F495288

General Info

Members Datasets Scaffolds Average Seq Length
1674 696 3348 210

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0602091|Ga0436361_0602091_290_1003
Length 237
Sequence MKRRLEADMEPELNLPAPYTPHVGFVAAFGACRMIAIVRGIKPAEAVAHGRALYEAGFRIIEVPLNSPQPLDSIAALREALPEDAMIGAGTVLTTARVRDVREAGGEVIVMPHADIDVILAAKLQGLACVPGVATPTEAFAALGHGADALKMFPAEQLGPAVTKAWRAVIPPVVPLLPVGGVKPDNMGPQLAAGASGFGLGSALYKPGQDAAATRANALAFIEGWRVTQLGMHGAQK

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
129 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
130 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
148 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
149 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
150 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
151 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
157 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
158 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
159 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
168 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
170 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
171 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
185 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
247 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
255 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
256 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
257 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
260 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
265 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
279 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
280 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
292 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
293 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
294 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
295 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
296 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
297 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
302 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
303 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
304 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
305 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
306 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
307 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
308 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
309 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
310 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
311 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
312 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
313 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
316 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
317 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
318 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
319 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
320 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
323 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
324 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
332 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
333 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
334 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
335 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
339 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
343 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
349 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
353 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
356 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
357 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
364 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
365 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
366 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
367 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
368 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
369 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
370 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
371 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
372 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
373 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
377 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
378 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
381 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
382 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
383 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
384 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
385 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
386 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
387 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
388 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
389 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
392 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
393 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
394 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
395 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
396 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
397 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
398 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
399 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
408 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
409 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
410 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
411 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
412 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
413 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
414 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
415 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
416 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
419 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
420 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
421 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
422 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
423 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
424 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
425 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
426 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
427 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
428 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
429 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
430 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
431 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
453 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
454 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
455 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
456 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
457 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
458 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
459 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
460 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
479 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
480 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
481 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
482 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
483 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
484 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
485 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
486 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
487 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
488 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
489 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
490 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
491 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
492 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
493 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
494 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
495 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
499 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
500 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
501 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
502 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
503 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
504 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
505 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
506 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
507 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
509 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
510 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
511 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
512 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
513 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
514 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
515 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
516 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
517 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
518 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
519 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
520 2511231004 Pseudomonas sp. GM102 Isolate Nodule
521 2511231010 Pseudomonas sp. GM25 Isolate Nodule
522 2511231011 Pseudomonas sp. GM30 Isolate Nodule
523 2511231012 Pseudomonas sp. GM33 Isolate Nodule
524 2511231015 Pseudomonas sp. GM49 Isolate Nodule
525 2511231016 Pseudomonas sp. GM50 Isolate Nodule
526 2511231017 Pseudomonas sp. GM55 Isolate Nodule
527 2511231018 Pseudomonas sp. GM60 Isolate Nodule
528 2511231019 Pseudomonas sp. GM67 Isolate Nodule
529 2511231020 Pseudomonas sp. GM74 Isolate Nodule
530 2511231022 Pseudomonas sp. GM79 Isolate Nodule
531 2511231023 Pseudomonas sp. GM80 Isolate Nodule
532 2511231031 Pseudomonas sp. GM16 Isolate Nodule
533 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
534 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
535 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
536 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
537 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
538 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
539 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
540 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
541 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
542 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
543 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
544 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
545 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
546 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
547 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
548 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
549 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
550 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
551 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
552 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
553 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
554 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
555 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
556 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
557 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
558 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
559 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
560 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
561 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
562 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
563 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
564 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
565 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
566 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
567 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
568 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
569 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
570 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
571 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
572 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
573 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
574 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
575 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
576 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
577 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
578 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
579 2643221570 Acidovorax sp. Root568 Isolate Unclassified
580 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
581 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
582 2643221596 Acidovorax sp. Root70 Isolate Unclassified
583 2643221609 Acidovorax sp. Root217 Isolate Unclassified
584 2643221611 Acidovorax sp. Root219 Isolate Unclassified
585 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
586 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
587 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
588 2643221717 Acidovorax sp. Root267 Isolate Unclassified
589 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
590 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
591 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
592 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
593 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
594 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
595 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
596 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
597 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
598 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
599 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
600 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
601 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
602 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
603 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
604 2739367700 Dyella sp. YR388 Isolate Unclassified
605 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
606 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
607 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
608 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
609 2773857673 Pseudomonas sp. 443 Isolate Unclassified
610 2784132063 Pseudomonas sp. 424 Isolate Unclassified
611 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
612 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
613 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
614 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
615 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
616 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
617 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
618 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
619 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
620 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
621 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
622 2818991436 Collimonas arenae 515 Isolate Unclassified
623 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
624 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
625 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
626 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
627 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
628 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
629 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
630 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
631 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
632 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
633 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
634 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
635 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
636 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
637 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
638 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
639 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
640 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
641 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
642 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
643 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
644 2884411467 Dyella sp. AD56 Isolate Rhizosphere
645 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
646 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
647 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
648 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
649 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
650 2904456579 Variovorax sp. 2002 Isolate Unclassified
651 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
652 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
653 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
654 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
655 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
656 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
657 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
658 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
659 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
660 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
661 2928963466 Dyella japonica 1073 Isolate Unclassified
662 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
663 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
664 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
665 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
666 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
667 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
668 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
669 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
670 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
671 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
672 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
673 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
674 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
675 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
676 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
677 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
678 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
679 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
680 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
681 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
682 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
683 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
684 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
685 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
686 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
687 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
688 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
689 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
690 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
691 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
692 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
693 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
694 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
695 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
696 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.65
Metatranscriptomes 0.18
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 10.39
Nodule 1.14
Rhizoplane 3.58
Rhizosphere 72.7
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0602091 3300039447 Bacteria 1223
2 SwRhRL2b_contig_656453 2162886007 Bacteria 2013
3 JGI24739J22299_10001818 3300001989 Bacteria 8134
4 JGI24737J22298_10091662 3300001990 Bacteria 901
5 JGI24735J21928_10000175 3300002067 Bacteria 22763
6 JGI24735J21928_10001426 3300002067 Bacteria 8447
7 JGI25162J39368_1000063 3300002737 Bacteria 134747
8 JGI25162J39368_1000287 3300002737 Bacteria 47192
9 JGI25158J39367_1004817 3300002739 Bacteria 2010
10 JGI25157J39369_1000217 3300002741 Bacteria 47210
11 JGI25157J39369_1008628 3300002741 Bacteria 1409
12 JGI25163J39215_1000677 3300002771 Bacteria 9056
13 JGI25163J39215_1002287 3300002771 Bacteria 2080
14 JGI25164J39214_1000672 3300002772 Bacteria 13810
15 JGI25164J39214_1004989 3300002772 Bacteria 1473
16 JGI25159J45721_1004581 3300002987 Bacteria 4548
17 JGI25151J46595_10000338 3300003187 Bacteria 50270
18 JGI25165J46597_1000069 3300003214 Bacteria 195460
19 JGI25165J46597_1000388 3300003214 Bacteria 47192
20 rootH1_10093753 3300003316 Bacteria 2008
21 rootH2_10007026 3300003320 Bacteria 3234
22 rootH2_10077057 3300003320 Bacteria 1527
23 rootL2_10039617 3300003322 Bacteria 3957
24 rootH1_10009337 3300003323 Bacteria 14683
25 rootH1_10071821 3300003323 Bacteria 3001
26 rootH1_10074923 3300003323 Bacteria 2899
27 rootH1_10105829 3300003323 Bacteria 2883
28 rootH1_10249875 3300003323 Bacteria 1124
29 JGI25161J50226_1000201 3300003374 Bacteria 39071
30 Ga0055538_1000034 3300003751 Bacteria 195460
31 Ga0055538_1004584 3300003751 Bacteria 1544
32 Ga0055539_1000044 3300003752 Bacteria 195460
33 Ga0055533_1000055 3300003756 Bacteria 195460
34 Ga0055525_1000066 3300003759 Bacteria 195460
35 Ga0055535_1000335 3300003761 Bacteria 47184
36 Ga0055535_1000978 3300003761 Bacteria 18662
37 Ga0055535_1019184 3300003761 Bacteria 873
38 Ga0055542_1000363 3300003762 Bacteria 47192
39 Ga0055542_1001209 3300003762 Bacteria 14546
40 Ga0055529_1000391 3300003763 Bacteria 47192
41 Ga0055529_1000610 3300003763 Bacteria 27246
42 Ga0055529_1000975 3300003763 Bacteria 14385
43 Ga0055529_1005226 3300003763 Bacteria 1897
44 Ga0055529_1015679 3300003763 Bacteria 955
45 Ga0055526_1000116 3300003771 Bacteria 70518
46 Ga0055526_1000487 3300003771 Bacteria 31529
47 Ga0055526_1006469 3300003771 Bacteria 6351
48 Ga0055537_1000035 3300003773 Bacteria 96274
49 Ga0055524_1021726 3300003775 Bacteria 2117
50 Ga0055524_1025753 3300003775 Bacteria 1834
51 Ga0055524_1053959 3300003775 Bacteria 885
52 Ga0055536_1000103 3300003781 Bacteria 73706
53 Ga0055536_1002169 3300003781 Bacteria 11186
54 Ga0055536_1041914 3300003781 Bacteria 1075
55 Ga0055534_1000104 3300003784 Bacteria 64767
56 Ga0055534_1000158 3300003784 Bacteria 50846
57 Ga0055534_1000325 3300003784 Bacteria 31562
58 Ga0055528_1000058 3300003790 Bacteria 88086
59 Ga0055530_10001374 3300003791 Bacteria 18030
60 Ga0055530_10007126 3300003791 Bacteria 4791
61 Ga0055540_1010062 3300003792 Bacteria 3184
62 Ga0055531_10006687 3300003794 Bacteria 6463
63 Ga0055531_10014117 3300003794 Bacteria 3623
64 Ga0055531_10023407 3300003794 Bacteria 2318
65 Ga0055531_10067287 3300003794 Bacteria 842
66 Ga0055541_1000032 3300003841 Bacteria 195460
67 Ga0058692_1000009 3300003856 Bacteria 349545
68 Ga0055543_1000103 3300004625 Bacteria 73828
69 Ga0065165_1000224 3300005262 Bacteria 99359
70 Ga0065165_1000854 3300005262 Bacteria 39869
71 Ga0065714_10007829 3300005288 Bacteria 3380
72 Ga0065714_10012581 3300005288 Bacteria 2772
73 Ga0065714_10069716 3300005288 Bacteria 4094
74 Ga0065704_10009257 3300005289 Bacteria 4670
75 Ga0065704_10118926 3300005289 Bacteria 1808
76 Ga0065704_10264331 3300005289 Bacteria 956
77 Ga0065712_10000132 3300005290 Bacteria 73390
78 Ga0065712_10090203 3300005290 Bacteria 2403
79 Ga0065707_10082092 3300005295 Bacteria 22240
80 Ga0070658_10014131 3300005327 Bacteria 6410
81 Ga0070658_10123076 3300005327 Bacteria 2156
82 Ga0070658_10173891 3300005327 Bacteria 1810
83 Ga0070676_10000184 3300005328 Bacteria 25832
84 Ga0070676_10016033 3300005328 Bacteria 4138
85 Ga0070676_10086903 3300005328 Bacteria 1908
86 Ga0070676_10155529 3300005328 Bacteria 1467
87 Ga0070683_100002328 3300005329 Bacteria 15073
88 Ga0070683_100031670 3300005329 Bacteria 4812
89 Ga0070683_100115303 3300005329 Bacteria 2536
90 Ga0070683_100140189 3300005329 Bacteria 2291
91 Ga0070683_100510519 3300005329 Bacteria 1149
92 Ga0070690_100096094 3300005330 Bacteria 1958
93 Ga0070670_100005054 3300005331 Bacteria 11101
94 Ga0070670_100026223 3300005331 Bacteria 5017
95 Ga0070670_100128471 3300005331 Bacteria 2187
96 Ga0070670_100265249 3300005331 Bacteria 1498
97 Ga0070677_10000379 3300005333 Bacteria 15666
98 Ga0070677_10022599 3300005333 Bacteria 2318
99 Ga0070677_10070743 3300005333 Bacteria 1467
100 Ga0068869_100028286 3300005334 Bacteria 3917
101 Ga0068869_100225786 3300005334 Bacteria 1486
102 Ga0070666_10012374 3300005335 Bacteria 5379
103 Ga0070680_100003334 3300005336 Bacteria 11980
104 Ga0070680_100124199 3300005336 Bacteria 2156
105 Ga0070680_100269382 3300005336 Bacteria 1442
106 Ga0070682_100003944 3300005337 Bacteria 8239
107 Ga0070682_100014112 3300005337 Bacteria 4613
108 Ga0068868_100002077 3300005338 Bacteria 13773
109 Ga0068868_100023967 3300005338 Bacteria 4625
110 Ga0068868_100026781 3300005338 Bacteria 4396
111 Ga0068868_100418855 3300005338 Bacteria 1159
112 Ga0068868_100647819 3300005338 Bacteria 940
113 Ga0070660_100001110 3300005339 Bacteria 18135
114 Ga0070660_100078997 3300005339 Bacteria 2581
115 Ga0070660_100114547 3300005339 Bacteria 2148
116 Ga0070661_100085612 3300005344 Bacteria 2329
117 Ga0070661_100120919 3300005344 Bacteria 1961
118 Ga0070668_100004033 3300005347 Bacteria 10859
119 Ga0070668_100060509 3300005347 Bacteria 2933
120 Ga0070668_100067315 3300005347 Bacteria 2782
121 Ga0070668_100094228 3300005347 Bacteria 2363
122 Ga0070668_100167475 3300005347 Bacteria 1787
123 Ga0070668_100275083 3300005347 Bacteria 1405
124 Ga0070668_100336190 3300005347 Bacteria 1275
125 Ga0070668_100410165 3300005347 Bacteria 1158
126 Ga0070669_100020760 3300005353 Bacteria 4692
127 Ga0070669_100136133 3300005353 Bacteria 1889
128 Ga0070669_100764828 3300005353 Bacteria 819
129 Ga0070675_100004329 3300005354 Bacteria 10827
130 Ga0070675_100010835 3300005354 Bacteria 7127
131 Ga0070675_100075645 3300005354 Bacteria 2799
132 Ga0070675_100251931 3300005354 Bacteria 1546
133 Ga0070675_100918528 3300005354 Bacteria 802
134 Ga0070671_100043865 3300005355 Bacteria 3716
135 Ga0070671_100049086 3300005355 Bacteria 3511
136 Ga0070671_100074400 3300005355 Bacteria 2838
137 Ga0070674_100006415 3300005356 Bacteria 6860
138 Ga0070674_100185045 3300005356 Bacteria 1598
139 Ga0070674_100228228 3300005356 Bacteria 1452
140 Ga0070673_100019406 3300005364 Bacteria 4879
141 Ga0070673_100021478 3300005364 Bacteria 4681
142 Ga0070673_100073974 3300005364 Bacteria 2744
143 Ga0070673_100087809 3300005364 Bacteria 2535
144 Ga0070688_100382213 3300005365 Bacteria 1038
145 Ga0070688_100832145 3300005365 Bacteria 724
146 Ga0070688_100844682 3300005365 Bacteria 719
147 Ga0070659_100062514 3300005366 Bacteria 2944
148 Ga0070659_100318943 3300005366 Bacteria 1299
149 Ga0070659_100548394 3300005366 Bacteria 989
150 Ga0070659_100770255 3300005366 Bacteria 836
151 Ga0070667_100018980 3300005367 Bacteria 5701
152 Ga0070667_100101645 3300005367 Bacteria 2484
153 Ga0070667_100153202 3300005367 Bacteria 2026
154 Ga0070667_100260558 3300005367 Bacteria 1552
155 Ga0070714_100601099 3300005435 Bacteria 1056
156 Ga0070713_100111919 3300005436 Bacteria 2381
157 Ga0070710_10021874 3300005437 Bacteria 3338
158 Ga0070711_100438177 3300005439 Bacteria 1068
159 Ga0070700_100798855 3300005441 Bacteria 760
160 Ga0070663_100013698 3300005455 Bacteria 5182
161 Ga0070663_100248073 3300005455 Bacteria 1408
162 Ga0070663_100403662 3300005455 Bacteria 1118
163 Ga0070663_100464896 3300005455 Bacteria 1045
164 Ga0070678_100342825 3300005456 Bacteria 1282
165 Ga0070678_100927899 3300005456 Bacteria 797
166 Ga0070662_100009714 3300005457 Bacteria 6296
167 Ga0070662_100029289 3300005457 Bacteria 3842
168 Ga0070662_100074443 3300005457 Bacteria 2512
169 Ga0070662_100264729 3300005457 Bacteria 1386
170 Ga0070662_100274238 3300005457 Bacteria 1363
171 Ga0070681_10211816 3300005458 Bacteria 1854
172 Ga0070681_10238260 3300005458 Bacteria 1733
173 Ga0070681_10308196 3300005458 Bacteria 1493
174 Ga0068867_100021598 3300005459 Bacteria 4595
175 Ga0070685_10031687 3300005466 Bacteria 2956
176 Ga0070685_10345998 3300005466 Bacteria 1015
177 Ga0070699_100470317 3300005518 Bacteria 1140
178 Ga0070679_100119972 3300005530 Bacteria 2615
179 Ga0070679_100153527 3300005530 Bacteria 2278
180 Ga0070679_100156262 3300005530 Bacteria 2255
181 Ga0070679_100225783 3300005530 Bacteria 1833
182 Ga0070679_100466101 3300005530 Bacteria 1208
183 Ga0070684_100001235 3300005535 Bacteria 18342
184 Ga0070684_100027746 3300005535 Bacteria 4782
185 Ga0070684_100057175 3300005535 Bacteria 3405
186 Ga0070684_100147827 3300005535 Bacteria 2128
187 Ga0070684_100218756 3300005535 Bacteria 1738
188 Ga0068853_100035810 3300005539 Bacteria 4218
189 Ga0070672_100024644 3300005543 Bacteria 4450
190 Ga0070672_100039537 3300005543 Bacteria 3614
191 Ga0070672_100083942 3300005543 Bacteria 2557
192 Ga0070672_100107480 3300005543 Bacteria 2270
193 Ga0070672_100113189 3300005543 Bacteria 2214
194 Ga0070672_100201041 3300005543 Bacteria 1666
195 Ga0070672_100318529 3300005543 Bacteria 1322
196 Ga0070672_100372234 3300005543 Bacteria 1221
197 Ga0070696_100186255 3300005546 Bacteria 1542
198 Ga0070693_100172707 3300005547 Bacteria 1386
199 Ga0070665_100012164 3300005548 Bacteria 8676
200 Ga0070665_100024403 3300005548 Bacteria 6089
201 Ga0070665_100459856 3300005548 Bacteria 1283
202 Ga0070665_100534549 3300005548 Bacteria 1184
203 Ga0070665_100560054 3300005548 Bacteria 1155
204 Ga0070665_100575002 3300005548 Bacteria 1139
205 Ga0068855_100003248 3300005563 Bacteria 19878
206 Ga0068855_100012376 3300005563 Bacteria 10305
207 Ga0068855_100051713 3300005563 Bacteria 4839
208 Ga0068855_100132342 3300005563 Bacteria 2847
209 Ga0068855_100183432 3300005563 Bacteria 2365
210 Ga0068855_100602645 3300005563 Bacteria 1184
211 Ga0070664_100055289 3300005564 Bacteria 3369
212 Ga0070664_100169074 3300005564 Bacteria 1939
213 Ga0070664_100178464 3300005564 Bacteria 1887
214 Ga0070664_100190283 3300005564 Bacteria 1828
215 Ga0070664_100418747 3300005564 Bacteria 1227
216 Ga0070664_100486035 3300005564 Bacteria 1137
217 Ga0068857_100008513 3300005577 Bacteria 8870
218 Ga0068857_100051007 3300005577 Bacteria 3670
219 Ga0068857_100063861 3300005577 Bacteria 3273
220 Ga0068857_100182706 3300005577 Bacteria 1909
221 Ga0068857_100365287 3300005577 Bacteria 1338
222 Ga0068854_100000699 3300005578 Bacteria 19878
223 Ga0068854_100001438 3300005578 Bacteria 14407
224 Ga0068854_100006866 3300005578 Bacteria 7259
225 Ga0068854_100162955 3300005578 Bacteria 1729
226 Ga0068854_100437129 3300005578 Bacteria 1090
227 Ga0068854_100523259 3300005578 Bacteria 1002
228 Ga0068854_100779783 3300005578 Bacteria 831
229 Ga0068856_100016100 3300005614 Bacteria 7228
230 Ga0068856_100768637 3300005614 Bacteria 983
231 Ga0068852_100045673 3300005616 Bacteria 3727
232 Ga0068852_100049791 3300005616 Bacteria 3586
233 Ga0068852_100113902 3300005616 Bacteria 2463
234 Ga0068852_100286449 3300005616 Bacteria 1590
235 Ga0068852_100704958 3300005616 Bacteria 1020
236 Ga0068859_100011168 3300005617 Bacteria 9029
237 Ga0068859_100014157 3300005617 Bacteria 7998
238 Ga0068859_100071933 3300005617 Bacteria 3494
239 Ga0068859_100233165 3300005617 Bacteria 1929
240 Ga0068864_100006939 3300005618 Bacteria 9292
241 Ga0068864_100014348 3300005618 Bacteria 6581
242 Ga0068864_100020963 3300005618 Bacteria 5473
243 Ga0068864_100035586 3300005618 Bacteria 4240
244 Ga0068866_10176571 3300005718 Unclassified 1258
245 Ga0068861_100001967 3300005719 Bacteria 13242
246 Ga0068861_100098554 3300005719 Bacteria 2320
247 Ga0068861_100099116 3300005719 Bacteria 2314
248 Ga0068861_101011004 3300005719 Bacteria 794
249 Ga0068851_10015815 3300005834 Bacteria 3601
250 Ga0068851_10065197 3300005834 Bacteria 1874
251 Ga0068851_10209105 3300005834 Bacteria 1092
252 Ga0068870_10027147 3300005840 Bacteria 2861
253 Ga0068870_10124361 3300005840 Bacteria 1490
254 Ga0068863_100012433 3300005841 Bacteria 8219
255 Ga0068863_100037327 3300005841 Bacteria 4626
256 Ga0068863_100151663 3300005841 Bacteria 2218
257 Ga0068863_100241408 3300005841 Bacteria 1744
258 Ga0068863_100276828 3300005841 Bacteria 1625
259 Ga0068863_100278780 3300005841 Bacteria 1619
260 Ga0068863_100336788 3300005841 Bacteria 1467
261 Ga0068863_100500118 3300005841 Bacteria 1197
262 Ga0068863_100518383 3300005841 Bacteria 1175
263 Ga0068863_100623364 3300005841 Bacteria 1068
264 Ga0068858_100139654 3300005842 Bacteria 2274
265 Ga0068858_100485410 3300005842 Bacteria 1193
266 Ga0068860_100014126 3300005843 Bacteria 7830
267 Ga0068860_100018457 3300005843 Bacteria 6785
268 Ga0068860_100230298 3300005843 Bacteria 1801
269 Ga0068860_100272470 3300005843 Bacteria 1652
270 Ga0068860_100275885 3300005843 Unclassified 1642
271 Ga0068860_100408596 3300005843 Bacteria 1344
272 Ga0068862_100015603 3300005844 Bacteria 6310
273 Ga0068862_100073069 3300005844 Unclassified 2964
274 Ga0075363_100279879 3300006048 Bacteria 965
275 Ga0075364_10320929 3300006051 Bacteria 1055
276 Ga0075364_10426602 3300006051 Bacteria 905
277 Ga0075364_10570376 3300006051 Bacteria 773
278 Ga0075432_10000316 3300006058 Bacteria 13593
279 Ga0075432_10103215 3300006058 Bacteria 1055
280 Ga0075362_10000923 3300006177 Bacteria 8934
281 Ga0075369_10119616 3300006186 Bacteria 1191
282 Ga0075366_10009494 3300006195 Bacteria 5431
283 Ga0097621_100386334 3300006237 Bacteria 1251
284 Ga0097621_100457433 3300006237 Bacteria 1151
285 Ga0097621_100516321 3300006237 Bacteria 1084
286 Ga0068871_100080037 3300006358 Bacteria 2704
287 Ga0068871_100829103 3300006358 Unclassified 854
288 Ga0075428_100647354 3300006844 Bacteria 1127
289 Ga0075428_101084647 3300006844 Bacteria 846
290 Ga0068865_100047329 3300006881 Bacteria 2955
291 Ga0068865_100227731 3300006881 Bacteria 1461
292 Ga0075436_100119814 3300006914 Bacteria 1840
293 Ga0097620_100011168 3300006931 Bacteria 9029
294 Ga0097620_100014159 3300006931 Bacteria 7998
295 Ga0097620_100071933 3300006931 Bacteria 3494
296 Ga0097620_100233177 3300006931 Bacteria 1929
297 Ga0079104_1021663 3300006946 Bacteria 1746
298 Ga0105251_10002617 3300009011 Bacteria 13912
299 Ga0105251_10004604 3300009011 Bacteria 9313
300 Ga0105251_10032844 3300009011 Bacteria 2582
301 Ga0105251_10056938 3300009011 Bacteria 1849
302 Ga0105244_10002401 3300009036 Bacteria 14159
303 Ga0105244_10120692 3300009036 Bacteria 1269
304 Ga0105244_10148471 3300009036 Bacteria 1124
305 Ga0105250_10000550 3300009092 Bacteria 25618
306 Ga0105250_10002212 3300009092 Bacteria 9912
307 Ga0105250_10026587 3300009092 Bacteria 2332
308 Ga0105250_10287560 3300009092 Bacteria 708
309 Ga0105240_10001607 3300009093 Bacteria 38298
310 Ga0105240_10005342 3300009093 Bacteria 19161
311 Ga0105240_10017316 3300009093 Bacteria 9714
312 Ga0105240_10020280 3300009093 Bacteria 8873
313 Ga0105240_10023104 3300009093 Bacteria 8233
314 Ga0105240_10224191 3300009093 Bacteria 2188
315 Ga0105240_10322835 3300009093 Bacteria 1759
316 Ga0105240_10381595 3300009093 Bacteria 1592
317 Ga0105240_10405876 3300009093 Bacteria 1534
318 Ga0105240_10648266 3300009093 Bacteria 1158
319 Ga0105240_11392873 3300009093 Bacteria 737
320 Ga0111539_10640115 3300009094 Bacteria 1238
321 Ga0105245_10257272 3300009098 Bacteria 1698
322 Ga0105245_10320485 3300009098 Bacteria 1527
323 Ga0105247_10018162 3300009101 Bacteria 4218
324 Ga0105247_10267118 3300009101 Bacteria 1175
325 Ga0105243_10001011 3300009148 Bacteria 25990
326 Ga0105243_10051347 3300009148 Bacteria 3261
327 Ga0105242_10358512 3300009176 Bacteria 1349
328 Ga0105242_10421815 3300009176 Bacteria 1250
329 Ga0105248_10257694 3300009177 Bacteria 1964
330 Ga0105248_10334437 3300009177 Bacteria 1705
331 Ga0105248_11132222 3300009177 Bacteria 885
332 Ga0105237_10000036 3300009545 Bacteria 191142
333 Ga0105237_10000136 3300009545 Bacteria 103269
334 Ga0105237_10058621 3300009545 Bacteria 3853
335 Ga0105237_10188719 3300009545 Bacteria 2061
336 Ga0105238_10036529 3300009551 Bacteria 4995
337 Ga0105238_10261347 3300009551 Bacteria 1710
338 Ga0105238_10777598 3300009551 Bacteria 972
339 Ga0105249_10096119 3300009553 Bacteria 2779
340 Ga0105239_10011357 3300010375 Bacteria 9936
341 Ga0105239_10061307 3300010375 Bacteria 4128
342 Ga0105246_10000322 3300011119 Bacteria 25369
343 Ga0105246_10002126 3300011119 Bacteria 11943
344 Ga0105246_10023561 3300011119 Bacteria 3985
345 Ga0105246_10567655 3300011119 Bacteria 975
346 Ga0157345_1000091 3300012498 Bacteria 19224
347 Ga0157314_1000581 3300012500 Bacteria 3371
348 Ga0157347_1002954 3300012502 Bacteria 1494
349 Ga0157373_10000568 3300013100 Bacteria 28815
350 Ga0157373_10003664 3300013100 Bacteria 11614
351 Ga0157373_10009218 3300013100 Bacteria 7299
352 Ga0157373_10085097 3300013100 Bacteria 2229
353 Ga0157373_10113106 3300013100 Bacteria 1907
354 Ga0157373_10638965 3300013100 Bacteria 777
355 Ga0157371_10016582 3300013102 Bacteria 5494
356 Ga0157371_10216135 3300013102 Bacteria 1376
357 Ga0157371_10377801 3300013102 Bacteria 1034
358 Ga0157370_10077206 3300013104 Bacteria 3138
359 Ga0157370_10281370 3300013104 Bacteria 1537
360 Ga0157370_10322545 3300013104 Bacteria 1425
361 Ga0157369_10001737 3300013105 Bacteria 26487
362 Ga0157369_10001978 3300013105 Bacteria 24687
363 Ga0157369_10025617 3300013105 Bacteria 6545
364 Ga0157369_10047946 3300013105 Bacteria 4637
365 Ga0157369_10147301 3300013105 Bacteria 2489
366 Ga0157369_10170224 3300013105 Bacteria 2295
367 Ga0157369_10255746 3300013105 Bacteria 1827
368 Ga0157369_10604876 3300013105 Bacteria 1131
369 Ga0157369_10646301 3300013105 Bacteria 1091
370 Ga0157369_10833279 3300013105 Bacteria 947
371 Ga0157374_10000055 3300013296 Bacteria 120079
372 Ga0157374_10003393 3300013296 Bacteria 13392
373 Ga0157374_10388709 3300013296 Bacteria 1390
374 Ga0157378_10285618 3300013297 Bacteria 1592
375 Ga0163162_10083329 3300013306 Bacteria 3271
376 Ga0163162_10162708 3300013306 Bacteria 2354
377 Ga0163162_10258243 3300013306 Bacteria 1874
378 Ga0163162_10578767 3300013306 Bacteria 1250
379 Ga0157372_10001079 3300013307 Bacteria 29711
380 Ga0157372_10055049 3300013307 Bacteria 4441
381 Ga0157372_10131453 3300013307 Bacteria 2880
382 Ga0157372_10220879 3300013307 Bacteria 2196
383 Ga0157372_10437604 3300013307 Bacteria 1524
384 Ga0157372_10477804 3300013307 Bacteria 1453
385 Ga0157372_10527871 3300013307 Bacteria 1376
386 Ga0157372_10544429 3300013307 Bacteria 1353
387 Ga0157375_10007393 3300013308 Bacteria 9615
388 Ga0157375_10012489 3300013308 Bacteria 7538
389 Ga0157375_10106507 3300013308 Bacteria 2895
390 Ga0157375_10350854 3300013308 Bacteria 1641
391 Ga0157375_10699769 3300013308 Bacteria 1167
392 Ga0157375_11107539 3300013308 Bacteria 927
393 Ga0163163_10012181 3300014325 Bacteria 7828
394 Ga0157380_10006526 3300014326 Bacteria 8227
395 Ga0157380_10125069 3300014326 Bacteria 2184
396 Ga0182008_10001995 3300014497 Bacteria 13100
397 Ga0182008_10009442 3300014497 Bacteria 5263
398 Ga0182008_10036444 3300014497 Bacteria 2461
399 Ga0182008_10038233 3300014497 Bacteria 2400
400 Ga0182008_10112878 3300014497 Bacteria 1347
401 Ga0157377_10395201 3300014745 Bacteria 940
402 Ga0157379_10007766 3300014968 Bacteria 9290
403 Ga0157379_10126591 3300014968 Bacteria 2298
404 Ga0157376_10069963 3300014969 Bacteria 2977
405 Ga0157376_10111105 3300014969 Bacteria 2413
406 Ga0157376_10159234 3300014969 Bacteria 2045
407 Ga0157376_10918310 3300014969 Bacteria 894
408 Ga0182006_1000967 3300015261 Bacteria 19035
409 Ga0182006_1002514 3300015261 Bacteria 9969
410 Ga0182006_1006793 3300015261 Bacteria 5279
411 Ga0182006_1009331 3300015261 Bacteria 4401
412 Ga0182006_1020584 3300015261 Bacteria 2762
413 Ga0182006_1104194 3300015261 Bacteria 1003
414 Ga0182006_1134970 3300015261 Bacteria 847
415 Ga0182005_1000289 3300015265 Bacteria 31434
416 Ga0182005_1041459 3300015265 Bacteria 1252
417 Ga0182005_1042136 3300015265 Bacteria 1241
418 Ga0183365_10004 3300015684 Bacteria 333304
419 Ga0183368_1007 3300015687 Bacteria 405609
420 Ga0183360_11919 3300015689 Bacteria 757
421 Ga0183363_1007 3300015690 Bacteria 315687
422 Ga0163161_10071262 3300017792 Bacteria 2543
423 Ga0163161_10087295 3300017792 Bacteria 2304
424 Ga0163161_10144012 3300017792 Bacteria 1806
425 Ga0163161_10160712 3300017792 Bacteria 1713
426 Ga0163161_10192938 3300017792 Bacteria 1567
427 Ga0163161_10599252 3300017792 Bacteria 908
428 Ga0163161_10603799 3300017792 Bacteria 905
429 Ga0163161_10784277 3300017792 Bacteria 800
430 Ga0206356_11616746 3300020070 Bacteria 3414
431 Ga0206354_10931273 3300020081 Bacteria 1474
432 Ga0213872_10001316 3300021361 Bacteria 16470
433 Ga0213875_10023663 3300021388 Bacteria 2933
434 Ga0228598_1000332 3300024227 Bacteria 9268
435 Ga0209435_106429 3300025206 Bacteria 1308
436 Ga0209760_100340 3300025207 Bacteria 13643
437 Ga0209760_101173 3300025207 Bacteria 2947
438 Ga0209436_100301 3300025208 Bacteria 22729
439 Ga0209784_100049 3300025224 Bacteria 195512
440 Ga0209784_100164 3300025224 Bacteria 57421
441 Ga0209566_100061 3300025225 Bacteria 195512
442 Ga0209566_102109 3300025225 Bacteria 4082
443 Ga0209674_100069 3300025226 Bacteria 243948
444 Ga0209672_102388 3300025228 Bacteria 4672
445 Ga0209672_102751 3300025228 Bacteria 4055
446 Ga0209672_103395 3300025228 Bacteria 3314
447 Ga0209672_112054 3300025228 Bacteria 1089
448 Ga0209563_100083 3300025230 Bacteria 195512
449 Ga0207427_100084 3300025231 Bacteria 142663
450 Ga0207427_101954 3300025231 Bacteria 6328
451 Ga0207427_103135 3300025231 Bacteria 3710
452 Ga0209437_100037 3300025233 Bacteria 459730
453 Ga0209437_100091 3300025233 Bacteria 243344
454 Ga0209437_100924 3300025233 Bacteria 11174
455 Ga0209258_100034 3300025242 Bacteria 437372
456 Ga0209258_100071 3300025242 Bacteria 278319
457 Ga0209258_100459 3300025242 Bacteria 44386
458 Ga0209258_100792 3300025242 Bacteria 18794
459 Ga0209258_101200 3300025242 Bacteria 10284
460 Ga0209258_103464 3300025242 Bacteria 3390
461 Ga0209646_1000895 3300025246 Bacteria 9727
462 Ga0209646_1001788 3300025246 Bacteria 5375
463 Ga0209026_1000187 3300025250 Bacteria 90872
464 Ga0209026_1000223 3300025250 Bacteria 77328
465 Ga0209677_100039 3300025253 Bacteria 243974
466 Ga0209148_1000001 3300025254 Bacteria 2545271
467 Ga0209148_1000002 3300025254 Bacteria 2399500
468 Ga0209148_1004832 3300025254 Bacteria 3213
469 Ga0209759_1001491 3300025256 Bacteria 12985
470 Ga0209759_1001499 3300025256 Bacteria 12890
471 Ga0209759_1001939 3300025256 Bacteria 10058
472 Ga0209759_1003025 3300025256 Bacteria 6937
473 Ga0209759_1003373 3300025256 Bacteria 6411
474 Ga0209129_1002340 3300025258 Bacteria 9382
475 Ga0209233_1000002 3300025261 Bacteria 2501366
476 Ga0209233_1000115 3300025261 Bacteria 243344
477 Ga0209233_1020535 3300025261 Bacteria 1730
478 Ga0209233_1023887 3300025261 Bacteria 1538
479 Ga0209565_1000009 3300025263 Bacteria 751701
480 Ga0209455_1000030 3300025272 Bacteria 533479
481 Ga0209455_1000054 3300025272 Bacteria 358936
482 Ga0209455_1000427 3300025272 Bacteria 32971
483 Ga0209455_1000628 3300025272 Bacteria 21902
484 Ga0209455_1003037 3300025272 Bacteria 6141
485 Ga0209673_1000036 3300025273 Bacteria 323162
486 Ga0209673_1007680 3300025273 Bacteria 4916
487 Ga0209130_1000044 3300025284 Bacteria 241110
488 Ga0209130_1000188 3300025284 Bacteria 86963
489 Ga0209130_1002498 3300025284 Bacteria 9091
490 Ga0209675_1000013 3300025291 Bacteria 448220
491 Ga0209675_1000078 3300025291 Bacteria 156111
492 Ga0209675_1007119 3300025291 Bacteria 4349
493 Ga0209676_1000121 3300025292 Bacteria 198920
494 Ga0209676_1000345 3300025292 Bacteria 88051
495 Ga0209676_1000440 3300025292 Bacteria 71013
496 Ga0209676_1004038 3300025292 Bacteria 8449
497 Ga0209025_1000051 3300025294 Bacteria 330080
498 Ga0209025_1038002 3300025294 Bacteria 2125
499 Ga0209564_1000122 3300025295 Bacteria 203709
500 Ga0209564_1000133 3300025295 Bacteria 189140
501 Ga0209564_1000202 3300025295 Bacteria 136555
502 Ga0209758_1001007 3300025297 Bacteria 37395
503 Ga0209758_1048733 3300025297 Bacteria 1502
504 Ga0209758_1066634 3300025297 Bacteria 1156
505 Ga0209050_1001731 3300025298 Bacteria 21722
506 Ga0209050_1002704 3300025298 Bacteria 14408
507 Ga0209256_1000106 3300025299 Bacteria 187258
508 Ga0209256_1001832 3300025299 Bacteria 19843
509 Ga0209256_1008649 3300025299 Bacteria 4663
510 Ga0209256_1010324 3300025299 Bacteria 3931
511 Ga0207426_1049454 3300025302 Bacteria 1258
512 Ga0209051_1000979 3300025303 Bacteria 27790
513 Ga0209051_1005522 3300025303 Bacteria 7372
514 Ga0209257_1000065 3300025304 Bacteria 353604
515 Ga0209257_1000121 3300025304 Bacteria 222588
516 Ga0209257_1000356 3300025304 Bacteria 93656
517 Ga0209257_1000452 3300025304 Bacteria 77144
518 Ga0209257_1001064 3300025304 Bacteria 36288
519 Ga0209257_1028082 3300025304 Bacteria 1858
520 Ga0209257_1068871 3300025304 Bacteria 939
521 Ga0207697_10017549 3300025315 Bacteria 2941
522 Ga0207697_10038369 3300025315 Bacteria 1964
523 Ga0207656_10079257 3300025321 Bacteria 1473
524 Ga0207696_1000165 3300025711 Bacteria 104683
525 Ga0207696_1001780 3300025711 Bacteria 11122
526 Ga0207655_1000603 3300025728 Bacteria 43527
527 Ga0207655_1000772 3300025728 Bacteria 35772
528 Ga0207655_1003483 3300025728 Bacteria 11691
529 Ga0207655_1004427 3300025728 Bacteria 9962
530 Ga0207655_1012890 3300025728 Bacteria 4840
531 Ga0207655_1014595 3300025728 Bacteria 4429
532 Ga0207655_1029630 3300025728 Bacteria 2559
533 Ga0207713_1001400 3300025735 Bacteria 19498
534 Ga0207713_1003713 3300025735 Bacteria 10262
535 Ga0207713_1017174 3300025735 Bacteria 3641
536 Ga0207682_10001014 3300025893 Bacteria 13035
537 Ga0207682_10182826 3300025893 Bacteria 958
538 Ga0207710_10017120 3300025900 Bacteria 3072
539 Ga0207680_10033556 3300025903 Bacteria 2929
540 Ga0207680_10036168 3300025903 Bacteria 2842
541 Ga0207680_10438600 3300025903 Bacteria 926
542 Ga0207647_10002310 3300025904 Bacteria 14530
543 Ga0207647_10003842 3300025904 Bacteria 11237
544 Ga0207647_10005179 3300025904 Bacteria 9593
545 Ga0207645_10000428 3300025907 Bacteria 34870
546 Ga0207645_10018585 3300025907 Bacteria 4569
547 Ga0207645_10025328 3300025907 Bacteria 3839
548 Ga0207643_10028023 3300025908 Bacteria 3125
549 Ga0207643_10057340 3300025908 Bacteria 2217
550 Ga0207705_10171889 3300025909 Bacteria 1632
551 Ga0207705_10205601 3300025909 Bacteria 1492
552 Ga0207705_10220760 3300025909 Bacteria 1440
553 Ga0207705_10234864 3300025909 Bacteria 1395
554 Ga0207707_10052033 3300025912 Bacteria 3566
555 Ga0207707_10303155 3300025912 Bacteria 1381
556 Ga0207695_10001702 3300025913 Bacteria 35225
557 Ga0207695_10003515 3300025913 Bacteria 21943
558 Ga0207695_10007231 3300025913 Bacteria 14184
559 Ga0207695_10012415 3300025913 Bacteria 10229
560 Ga0207695_10021072 3300025913 Bacteria 7444
561 Ga0207695_10242701 3300025913 Bacteria 1702
562 Ga0207695_10313859 3300025913 Bacteria 1458
563 Ga0207671_10000059 3300025914 Bacteria 179761
564 Ga0207671_10000135 3300025914 Bacteria 112401
565 Ga0207671_10000713 3300025914 Bacteria 42635
566 Ga0207671_10004409 3300025914 Bacteria 13488
567 Ga0207671_10223289 3300025914 Bacteria 1476
568 Ga0207671_10269649 3300025914 Bacteria 1341
569 Ga0207660_10154998 3300025917 Bacteria 1763
570 Ga0207657_10009078 3300025919 Bacteria 10037
571 Ga0207657_10067795 3300025919 Bacteria 3033
572 Ga0207649_10000007 3300025920 Bacteria 334217
573 Ga0207649_10019952 3300025920 Bacteria 3838
574 Ga0207649_10123389 3300025920 Bacteria 1749
575 Ga0207649_10159895 3300025920 Bacteria 1560
576 Ga0207649_10213836 3300025920 Bacteria 1369
577 Ga0207649_10272468 3300025920 Bacteria 1227
578 Ga0207652_10530962 3300025921 Bacteria 1058
579 Ga0207681_10073391 3300025923 Bacteria 2393
580 Ga0207694_10042761 3300025924 Bacteria 3496
581 Ga0207650_10034174 3300025925 Bacteria 3686
582 Ga0207650_10124175 3300025925 Bacteria 2013
583 Ga0207650_10263864 3300025925 Bacteria 1398
584 Ga0207659_10131071 3300025926 Bacteria 1935
585 Ga0207687_10043694 3300025927 Bacteria 3089
586 Ga0207687_10186128 3300025927 Bacteria 1612
587 Ga0207700_10260945 3300025928 Bacteria 1483
588 Ga0207664_10044849 3300025929 Bacteria 3464
589 Ga0207664_10563071 3300025929 Bacteria 1023
590 Ga0207644_10070897 3300025931 Bacteria 2548
591 Ga0207644_10087503 3300025931 Bacteria 2315
592 Ga0207644_10323607 3300025931 Bacteria 1247
593 Ga0207690_10014282 3300025932 Bacteria 4795
594 Ga0207690_10096449 3300025932 Bacteria 2103
595 Ga0207706_10057627 3300025933 Bacteria 3422
596 Ga0207706_10094002 3300025933 Bacteria 2637
597 Ga0207706_10133108 3300025933 Bacteria 2187
598 Ga0207706_10138154 3300025933 Bacteria 2144
599 Ga0207706_10588517 3300025933 Bacteria 956
600 Ga0207686_10001532 3300025934 Bacteria 13024
601 Ga0207686_10607395 3300025934 Bacteria 861
602 Ga0207709_10065230 3300025935 Bacteria 2289
603 Ga0207670_10565835 3300025936 Bacteria 930
604 Ga0207669_10544061 3300025937 Bacteria 936
605 Ga0207704_10010676 3300025938 Bacteria 4489
606 Ga0207704_10115126 3300025938 Bacteria 1827
607 Ga0207691_10000127 3300025940 Bacteria 69355
608 Ga0207691_10004858 3300025940 Bacteria 12997
609 Ga0207691_10071976 3300025940 Bacteria 3118
610 Ga0207691_10133688 3300025940 Bacteria 2189
611 Ga0207691_10172497 3300025940 Bacteria 1893
612 Ga0207691_10234026 3300025940 Bacteria 1590
613 Ga0207689_10262507 3300025942 Bacteria 1429
614 Ga0207661_10003004 3300025944 Bacteria 11670
615 Ga0207661_10041845 3300025944 Bacteria 3609
616 Ga0207661_10091582 3300025944 Bacteria 2533
617 Ga0207661_10102213 3300025944 Bacteria 2409
618 Ga0207661_10227205 3300025944 Bacteria 1651
619 Ga0207679_10000013 3300025945 Bacteria 334197
620 Ga0207679_10007435 3300025945 Bacteria 6949
621 Ga0207679_10055251 3300025945 Bacteria 2926
622 Ga0207679_10153761 3300025945 Bacteria 1876
623 Ga0207679_10246545 3300025945 Bacteria 1516
624 Ga0207679_11229545 3300025945 Unclassified 687
625 Ga0207667_10000292 3300025949 Bacteria 69279
626 Ga0207667_10000486 3300025949 Bacteria 52631
627 Ga0207667_10009358 3300025949 Bacteria 11553
628 Ga0207667_10055825 3300025949 Bacteria 4150
629 Ga0207667_10121940 3300025949 Bacteria 2686
630 Ga0207667_10471054 3300025949 Bacteria 1275
631 Ga0207651_10341407 3300025960 Bacteria 1258
632 Ga0207651_10452334 3300025960 Bacteria 1102
633 Ga0207668_10021890 3300025972 Bacteria 4082
634 Ga0207668_10122115 3300025972 Bacteria 1974
635 Ga0207668_10124149 3300025972 Bacteria 1960
636 Ga0207668_10223889 3300025972 Bacteria 1512
637 Ga0207668_10356560 3300025972 Bacteria 1224
638 Ga0207668_10469968 3300025972 Bacteria 1077
639 Ga0207668_10620511 3300025972 Bacteria 943
640 Ga0207640_10000471 3300025981 Bacteria 24571
641 Ga0207640_10000670 3300025981 Bacteria 19993
642 Ga0207640_10018115 3300025981 Bacteria 4132
643 Ga0207640_10021026 3300025981 Bacteria 3882
644 Ga0207640_10053029 3300025981 Bacteria 2645
645 Ga0207640_10182581 3300025981 Bacteria 1574
646 Ga0207658_10044979 3300025986 Bacteria 3216
647 Ga0207658_10059775 3300025986 Bacteria 2841
648 Ga0207658_10065595 3300025986 Bacteria 2727
649 Ga0207658_10117646 3300025986 Bacteria 2113
650 Ga0207677_10026161 3300026023 Bacteria 3654
651 Ga0207677_10088036 3300026023 Bacteria 2250
652 Ga0207677_10892240 3300026023 Bacteria 801
653 Ga0207703_10132703 3300026035 Bacteria 2153
654 Ga0207703_10536907 3300026035 Bacteria 1102
655 Ga0207703_10553092 3300026035 Bacteria 1085
656 Ga0207703_10931067 3300026035 Bacteria 832
657 Ga0207639_10193654 3300026041 Bacteria 1738
658 Ga0207678_10000969 3300026067 Bacteria 26231
659 Ga0207678_10032281 3300026067 Bacteria 4563
660 Ga0207678_10143379 3300026067 Bacteria 2039
661 Ga0207678_10145112 3300026067 Bacteria 2026
662 Ga0207678_10724564 3300026067 Bacteria 876
663 Ga0207708_10235273 3300026075 Bacteria 1472
664 Ga0207702_11166583 3300026078 Bacteria 764
665 Ga0207641_10049260 3300026088 Bacteria 3559
666 Ga0207641_10173981 3300026088 Bacteria 1967
667 Ga0207641_10265698 3300026088 Bacteria 1608
668 Ga0207641_10323837 3300026088 Bacteria 1462
669 Ga0207641_10331629 3300026088 Bacteria 1445
670 Ga0207641_10346093 3300026088 Bacteria 1416
671 Ga0207641_10365360 3300026088 Bacteria 1379
672 Ga0207641_10877082 3300026088 Unclassified 890
673 Ga0207641_11113180 3300026088 Bacteria 788
674 Ga0207648_10004283 3300026089 Bacteria 14715
675 Ga0207648_10011720 3300026089 Bacteria 8244
676 Ga0207648_10023017 3300026089 Bacteria 5587
677 Ga0207648_10265180 3300026089 Bacteria 1533
678 Ga0207676_10032072 3300026095 Bacteria 3956
679 Ga0207676_10048307 3300026095 Bacteria 3303
680 Ga0207676_10170681 3300026095 Bacteria 1895
681 Ga0207674_10000298 3300026116 Bacteria 62902
682 Ga0207674_10010196 3300026116 Bacteria 10673
683 Ga0207674_10011014 3300026116 Bacteria 10169
684 Ga0207674_10155541 3300026116 Bacteria 2242
685 Ga0207675_100012815 3300026118 Bacteria 7834
686 Ga0207675_100029062 3300026118 Bacteria 5151
687 Ga0207675_100075242 3300026118 Bacteria 3161
688 Ga0207675_100162337 3300026118 Bacteria 2132
689 Ga0207675_100862005 3300026118 Bacteria 921
690 Ga0207683_10000009 3300026121 Bacteria 150281
691 Ga0207698_10008277 3300026142 Bacteria 6567
692 Ga0207698_10019529 3300026142 Bacteria 4642
693 Ga0207698_10046054 3300026142 Bacteria 3290
694 Ga0207698_10140636 3300026142 Bacteria 2079
695 Ga0207698_10215874 3300026142 Bacteria 1730
696 Ga0207698_10388092 3300026142 Bacteria 1331
697 Ga0207698_10711551 3300026142 Bacteria 1000
698 Ga0209281_1013031 3300027111 Bacteria 1806
699 Ga0209371_1000023 3300027312 Bacteria 519553
700 Ga0207428_10015977 3300027907 Bacteria 6471
701 Ga0207428_10203634 3300027907 Bacteria 1489
702 Ga0268266_10005005 3300028379 Bacteria 12518
703 Ga0268266_10060827 3300028379 Bacteria 3256
704 Ga0268266_10172820 3300028379 Bacteria 1962
705 Ga0268266_10297171 3300028379 Bacteria 1505
706 Ga0268266_10922761 3300028379 Bacteria 845
707 Ga0268266_11010465 3300028379 Bacteria 805
708 Ga0268265_10289752 3300028380 Bacteria 1469
709 Ga0268264_10058224 3300028381 Bacteria 3235
710 Ga0268264_10070210 3300028381 Bacteria 2965
711 Ga0268264_10081212 3300028381 Bacteria 2770
712 Ga0268264_10643278 3300028381 Bacteria 1049
713 Ga0268264_10678496 3300028381 Bacteria 1022
714 Ga0307517_10005849 3300028786 Bacteria 18395
715 Ga0307517_10010226 3300028786 Bacteria 13164
716 Ga0307517_10104066 3300028786 Bacteria 2213
717 Ga0307517_10217316 3300028786 Bacteria 1167
718 Ga0307515_10013824 3300028794 Bacteria 15040
719 Ga0307515_10133079 3300028794 Bacteria 2723
720 Ga0265338_10000118 3300028800 Bacteria 146710
721 Ga0268256_1000023 3300030500 Bacteria 519631
722 Ga0268256_1000050 3300030500 Bacteria 300675
723 Ga0316177_1104169 3300030731 Bacteria 1494
724 Ga0316181_1003769 3300030744 Bacteria 2103
725 Ga0265332_10020812 3300031238 Bacteria 2897
726 Ga0265340_10063801 3300031247 Bacteria 1757
727 Ga0265316_10205203 3300031344 Bacteria 1460
728 Ga0307513_10020408 3300031456 Bacteria 7861
729 Ga0307513_10052805 3300031456 Bacteria 4374
730 Ga0307513_10086379 3300031456 Bacteria 3216
731 Ga0307513_10117764 3300031456 Bacteria 2633
732 Ga0307513_10138965 3300031456 Bacteria 2359
733 Ga0307513_10350485 3300031456 Unclassified 1224
734 Ga0307509_10000052 3300031507 Bacteria 164947
735 Ga0307509_10003622 3300031507 Bacteria 23190
736 Ga0307509_10023567 3300031507 Bacteria 6906
737 Ga0307509_10034645 3300031507 Bacteria 5545
738 Ga0307509_10067060 3300031507 Bacteria 3761
739 Ga0307509_10147362 3300031507 Bacteria 2276
740 Ga0307408_100000194 3300031548 Bacteria 65753
741 Ga0307408_100020906 3300031548 Bacteria 4423
742 Ga0307408_100100941 3300031548 Bacteria 2198
743 Ga0307408_100190230 3300031548 Bacteria 1653
744 Ga0307508_10002365 3300031616 Bacteria 19947
745 Ga0307508_10442277 3300031616 Bacteria 892
746 Ga0307508_10481723 3300031616 Bacteria 834
747 Ga0307514_10012360 3300031649 Bacteria 7101
748 Ga0307516_10007666 3300031730 Bacteria 12353
749 Ga0307516_10063274 3300031730 Bacteria 3582
750 Ga0307516_10134536 3300031730 Bacteria 2248
751 Ga0307516_10167955 3300031730 Bacteria 1937
752 Ga0307516_10251391 3300031730 Bacteria 1462
753 Ga0307516_10653191 3300031730 Bacteria 707
754 Ga0307405_10164241 3300031731 Bacteria 1576
755 Ga0307405_10301078 3300031731 Bacteria 1216
756 Ga0307413_10025015 3300031824 Bacteria 3265
757 Ga0307413_10226532 3300031824 Bacteria 1369
758 Ga0307410_10080021 3300031852 Bacteria 2291
759 Ga0307410_10306209 3300031852 Bacteria 1255
760 Ga0307406_10130772 3300031901 Bacteria 1762
761 Ga0307406_10539633 3300031901 Bacteria 952
762 Ga0307407_10005761 3300031903 Bacteria 5417
763 Ga0307407_10133122 3300031903 Bacteria 1594
764 Ga0307412_10047860 3300031911 Bacteria 2809
765 Ga0307409_100037068 3300031995 Bacteria 3591
766 Ga0307409_100075501 3300031995 Bacteria 2699
767 Ga0307409_100207555 3300031995 Bacteria 1758
768 Ga0307409_100536681 3300031995 Bacteria 1146
769 Ga0307416_100019933 3300032002 Bacteria 4769
770 Ga0307416_100068548 3300032002 Bacteria 2932
771 Ga0307416_100307980 3300032002 Bacteria 1578
772 Ga0307414_10112044 3300032004 Bacteria 2079
773 Ga0307414_10236516 3300032004 Bacteria 1509
774 Ga0307414_10510780 3300032004 Bacteria 1065
775 Ga0307507_10092396 3300033179 Bacteria 2583
776 Ga0307507_10117726 3300033179 Bacteria 2140
777 Ga0307510_10000118 3300033180 Bacteria 63011
778 Ga0307510_10014576 3300033180 Bacteria 9303
779 Ga0307510_10088730 3300033180 Bacteria 2950
780 Ga0307510_10120543 3300033180 Bacteria 2329
781 Ga0307510_10145502 3300033180 Bacteria 2003
782 Ga0307510_10184103 3300033180 Bacteria 1646
783 Ga0373940_0087971 3300035088 Bacteria 927
784 Ga0373951_0081722 3300035091 Bacteria 837
785 Ga0373932_0054478 3300035112 Bacteria 1197
786 Ga0373931_0072019 3300035691 Bacteria 1889
787 Ga0373931_0239671 3300035691 Bacteria 1099
788 Ga0373947_0163753 3300035725 Bacteria 1439
789 Ga0373947_0420280 3300035725 Bacteria 903
790 Ga0373947_0721919 3300035725 Bacteria 680
791 Ga0373937_0025086 3300036401 Bacteria 5382
792 Ga0373937_0341074 3300036401 Bacteria 1419
793 Ga0373925_0212396 3300037068 Bacteria 1542
794 Ga0373925_0254489 3300037068 Bacteria 1409
795 Ga0395899_0000012 3300037312 Bacteria 517561
796 Ga0395899_0005005 3300037312 Bacteria 10313
797 Ga0395899_0010317 3300037312 Bacteria 7162
798 Ga0395899_0012450 3300037312 Bacteria 6517
799 Ga0395899_0195356 3300037312 Bacteria 1414
800 Ga0395900_0002549 3300037418 Bacteria 19963
801 Ga0395900_0006267 3300037418 Bacteria 12412
802 Ga0395900_0092457 3300037418 Bacteria 3108
803 Ga0395900_0124178 3300037418 Bacteria 2647
804 Ga0395898_0005884 3300037466 Bacteria 13184
805 Ga0395898_0110701 3300037466 Bacteria 2632
806 Ga0395898_0508189 3300037466 Bacteria 1146
807 Ga0395898_0626058 3300037466 Bacteria 1018
808 Ga0395905_0000136 3300037471 Bacteria 121009
809 Ga0395905_0001886 3300037471 Bacteria 24164
810 Ga0395905_0055632 3300037471 Bacteria 3703
811 Ga0395905_0147935 3300037471 Bacteria 2210
812 Ga0436364_0034966 3300037853 Bacteria 762
813 Ga0436364_0389486 3300037853 Bacteria 795
814 Ga0436364_0471363 3300037853 Bacteria 869
815 Ga0436364_1529296 3300037853 Bacteria 12470
816 Ga0395901_0001400 3300038443 Bacteria 25196
817 Ga0395901_0003633 3300038443 Bacteria 15561
818 Ga0395901_0003670 3300038443 Bacteria 15482
819 Ga0395901_0630531 3300038443 Bacteria 1078
820 Ga0237819_00624 3300038705 Bacteria 11567
821 Ga0237819_07641 3300038705 Bacteria 1540
822 Ga0400483_000346 3300039062 Bacteria 4820
823 Ga0400483_020937 3300039062 Bacteria 11125
824 Ga0400483_095196 3300039062 Bacteria 15889
825 Ga0400483_163079 3300039062 Bacteria 1305
826 Ga0400483_171786 3300039062 Bacteria 5041
827 Ga0400483_248084 3300039062 Bacteria 9234
828 Ga0400483_248289 3300039062 Bacteria 9961
829 Ga0436361_0821396 3300039447 Bacteria 16496
830 Ga0436362_0202120 3300039453 Bacteria 1813
831 Ga0439438_004655 3300041405 Bacteria 5215
832 Ga0439447_002799 3300041407 Bacteria 6291
833 Ga0439466_0004451 3300041411 Bacteria 5392
834 Ga0439431_0010973 3300041997 Bacteria 2064
835 Ga0439448_0023985 3300042005 Bacteria 1906
836 Ga0439432_016961 3300042006 Bacteria 2447
837 Ga0439449_0065883 3300042007 Bacteria 1336
838 Ga0439451_000445 3300042009 Bacteria 8055
839 Ga0439451_004420 3300042009 Bacteria 2855
840 Ga0439452_000485 3300042010 Bacteria 22057
841 Ga0439452_019785 3300042010 Bacteria 1774
842 Ga0439462_0032484 3300042015 Bacteria 1383
843 Ga0439463_002054 3300042016 Bacteria 5222
844 Ga0439463_025189 3300042016 Bacteria 1492
845 Ga0439463_057533 3300042016 Bacteria 993
846 Ga0450911_001553 3300042115 Bacteria 5205
847 Ga0450911_003577 3300042115 Bacteria 2707
848 Ga0450913_008653 3300042117 Bacteria 787
849 Ga0450890_000729 3300042127 Bacteria 4769
850 Ga0450891_003745 3300042129 Bacteria 1451
851 Ga0450903_014414 3300042138 Bacteria 1250
852 Ga0450907_009459 3300042146 Bacteria 1616
853 Ga0439446_0087263 3300042156 Bacteria 973
854 Ga0439446_0169028 3300042156 Bacteria 726
855 Ga0439435_0112338 3300042436 Unclassified 847
856 Ga0439464_0004285 3300042439 Bacteria 3644
857 Ga0439460_0004154 3300042461 Bacteria 3524
858 Ga0451577_0000561 3300042876 Bacteria 60402
859 Ga0466969_0002544 3300044656 Bacteria 9741
860 Ga0466969_0017277 3300044656 Bacteria 3770
861 Ga0466969_0034736 3300044656 Bacteria 2553
862 Ga0466972_0062241 3300044658 Bacteria 1788
863 Ga0466972_0137285 3300044658 Bacteria 1151
864 Ga0466982_0000044 3300044672 Bacteria 38923
865 Ga0466965_0016690 3300044683 Bacteria 3498
866 Ga0466966_0000701 3300044684 Bacteria 21320
867 Ga0466966_0002676 3300044684 Bacteria 11672
868 Ga0466961_0002712 3300044693 Bacteria 11005
869 Ga0466961_0003965 3300044693 Bacteria 9260
870 Ga0466961_0070693 3300044693 Bacteria 2215
871 Ga0466963_0240141 3300044694 Bacteria 1270
872 Ga0466964_0022707 3300044706 Bacteria 2436
873 Ga0466964_0052165 3300044706 Bacteria 1681
874 Ga0453684_0532631 3300044712 Bacteria 1296
875 Ga0466971_0004296 3300044719 Bacteria 6142
876 Ga0466971_0090701 3300044719 Bacteria 1399
877 Ga0466971_0210867 3300044719 Bacteria 919
878 Ga0466968_0008215 3300044735 Bacteria 3992
879 Ga0466968_0068779 3300044735 Bacteria 1538
880 Ga0466970_0003084 3300044765 Bacteria 8089
881 Ga0466970_0013349 3300044765 Bacteria 4211
882 Ga0466970_0179059 3300044765 Bacteria 1176
883 Ga0466970_0381209 3300044765 Unclassified 803
884 Ga0466957_0004013 3300044842 Bacteria 8140
885 Ga0466960_0030336 3300044901 Bacteria 2487
886 Ga0466959_0000100 3300045049 Bacteria 54979
887 Ga0466959_0020575 3300045049 Bacteria 4862
888 Ga0466959_0139992 3300045049 Bacteria 1711
889 Ga0466959_0167906 3300045049 Bacteria 1540
890 Ga0466959_0288700 3300045049 Bacteria 1125
891 Ga0466959_0436775 3300045049 Bacteria 888
892 Ga0451576_0097798 3300045051 Bacteria 3052
893 Ga0451576_0132455 3300045051 Bacteria 2599
894 Ga0451576_0220133 3300045051 Bacteria 1982
895 Ga0466958_0006453 3300045836 Bacteria 6384
896 Ga0466958_0287134 3300045836 Bacteria 1055
897 Ga0466967_0111240 3300045976 Bacteria 2517
898 Ga0466967_0205699 3300045976 Bacteria 1866
899 Ga0466967_0356071 3300045976 Bacteria 1417
900 Ga0495617_086552 3300046452 Bacteria 1024
901 Ga0495617_093614 3300046452 Bacteria 979
902 Ga0495627_002371 3300046453 Bacteria 9195
903 Ga0495627_003650 3300046453 Bacteria 6678
904 Ga0495627_004572 3300046453 Bacteria 5752
905 Ga0495592_0000142 3300046454 Bacteria 63571
906 Ga0495592_0140582 3300046454 Bacteria 1680
907 Ga0495592_0435252 3300046454 Bacteria 824
908 Ga0495603_0090152 3300046455 Bacteria 1793
909 Ga0495590_0053594 3300046457 Bacteria 1408
910 Ga0495590_0075190 3300046457 Bacteria 1188
911 Ga0495591_000037 3300046458 Bacteria 158323
912 Ga0495591_000960 3300046458 Bacteria 19699
913 Ga0495591_001346 3300046458 Bacteria 15427
914 Ga0495591_001506 3300046458 Bacteria 14373
915 Ga0495591_001756 3300046458 Bacteria 12889
916 Ga0495591_002170 3300046458 Bacteria 11235
917 Ga0495591_002395 3300046458 Bacteria 10486
918 Ga0495591_007687 3300046458 Bacteria 4537
919 Ga0495591_047522 3300046458 Bacteria 1187
920 Ga0495629_0309896 3300046459 Bacteria 1080
921 Ga0495638_0000048 3300046460 Bacteria 209787
922 Ga0495638_0000116 3300046460 Bacteria 128087
923 Ga0495638_0000609 3300046460 Bacteria 40051
924 Ga0495638_0004826 3300046460 Bacteria 10156
925 Ga0495638_0005132 3300046460 Bacteria 9801
926 Ga0495638_0005434 3300046460 Bacteria 9478
927 Ga0495638_0006182 3300046460 Bacteria 8746
928 Ga0495638_0006896 3300046460 Bacteria 8198
929 Ga0495638_0009403 3300046460 Bacteria 6867
930 Ga0495638_0014627 3300046460 Bacteria 5295
931 Ga0495638_0051434 3300046460 Bacteria 2569
932 Ga0495638_0065460 3300046460 Bacteria 2237
933 Ga0495638_0089304 3300046460 Bacteria 1859
934 Ga0495638_0175133 3300046460 Bacteria 1228
935 Ga0495651_0001526 3300046462 Bacteria 17899
936 Ga0495651_0017466 3300046462 Bacteria 5556
937 Ga0495653_0010928 3300046463 Bacteria 7434
938 Ga0495653_0046847 3300046463 Bacteria 3346
939 Ga0495653_0207640 3300046463 Bacteria 1325
940 Ga0495650_0000064 3300046471 Bacteria 275412
941 Ga0495650_0000174 3300046471 Bacteria 142519
942 Ga0495650_0001163 3300046471 Bacteria 28128
943 Ga0495650_0005976 3300046471 Bacteria 7710
944 Ga0495650_0011700 3300046471 Bacteria 4778
945 Ga0495582_0028785 3300046473 Bacteria 3049
946 Ga0495605_0000036 3300046474 Bacteria 203902
947 Ga0495605_0000849 3300046474 Bacteria 21311
948 Ga0495605_0002810 3300046474 Bacteria 10584
949 Ga0495605_0013595 3300046474 Bacteria 4479
950 Ga0495605_0019669 3300046474 Bacteria 3603
951 Ga0495605_0033210 3300046474 Bacteria 2622
952 Ga0495605_0069943 3300046474 Bacteria 1660
953 Ga0495639_0037023 3300046475 Unclassified 2187
954 Ga0495639_0063650 3300046475 Bacteria 1694
955 Ga0495664_0355824 3300046477 Bacteria 881
956 Ga0495584_0002037 3300046491 Bacteria 11614
957 Ga0495584_0003914 3300046491 Bacteria 8049
958 Ga0495584_0019260 3300046491 Bacteria 3466
959 Ga0495584_0048988 3300046491 Bacteria 2129
960 Ga0495584_0095941 3300046491 Bacteria 1497
961 Ga0495584_0212467 3300046491 Bacteria 983
962 Ga0495585_0002685 3300046492 Bacteria 12473
963 Ga0495585_0013417 3300046492 Bacteria 4795
964 Ga0495585_0192600 3300046492 Bacteria 1042
965 Ga0495594_0001898 3300046499 Bacteria 10887
966 Ga0495594_0067344 3300046499 Bacteria 1987
967 Ga0495596_0003157 3300046500 Bacteria 8489
968 Ga0495607_0000149 3300046501 Bacteria 73673
969 Ga0495607_0001076 3300046501 Bacteria 24950
970 Ga0495607_0001283 3300046501 Bacteria 22484
971 Ga0495607_0001388 3300046501 Bacteria 21548
972 Ga0495607_0009553 3300046501 Bacteria 6554
973 Ga0495607_0018552 3300046501 Bacteria 4434
974 Ga0495607_0021322 3300046501 Bacteria 4078
975 Ga0495607_0040702 3300046501 Bacteria 2764
976 Ga0495607_0060814 3300046501 Bacteria 2148
977 Ga0495607_0061381 3300046501 Bacteria 2136
978 Ga0495607_0061828 3300046501 Bacteria 2126
979 Ga0495607_0112849 3300046501 Bacteria 1438
980 Ga0495607_0189239 3300046501 Bacteria 1026
981 Ga0495607_0190950 3300046501 Bacteria 1020
982 Ga0495583_0000028 3300046506 Bacteria 255787
983 Ga0495583_0000271 3300046506 Bacteria 85085
984 Ga0495583_0003346 3300046506 Bacteria 12366
985 Ga0495583_0003399 3300046506 Bacteria 12174
986 Ga0495583_0004619 3300046506 Bacteria 9731
987 Ga0495583_0005967 3300046506 Bacteria 8081
988 Ga0495583_0007992 3300046506 Bacteria 6542
989 Ga0495583_0017345 3300046506 Bacteria 3825
990 Ga0495583_0091190 3300046506 Bacteria 1311
991 Ga0495606_0000042 3300046507 Bacteria 215099
992 Ga0495606_0000094 3300046507 Bacteria 151840
993 Ga0495606_0000415 3300046507 Bacteria 71371
994 Ga0495606_0004342 3300046507 Bacteria 14233
995 Ga0495606_0006710 3300046507 Bacteria 10546
996 Ga0495606_0010458 3300046507 Bacteria 7697
997 Ga0495606_0014490 3300046507 Bacteria 6147
998 Ga0495606_0024275 3300046507 Bacteria 4373
999 Ga0495606_0036664 3300046507 Bacteria 3337
1000 Ga0495606_0039111 3300046507 Bacteria 3202
1001 Ga0495606_0052325 3300046507 Bacteria 2656
1002 Ga0495606_0088236 3300046507 Bacteria 1912
1003 Ga0495606_0169291 3300046507 Bacteria 1269
1004 Ga0495608_0014841 3300046511 Bacteria 5405
1005 Ga0495608_0214098 3300046511 Bacteria 1210
1006 Ga0495610_0002926 3300046512 Bacteria 13804
1007 Ga0495610_0011761 3300046512 Bacteria 5316
1008 Ga0495610_0019341 3300046512 Bacteria 3815
1009 Ga0495610_0021121 3300046512 Bacteria 3587
1010 Ga0495610_0026266 3300046512 Bacteria 3111
1011 Ga0495610_0034583 3300046512 Bacteria 2602
1012 Ga0495610_0053459 3300046512 Bacteria 1956
1013 Ga0495610_0083878 3300046512 Bacteria 1457
1014 Ga0495610_0132491 3300046512 Bacteria 1081
1015 Ga0495616_0006962 3300046513 Bacteria 6809
1016 Ga0495616_0013952 3300046513 Bacteria 4514
1017 Ga0495616_0049861 3300046513 Bacteria 2096
1018 Ga0495616_0257611 3300046513 Bacteria 747
1019 Ga0495618_0117375 3300046514 Bacteria 1704
1020 Ga0495618_0489653 3300046514 Bacteria 742
1021 Ga0495620_0000322 3300046515 Bacteria 33867
1022 Ga0495620_0000370 3300046515 Bacteria 30870
1023 Ga0495620_0000712 3300046515 Bacteria 20529
1024 Ga0495620_0004434 3300046515 Bacteria 7912
1025 Ga0495620_0015211 3300046515 Bacteria 3889
1026 Ga0495620_0029580 3300046515 Bacteria 2532
1027 Ga0495620_0041274 3300046515 Bacteria 2025
1028 Ga0495620_0073965 3300046515 Bacteria 1389
1029 Ga0495620_0120267 3300046515 Bacteria 1035
1030 Ga0495628_0019455 3300046516 Bacteria 5612
1031 Ga0495628_0023111 3300046516 Bacteria 5105
1032 Ga0495628_0043863 3300046516 Bacteria 3560
1033 Ga0495630_0302918 3300046517 Bacteria 1221
1034 Ga0495630_0343695 3300046517 Bacteria 1142
1035 Ga0495631_0009296 3300046518 Bacteria 4915
1036 Ga0495631_0013326 3300046518 Bacteria 3992
1037 Ga0495631_0058600 3300046518 Bacteria 1674
1038 Ga0495631_0077096 3300046518 Bacteria 1438
1039 Ga0495632_0000839 3300046519 Bacteria 27070
1040 Ga0495632_0002490 3300046519 Bacteria 13979
1041 Ga0495632_0003654 3300046519 Bacteria 10796
1042 Ga0495632_0007029 3300046519 Bacteria 7136
1043 Ga0495632_0017521 3300046519 Bacteria 3950
1044 Ga0495632_0068575 3300046519 Bacteria 1709
1045 Ga0495632_0076860 3300046519 Bacteria 1596
1046 Ga0495632_0112566 3300046519 Bacteria 1277
1047 Ga0495632_0244946 3300046519 Bacteria 805
1048 Ga0495637_0000518 3300046520 Bacteria 27995
1049 Ga0495637_0002120 3300046520 Bacteria 11144
1050 Ga0495637_0002498 3300046520 Bacteria 10150
1051 Ga0495637_0006632 3300046520 Bacteria 5795
1052 Ga0495637_0011157 3300046520 Bacteria 4322
1053 Ga0495637_0013035 3300046520 Bacteria 3958
1054 Ga0495637_0054447 3300046520 Bacteria 1662
1055 Ga0495637_0090531 3300046520 Bacteria 1207
1056 Ga0495637_0098999 3300046520 Bacteria 1141
1057 Ga0495643_0001985 3300046522 Bacteria 17133
1058 Ga0495643_0027906 3300046522 Bacteria 3168
1059 Ga0495643_0072791 3300046522 Bacteria 1801
1060 Ga0495643_0228252 3300046522 Bacteria 879
1061 Ga0495643_0273125 3300046522 Bacteria 780
1062 Ga0495644_0003319 3300046523 Bacteria 6361
1063 Ga0495644_0022555 3300046523 Bacteria 2399
1064 Ga0495648_0003291 3300046524 Bacteria 14274
1065 Ga0495648_0009523 3300046524 Bacteria 7506
1066 Ga0495648_0012087 3300046524 Bacteria 6462
1067 Ga0495648_0015690 3300046524 Bacteria 5487
1068 Ga0495648_0021890 3300046524 Bacteria 4415
1069 Ga0495648_0021980 3300046524 Bacteria 4404
1070 Ga0495648_0034583 3300046524 Bacteria 3286
1071 Ga0495648_0085577 3300046524 Bacteria 1780
1072 Ga0495648_0328987 3300046524 Bacteria 705
1073 Ga0495663_0037378 3300046525 Unclassified 1464
1074 Ga0495666_0002123 3300046526 Bacteria 9831
1075 Ga0495666_0015904 3300046526 Bacteria 3747
1076 Ga0495642_0001683 3300046528 Bacteria 9580
1077 Ga0495652_0003383 3300046529 Bacteria 15774
1078 Ga0495652_0014655 3300046529 Bacteria 7030
1079 Ga0495652_0018360 3300046529 Bacteria 6237
1080 Ga0495652_0062372 3300046529 Bacteria 3143
1081 Ga0495654_0009795 3300046530 Bacteria 5236
1082 Ga0495654_0010614 3300046530 Bacteria 5005
1083 Ga0495654_0010779 3300046530 Bacteria 4965
1084 Ga0495654_0018508 3300046530 Bacteria 3649
1085 Ga0495654_0027630 3300046530 Bacteria 2907
1086 Ga0495654_0045750 3300046530 Bacteria 2158
1087 Ga0495654_0054388 3300046530 Bacteria 1942
1088 Ga0495654_0138228 3300046530 Bacteria 1088
1089 Ga0495586_0090429 3300046535 Bacteria 1690
1090 Ga0495587_0096907 3300046536 Bacteria 1701
1091 Ga0495609_0000115 3300046538 Bacteria 93419
1092 Ga0495609_0000395 3300046538 Bacteria 36677
1093 Ga0495609_0001220 3300046538 Bacteria 17715
1094 Ga0495609_0027036 3300046538 Bacteria 2623
1095 Ga0495609_0089017 3300046538 Bacteria 1343
1096 Ga0495609_0104390 3300046538 Bacteria 1226
1097 Ga0495597_0001034 3300046542 Bacteria 21263
1098 Ga0495597_0003290 3300046542 Bacteria 9561
1099 Ga0495597_0009290 3300046542 Bacteria 4866
1100 Ga0495597_0038735 3300046542 Bacteria 2136
1101 Ga0495645_0041759 3300046543 Bacteria 3344
1102 Ga0495645_0146948 3300046543 Bacteria 1641
1103 Ga0495645_0234638 3300046543 Bacteria 1227
1104 Ga0495622_0001521 3300046557 Bacteria 11587
1105 Ga0495622_0010711 3300046557 Bacteria 4231
1106 Ga0495622_0015667 3300046557 Bacteria 3524
1107 Ga0495633_0001693 3300046558 Bacteria 16578
1108 Ga0495633_0003880 3300046558 Bacteria 9752
1109 Ga0495633_0018744 3300046558 Bacteria 3510
1110 Ga0495633_0104180 3300046558 Bacteria 1316
1111 Ga0495668_0000025 3300046616 Bacteria 304546
1112 Ga0495668_0000034 3300046616 Bacteria 254171
1113 Ga0495668_0003196 3300046616 Bacteria 12548
1114 Ga0495668_0018558 3300046616 Bacteria 4019
1115 Ga0495668_0045515 3300046616 Bacteria 2440
1116 Ga0495611_0000736 3300046648 Bacteria 18466
1117 Ga0495611_0000932 3300046648 Bacteria 15712
1118 Ga0495611_0004344 3300046648 Bacteria 6144
1119 Ga0495611_0011566 3300046648 Bacteria 3743
1120 Ga0495611_0118484 3300046648 Bacteria 1234
1121 Ga0495625_0000672 3300046660 Bacteria 48741
1122 Ga0495625_0001328 3300046660 Bacteria 30717
1123 Ga0495625_0002338 3300046660 Bacteria 20719
1124 Ga0495625_0003330 3300046660 Bacteria 16184
1125 Ga0495625_0007862 3300046660 Bacteria 9187
1126 Ga0495625_0013918 3300046660 Bacteria 6441
1127 Ga0495625_0015980 3300046660 Bacteria 5920
1128 Ga0495625_0029666 3300046660 Bacteria 4087
1129 Ga0495625_0034457 3300046660 Bacteria 3737
1130 Ga0495625_0058185 3300046660 Bacteria 2747
1131 Ga0495625_0125368 3300046660 Bacteria 1744
1132 Ga0495625_0327292 3300046660 Bacteria 974
1133 Ga0495635_0142949 3300046663 Bacteria 1629
1134 Ga0495659_0003001 3300046664 Bacteria 5412
1135 Ga0495661_0000205 3300046665 Bacteria 68743
1136 Ga0495661_0000437 3300046665 Bacteria 44095
1137 Ga0495661_0000685 3300046665 Bacteria 33805
1138 Ga0495661_0001817 3300046665 Bacteria 17115
1139 Ga0495661_0015865 3300046665 Bacteria 5014
1140 Ga0495661_0021833 3300046665 Bacteria 4167
1141 Ga0495661_0030083 3300046665 Bacteria 3460
1142 Ga0495661_0050094 3300046665 Bacteria 2530
1143 Ga0495661_0117772 3300046665 Bacteria 1471
1144 Ga0495661_0170983 3300046665 Bacteria 1159
1145 Ga0495588_0386856 3300046674 Bacteria 734
1146 Ga0495657_0078730 3300046675 Bacteria 2136
1147 Ga0495657_0169271 3300046675 Bacteria 1346
1148 Ga0495599_0065919 3300046678 Bacteria 2262
1149 Ga0495599_0092568 3300046678 Bacteria 1886
1150 Ga0495623_0006272 3300046679 Bacteria 7731
1151 Ga0495623_0011011 3300046679 Bacteria 5853
1152 Ga0495623_0117161 3300046679 Bacteria 1608
1153 Ga0495646_0031113 3300046680 Bacteria 3329
1154 Ga0495646_0167151 3300046680 Bacteria 1214
1155 Ga0495669_0005645 3300046684 Bacteria 5222
1156 Ga0495624_0008471 3300046690 Bacteria 7167
1157 Ga0495624_0008919 3300046690 Bacteria 6971
1158 Ga0495624_0090273 3300046690 Bacteria 1890
1159 Ga0495624_0205268 3300046690 Bacteria 1196
1160 Ga0495670_0007244 3300046691 Bacteria 5455
1161 Ga0495670_0037571 3300046691 Bacteria 2413
1162 Ga0495670_0149284 3300046691 Bacteria 1225
1163 Ga0495671_0003674 3300046692 Bacteria 9339
1164 Ga0495671_0004465 3300046692 Bacteria 8360
1165 Ga0495671_0004983 3300046692 Bacteria 7824
1166 Ga0495671_0007822 3300046692 Bacteria 6049
1167 Ga0495671_0015205 3300046692 Bacteria 4130
1168 Ga0495671_0015406 3300046692 Bacteria 4095
1169 Ga0495671_0034356 3300046692 Bacteria 2578
1170 Ga0495671_0104254 3300046692 Bacteria 1385
1171 Ga0495671_0115800 3300046692 Bacteria 1308
1172 Ga0495671_0121301 3300046692 Bacteria 1275
1173 Ga0495649_0000813 3300046694 Bacteria 25176
1174 Ga0495649_0001962 3300046694 Bacteria 14916
1175 Ga0495649_0011895 3300046694 Bacteria 5085
1176 Ga0495649_0023047 3300046694 Bacteria 3478
1177 Ga0495649_0047497 3300046694 Bacteria 2334
1178 Ga0495649_0055434 3300046694 Bacteria 2141
1179 Ga0495649_0070460 3300046694 Bacteria 1874
1180 Ga0495649_0084108 3300046694 Bacteria 1699
1181 Ga0495649_0098503 3300046694 Bacteria 1555
1182 Ga0495649_0211595 3300046694 Bacteria 1004
1183 Ga0495649_0358682 3300046694 Bacteria 736
1184 Ga0495589_0003822 3300046794 Bacteria 8093
1185 Ga0495589_0006874 3300046794 Bacteria 5981
1186 Ga0495589_0009064 3300046794 Bacteria 5173
1187 Ga0495600_0005056 3300046809 Bacteria 7922
1188 Ga0495600_0022072 3300046809 Bacteria 4084
1189 Ga0495600_0115827 3300046809 Bacteria 1744
1190 Ga0495600_0447738 3300046809 Bacteria 799
1191 Ga0495660_0001767 3300046810 Bacteria 14330
1192 Ga0495660_0002709 3300046810 Bacteria 11186
1193 Ga0495660_0003160 3300046810 Bacteria 10257
1194 Ga0495660_0006768 3300046810 Bacteria 6759
1195 Ga0495660_0011688 3300046810 Bacteria 5092
1196 Ga0495660_0028243 3300046810 Bacteria 3171
1197 Ga0495660_0043308 3300046810 Bacteria 2483
1198 Ga0495660_0079486 3300046810 Bacteria 1722
1199 Ga0495660_0093520 3300046810 Bacteria 1558
1200 Ga0495660_0093707 3300046810 Bacteria 1556
1201 Ga0495660_0187273 3300046810 Bacteria 997
1202 Ga0495660_0251164 3300046810 Bacteria 820
1203 Ga0495604_0015148 3300047317 Bacteria 6153
1204 Ga0495636_0002862 3300047318 Bacteria 6662
1205 Ga0495674_0371631 3300047319 Bacteria 1158
1206 Ga0495674_0752674 3300047319 Bacteria 761
1207 Ga0495672_0003648 3300047320 Bacteria 13034
1208 Ga0495672_0008206 3300047320 Bacteria 7744
1209 Ga0495672_0008237 3300047320 Bacteria 7727
1210 Ga0495672_0012356 3300047320 Bacteria 5962
1211 Ga0495672_0029446 3300047320 Bacteria 3458
1212 Ga0495672_0029976 3300047320 Bacteria 3419
1213 Ga0495672_0035502 3300047320 Bacteria 3070
1214 Ga0495672_0044459 3300047320 Bacteria 2664
1215 Ga0495672_0085170 3300047320 Bacteria 1752
1216 Ga0495676_0000171 3300047321 Bacteria 50588
1217 Ga0495676_0005618 3300047321 Bacteria 11494
1218 Ga0495676_0019092 3300047321 Bacteria 6035
1219 Ga0495676_0287743 3300047321 Bacteria 1111
1220 Ga0495680_0013577 3300047322 Bacteria 7098
1221 Ga0495680_0195899 3300047322 Bacteria 1451
1222 Ga0495680_0245429 3300047322 Bacteria 1270
1223 Ga0495680_0590021 3300047322 Bacteria 744
1224 Ga0495683_0000507 3300047323 Bacteria 30072
1225 Ga0495683_0002187 3300047323 Bacteria 11984
1226 Ga0495683_0004452 3300047323 Bacteria 7955
1227 Ga0495683_0060803 3300047323 Bacteria 1871
1228 Ga0495683_0112566 3300047323 Bacteria 1298
1229 Ga0495687_014652 3300047443 Bacteria 4022
1230 Ga0495675_0160520 3300047444 Bacteria 1384
1231 Ga0495679_000119 3300047446 Bacteria 69255
1232 Ga0495679_000616 3300047446 Bacteria 24020
1233 Ga0495679_005316 3300047446 Bacteria 5728
1234 Ga0495679_005487 3300047446 Bacteria 5616
1235 Ga0495679_011231 3300047446 Bacteria 3470
1236 Ga0495673_0002146 3300047469 Bacteria 14327
1237 Ga0495673_0003396 3300047469 Bacteria 10517
1238 Ga0495673_0004684 3300047469 Bacteria 8491
1239 Ga0495673_0006738 3300047469 Bacteria 6713
1240 Ga0495673_0014086 3300047469 Bacteria 4169
1241 Ga0495673_0015086 3300047469 Bacteria 3993
1242 Ga0495673_0016949 3300047469 Bacteria 3712
1243 Ga0495673_0021460 3300047469 Bacteria 3187
1244 Ga0495673_0032777 3300047469 Bacteria 2417
1245 Ga0495673_0071120 3300047469 Bacteria 1463
1246 Ga0495673_0087608 3300047469 Bacteria 1277
1247 Ga0495673_0092902 3300047469 Bacteria 1230
1248 Ga0495673_0106155 3300047469 Bacteria 1128
1249 Ga0495681_0006275 3300047470 Bacteria 7830
1250 Ga0495681_0007039 3300047470 Bacteria 7263
1251 Ga0495681_0011334 3300047470 Bacteria 5316
1252 Ga0495681_0016651 3300047470 Bacteria 4110
1253 Ga0495681_0018332 3300047470 Bacteria 3859
1254 Ga0495681_0021522 3300047470 Bacteria 3472
1255 Ga0495681_0022687 3300047470 Bacteria 3352
1256 Ga0495681_0028069 3300047470 Bacteria 2901
1257 Ga0495681_0106035 3300047470 Bacteria 1222
1258 Ga0495684_0239586 3300047471 Bacteria 1324
1259 Ga0495686_0004625 3300047472 Bacteria 11194
1260 Ga0495686_0013186 3300047472 Bacteria 5748
1261 Ga0495686_0049354 3300047472 Bacteria 2648
1262 Ga0495686_0145655 3300047472 Bacteria 1394
1263 Ga0495686_0150339 3300047472 Bacteria 1367
1264 Ga0495686_0350079 3300047472 Bacteria 803
1265 Ga0495593_0005528 3300047673 Bacteria 7462
1266 Ga0495593_0036138 3300047673 Bacteria 2680
1267 Ga0495602_0035542 3300048088 Bacteria 4646
1268 Ga0495602_0052798 3300048088 Bacteria 3606
1269 Ga0495602_0189543 3300048088 Bacteria 1578
1270 Ga0495602_0339293 3300048088 Bacteria 1087
1271 Ga0495602_0502137 3300048088 Bacteria 848
1272 Ga0495626_0000123 3300048091 Bacteria 100704
1273 Ga0495626_0003485 3300048091 Bacteria 10079
1274 Ga0495626_0009762 3300048091 Bacteria 5168
1275 Ga0495626_0040937 3300048091 Bacteria 2185
1276 Ga0495626_0052685 3300048091 Bacteria 1875
1277 Ga0495626_0055747 3300048091 Bacteria 1810
1278 Ga0496100_0481852 3300048903 Bacteria 954
1279 Ga0496101_0540725 3300048904 Bacteria 921
1280 Ga0496102_0062552 3300048905 Bacteria 3408
1281 Ga0496102_0296561 3300048905 Bacteria 1524
1282 Ga0496103_0077612 3300048906 Bacteria 2085
1283 Ga0496106_0265042 3300048909 Bacteria 1375
1284 Ga0496108_0358924 3300048911 Bacteria 1272
1285 Ga0496108_0382610 3300048911 Bacteria 1229
1286 Ga0496110_0229455 3300048913 Bacteria 1688
1287 Ga0496110_0270918 3300048913 Bacteria 1546
1288 Ga0496112_0001839 3300048915 Bacteria 16699
1289 Ga0496112_0043323 3300048915 Bacteria 4406
1290 Ga0496112_0526048 3300048915 Bacteria 1117
1291 Ga0496113_0021787 3300048916 Bacteria 4525
1292 Ga0496113_0031793 3300048916 Bacteria 3833
1293 Ga0496113_0156192 3300048916 Bacteria 1802
1294 Ga0496114_0205139 3300048917 Bacteria 1728
1295 Ga0496115_0000272 3300048918 Bacteria 45410
1296 Ga0496115_0000603 3300048918 Bacteria 27521
1297 Ga0496115_0060115 3300048918 Bacteria 3061
1298 Ga0496115_0077865 3300048918 Bacteria 2697
1299 Ga0496115_0148277 3300048918 Bacteria 1936
1300 Ga0496115_0494381 3300048918 Bacteria 984
1301 Ga0496116_0001261 3300048919 Bacteria 29306
1302 Ga0496116_0009203 3300048919 Bacteria 8455
1303 Ga0496116_0065947 3300048919 Bacteria 2319
1304 Ga0496117_0007562 3300048920 Bacteria 10581
1305 Ga0496117_0013964 3300048920 Bacteria 6959
1306 Ga0496117_0043017 3300048920 Bacteria 3290
1307 Ga0496117_0275142 3300048920 Bacteria 904
1308 Ga0496118_0000110 3300048921 Bacteria 152891
1309 Ga0496118_0106046 3300048921 Bacteria 1881
1310 Ga0496118_0202860 3300048921 Bacteria 1172
1311 Ga0496118_0212095 3300048921 Bacteria 1135
1312 Ga0496119_0018322 3300048922 Bacteria 5222
1313 Ga0496121_0003265 3300048924 Bacteria 23309
1314 Ga0496121_0007177 3300048924 Bacteria 13499
1315 Ga0496121_0022646 3300048924 Bacteria 6083
1316 Ga0496121_0023406 3300048924 Bacteria 5950
1317 Ga0496121_0027767 3300048924 Bacteria 5287
1318 Ga0496121_0049083 3300048924 Bacteria 3583
1319 Ga0496121_0073761 3300048924 Bacteria 2733
1320 Ga0496121_0157459 3300048924 Bacteria 1665
1321 Ga0496121_0298633 3300048924 Bacteria 1094
1322 Ga0496121_0495183 3300048924 Bacteria 777
1323 Ga0496122_0000156 3300048925 Bacteria 160178
1324 Ga0496122_0000203 3300048925 Bacteria 132679
1325 Ga0496122_0001639 3300048925 Bacteria 34793
1326 Ga0496122_0001861 3300048925 Bacteria 32176
1327 Ga0496122_0005055 3300048925 Bacteria 15939
1328 Ga0496122_0031343 3300048925 Bacteria 4427
1329 Ga0496122_0039759 3300048925 Bacteria 3746
1330 Ga0496122_0040203 3300048925 Bacteria 3721
1331 Ga0496122_0080009 3300048925 Bacteria 2281
1332 Ga0496122_0125128 3300048925 Bacteria 1647
1333 Ga0496123_0000087 3300048926 Bacteria 182994
1334 Ga0496123_0000164 3300048926 Bacteria 132565
1335 Ga0496123_0001205 3300048926 Bacteria 37836
1336 Ga0496123_0001590 3300048926 Bacteria 30876
1337 Ga0496123_0007317 3300048926 Bacteria 10466
1338 Ga0496123_0008731 3300048926 Bacteria 9251
1339 Ga0496123_0035809 3300048926 Bacteria 3530
1340 Ga0496123_0080573 3300048926 Bacteria 1983
1341 Ga0496123_0112383 3300048926 Bacteria 1553
1342 Ga0496123_0155192 3300048926 Bacteria 1228
1343 Ga0496123_0316871 3300048926 Bacteria 738
1344 Ga0496124_0000006 3300048927 Bacteria 904259
1345 Ga0496124_0000625 3300048927 Bacteria 58974
1346 Ga0496124_0004834 3300048927 Bacteria 15491
1347 Ga0496124_0014633 3300048927 Bacteria 7575
1348 Ga0496124_0034319 3300048927 Bacteria 4454
1349 Ga0496124_0038440 3300048927 Bacteria 4156
1350 Ga0496124_0204851 3300048927 Bacteria 1497
1351 Ga0496124_0231951 3300048927 Bacteria 1379
1352 Ga0496124_0381799 3300048927 Bacteria 985
1353 Ga0496124_0430146 3300048927 Bacteria 906
1354 Ga0496125_0000144 3300048928 Bacteria 156270
1355 Ga0496125_0000453 3300048928 Bacteria 74032
1356 Ga0496125_0003794 3300048928 Bacteria 17970
1357 Ga0496125_0028662 3300048928 Bacteria 5022
1358 Ga0496126_0012736 3300048929 Bacteria 8596
1359 Ga0496126_0033969 3300048929 Bacteria 4796
1360 Ga0496126_0097693 3300048929 Bacteria 2573
1361 Ga0496126_0169439 3300048929 Bacteria 1861
1362 Ga0496126_0423695 3300048929 Bacteria 1075
1363 Ga0495678_000020 3300049459 Bacteria 253654
1364 Ga0495678_003152 3300049459 Bacteria 10408
1365 Ga0495678_003293 3300049459 Bacteria 10086
1366 Ga0495678_003507 3300049459 Bacteria 9650
1367 Ga0495678_013660 3300049459 Bacteria 3801
1368 Ga0495678_014347 3300049459 Bacteria 3686
1369 Ga0495678_014358 3300049459 Bacteria 3684
1370 Ga0495678_018085 3300049459 Bacteria 3177
1371 Ga0495678_032830 3300049459 Bacteria 2147
1372 Ga0495678_035839 3300049459 Bacteria 2030
1373 Ga0495678_105558 3300049459 Bacteria 969
1374 Ga0495682_0000586 3300049460 Bacteria 24744
1375 Ga0495682_0002009 3300049460 Bacteria 10039
1376 Ga0495682_0005889 3300049460 Bacteria 5031
1377 Ga0501032_0497113 3300049569 Bacteria 780
1378 Ga0501033_0005599 3300049570 Bacteria 9920
1379 Ga0501033_0219951 3300049570 Bacteria 1352
1380 Ga0501034_0001143 3300049571 Bacteria 36925
1381 Ga0501034_0007022 3300049571 Bacteria 12011
1382 Ga0501034_0013846 3300049571 Bacteria 8302
1383 Ga0501034_0022920 3300049571 Bacteria 6362
1384 Ga0501034_0144429 3300049571 Bacteria 2357
1385 Ga0501034_0153669 3300049571 Bacteria 2276
1386 Ga0501034_0579291 3300049571 Bacteria 1029
1387 Ga0501036_0015983 3300049572 Bacteria 6269
1388 Ga0501038_0044736 3300049574 Bacteria 3845
1389 Ga0501039_0002412 3300049575 Bacteria 13907
1390 Ga0501039_0305875 3300049575 Bacteria 1250
1391 Ga0501040_0034026 3300049576 Bacteria 3453
1392 Ga0501041_0029168 3300049577 Bacteria 3328
1393 Ga0501042_0005080 3300049578 Bacteria 8442
1394 Ga0501042_0133279 3300049578 Bacteria 1791
1395 Ga0501043_0003327 3300049579 Bacteria 13249
1396 Ga0501043_0075596 3300049579 Bacteria 2646
1397 Ga0501043_0486007 3300049579 Bacteria 924
1398 Ga0501046_0012903 3300049580 Bacteria 7105
1399 Ga0501047_0039535 3300049581 Bacteria 4562
1400 Ga0501047_0053424 3300049581 Bacteria 3907
1401 Ga0501047_0080968 3300049581 Bacteria 3122
1402 Ga0501068_0000930 3300049584 Bacteria 15380
1403 Ga0501070_0079142 3300049586 Bacteria 2720
1404 Ga0501070_0264244 3300049586 Bacteria 1406
1405 Ga0501071_0467023 3300049587 Bacteria 966
1406 Ga0501072_0010165 3300049588 Bacteria 7167
1407 Ga0501072_0381629 3300049588 Bacteria 1118
1408 Ga0501073_0044984 3300049589 Bacteria 3111
1409 Ga0501073_0064473 3300049589 Bacteria 2555
1410 Ga0501074_0058162 3300049590 Bacteria 2785
1411 Ga0501076_0008593 3300049592 Bacteria 7491
1412 Ga0501076_0377147 3300049592 Bacteria 1166
1413 Ga0501077_0007696 3300049593 Bacteria 6648
1414 Ga0501077_0489887 3300049593 Bacteria 788
1415 Ga0501257_050780 3300049686 Bacteria 1034
1416 Ga0501079_0188946 3300049741 Bacteria 1607
1417 Ga0501080_0020448 3300049742 Bacteria 6128
1418 Ga0501080_0136946 3300049742 Unclassified 2265
1419 Ga0501080_0494998 3300049742 Bacteria 1093
1420 Ga0501081_0020291 3300049743 Bacteria 4429
1421 Ga0501083_0238302 3300049744 Bacteria 1184
1422 Ga0501241_004812 3300049758 Bacteria 2521
1423 Ga0501035_0004258 3300049822 Bacteria 13582
1424 Ga0501035_0024656 3300049822 Bacteria 5515
1425 Ga0501035_0155649 3300049822 Bacteria 1981
1426 Ga0501035_0416739 3300049822 Bacteria 1115
1427 Ga0501044_0002363 3300049823 Bacteria 21502
1428 Ga0501044_0069914 3300049823 Bacteria 3573
1429 Ga0501044_0072183 3300049823 Bacteria 3510
1430 Ga0501044_0278560 3300049823 Bacteria 1607
1431 Ga0501044_0331238 3300049823 Bacteria 1445
1432 Ga0501045_0012036 3300049824 Bacteria 6083
1433 Ga0501045_0224852 3300049824 Bacteria 1397
1434 nmdc:mga03683_3195_c1 3300050489 Bacteria 5235
1435 nmdc:mga0k408_19404_c1 3300050493 Bacteria 3800
1436 nmdc:mga07m45_13908_c2 3300050496 Bacteria 1571
1437 nmdc:mga0qj67_116626_c1 3300050509 Bacteria 2158
1438 nmdc:mga0sz30_118006_c1 3300050516 Bacteria 1165
1439 Ga0495601_0053137 3300053077 Bacteria 2560
1440 Ga0495601_0090848 3300053077 Bacteria 1965
1441 Ga0495601_0090990 3300053077 Bacteria 1964
1442 Ga0495601_0666155 3300053077 Bacteria 665
1443 Ga0500635_0004850 3300053080 Bacteria 3489
1444 Ga0495595_0073684 3300053084 Bacteria 1617
1445 Ga0495619_0395030 3300053085 Bacteria 955
1446 Ga0500643_000498 3300053087 Bacteria 28188
1447 Ga0500644_0001114 3300053088 Bacteria 7914
1448 Ga0500644_0064461 3300053088 Bacteria 1302
1449 Ga0500646_0105160 3300053090 Bacteria 891
1450 Ga0500583_0043969 3300053092 Bacteria 2043
1451 Ga0500583_0142876 3300053092 Bacteria 1190
1452 Ga0500555_028482 3300053103 Unclassified 1591
1453 Ga0500594_0019363 3300053118 Bacteria 1686
1454 Ga0500595_001126 3300053119 Bacteria 14807
1455 Ga0500607_049700 3300053121 Bacteria 2238
1456 Ga0500608_001477 3300053122 Bacteria 8402
1457 Ga0500617_060103 3300053124 Bacteria 1684
1458 Ga0500618_019033 3300053125 Bacteria 1693
1459 Ga0500642_0293386 3300053130 Bacteria 736
1460 Ga0500658_0012753 3300053134 Bacteria 3103
1461 Ga0500559_0001341 3300053136 Bacteria 14123
1462 Ga0500559_0010104 3300053136 Bacteria 4062
1463 Ga0500559_0143991 3300053136 Bacteria 1117
1464 Ga0500564_114763 3300053138 Bacteria 1179
1465 Ga0500568_0058092 3300053139 Bacteria 1504
1466 Ga0500573_0000071 3300053140 Bacteria 59706
1467 Ga0500573_0094310 3300053140 Bacteria 1688
1468 Ga0500574_005083 3300053141 Bacteria 2527
1469 Ga0500577_0298617 3300053142 Bacteria 703
1470 Ga0500588_0110221 3300053146 Bacteria 959
1471 Ga0500600_0005717 3300053149 Bacteria 7357
1472 Ga0500616_0024107 3300053153 Bacteria 3386
1473 Ga0500622_0001100 3300053156 Bacteria 22485
1474 Ga0500622_0173085 3300053156 Bacteria 1003
1475 Ga0500627_0346951 3300053158 Bacteria 641
1476 Ga0500636_0035697 3300053177 Bacteria 2941
1477 Ga0500611_089672 3300053727 Bacteria 781
1478 Ga0500645_007540 3300053730 Bacteria 3778
1479 Ga0500552_000300 3300053733 Bacteria 4486
1480 Ga0501084_0008983 3300054114 Bacteria 8264
1481 Ga0587111_0004128 3300060346 Bacteria 2134
1482 Ga0501082_0315950 3300060353 Bacteria 1361
1483 Ga0501082_0464469 3300060353 Bacteria 1106
1484 Ga0466962_0002025 3300061719 Bacteria 9565
1485 Ga0466962_0043341 3300061719 Bacteria 2153
1486 Ga0530510_0019831 3300061734 Bacteria 4778
1487 Ga0530510_0333456 3300061734 Bacteria 1138
1488 2501070871 2501025501 Bacteria 7768574
1489 2501078568 2501025502 Bacteria 9641094
1490 2501413700 2501025504 Bacteria 8008976
1491 2510282948 2510065053 Bacteria 5005518
1492 2510293622 2510065055 Bacteria 5037935
1493 2510310772 2510065058 Bacteria 5005894
1494 2511089625 2510917013 Bacteria 9951648
1495 2511095029 2510917014 Bacteria 8296963
1496 2511104685 2510917015 Bacteria 7950052
1497 2511256746 2511231004 Bacteria 6669789
1498 2511287653 2511231010 Bacteria 6373152
1499 2511294081 2511231011 Bacteria 6149768
1500 2511303121 2511231012 Bacteria 6738011
1501 2511319887 2511231015 Bacteria 6598026
1502 2511327730 2511231016 Bacteria 6704427
1503 2511331593 2511231017 Bacteria 6503007
1504 2511340314 2511231018 Bacteria 6436256
1505 2511344956 2511231019 Bacteria 6520662
1506 2511348646 2511231020 Bacteria 6115223
1507 2511360794 2511231022 Bacteria 6719296
1508 2511371090 2511231023 Bacteria 6808468
1509 2511410727 2511231031 Bacteria 6558529
1510 2511826113 2511231156 Bacteria 6845832
1511 2512035163 2511231221 Bacteria 6846400
1512 2513551450 2513237082 Bacteria 8640282
1513 2513560100 2513237083 Bacteria 8410967
1514 2516016857 2515154189 Bacteria 9629850
1515 2523107000 2522572158 Bacteria 6514390
1516 2597866972 2597489889 Bacteria 6297495
1517 2599326628 2599185155 Bacteria 5827168
1518 2599504338 2599185188 Bacteria 6164180
1519 2599613628 2599185212 Bacteria 6765997
1520 2599773002 2599185248 Bacteria 6696816
1521 2599879345 2599185288 Bacteria 6666191
1522 2599889369 2599185289 Bacteria 6778765
1523 2599900767 2599185291 Bacteria 6775623
1524 2599933401 2599185300 Bacteria 6062622
1525 2599944146 2599185302 Bacteria 5954930
1526 2599948709 2599185303 Bacteria 6512725
1527 2599956364 2599185304 Bacteria 5951361
1528 2599963412 2599185305 Bacteria 6748700
1529 2599966542 2599185306 Bacteria 6637356
1530 2599970517 2599185307 Bacteria 6194719
1531 2599977679 2599185308 Bacteria 6621546
1532 2599985058 2599185309 Bacteria 5969593
1533 2599989316 2599185310 Bacteria 6014457
1534 2599994229 2599185311 Bacteria 6354990
1535 2600000288 2599185312 Bacteria 5912071
1536 2600011848 2599185314 Bacteria 6621749
1537 2600019337 2599185315 Bacteria 6771107
1538 2600023524 2599185316 Bacteria 6320029
1539 2600030674 2599185317 Bacteria 6435722
1540 2600037031 2599185318 Bacteria 6961590
1541 2600042454 2599185319 Bacteria 6637840
1542 2600049550 2599185320 Bacteria 5963263
1543 2600053847 2599185321 Bacteria 6764560
1544 2600060517 2599185322 Bacteria 6763055
1545 2600065616 2599185323 Bacteria 6688755
1546 2600070775 2599185324 Bacteria 6590677
1547 2600078301 2599185325 Bacteria 6324919
1548 2600227499 2599185359 Bacteria 4772316
1549 2600360481 2600254930 Bacteria 6431253
1550 2601624908 2600255283 Bacteria 6061572
1551 2601693299 2600255296 Bacteria 5784754
1552 2621296521 2619619299 Bacteria 6649820
1553 2624482029 2623620443 Bacteria 6427864
1554 2643789496 2643221554 Bacteria 6603920
1555 2643845072 2643221565 Bacteria 6216018
1556 2643865505 2643221570 Bacteria 5103772
1557 2643873515 2643221571 Bacteria 6228673
1558 2643895807 2643221577 Bacteria 3710843
1559 2643992044 2643221596 Bacteria 5006805
1560 2644063252 2643221609 Bacteria 6756331
1561 2644071735 2643221611 Bacteria 6820941
1562 2644286253 2643221650 Bacteria 7029547
1563 2644301090 2643221654 Bacteria 5273570
1564 2644477999 2643221685 Bacteria 3673288
1565 2644649451 2643221717 Bacteria 5676132
1566 2671093677 2667528170 Bacteria 6786960
1567 2671129093 2667528176 Bacteria 6724917
1568 2671695356 2671180139 Bacteria 4196045
1569 2678264449 2675903515 Bacteria 6580491
1570 2718635272 2718217725 Bacteria 5758958
1571 2738673467 2738541265 Bacteria 6594665
1572 2738688496 2738541271 Bacteria 5657310
1573 2738751860 2738541282 Bacteria 6593925
1574 2738807569 2738541294 Bacteria 6925949
1575 2738860901 2738541303 Bacteria 6591772
1576 2738894929 2738541309 Bacteria 6926455
1577 2739264228 2738543016 Bacteria 5657564
1578 2739284892 2738543020 Bacteria 5718238
1579 2739290206 2738543021 Bacteria 5718241
1580 2739315061 2738543025 Bacteria 6600348
1581 2739733513 2739367700 Bacteria 4747630
1582 2739792210 2739367756 Bacteria 4553612
1583 2745004903 2744054620 Bacteria 6551379
1584 2765578237 2765235840 Bacteria 4663337
1585 2774129007 2773857672 Bacteria 4993178
1586 2774132930 2773857673 Bacteria 6513460
1587 2784263206 2784132063 Bacteria 6262788
1588 2794595962 2791355520 Bacteria 5948615
1589 2808856905 2808606361 Bacteria 6136259
1590 2808924261 2808606376 Bacteria 6248667
1591 2808936976 2808606378 Bacteria 6177535
1592 2808946354 2808606380 Bacteria 6248705
1593 2808965328 2808606383 Bacteria 6138645
1594 2808980119 2808606385 Bacteria 6711065
1595 2808995839 2808606388 Bacteria 6706662
1596 2809000184 2808606389 Bacteria 6138126
1597 2809218873 2808606445 Bacteria 6057339
1598 2817488000 2816332298 Bacteria 6852809
1599 2819543539 2818991436 Bacteria 5376622
1600 2819655767 2818991456 Bacteria 6123676
1601 2819716083 2818991466 Bacteria 4748179
1602 2825656609 2825651385 Bacteria 6715909
1603 2826583068 2826581358 Bacteria 5963467
1604 2842776991 2842775625 Bacteria 5587290
1605 2842782426 2842780639 Bacteria 4337790
1606 2842817526 2842815866 Bacteria 5947510
1607 2842850677 2842849001 Bacteria 5924277
1608 2842859300 2842854478 Bacteria 6143501
1609 2848298180 2848297114 Bacteria 3608511
1610 2852616657 2852612431 Bacteria 6885235
1611 2852657290 2852653556 Bacteria 4050083
1612 2852663017 2852657418 Bacteria 6472974
1613 2852671625 2852667396 Bacteria 6885555
1614 2856293324 2856287931 Bacteria 7223934
1615 2857366557 2857357740 Bacteria 9937880
1616 2857443924 2857442823 Bacteria 4562550
1617 2860868025 2860867994 Bacteria 5645326
1618 2879163333 2879163058 Bacteria 4223965
1619 2879164124 2879163058 Bacteria 4223965
1620 2880234631 2880230671 Bacteria 6140320
1621 2883094613 2883087390 Bacteria 9532701
1622 2884412791 2884411467 Bacteria 5246714
1623 2884963330 2884960567 Bacteria 5437054
1624 2894775022 2894772417 Bacteria 5305674
1625 2899275640 2899275550 Bacteria 3958688
1626 2904434671 2904434214 Bacteria 6230908
1627 2904455291 2904449895 Bacteria 6927402
1628 2904461324 2904456579 Bacteria 6819253
1629 2904521230 2904518522 Bacteria 6068986
1630 2904555284 2904550169 Bacteria 6221258
1631 2913040926 2913036834 Bacteria 6704877
1632 2917836877 2917832318 Bacteria 5346010
1633 2919125914 2919125081 Bacteria 5385106
1634 2919460967 2919456309 Bacteria 6586567
1635 2919466868 2919462493 Bacteria 5817112
1636 2919487275 2919481497 Bacteria 6907839
1637 2923589963 2923586266 Bacteria 6565975
1638 2928528143 2928526807 Bacteria 4760224
1639 2928966808 2928963466 Bacteria 5165703
1640 2928971350 2928968154 Bacteria 4633371
1641 2928973921 2928972540 Bacteria 3058286
1642 2929148425 2929144301 Bacteria 6622272
1643 2929189908 2929189879 Bacteria 5930554
1644 2929204315 2929199973 Bacteria 7260745
1645 2931374159 2931369376 Bacteria 6847892
1646 2939623926 2939622612 Bacteria 4698046
1647 2939637519 2939636861 Bacteria 6297853
1648 2946012923 2946006987 Bacteria 6705746
1649 2946028213 2946027586 Bacteria 6049274
1650 2947234734 2947233263 Bacteria 6439278
1651 2969308785 2969304461 Bacteria 6601805
1652 2974302578 2974298342 Bacteria 4840922
1653 2977241119 2977240413 Bacteria 3191065
1654 2984290602 2984286254 Bacteria 6702062
1655 2984499836 2984499530 Bacteria 5020881
1656 2984506267 2984504281 Bacteria 5262371
1657 2988730026 2988728565 Bacteria 6124362
1658 3000865581 3000865235 Bacteria 3106258
1659 3007315895 3007315729 Bacteria 5076637
1660 3007400967 3007395558 Bacteria 6755444
1661 3007515729 3007511990 Bacteria 6481491
1662 3007617863 3007614139 Bacteria 6053559
1663 3007619929 3007619802 Bacteria 6411688
1664 3007858925 3007855910 Bacteria 5637581
1665 3007865519 3007861166 Bacteria 6045338
1666 643602444 643348564 Bacteria 8839022
1667 8003015638 8003014200 Bacteria 4059994
1668 8003957365 8003955200 Bacteria 8601927
1669 8016731742 8016728285 Bacteria 5263933
1670 8034965120 8034962539 Bacteria 4884839
1671 8054503576 8054503363 Bacteria 6101651
1672 8056127469 8056125926 Bacteria 6228218
1673 8056144946 8056143049 Bacteria 6307666
1674 8056180094 8056177738 Bacteria 6748268
1675 Ga0436361_0602091
1676 SwRhRL2b_contig_656453
1677 JGI24739J22299_10001818
1678 JGI24737J22298_10091662
1679 JGI24735J21928_10000175
1680 JGI24735J21928_10001426
1681 JGI25162J39368_1000063
1682 JGI25162J39368_1000287
1683 JGI25158J39367_1004817
1684 JGI25157J39369_1000217
1685 JGI25157J39369_1008628
1686 JGI25163J39215_1000677
1687 JGI25163J39215_1002287
1688 JGI25164J39214_1000672
1689 JGI25164J39214_1004989
1690 JGI25159J45721_1004581
1691 JGI25151J46595_10000338
1692 JGI25165J46597_1000069
1693 JGI25165J46597_1000388
1694 rootH1_10093753
1695 rootH2_10007026
1696 rootH2_10077057
1697 rootL2_10039617
1698 rootH1_10009337
1699 rootH1_10071821
1700 rootH1_10074923
1701 rootH1_10105829
1702 rootH1_10249875
1703 JGI25161J50226_1000201
1704 Ga0055538_1000034
1705 Ga0055538_1004584
1706 Ga0055539_1000044
1707 Ga0055533_1000055
1708 Ga0055525_1000066
1709 Ga0055535_1000335
1710 Ga0055535_1000978
1711 Ga0055535_1019184
1712 Ga0055542_1000363
1713 Ga0055542_1001209
1714 Ga0055529_1000391
1715 Ga0055529_1000610
1716 Ga0055529_1000975
1717 Ga0055529_1005226
1718 Ga0055529_1015679
1719 Ga0055526_1000116
1720 Ga0055526_1000487
1721 Ga0055526_1006469
1722 Ga0055537_1000035
1723 Ga0055524_1021726
1724 Ga0055524_1025753
1725 Ga0055524_1053959
1726 Ga0055536_1000103
1727 Ga0055536_1002169
1728 Ga0055536_1041914
1729 Ga0055534_1000104
1730 Ga0055534_1000158
1731 Ga0055534_1000325
1732 Ga0055528_1000058
1733 Ga0055530_10001374
1734 Ga0055530_10007126
1735 Ga0055540_1010062
1736 Ga0055531_10006687
1737 Ga0055531_10014117
1738 Ga0055531_10023407
1739 Ga0055531_10067287
1740 Ga0055541_1000032
1741 Ga0058692_1000009
1742 Ga0055543_1000103
1743 Ga0065165_1000224
1744 Ga0065165_1000854
1745 Ga0065714_10007829
1746 Ga0065714_10012581
1747 Ga0065714_10069716
1748 Ga0065704_10009257
1749 Ga0065704_10118926
1750 Ga0065704_10264331
1751 Ga0065712_10000132
1752 Ga0065712_10090203
1753 Ga0065707_10082092
1754 Ga0070658_10014131
1755 Ga0070658_10123076
1756 Ga0070658_10173891
1757 Ga0070676_10000184
1758 Ga0070676_10016033
1759 Ga0070676_10086903
1760 Ga0070676_10155529
1761 Ga0070683_100002328
1762 Ga0070683_100031670
1763 Ga0070683_100115303
1764 Ga0070683_100140189
1765 Ga0070683_100510519
1766 Ga0070690_100096094
1767 Ga0070670_100005054
1768 Ga0070670_100026223
1769 Ga0070670_100128471
1770 Ga0070670_100265249
1771 Ga0070677_10000379
1772 Ga0070677_10022599
1773 Ga0070677_10070743
1774 Ga0068869_100028286
1775 Ga0068869_100225786
1776 Ga0070666_10012374
1777 Ga0070680_100003334
1778 Ga0070680_100124199
1779 Ga0070680_100269382
1780 Ga0070682_100003944
1781 Ga0070682_100014112
1782 Ga0068868_100002077
1783 Ga0068868_100023967
1784 Ga0068868_100026781
1785 Ga0068868_100418855
1786 Ga0068868_100647819
1787 Ga0070660_100001110
1788 Ga0070660_100078997
1789 Ga0070660_100114547
1790 Ga0070661_100085612
1791 Ga0070661_100120919
1792 Ga0070668_100004033
1793 Ga0070668_100060509
1794 Ga0070668_100067315
1795 Ga0070668_100094228
1796 Ga0070668_100167475
1797 Ga0070668_100275083
1798 Ga0070668_100336190
1799 Ga0070668_100410165
1800 Ga0070669_100020760
1801 Ga0070669_100136133
1802 Ga0070669_100764828
1803 Ga0070675_100004329
1804 Ga0070675_100010835
1805 Ga0070675_100075645
1806 Ga0070675_100251931
1807 Ga0070675_100918528
1808 Ga0070671_100043865
1809 Ga0070671_100049086
1810 Ga0070671_100074400
1811 Ga0070674_100006415
1812 Ga0070674_100185045
1813 Ga0070674_100228228
1814 Ga0070673_100019406
1815 Ga0070673_100021478
1816 Ga0070673_100073974
1817 Ga0070673_100087809
1818 Ga0070688_100382213
1819 Ga0070688_100832145
1820 Ga0070688_100844682
1821 Ga0070659_100062514
1822 Ga0070659_100318943
1823 Ga0070659_100548394
1824 Ga0070659_100770255
1825 Ga0070667_100018980
1826 Ga0070667_100101645
1827 Ga0070667_100153202
1828 Ga0070667_100260558
1829 Ga0070714_100601099
1830 Ga0070713_100111919
1831 Ga0070710_10021874
1832 Ga0070711_100438177
1833 Ga0070700_100798855
1834 Ga0070663_100013698
1835 Ga0070663_100248073
1836 Ga0070663_100403662
1837 Ga0070663_100464896
1838 Ga0070678_100342825
1839 Ga0070678_100927899
1840 Ga0070662_100009714
1841 Ga0070662_100029289
1842 Ga0070662_100074443
1843 Ga0070662_100264729
1844 Ga0070662_100274238
1845 Ga0070681_10211816
1846 Ga0070681_10238260
1847 Ga0070681_10308196
1848 Ga0068867_100021598
1849 Ga0070685_10031687
1850 Ga0070685_10345998
1851 Ga0070699_100470317
1852 Ga0070679_100119972
1853 Ga0070679_100153527
1854 Ga0070679_100156262
1855 Ga0070679_100225783
1856 Ga0070679_100466101
1857 Ga0070684_100001235
1858 Ga0070684_100027746
1859 Ga0070684_100057175
1860 Ga0070684_100147827
1861 Ga0070684_100218756
1862 Ga0068853_100035810
1863 Ga0070672_100024644
1864 Ga0070672_100039537
1865 Ga0070672_100083942
1866 Ga0070672_100107480
1867 Ga0070672_100113189
1868 Ga0070672_100201041
1869 Ga0070672_100318529
1870 Ga0070672_100372234
1871 Ga0070696_100186255
1872 Ga0070693_100172707
1873 Ga0070665_100012164
1874 Ga0070665_100024403
1875 Ga0070665_100459856
1876 Ga0070665_100534549
1877 Ga0070665_100560054
1878 Ga0070665_100575002
1879 Ga0068855_100003248
1880 Ga0068855_100012376
1881 Ga0068855_100051713
1882 Ga0068855_100132342
1883 Ga0068855_100183432
1884 Ga0068855_100602645
1885 Ga0070664_100055289
1886 Ga0070664_100169074
1887 Ga0070664_100178464
1888 Ga0070664_100190283
1889 Ga0070664_100418747
1890 Ga0070664_100486035
1891 Ga0068857_100008513
1892 Ga0068857_100051007
1893 Ga0068857_100063861
1894 Ga0068857_100182706
1895 Ga0068857_100365287
1896 Ga0068854_100000699
1897 Ga0068854_100001438
1898 Ga0068854_100006866
1899 Ga0068854_100162955
1900 Ga0068854_100437129
1901 Ga0068854_100523259
1902 Ga0068854_100779783
1903 Ga0068856_100016100
1904 Ga0068856_100768637
1905 Ga0068852_100045673
1906 Ga0068852_100049791
1907 Ga0068852_100113902
1908 Ga0068852_100286449
1909 Ga0068852_100704958
1910 Ga0068859_100011168
1911 Ga0068859_100014157
1912 Ga0068859_100071933
1913 Ga0068859_100233165
1914 Ga0068864_100006939
1915 Ga0068864_100014348
1916 Ga0068864_100020963
1917 Ga0068864_100035586
1918 Ga0068866_10176571
1919 Ga0068861_100001967
1920 Ga0068861_100098554
1921 Ga0068861_100099116
1922 Ga0068861_101011004
1923 Ga0068851_10015815
1924 Ga0068851_10065197
1925 Ga0068851_10209105
1926 Ga0068870_10027147
1927 Ga0068870_10124361
1928 Ga0068863_100012433
1929 Ga0068863_100037327
1930 Ga0068863_100151663
1931 Ga0068863_100241408
1932 Ga0068863_100276828
1933 Ga0068863_100278780
1934 Ga0068863_100336788
1935 Ga0068863_100500118
1936 Ga0068863_100518383
1937 Ga0068863_100623364
1938 Ga0068858_100139654
1939 Ga0068858_100485410
1940 Ga0068860_100014126
1941 Ga0068860_100018457
1942 Ga0068860_100230298
1943 Ga0068860_100272470
1944 Ga0068860_100275885
1945 Ga0068860_100408596
1946 Ga0068862_100015603
1947 Ga0068862_100073069
1948 Ga0075363_100279879
1949 Ga0075364_10320929
1950 Ga0075364_10426602
1951 Ga0075364_10570376
1952 Ga0075432_10000316
1953 Ga0075432_10103215
1954 Ga0075362_10000923
1955 Ga0075369_10119616
1956 Ga0075366_10009494
1957 Ga0097621_100386334
1958 Ga0097621_100457433
1959 Ga0097621_100516321
1960 Ga0068871_100080037
1961 Ga0068871_100829103
1962 Ga0075428_100647354
1963 Ga0075428_101084647
1964 Ga0068865_100047329
1965 Ga0068865_100227731
1966 Ga0075436_100119814
1967 Ga0097620_100011168
1968 Ga0097620_100014159
1969 Ga0097620_100071933
1970 Ga0097620_100233177
1971 Ga0079104_1021663
1972 Ga0105251_10002617
1973 Ga0105251_10004604
1974 Ga0105251_10032844
1975 Ga0105251_10056938
1976 Ga0105244_10002401
1977 Ga0105244_10120692
1978 Ga0105244_10148471
1979 Ga0105250_10000550
1980 Ga0105250_10002212
1981 Ga0105250_10026587
1982 Ga0105250_10287560
1983 Ga0105240_10001607
1984 Ga0105240_10005342
1985 Ga0105240_10017316
1986 Ga0105240_10020280
1987 Ga0105240_10023104
1988 Ga0105240_10224191
1989 Ga0105240_10322835
1990 Ga0105240_10381595
1991 Ga0105240_10405876
1992 Ga0105240_10648266
1993 Ga0105240_11392873
1994 Ga0111539_10640115
1995 Ga0105245_10257272
1996 Ga0105245_10320485
1997 Ga0105247_10018162
1998 Ga0105247_10267118
1999 Ga0105243_10001011
2000 Ga0105243_10051347
2001 Ga0105242_10358512
2002 Ga0105242_10421815
2003 Ga0105248_10257694
2004 Ga0105248_10334437
2005 Ga0105248_11132222
2006 Ga0105237_10000036
2007 Ga0105237_10000136
2008 Ga0105237_10058621
2009 Ga0105237_10188719
2010 Ga0105238_10036529
2011 Ga0105238_10261347
2012 Ga0105238_10777598
2013 Ga0105249_10096119
2014 Ga0105239_10011357
2015 Ga0105239_10061307
2016 Ga0105246_10000322
2017 Ga0105246_10002126
2018 Ga0105246_10023561
2019 Ga0105246_10567655
2020 Ga0157345_1000091
2021 Ga0157314_1000581
2022 Ga0157347_1002954
2023 Ga0157373_10000568
2024 Ga0157373_10003664
2025 Ga0157373_10009218
2026 Ga0157373_10085097
2027 Ga0157373_10113106
2028 Ga0157373_10638965
2029 Ga0157371_10016582
2030 Ga0157371_10216135
2031 Ga0157371_10377801
2032 Ga0157370_10077206
2033 Ga0157370_10281370
2034 Ga0157370_10322545
2035 Ga0157369_10001737
2036 Ga0157369_10001978
2037 Ga0157369_10025617
2038 Ga0157369_10047946
2039 Ga0157369_10147301
2040 Ga0157369_10170224
2041 Ga0157369_10255746
2042 Ga0157369_10604876
2043 Ga0157369_10646301
2044 Ga0157369_10833279
2045 Ga0157374_10000055
2046 Ga0157374_10003393
2047 Ga0157374_10388709
2048 Ga0157378_10285618
2049 Ga0163162_10083329
2050 Ga0163162_10162708
2051 Ga0163162_10258243
2052 Ga0163162_10578767
2053 Ga0157372_10001079
2054 Ga0157372_10055049
2055 Ga0157372_10131453
2056 Ga0157372_10220879
2057 Ga0157372_10437604
2058 Ga0157372_10477804
2059 Ga0157372_10527871
2060 Ga0157372_10544429
2061 Ga0157375_10007393
2062 Ga0157375_10012489
2063 Ga0157375_10106507
2064 Ga0157375_10350854
2065 Ga0157375_10699769
2066 Ga0157375_11107539
2067 Ga0163163_10012181
2068 Ga0157380_10006526
2069 Ga0157380_10125069
2070 Ga0182008_10001995
2071 Ga0182008_10009442
2072 Ga0182008_10036444
2073 Ga0182008_10038233
2074 Ga0182008_10112878
2075 Ga0157377_10395201
2076 Ga0157379_10007766
2077 Ga0157379_10126591
2078 Ga0157376_10069963
2079 Ga0157376_10111105
2080 Ga0157376_10159234
2081 Ga0157376_10918310
2082 Ga0182006_1000967
2083 Ga0182006_1002514
2084 Ga0182006_1006793
2085 Ga0182006_1009331
2086 Ga0182006_1020584
2087 Ga0182006_1104194
2088 Ga0182006_1134970
2089 Ga0182005_1000289
2090 Ga0182005_1041459
2091 Ga0182005_1042136
2092 Ga0183365_10004
2093 Ga0183368_1007
2094 Ga0183360_11919
2095 Ga0183363_1007
2096 Ga0163161_10071262
2097 Ga0163161_10087295
2098 Ga0163161_10144012
2099 Ga0163161_10160712
2100 Ga0163161_10192938
2101 Ga0163161_10599252
2102 Ga0163161_10603799
2103 Ga0163161_10784277
2104 Ga0206356_11616746
2105 Ga0206354_10931273
2106 Ga0213872_10001316
2107 Ga0213875_10023663
2108 Ga0228598_1000332
2109 Ga0209435_106429
2110 Ga0209760_100340
2111 Ga0209760_101173
2112 Ga0209436_100301
2113 Ga0209784_100049
2114 Ga0209784_100164
2115 Ga0209566_100061
2116 Ga0209566_102109
2117 Ga0209674_100069
2118 Ga0209672_102388
2119 Ga0209672_102751
2120 Ga0209672_103395
2121 Ga0209672_112054
2122 Ga0209563_100083
2123 Ga0207427_100084
2124 Ga0207427_101954
2125 Ga0207427_103135
2126 Ga0209437_100037
2127 Ga0209437_100091
2128 Ga0209437_100924
2129 Ga0209258_100034
2130 Ga0209258_100071
2131 Ga0209258_100459
2132 Ga0209258_100792
2133 Ga0209258_101200
2134 Ga0209258_103464
2135 Ga0209646_1000895
2136 Ga0209646_1001788
2137 Ga0209026_1000187
2138 Ga0209026_1000223
2139 Ga0209677_100039
2140 Ga0209148_1000001
2141 Ga0209148_1000002
2142 Ga0209148_1004832
2143 Ga0209759_1001491
2144 Ga0209759_1001499
2145 Ga0209759_1001939
2146 Ga0209759_1003025
2147 Ga0209759_1003373
2148 Ga0209129_1002340
2149 Ga0209233_1000002
2150 Ga0209233_1000115
2151 Ga0209233_1020535
2152 Ga0209233_1023887
2153 Ga0209565_1000009
2154 Ga0209455_1000030
2155 Ga0209455_1000054
2156 Ga0209455_1000427
2157 Ga0209455_1000628
2158 Ga0209455_1003037
2159 Ga0209673_1000036
2160 Ga0209673_1007680
2161 Ga0209130_1000044
2162 Ga0209130_1000188
2163 Ga0209130_1002498
2164 Ga0209675_1000013
2165 Ga0209675_1000078
2166 Ga0209675_1007119
2167 Ga0209676_1000121
2168 Ga0209676_1000345
2169 Ga0209676_1000440
2170 Ga0209676_1004038
2171 Ga0209025_1000051
2172 Ga0209025_1038002
2173 Ga0209564_1000122
2174 Ga0209564_1000133
2175 Ga0209564_1000202
2176 Ga0209758_1001007
2177 Ga0209758_1048733
2178 Ga0209758_1066634
2179 Ga0209050_1001731
2180 Ga0209050_1002704
2181 Ga0209256_1000106
2182 Ga0209256_1001832
2183 Ga0209256_1008649
2184 Ga0209256_1010324
2185 Ga0207426_1049454
2186 Ga0209051_1000979
2187 Ga0209051_1005522
2188 Ga0209257_1000065
2189 Ga0209257_1000121
2190 Ga0209257_1000356
2191 Ga0209257_1000452
2192 Ga0209257_1001064
2193 Ga0209257_1028082
2194 Ga0209257_1068871
2195 Ga0207697_10017549
2196 Ga0207697_10038369
2197 Ga0207656_10079257
2198 Ga0207696_1000165
2199 Ga0207696_1001780
2200 Ga0207655_1000603
2201 Ga0207655_1000772
2202 Ga0207655_1003483
2203 Ga0207655_1004427
2204 Ga0207655_1012890
2205 Ga0207655_1014595
2206 Ga0207655_1029630
2207 Ga0207713_1001400
2208 Ga0207713_1003713
2209 Ga0207713_1017174
2210 Ga0207682_10001014
2211 Ga0207682_10182826
2212 Ga0207710_10017120
2213 Ga0207680_10033556
2214 Ga0207680_10036168
2215 Ga0207680_10438600
2216 Ga0207647_10002310
2217 Ga0207647_10003842
2218 Ga0207647_10005179
2219 Ga0207645_10000428
2220 Ga0207645_10018585
2221 Ga0207645_10025328
2222 Ga0207643_10028023
2223 Ga0207643_10057340
2224 Ga0207705_10171889
2225 Ga0207705_10205601
2226 Ga0207705_10220760
2227 Ga0207705_10234864
2228 Ga0207707_10052033
2229 Ga0207707_10303155
2230 Ga0207695_10001702
2231 Ga0207695_10003515
2232 Ga0207695_10007231
2233 Ga0207695_10012415
2234 Ga0207695_10021072
2235 Ga0207695_10242701
2236 Ga0207695_10313859
2237 Ga0207671_10000059
2238 Ga0207671_10000135
2239 Ga0207671_10000713
2240 Ga0207671_10004409
2241 Ga0207671_10223289
2242 Ga0207671_10269649
2243 Ga0207660_10154998
2244 Ga0207657_10009078
2245 Ga0207657_10067795
2246 Ga0207649_10000007
2247 Ga0207649_10019952
2248 Ga0207649_10123389
2249 Ga0207649_10159895
2250 Ga0207649_10213836
2251 Ga0207649_10272468
2252 Ga0207652_10530962
2253 Ga0207681_10073391
2254 Ga0207694_10042761
2255 Ga0207650_10034174
2256 Ga0207650_10124175
2257 Ga0207650_10263864
2258 Ga0207659_10131071
2259 Ga0207687_10043694
2260 Ga0207687_10186128
2261 Ga0207700_10260945
2262 Ga0207664_10044849
2263 Ga0207664_10563071
2264 Ga0207644_10070897
2265 Ga0207644_10087503
2266 Ga0207644_10323607
2267 Ga0207690_10014282
2268 Ga0207690_10096449
2269 Ga0207706_10057627
2270 Ga0207706_10094002
2271 Ga0207706_10133108
2272 Ga0207706_10138154
2273 Ga0207706_10588517
2274 Ga0207686_10001532
2275 Ga0207686_10607395
2276 Ga0207709_10065230
2277 Ga0207670_10565835
2278 Ga0207669_10544061
2279 Ga0207704_10010676
2280 Ga0207704_10115126
2281 Ga0207691_10000127
2282 Ga0207691_10004858
2283 Ga0207691_10071976
2284 Ga0207691_10133688
2285 Ga0207691_10172497
2286 Ga0207691_10234026
2287 Ga0207689_10262507
2288 Ga0207661_10003004
2289 Ga0207661_10041845
2290 Ga0207661_10091582
2291 Ga0207661_10102213
2292 Ga0207661_10227205
2293 Ga0207679_10000013
2294 Ga0207679_10007435
2295 Ga0207679_10055251
2296 Ga0207679_10153761
2297 Ga0207679_10246545
2298 Ga0207679_11229545
2299 Ga0207667_10000292
2300 Ga0207667_10000486
2301 Ga0207667_10009358
2302 Ga0207667_10055825
2303 Ga0207667_10121940
2304 Ga0207667_10471054
2305 Ga0207651_10341407
2306 Ga0207651_10452334
2307 Ga0207668_10021890
2308 Ga0207668_10122115
2309 Ga0207668_10124149
2310 Ga0207668_10223889
2311 Ga0207668_10356560
2312 Ga0207668_10469968
2313 Ga0207668_10620511
2314 Ga0207640_10000471
2315 Ga0207640_10000670
2316 Ga0207640_10018115
2317 Ga0207640_10021026
2318 Ga0207640_10053029
2319 Ga0207640_10182581
2320 Ga0207658_10044979
2321 Ga0207658_10059775
2322 Ga0207658_10065595
2323 Ga0207658_10117646
2324 Ga0207677_10026161
2325 Ga0207677_10088036
2326 Ga0207677_10892240
2327 Ga0207703_10132703
2328 Ga0207703_10536907
2329 Ga0207703_10553092
2330 Ga0207703_10931067
2331 Ga0207639_10193654
2332 Ga0207678_10000969
2333 Ga0207678_10032281
2334 Ga0207678_10143379
2335 Ga0207678_10145112
2336 Ga0207678_10724564
2337 Ga0207708_10235273
2338 Ga0207702_11166583
2339 Ga0207641_10049260
2340 Ga0207641_10173981
2341 Ga0207641_10265698
2342 Ga0207641_10323837
2343 Ga0207641_10331629
2344 Ga0207641_10346093
2345 Ga0207641_10365360
2346 Ga0207641_10877082
2347 Ga0207641_11113180
2348 Ga0207648_10004283
2349 Ga0207648_10011720
2350 Ga0207648_10023017
2351 Ga0207648_10265180
2352 Ga0207676_10032072
2353 Ga0207676_10048307
2354 Ga0207676_10170681
2355 Ga0207674_10000298
2356 Ga0207674_10010196
2357 Ga0207674_10011014
2358 Ga0207674_10155541
2359 Ga0207675_100012815
2360 Ga0207675_100029062
2361 Ga0207675_100075242
2362 Ga0207675_100162337
2363 Ga0207675_100862005
2364 Ga0207683_10000009
2365 Ga0207698_10008277
2366 Ga0207698_10019529
2367 Ga0207698_10046054
2368 Ga0207698_10140636
2369 Ga0207698_10215874
2370 Ga0207698_10388092
2371 Ga0207698_10711551
2372 Ga0209281_1013031
2373 Ga0209371_1000023
2374 Ga0207428_10015977
2375 Ga0207428_10203634
2376 Ga0268266_10005005
2377 Ga0268266_10060827
2378 Ga0268266_10172820
2379 Ga0268266_10297171
2380 Ga0268266_10922761
2381 Ga0268266_11010465
2382 Ga0268265_10289752
2383 Ga0268264_10058224
2384 Ga0268264_10070210
2385 Ga0268264_10081212
2386 Ga0268264_10643278
2387 Ga0268264_10678496
2388 Ga0307517_10005849
2389 Ga0307517_10010226
2390 Ga0307517_10104066
2391 Ga0307517_10217316
2392 Ga0307515_10013824
2393 Ga0307515_10133079
2394 Ga0265338_10000118
2395 Ga0268256_1000023
2396 Ga0268256_1000050
2397 Ga0316177_1104169
2398 Ga0316181_1003769
2399 Ga0265332_10020812
2400 Ga0265340_10063801
2401 Ga0265316_10205203
2402 Ga0307513_10020408
2403 Ga0307513_10052805
2404 Ga0307513_10086379
2405 Ga0307513_10117764
2406 Ga0307513_10138965
2407 Ga0307513_10350485
2408 Ga0307509_10000052
2409 Ga0307509_10003622
2410 Ga0307509_10023567
2411 Ga0307509_10034645
2412 Ga0307509_10067060
2413 Ga0307509_10147362
2414 Ga0307408_100000194
2415 Ga0307408_100020906
2416 Ga0307408_100100941
2417 Ga0307408_100190230
2418 Ga0307508_10002365
2419 Ga0307508_10442277
2420 Ga0307508_10481723
2421 Ga0307514_10012360
2422 Ga0307516_10007666
2423 Ga0307516_10063274
2424 Ga0307516_10134536
2425 Ga0307516_10167955
2426 Ga0307516_10251391
2427 Ga0307516_10653191
2428 Ga0307405_10164241
2429 Ga0307405_10301078
2430 Ga0307413_10025015
2431 Ga0307413_10226532
2432 Ga0307410_10080021
2433 Ga0307410_10306209
2434 Ga0307406_10130772
2435 Ga0307406_10539633
2436 Ga0307407_10005761
2437 Ga0307407_10133122
2438 Ga0307412_10047860
2439 Ga0307409_100037068
2440 Ga0307409_100075501
2441 Ga0307409_100207555
2442 Ga0307409_100536681
2443 Ga0307416_100019933
2444 Ga0307416_100068548
2445 Ga0307416_100307980
2446 Ga0307414_10112044
2447 Ga0307414_10236516
2448 Ga0307414_10510780
2449 Ga0307507_10092396
2450 Ga0307507_10117726
2451 Ga0307510_10000118
2452 Ga0307510_10014576
2453 Ga0307510_10088730
2454 Ga0307510_10120543
2455 Ga0307510_10145502
2456 Ga0307510_10184103
2457 Ga0373940_0087971
2458 Ga0373951_0081722
2459 Ga0373932_0054478
2460 Ga0373931_0072019
2461 Ga0373931_0239671
2462 Ga0373947_0163753
2463 Ga0373947_0420280
2464 Ga0373947_0721919
2465 Ga0373937_0025086
2466 Ga0373937_0341074
2467 Ga0373925_0212396
2468 Ga0373925_0254489
2469 Ga0395899_0000012
2470 Ga0395899_0005005
2471 Ga0395899_0010317
2472 Ga0395899_0012450
2473 Ga0395899_0195356
2474 Ga0395900_0002549
2475 Ga0395900_0006267
2476 Ga0395900_0092457
2477 Ga0395900_0124178
2478 Ga0395898_0005884
2479 Ga0395898_0110701
2480 Ga0395898_0508189
2481 Ga0395898_0626058
2482 Ga0395905_0000136
2483 Ga0395905_0001886
2484 Ga0395905_0055632
2485 Ga0395905_0147935
2486 Ga0436364_0034966
2487 Ga0436364_0389486
2488 Ga0436364_0471363
2489 Ga0436364_1529296
2490 Ga0395901_0001400
2491 Ga0395901_0003633
2492 Ga0395901_0003670
2493 Ga0395901_0630531
2494 Ga0237819_00624
2495 Ga0237819_07641
2496 Ga0400483_000346
2497 Ga0400483_020937
2498 Ga0400483_095196
2499 Ga0400483_163079
2500 Ga0400483_171786
2501 Ga0400483_248084
2502 Ga0400483_248289
2503 Ga0436361_0821396
2504 Ga0436362_0202120
2505 Ga0439438_004655
2506 Ga0439447_002799
2507 Ga0439466_0004451
2508 Ga0439431_0010973
2509 Ga0439448_0023985
2510 Ga0439432_016961
2511 Ga0439449_0065883
2512 Ga0439451_000445
2513 Ga0439451_004420
2514 Ga0439452_000485
2515 Ga0439452_019785
2516 Ga0439462_0032484
2517 Ga0439463_002054
2518 Ga0439463_025189
2519 Ga0439463_057533
2520 Ga0450911_001553
2521 Ga0450911_003577
2522 Ga0450913_008653
2523 Ga0450890_000729
2524 Ga0450891_003745
2525 Ga0450903_014414
2526 Ga0450907_009459
2527 Ga0439446_0087263
2528 Ga0439446_0169028
2529 Ga0439435_0112338
2530 Ga0439464_0004285
2531 Ga0439460_0004154
2532 Ga0451577_0000561
2533 Ga0466969_0002544
2534 Ga0466969_0017277
2535 Ga0466969_0034736
2536 Ga0466972_0062241
2537 Ga0466972_0137285
2538 Ga0466982_0000044
2539 Ga0466965_0016690
2540 Ga0466966_0000701
2541 Ga0466966_0002676
2542 Ga0466961_0002712
2543 Ga0466961_0003965
2544 Ga0466961_0070693
2545 Ga0466963_0240141
2546 Ga0466964_0022707
2547 Ga0466964_0052165
2548 Ga0453684_0532631
2549 Ga0466971_0004296
2550 Ga0466971_0090701
2551 Ga0466971_0210867
2552 Ga0466968_0008215
2553 Ga0466968_0068779
2554 Ga0466970_0003084
2555 Ga0466970_0013349
2556 Ga0466970_0179059
2557 Ga0466970_0381209
2558 Ga0466957_0004013
2559 Ga0466960_0030336
2560 Ga0466959_0000100
2561 Ga0466959_0020575
2562 Ga0466959_0139992
2563 Ga0466959_0167906
2564 Ga0466959_0288700
2565 Ga0466959_0436775
2566 Ga0451576_0097798
2567 Ga0451576_0132455
2568 Ga0451576_0220133
2569 Ga0466958_0006453
2570 Ga0466958_0287134
2571 Ga0466967_0111240
2572 Ga0466967_0205699
2573 Ga0466967_0356071
2574 Ga0495617_086552
2575 Ga0495617_093614
2576 Ga0495627_002371
2577 Ga0495627_003650
2578 Ga0495627_004572
2579 Ga0495592_0000142
2580 Ga0495592_0140582
2581 Ga0495592_0435252
2582 Ga0495603_0090152
2583 Ga0495590_0053594
2584 Ga0495590_0075190
2585 Ga0495591_000037
2586 Ga0495591_000960
2587 Ga0495591_001346
2588 Ga0495591_001506
2589 Ga0495591_001756
2590 Ga0495591_002170
2591 Ga0495591_002395
2592 Ga0495591_007687
2593 Ga0495591_047522
2594 Ga0495629_0309896
2595 Ga0495638_0000048
2596 Ga0495638_0000116
2597 Ga0495638_0000609
2598 Ga0495638_0004826
2599 Ga0495638_0005132
2600 Ga0495638_0005434
2601 Ga0495638_0006182
2602 Ga0495638_0006896
2603 Ga0495638_0009403
2604 Ga0495638_0014627
2605 Ga0495638_0051434
2606 Ga0495638_0065460
2607 Ga0495638_0089304
2608 Ga0495638_0175133
2609 Ga0495651_0001526
2610 Ga0495651_0017466
2611 Ga0495653_0010928
2612 Ga0495653_0046847
2613 Ga0495653_0207640
2614 Ga0495650_0000064
2615 Ga0495650_0000174
2616 Ga0495650_0001163
2617 Ga0495650_0005976
2618 Ga0495650_0011700
2619 Ga0495582_0028785
2620 Ga0495605_0000036
2621 Ga0495605_0000849
2622 Ga0495605_0002810
2623 Ga0495605_0013595
2624 Ga0495605_0019669
2625 Ga0495605_0033210
2626 Ga0495605_0069943
2627 Ga0495639_0037023
2628 Ga0495639_0063650
2629 Ga0495664_0355824
2630 Ga0495584_0002037
2631 Ga0495584_0003914
2632 Ga0495584_0019260
2633 Ga0495584_0048988
2634 Ga0495584_0095941
2635 Ga0495584_0212467
2636 Ga0495585_0002685
2637 Ga0495585_0013417
2638 Ga0495585_0192600
2639 Ga0495594_0001898
2640 Ga0495594_0067344
2641 Ga0495596_0003157
2642 Ga0495607_0000149
2643 Ga0495607_0001076
2644 Ga0495607_0001283
2645 Ga0495607_0001388
2646 Ga0495607_0009553
2647 Ga0495607_0018552
2648 Ga0495607_0021322
2649 Ga0495607_0040702
2650 Ga0495607_0060814
2651 Ga0495607_0061381
2652 Ga0495607_0061828
2653 Ga0495607_0112849
2654 Ga0495607_0189239
2655 Ga0495607_0190950
2656 Ga0495583_0000028
2657 Ga0495583_0000271
2658 Ga0495583_0003346
2659 Ga0495583_0003399
2660 Ga0495583_0004619
2661 Ga0495583_0005967
2662 Ga0495583_0007992
2663 Ga0495583_0017345
2664 Ga0495583_0091190
2665 Ga0495606_0000042
2666 Ga0495606_0000094
2667 Ga0495606_0000415
2668 Ga0495606_0004342
2669 Ga0495606_0006710
2670 Ga0495606_0010458
2671 Ga0495606_0014490
2672 Ga0495606_0024275
2673 Ga0495606_0036664
2674 Ga0495606_0039111
2675 Ga0495606_0052325
2676 Ga0495606_0088236
2677 Ga0495606_0169291
2678 Ga0495608_0014841
2679 Ga0495608_0214098
2680 Ga0495610_0002926
2681 Ga0495610_0011761
2682 Ga0495610_0019341
2683 Ga0495610_0021121
2684 Ga0495610_0026266
2685 Ga0495610_0034583
2686 Ga0495610_0053459
2687 Ga0495610_0083878
2688 Ga0495610_0132491
2689 Ga0495616_0006962
2690 Ga0495616_0013952
2691 Ga0495616_0049861
2692 Ga0495616_0257611
2693 Ga0495618_0117375
2694 Ga0495618_0489653
2695 Ga0495620_0000322
2696 Ga0495620_0000370
2697 Ga0495620_0000712
2698 Ga0495620_0004434
2699 Ga0495620_0015211
2700 Ga0495620_0029580
2701 Ga0495620_0041274
2702 Ga0495620_0073965
2703 Ga0495620_0120267
2704 Ga0495628_0019455
2705 Ga0495628_0023111
2706 Ga0495628_0043863
2707 Ga0495630_0302918
2708 Ga0495630_0343695
2709 Ga0495631_0009296
2710 Ga0495631_0013326
2711 Ga0495631_0058600
2712 Ga0495631_0077096
2713 Ga0495632_0000839
2714 Ga0495632_0002490
2715 Ga0495632_0003654
2716 Ga0495632_0007029
2717 Ga0495632_0017521
2718 Ga0495632_0068575
2719 Ga0495632_0076860
2720 Ga0495632_0112566
2721 Ga0495632_0244946
2722 Ga0495637_0000518
2723 Ga0495637_0002120
2724 Ga0495637_0002498
2725 Ga0495637_0006632
2726 Ga0495637_0011157
2727 Ga0495637_0013035
2728 Ga0495637_0054447
2729 Ga0495637_0090531
2730 Ga0495637_0098999
2731 Ga0495643_0001985
2732 Ga0495643_0027906
2733 Ga0495643_0072791
2734 Ga0495643_0228252
2735 Ga0495643_0273125
2736 Ga0495644_0003319
2737 Ga0495644_0022555
2738 Ga0495648_0003291
2739 Ga0495648_0009523
2740 Ga0495648_0012087
2741 Ga0495648_0015690
2742 Ga0495648_0021890
2743 Ga0495648_0021980
2744 Ga0495648_0034583
2745 Ga0495648_0085577
2746 Ga0495648_0328987
2747 Ga0495663_0037378
2748 Ga0495666_0002123
2749 Ga0495666_0015904
2750 Ga0495642_0001683
2751 Ga0495652_0003383
2752 Ga0495652_0014655
2753 Ga0495652_0018360
2754 Ga0495652_0062372
2755 Ga0495654_0009795
2756 Ga0495654_0010614
2757 Ga0495654_0010779
2758 Ga0495654_0018508
2759 Ga0495654_0027630
2760 Ga0495654_0045750
2761 Ga0495654_0054388
2762 Ga0495654_0138228
2763 Ga0495586_0090429
2764 Ga0495587_0096907
2765 Ga0495609_0000115
2766 Ga0495609_0000395
2767 Ga0495609_0001220
2768 Ga0495609_0027036
2769 Ga0495609_0089017
2770 Ga0495609_0104390
2771 Ga0495597_0001034
2772 Ga0495597_0003290
2773 Ga0495597_0009290
2774 Ga0495597_0038735
2775 Ga0495645_0041759
2776 Ga0495645_0146948
2777 Ga0495645_0234638
2778 Ga0495622_0001521
2779 Ga0495622_0010711
2780 Ga0495622_0015667
2781 Ga0495633_0001693
2782 Ga0495633_0003880
2783 Ga0495633_0018744
2784 Ga0495633_0104180
2785 Ga0495668_0000025
2786 Ga0495668_0000034
2787 Ga0495668_0003196
2788 Ga0495668_0018558
2789 Ga0495668_0045515
2790 Ga0495611_0000736
2791 Ga0495611_0000932
2792 Ga0495611_0004344
2793 Ga0495611_0011566
2794 Ga0495611_0118484
2795 Ga0495625_0000672
2796 Ga0495625_0001328
2797 Ga0495625_0002338
2798 Ga0495625_0003330
2799 Ga0495625_0007862
2800 Ga0495625_0013918
2801 Ga0495625_0015980
2802 Ga0495625_0029666
2803 Ga0495625_0034457
2804 Ga0495625_0058185
2805 Ga0495625_0125368
2806 Ga0495625_0327292
2807 Ga0495635_0142949
2808 Ga0495659_0003001
2809 Ga0495661_0000205
2810 Ga0495661_0000437
2811 Ga0495661_0000685
2812 Ga0495661_0001817
2813 Ga0495661_0015865
2814 Ga0495661_0021833
2815 Ga0495661_0030083
2816 Ga0495661_0050094
2817 Ga0495661_0117772
2818 Ga0495661_0170983
2819 Ga0495588_0386856
2820 Ga0495657_0078730
2821 Ga0495657_0169271
2822 Ga0495599_0065919
2823 Ga0495599_0092568
2824 Ga0495623_0006272
2825 Ga0495623_0011011
2826 Ga0495623_0117161
2827 Ga0495646_0031113
2828 Ga0495646_0167151
2829 Ga0495669_0005645
2830 Ga0495624_0008471
2831 Ga0495624_0008919
2832 Ga0495624_0090273
2833 Ga0495624_0205268
2834 Ga0495670_0007244
2835 Ga0495670_0037571
2836 Ga0495670_0149284
2837 Ga0495671_0003674
2838 Ga0495671_0004465
2839 Ga0495671_0004983
2840 Ga0495671_0007822
2841 Ga0495671_0015205
2842 Ga0495671_0015406
2843 Ga0495671_0034356
2844 Ga0495671_0104254
2845 Ga0495671_0115800
2846 Ga0495671_0121301
2847 Ga0495649_0000813
2848 Ga0495649_0001962
2849 Ga0495649_0011895
2850 Ga0495649_0023047
2851 Ga0495649_0047497
2852 Ga0495649_0055434
2853 Ga0495649_0070460
2854 Ga0495649_0084108
2855 Ga0495649_0098503
2856 Ga0495649_0211595
2857 Ga0495649_0358682
2858 Ga0495589_0003822
2859 Ga0495589_0006874
2860 Ga0495589_0009064
2861 Ga0495600_0005056
2862 Ga0495600_0022072
2863 Ga0495600_0115827
2864 Ga0495600_0447738
2865 Ga0495660_0001767
2866 Ga0495660_0002709
2867 Ga0495660_0003160
2868 Ga0495660_0006768
2869 Ga0495660_0011688
2870 Ga0495660_0028243
2871 Ga0495660_0043308
2872 Ga0495660_0079486
2873 Ga0495660_0093520
2874 Ga0495660_0093707
2875 Ga0495660_0187273
2876 Ga0495660_0251164
2877 Ga0495604_0015148
2878 Ga0495636_0002862
2879 Ga0495674_0371631
2880 Ga0495674_0752674
2881 Ga0495672_0003648
2882 Ga0495672_0008206
2883 Ga0495672_0008237
2884 Ga0495672_0012356
2885 Ga0495672_0029446
2886 Ga0495672_0029976
2887 Ga0495672_0035502
2888 Ga0495672_0044459
2889 Ga0495672_0085170
2890 Ga0495676_0000171
2891 Ga0495676_0005618
2892 Ga0495676_0019092
2893 Ga0495676_0287743
2894 Ga0495680_0013577
2895 Ga0495680_0195899
2896 Ga0495680_0245429
2897 Ga0495680_0590021
2898 Ga0495683_0000507
2899 Ga0495683_0002187
2900 Ga0495683_0004452
2901 Ga0495683_0060803
2902 Ga0495683_0112566
2903 Ga0495687_014652
2904 Ga0495675_0160520
2905 Ga0495679_000119
2906 Ga0495679_000616
2907 Ga0495679_005316
2908 Ga0495679_005487
2909 Ga0495679_011231
2910 Ga0495673_0002146
2911 Ga0495673_0003396
2912 Ga0495673_0004684
2913 Ga0495673_0006738
2914 Ga0495673_0014086
2915 Ga0495673_0015086
2916 Ga0495673_0016949
2917 Ga0495673_0021460
2918 Ga0495673_0032777
2919 Ga0495673_0071120
2920 Ga0495673_0087608
2921 Ga0495673_0092902
2922 Ga0495673_0106155
2923 Ga0495681_0006275
2924 Ga0495681_0007039
2925 Ga0495681_0011334
2926 Ga0495681_0016651
2927 Ga0495681_0018332
2928 Ga0495681_0021522
2929 Ga0495681_0022687
2930 Ga0495681_0028069
2931 Ga0495681_0106035
2932 Ga0495684_0239586
2933 Ga0495686_0004625
2934 Ga0495686_0013186
2935 Ga0495686_0049354
2936 Ga0495686_0145655
2937 Ga0495686_0150339
2938 Ga0495686_0350079
2939 Ga0495593_0005528
2940 Ga0495593_0036138
2941 Ga0495602_0035542
2942 Ga0495602_0052798
2943 Ga0495602_0189543
2944 Ga0495602_0339293
2945 Ga0495602_0502137
2946 Ga0495626_0000123
2947 Ga0495626_0003485
2948 Ga0495626_0009762
2949 Ga0495626_0040937
2950 Ga0495626_0052685
2951 Ga0495626_0055747
2952 Ga0496100_0481852
2953 Ga0496101_0540725
2954 Ga0496102_0062552
2955 Ga0496102_0296561
2956 Ga0496103_0077612
2957 Ga0496106_0265042
2958 Ga0496108_0358924
2959 Ga0496108_0382610
2960 Ga0496110_0229455
2961 Ga0496110_0270918
2962 Ga0496112_0001839
2963 Ga0496112_0043323
2964 Ga0496112_0526048
2965 Ga0496113_0021787
2966 Ga0496113_0031793
2967 Ga0496113_0156192
2968 Ga0496114_0205139
2969 Ga0496115_0000272
2970 Ga0496115_0000603
2971 Ga0496115_0060115
2972 Ga0496115_0077865
2973 Ga0496115_0148277
2974 Ga0496115_0494381
2975 Ga0496116_0001261
2976 Ga0496116_0009203
2977 Ga0496116_0065947
2978 Ga0496117_0007562
2979 Ga0496117_0013964
2980 Ga0496117_0043017
2981 Ga0496117_0275142
2982 Ga0496118_0000110
2983 Ga0496118_0106046
2984 Ga0496118_0202860
2985 Ga0496118_0212095
2986 Ga0496119_0018322
2987 Ga0496121_0003265
2988 Ga0496121_0007177
2989 Ga0496121_0022646
2990 Ga0496121_0023406
2991 Ga0496121_0027767
2992 Ga0496121_0049083
2993 Ga0496121_0073761
2994 Ga0496121_0157459
2995 Ga0496121_0298633
2996 Ga0496121_0495183
2997 Ga0496122_0000156
2998 Ga0496122_0000203
2999 Ga0496122_0001639
3000 Ga0496122_0001861
3001 Ga0496122_0005055
3002 Ga0496122_0031343
3003 Ga0496122_0039759
3004 Ga0496122_0040203
3005 Ga0496122_0080009
3006 Ga0496122_0125128
3007 Ga0496123_0000087
3008 Ga0496123_0000164
3009 Ga0496123_0001205
3010 Ga0496123_0001590
3011 Ga0496123_0007317
3012 Ga0496123_0008731
3013 Ga0496123_0035809
3014 Ga0496123_0080573
3015 Ga0496123_0112383
3016 Ga0496123_0155192
3017 Ga0496123_0316871
3018 Ga0496124_0000006
3019 Ga0496124_0000625
3020 Ga0496124_0004834
3021 Ga0496124_0014633
3022 Ga0496124_0034319
3023 Ga0496124_0038440
3024 Ga0496124_0204851
3025 Ga0496124_0231951
3026 Ga0496124_0381799
3027 Ga0496124_0430146
3028 Ga0496125_0000144
3029 Ga0496125_0000453
3030 Ga0496125_0003794
3031 Ga0496125_0028662
3032 Ga0496126_0012736
3033 Ga0496126_0033969
3034 Ga0496126_0097693
3035 Ga0496126_0169439
3036 Ga0496126_0423695
3037 Ga0495678_000020
3038 Ga0495678_003152
3039 Ga0495678_003293
3040 Ga0495678_003507
3041 Ga0495678_013660
3042 Ga0495678_014347
3043 Ga0495678_014358
3044 Ga0495678_018085
3045 Ga0495678_032830
3046 Ga0495678_035839
3047 Ga0495678_105558
3048 Ga0495682_0000586
3049 Ga0495682_0002009
3050 Ga0495682_0005889
3051 Ga0501032_0497113
3052 Ga0501033_0005599
3053 Ga0501033_0219951
3054 Ga0501034_0001143
3055 Ga0501034_0007022
3056 Ga0501034_0013846
3057 Ga0501034_0022920
3058 Ga0501034_0144429
3059 Ga0501034_0153669
3060 Ga0501034_0579291
3061 Ga0501036_0015983
3062 Ga0501038_0044736
3063 Ga0501039_0002412
3064 Ga0501039_0305875
3065 Ga0501040_0034026
3066 Ga0501041_0029168
3067 Ga0501042_0005080
3068 Ga0501042_0133279
3069 Ga0501043_0003327
3070 Ga0501043_0075596
3071 Ga0501043_0486007
3072 Ga0501046_0012903
3073 Ga0501047_0039535
3074 Ga0501047_0053424
3075 Ga0501047_0080968
3076 Ga0501068_0000930
3077 Ga0501070_0079142
3078 Ga0501070_0264244
3079 Ga0501071_0467023
3080 Ga0501072_0010165
3081 Ga0501072_0381629
3082 Ga0501073_0044984
3083 Ga0501073_0064473
3084 Ga0501074_0058162
3085 Ga0501076_0008593
3086 Ga0501076_0377147
3087 Ga0501077_0007696
3088 Ga0501077_0489887
3089 Ga0501257_050780
3090 Ga0501079_0188946
3091 Ga0501080_0020448
3092 Ga0501080_0136946
3093 Ga0501080_0494998
3094 Ga0501081_0020291
3095 Ga0501083_0238302
3096 Ga0501241_004812
3097 Ga0501035_0004258
3098 Ga0501035_0024656
3099 Ga0501035_0155649
3100 Ga0501035_0416739
3101 Ga0501044_0002363
3102 Ga0501044_0069914
3103 Ga0501044_0072183
3104 Ga0501044_0278560
3105 Ga0501044_0331238
3106 Ga0501045_0012036
3107 Ga0501045_0224852
3108 nmdc:mga03683_3195_c1
3109 nmdc:mga0k408_19404_c1
3110 nmdc:mga07m45_13908_c2
3111 nmdc:mga0qj67_116626_c1
3112 nmdc:mga0sz30_118006_c1
3113 Ga0495601_0053137
3114 Ga0495601_0090848
3115 Ga0495601_0090990
3116 Ga0495601_0666155
3117 Ga0500635_0004850
3118 Ga0495595_0073684
3119 Ga0495619_0395030
3120 Ga0500643_000498
3121 Ga0500644_0001114
3122 Ga0500644_0064461
3123 Ga0500646_0105160
3124 Ga0500583_0043969
3125 Ga0500583_0142876
3126 Ga0500555_028482
3127 Ga0500594_0019363
3128 Ga0500595_001126
3129 Ga0500607_049700
3130 Ga0500608_001477
3131 Ga0500617_060103
3132 Ga0500618_019033
3133 Ga0500642_0293386
3134 Ga0500658_0012753
3135 Ga0500559_0001341
3136 Ga0500559_0010104
3137 Ga0500559_0143991
3138 Ga0500564_114763
3139 Ga0500568_0058092
3140 Ga0500573_0000071
3141 Ga0500573_0094310
3142 Ga0500574_005083
3143 Ga0500577_0298617
3144 Ga0500588_0110221
3145 Ga0500600_0005717
3146 Ga0500616_0024107
3147 Ga0500622_0001100
3148 Ga0500622_0173085
3149 Ga0500627_0346951
3150 Ga0500636_0035697
3151 Ga0500611_089672
3152 Ga0500645_007540
3153 Ga0500552_000300
3154 Ga0501084_0008983
3155 Ga0587111_0004128
3156 Ga0501082_0315950
3157 Ga0501082_0464469
3158 Ga0466962_0002025
3159 Ga0466962_0043341
3160 Ga0530510_0019831
3161 Ga0530510_0333456
3162 2501070871
3163 2501078568
3164 2501413700
3165 2510282948
3166 2510293622
3167 2510310772
3168 2511089625
3169 2511095029
3170 2511104685
3171 2511256746
3172 2511287653
3173 2511294081
3174 2511303121
3175 2511319887
3176 2511327730
3177 2511331593
3178 2511340314
3179 2511344956
3180 2511348646
3181 2511360794
3182 2511371090
3183 2511410727
3184 2511826113
3185 2512035163
3186 2513551450
3187 2513560100
3188 2516016857
3189 2523107000
3190 2597866972
3191 2599326628
3192 2599504338
3193 2599613628
3194 2599773002
3195 2599879345
3196 2599889369
3197 2599900767
3198 2599933401
3199 2599944146
3200 2599948709
3201 2599956364
3202 2599963412
3203 2599966542
3204 2599970517
3205 2599977679
3206 2599985058
3207 2599989316
3208 2599994229
3209 2600000288
3210 2600011848
3211 2600019337
3212 2600023524
3213 2600030674
3214 2600037031
3215 2600042454
3216 2600049550
3217 2600053847
3218 2600060517
3219 2600065616
3220 2600070775
3221 2600078301
3222 2600227499
3223 2600360481
3224 2601624908
3225 2601693299
3226 2621296521
3227 2624482029
3228 2643789496
3229 2643845072
3230 2643865505
3231 2643873515
3232 2643895807
3233 2643992044
3234 2644063252
3235 2644071735
3236 2644286253
3237 2644301090
3238 2644477999
3239 2644649451
3240 2671093677
3241 2671129093
3242 2671695356
3243 2678264449
3244 2718635272
3245 2738673467
3246 2738688496
3247 2738751860
3248 2738807569
3249 2738860901
3250 2738894929
3251 2739264228
3252 2739284892
3253 2739290206
3254 2739315061
3255 2739733513
3256 2739792210
3257 2745004903
3258 2765578237
3259 2774129007
3260 2774132930
3261 2784263206
3262 2794595962
3263 2808856905
3264 2808924261
3265 2808936976
3266 2808946354
3267 2808965328
3268 2808980119
3269 2808995839
3270 2809000184
3271 2809218873
3272 2817488000
3273 2819543539
3274 2819655767
3275 2819716083
3276 2825656609
3277 2826583068
3278 2842776991
3279 2842782426
3280 2842817526
3281 2842850677
3282 2842859300
3283 2848298180
3284 2852616657
3285 2852657290
3286 2852663017
3287 2852671625
3288 2856293324
3289 2857366557
3290 2857443924
3291 2860868025
3292 2879163333
3293 2879164124
3294 2880234631
3295 2883094613
3296 2884412791
3297 2884963330
3298 2894775022
3299 2899275640
3300 2904434671
3301 2904455291
3302 2904461324
3303 2904521230
3304 2904555284
3305 2913040926
3306 2917836877
3307 2919125914
3308 2919460967
3309 2919466868
3310 2919487275
3311 2923589963
3312 2928528143
3313 2928966808
3314 2928971350
3315 2928973921
3316 2929148425
3317 2929189908
3318 2929204315
3319 2931374159
3320 2939623926
3321 2939637519
3322 2946012923
3323 2946028213
3324 2947234734
3325 2969308785
3326 2974302578
3327 2977241119
3328 2984290602
3329 2984499836
3330 2984506267
3331 2988730026
3332 3000865581
3333 3007315895
3334 3007400967
3335 3007515729
3336 3007617863
3337 3007619929
3338 3007858925
3339 3007865519
3340 643602444
3341 8003015638
3342 8003957365
3343 8016731742
3344 8034965120
3345 8054503576
3346 8056127469
3347 8056144946
3348 8056180094

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

27

217

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v81-assembly1.cif.gz_A native kdpgal structure 0.9831 11 205
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9809 10 205
6xh5-assembly1.cif.gz_A hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks 0.9364 10 203
8szz-assembly1.cif.gz_J cryoem structure of computationally designed nanocage o32-zl4 0.9354 3 204
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.9335 1 204
ID Description Score Start End Superfamily
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.98 11 205 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9328 2 206 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9278 11 205 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9114 2 206 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9109 39 201 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A519F750-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 1 20 206 GO:0016829
AF-A0A3M3GZY1-F1-model_v4 deleted 0.9999 1 113
AF-A0A3L8CVF3-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9978 65 206 GO:0016829
AF-A0A2N8GTS6-F1-model_v4 deleted 0.9967 54 183
AF-A0A3M3A9Z3-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9963 98 206 GO:0016829

Map