
| 3320 | 2939623926 | |||
| 3321 | 2939637519 | |||
| 3322 | 2946012923 | |||
| 3323 | 2946028213 | |||
| 3324 | 2947234734 | |||
| 3325 | 2969308785 | |||
| 3326 | 2974302578 | |||
| 3327 | 2977241119 | |||
| 3328 | 2984290602 | |||
| 3329 | 2984499836 | |||
| 3330 | 2984506267 | |||
| 3331 | 2988730026 | |||
| 3332 | 3000865581 | |||
| 3333 | 3007315895 | |||
| 3334 | 3007400967 | |||
| 3335 | 3007515729 | |||
| 3336 | 3007617863 | |||
| 3337 | 3007619929 | |||
| 3338 | 3007858925 | |||
| 3339 | 3007865519 | |||
| 3340 | 643602444 | |||
| 3341 | 8003015638 | |||
| 3342 | 8003957365 | |||
| 3343 | 8016731742 | |||
| 3344 | 8034965120 | |||
| 3345 | 8054503576 | |||
| 3346 | 8056127469 | |||
| 3347 | 8056144946 | |||
| 3348 | 8056180094 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v81-assembly1.cif.gz_A | native kdpgal structure | 0.9831 | 11 | 205 |
| 4qcc-assembly1.cif.gz_A | structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains | 0.9809 | 10 | 205 |
| 6xh5-assembly1.cif.gz_A | hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks | 0.9364 | 10 | 203 |
| 8szz-assembly1.cif.gz_J | cryoem structure of computationally designed nanocage o32-zl4 | 0.9354 | 3 | 204 |
| 7b3y-assembly1.cif.gz_B-9 | structure of a nanoparticle for a covid-19 vaccine candidate | 0.9335 | 1 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v81A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.98 | 11 | 205 | 3.20.20.70 |
| 1vlwB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9328 | 2 | 206 | 3.20.20.70 |
| 2v81A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9278 | 11 | 205 | 3.20.20.70 |
| 1vlwB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9114 | 2 | 206 | 3.20.20.70 |
| af_A0A1D6HW21_144_318_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9109 | 39 | 201 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519F750-F1-model_v4 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | 1 | 20 | 206 |
GO:0016829
|
| AF-A0A3M3GZY1-F1-model_v4 | deleted | 0.9999 | 1 | 113 |
|
| AF-A0A3L8CVF3-F1-model_v4 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | 0.9978 | 65 | 206 |
GO:0016829
|
| AF-A0A2N8GTS6-F1-model_v4 | deleted | 0.9967 | 54 | 183 |
|
| AF-A0A3M3A9Z3-F1-model_v4 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | 0.9963 | 98 | 206 |
GO:0016829
|