F495294

General Info

Members Datasets Scaffolds Average Seq Length
1676 714 3352 382

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0011332|Ga0466969_0011332_2736_4004
Length 422
Sequence MTNGEPAAALPPGSGPRSPEVSSAQAAVSAGASAPVNLLDFDLDGLAAFCERLGEKRFRATQLYRWIHQKGAADFAQMSDLAKSLRQKLAGTAEVRGLPVISEQASADGTIKWLFDVGGGNAVESVFIPEDDRGTLCVSSQAGCAVGCRFCSTGHQGFSRNLSTGEIVAQLWFAEHHLRQRLNLKEGERAVTNVVMMGMGEPLQNYGALVPALRTMLDDHGYGLSRRRVTVSTSGVVPMMDRLREDCPVALAVSLHAPNDALRDVLVPLNRKYPLRELMAACRRYLDAAPRDFITFEYCMLDGVNDTPELAQELIARVRGEHPDARGVGAVACKFNLIPFNPFPESGLKRSPRDRVLAFAKLLQDAGVVTTVRKTRGDDIDAACGQLAGEVQDRTRAAERMTRAPIRVHRTPPAGGTGRMRE

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
162 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
169 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
199 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
254 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
263 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
268 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
274 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
275 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
276 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
277 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
278 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
279 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
280 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
281 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
282 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
283 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
284 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
285 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
286 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
287 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
288 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
291 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
292 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
293 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
294 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
295 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
296 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
299 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
300 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
301 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
302 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
303 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
304 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
305 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
306 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
307 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
308 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
309 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
310 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
311 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
312 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
313 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
315 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
316 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
317 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
318 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
319 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
320 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
323 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
324 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
325 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
326 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
327 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
328 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
329 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
330 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
331 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
332 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
333 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
336 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
337 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
338 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
339 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
340 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
341 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
342 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
343 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
344 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
345 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
346 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
347 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
348 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
349 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
350 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
351 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
352 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
353 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
354 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
355 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
356 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
357 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
358 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
359 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
360 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
361 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
362 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
363 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
364 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
365 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
366 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
367 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
368 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
369 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
370 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
371 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
372 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
373 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
374 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
375 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
376 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
377 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
378 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
379 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
380 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
381 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
382 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
383 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
384 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
385 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
386 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
387 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
388 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
389 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
390 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
391 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
392 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
393 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
396 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
397 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
398 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
399 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
400 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
403 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
404 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
405 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
406 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
407 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
408 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
409 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
410 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
411 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
412 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
413 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
414 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
415 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
416 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
417 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
418 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
419 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
420 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
421 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
422 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
423 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
424 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
425 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
426 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
427 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
428 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
429 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
430 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
431 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
432 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
433 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
434 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
435 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
436 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
437 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
438 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
439 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
440 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
441 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
442 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
443 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
444 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
445 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
446 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
447 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
448 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
449 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
450 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
451 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
452 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
453 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
454 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
455 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
456 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
457 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
458 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
459 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
460 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
461 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
462 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
463 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
464 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
465 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
466 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
467 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
468 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
469 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
470 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
471 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
472 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
473 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
474 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
475 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
476 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
477 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
478 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
479 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
480 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
482 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
483 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
484 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
485 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
486 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
494 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
495 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
496 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
497 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
498 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
499 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
500 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
501 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
502 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
503 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
504 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
505 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
506 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
507 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
509 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
510 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
511 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
512 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
513 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
514 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
515 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
516 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
517 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
518 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
519 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
520 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
521 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
522 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
523 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
524 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
525 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
526 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
527 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
528 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
529 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
530 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
531 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
532 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
533 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
534 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
535 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
536 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
537 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
538 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
539 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
540 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
541 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
542 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
543 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
544 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
545 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
546 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
547 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
548 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
549 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
550 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
551 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
552 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
574 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
575 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
576 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
577 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
578 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
579 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
580 2547132374 Acidovorax radicis N35 Isolate Unclassified
581 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
582 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
583 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
584 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
585 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
586 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
587 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
588 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
589 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
590 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
591 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
592 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
593 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
594 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
595 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
596 2643221556 Massilia sp. Root1485 Isolate Unclassified
597 2643221570 Acidovorax sp. Root568 Isolate Unclassified
598 2643221585 Pelomonas sp. Root662 Isolate Unclassified
599 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
600 2643221596 Acidovorax sp. Root70 Isolate Unclassified
601 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
602 2643221611 Acidovorax sp. Root219 Isolate Unclassified
603 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
604 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
605 2643221638 Duganella sp. Root336D2 Isolate Unclassified
606 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
607 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
608 2643221645 Massilia sp. Root351 Isolate Unclassified
609 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
610 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
611 2643221652 Acidovorax sp. Root402 Isolate Unclassified
612 2643221656 Pelomonas sp. Root405 Isolate Unclassified
613 2643221658 Variovorax sp. Root411 Isolate Unclassified
614 2643221664 Massilia sp. Root418 Isolate Unclassified
615 2643221672 Variovorax sp. Root434 Isolate Unclassified
616 2643221683 Variovorax sp. Root473 Isolate Unclassified
617 2643221684 Massilia sp. Root133 Isolate Unclassified
618 2643221717 Acidovorax sp. Root267 Isolate Unclassified
619 2738541277 Variovorax sp. GV051 Isolate Unclassified
620 2738541280 Massilia sp. GV090 Isolate Unclassified
621 2738541297 Duganella sp. GV083 Isolate Unclassified
622 2738541300 Massilia sp. GV016 Isolate Unclassified
623 2738541307 Variovorax sp. GV008 Isolate Unclassified
624 2738541337 Pelomonas sp. BT06 Isolate Unclassified
625 2738541357 Duganella sp. GV053 Isolate Unclassified
626 2738543003 Duganella sp. GV066 Isolate Unclassified
627 2738543013 Variovorax sp. BT01 Isolate Unclassified
628 2738543018 Massilia sp. GV045 Isolate Unclassified
629 2738543019 Variovorax sp. GV040 Isolate Unclassified
630 2738543026 Duganella sp. GV089 Isolate Unclassified
631 2738543029 Duganella sp. GV039 Isolate Unclassified
632 2738543030 Massilia sp. GV097 Isolate Unclassified
633 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
634 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
635 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
636 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
637 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
638 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
639 2816332133 Acidovorax radicis 2721A Isolate Unclassified
640 2818991436 Collimonas arenae 515 Isolate Unclassified
641 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
642 2818991446 Variovorax sp. 1180 Isolate Unclassified
643 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
644 2821131069 Duganella sp. 1224 Isolate Unclassified
645 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
646 2831864461 Roseateles noduli HZ7 Isolate Nodule
647 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
648 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
649 2842677519 Variovorax sp. R-72495 Isolate Unclassified
650 2842711865 Duganella sp. R-73148 Isolate Unclassified
651 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
652 2842733646 Variovorax sp. R-72446 Isolate Unclassified
653 2842747753 Variovorax sp. R-72060 Isolate Unclassified
654 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
655 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
656 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
657 2857553236 Duganella sp. R-74557 Isolate Unclassified
658 2857558681 Duganella sp. R-74565 Isolate Unclassified
659 2857564685 Duganella sp. R-74599 Isolate Unclassified
660 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
661 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
662 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
663 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
664 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
665 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
666 2885198086 Variovorax sp. 679 Isolate Unclassified
667 2885211737 Variovorax sp. 553 Isolate Unclassified
668 2885266251 Ralstonia sp. SET104 Isolate Nodule
669 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
670 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
671 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
672 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
673 2899924645 Variovorax sp. 369 Isolate Unclassified
674 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
675 2904424332 Duganella sp. 1411 Isolate Rhizosphere
676 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
677 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
678 2904456579 Variovorax sp. 2002 Isolate Unclassified
679 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
680 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
681 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
682 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
683 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
684 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
685 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
686 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
687 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
688 2919476304 Duganella sp. 3397 Isolate Unclassified
689 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
690 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
691 2928037797 Variovorax sp. 1126 Isolate Unclassified
692 2928044640 Variovorax sp. 1128 Isolate Unclassified
693 2928051484 Variovorax sp. 1133 Isolate Unclassified
694 2928058823 Ralstonia sp. 1138 Isolate Unclassified
695 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
696 2928070936 Variovorax gossypii 1167 Isolate Unclassified
697 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
698 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
699 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
700 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
701 2929520902 Variovorax beijingensis 502 Isolate Unclassified
702 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
703 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
704 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
705 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
706 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
707 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
708 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
709 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
710 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
711 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
712 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
713 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
714 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.42
Metatranscriptomes 3.1
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.61
Nodule 1.07
Rhizoplane 1.91
Rhizosphere 62.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0011332 3300044656 Bacteria 4721
2 JGI24741J21665_1000199 3300001915 Bacteria 17754
3 JGI24740J21852_10000895 3300001979 Bacteria 13189
4 JGI24740J21852_10001585 3300001979 Bacteria 10460
5 JGI24740J21852_10004992 3300001979 Bacteria 5638
6 JGI25155J39150_1000002 3300002704 Bacteria 292156
7 JGI25155J39150_1001127 3300002704 Bacteria 2553
8 JGI25155J39150_1001208 3300002704 Bacteria 2211
9 JGI25156J39149_1000003 3300002705 Bacteria 305434
10 JGI25156J39149_1000581 3300002705 Bacteria 20815
11 JGI25156J39149_1001438 3300002705 Bacteria 10105
12 JGI25156J39149_1001520 3300002705 Bacteria 9631
13 JGI25156J39149_1003958 3300002705 Bacteria 4680
14 JGI25156J39149_1005219 3300002705 Bacteria 3801
15 JGI25162J39368_1000015 3300002737 Bacteria 316381
16 JGI25162J39368_1007808 3300002737 Bacteria 1613
17 JGI25154J39366_1000009 3300002738 Bacteria 305408
18 JGI25154J39366_1000235 3300002738 Bacteria 36388
19 JGI25154J39366_1001232 3300002738 Bacteria 9642
20 JGI25154J39366_1001235 3300002738 Bacteria 9631
21 JGI25154J39366_1001307 3300002738 Bacteria 9249
22 JGI25154J39366_1001714 3300002738 Bacteria 7165
23 JGI25158J39367_1005220 3300002739 Bacteria 1911
24 JGI25157J39369_1000002 3300002741 Bacteria 305434
25 JGI25157J39369_1000163 3300002741 Bacteria 55914
26 JGI25157J39369_1000420 3300002741 Bacteria 28199
27 JGI25157J39369_1001343 3300002741 Bacteria 9712
28 JGI25152J39213_1000550 3300002773 Bacteria 20595
29 JGI25150J39212_1001844 3300002774 Bacteria 5603
30 JGI25150J39212_1002871 3300002774 Bacteria 4172
31 JGI25159J45721_1000800 3300002987 Bacteria 13705
32 JGI25159J45721_1004502 3300002987 Bacteria 4610
33 JGI25159J45721_1005712 3300002987 Bacteria 3856
34 JGI25159J45721_1009490 3300002987 Bacteria 2561
35 JGI25159J45721_1012145 3300002987 Bacteria 2070
36 Ga0006759J45824_1003446 3300003163 Bacteria 2823
37 JGI25151J46595_10005733 3300003187 Bacteria 6368
38 JGI25151J46595_10012448 3300003187 Bacteria 3868
39 JGI25151J46595_10022540 3300003187 Bacteria 2612
40 JGI25165J46597_1000001 3300003214 Bacteria 1111887
41 JGI25153J46596_10003458 3300003215 Bacteria 8844
42 JGI25153J46596_10008695 3300003215 Bacteria 4820
43 JGI25153J46596_10012758 3300003215 Bacteria 3600
44 JGI25153J46596_10021011 3300003215 Bacteria 2446
45 Ga0006777J48905_1005637 3300003308 Bacteria 1428
46 rootH1_10015076 3300003316 Bacteria 5286
47 rootL2_10000199 3300003322 Bacteria 15762
48 rootH1_10066204 3300003323 Bacteria 3979
49 JGI26128J50194_1000545 3300003347 Bacteria 2109
50 JGI25160J50197_1000257 3300003354 Bacteria 39928
51 JGI25160J50197_1000586 3300003354 Bacteria 20466
52 JGI26145J50221_1002406 3300003371 Bacteria 1473
53 JGI25161J50226_1000018 3300003374 Bacteria 172599
54 Ga0007417J51691_1021004 3300003544 Bacteria 1857
55 Ga0007410J51695_1007930 3300003574 Bacteria 3108
56 Ga0007410J51695_1013383 3300003574 Bacteria 1886
57 Ga0007410J51695_1013461 3300003574 Bacteria 1995
58 Ga0007409J51694_1007957 3300003575 Bacteria 2503
59 Ga0007409J51694_1014187 3300003575 Bacteria 16595
60 Ga0007416J51690_1015392 3300003577 Bacteria 16759
61 Ga0007416J51690_1017208 3300003577 Bacteria 3640
62 Ga0006562J51391_1019774 3300003578 Bacteria 2031
63 Ga0032354_1010901 3300003693 Bacteria 3273
64 Ga0032354_1037686 3300003693 Bacteria 6660
65 Ga0055538_1000001 3300003751 Bacteria 1111887
66 Ga0055539_1000001 3300003752 Bacteria 1111887
67 Ga0055539_1000021 3300003752 Bacteria 305460
68 Ga0055539_1000172 3300003752 Bacteria 56105
69 Ga0055539_1003113 3300003752 Bacteria 2375
70 Ga0055533_1000003 3300003756 Bacteria 1111887
71 Ga0055533_1000006 3300003756 Bacteria 635559
72 Ga0055533_1000029 3300003756 Bacteria 305460
73 Ga0055532_1000002 3300003758 Bacteria 576000
74 Ga0055532_1000029 3300003758 Bacteria 232900
75 Ga0055532_1000050 3300003758 Bacteria 169240
76 Ga0055525_1000001 3300003759 Bacteria 1016948
77 Ga0055525_1000026 3300003759 Bacteria 345798
78 Ga0055525_1000033 3300003759 Bacteria 305460
79 Ga0055525_1000087 3300003759 Bacteria 149803
80 Ga0055525_1000662 3300003759 Bacteria 13279
81 Ga0055535_1000270 3300003761 Bacteria 54462
82 Ga0055535_1000881 3300003761 Bacteria 20958
83 Ga0055542_1000027 3300003762 Bacteria 254819
84 Ga0055542_1001549 3300003762 Bacteria 10899
85 Ga0055542_1007204 3300003762 Bacteria 2287
86 Ga0055529_1000062 3300003763 Bacteria 183782
87 Ga0055529_1000095 3300003763 Bacteria 134030
88 Ga0055529_1000175 3300003763 Bacteria 87829
89 Ga0055526_1000256 3300003771 Bacteria 44998
90 Ga0055526_1000412 3300003771 Bacteria 34667
91 Ga0055526_1003759 3300003771 Bacteria 9471
92 Ga0055526_1011228 3300003771 Bacteria 4063
93 Ga0055526_1019259 3300003771 Bacteria 2494
94 Ga0055526_1019561 3300003771 Bacteria 2462
95 Ga0055537_1000008 3300003773 Bacteria 142572
96 Ga0055537_1000143 3300003773 Bacteria 53762
97 Ga0055537_1000638 3300003773 Bacteria 18639
98 Ga0055537_1003491 3300003773 Bacteria 4820
99 Ga0055524_1000083 3300003775 Bacteria 119259
100 Ga0055524_1000161 3300003775 Bacteria 77623
101 Ga0055536_1011405 3300003781 Bacteria 3414
102 Ga0055534_1000226 3300003784 Bacteria 40702
103 Ga0055534_1000304 3300003784 Bacteria 32991
104 Ga0055534_1000742 3300003784 Bacteria 15697
105 Ga0055534_1002938 3300003784 Bacteria 5648
106 Ga0055534_1009543 3300003784 Bacteria 2101
107 Ga0055528_1002845 3300003790 Bacteria 9031
108 Ga0055528_1006547 3300003790 Bacteria 5277
109 Ga0055530_10000211 3300003791 Bacteria 52600
110 Ga0055530_10002691 3300003791 Bacteria 11067
111 Ga0055530_10009042 3300003791 Bacteria 3884
112 Ga0055530_10009823 3300003791 Bacteria 3617
113 Ga0055540_1000012 3300003792 Bacteria 262667
114 Ga0055540_1000062 3300003792 Bacteria 128474
115 Ga0055540_1002597 3300003792 Bacteria 9408
116 Ga0055540_1006225 3300003792 Bacteria 4790
117 Ga0055540_1007759 3300003792 Bacteria 3984
118 Ga0055540_1018181 3300003792 Bacteria 1933
119 Ga0055531_10000481 3300003794 Bacteria 36889
120 Ga0055531_10000823 3300003794 Bacteria 25703
121 Ga0055531_10002967 3300003794 Bacteria 11029
122 Ga0055531_10008585 3300003794 Bacteria 5360
123 Ga0055531_10009809 3300003794 Bacteria 4853
124 Ga0055531_10018344 3300003794 Bacteria 2894
125 Ga0055541_1000001 3300003841 Bacteria 1111887
126 Ga0055541_1000029 3300003841 Bacteria 199874
127 Ga0055541_1000045 3300003841 Bacteria 148620
128 Ga0055541_1000370 3300003841 Bacteria 13833
129 Ga0055541_1000532 3300003841 Bacteria 10465
130 Ga0055543_1000993 3300004625 Bacteria 12770
131 Ga0055543_1001717 3300004625 Bacteria 8242
132 Ga0055543_1002038 3300004625 Bacteria 7097
133 Ga0055543_1002844 3300004625 Bacteria 5456
134 Ga0055543_1002954 3300004625 Bacteria 5295
135 Ga0055543_1005341 3300004625 Bacteria 3296
136 Ga0065165_1000006 3300005262 Bacteria 352298
137 Ga0065165_1000268 3300005262 Bacteria 89520
138 Ga0065165_1001911 3300005262 Bacteria 19919
139 Ga0065165_1005783 3300005262 Bacteria 6760
140 Ga0065165_1016274 3300005262 Bacteria 2792
141 Ga0065165_1042039 3300005262 Bacteria 1352
142 Ga0065704_10087556 3300005289 Bacteria 3016
143 Ga0065715_10137524 3300005293 Bacteria 1905
144 Ga0070658_10099644 3300005327 Bacteria 2401
145 Ga0070658_10166852 3300005327 Bacteria 1848
146 Ga0070676_10058257 3300005328 Bacteria 2288
147 Ga0070676_10060174 3300005328 Bacteria 2255
148 Ga0070676_10065730 3300005328 Bacteria 2166
149 Ga0070690_100030769 3300005330 Bacteria 3340
150 Ga0070690_100152895 3300005330 Bacteria 1576
151 Ga0070670_100000334 3300005331 Bacteria 39594
152 Ga0070677_10002685 3300005333 Bacteria 5693
153 Ga0068869_100052976 3300005334 Bacteria 2948
154 Ga0070666_10003592 3300005335 Bacteria 9401
155 Ga0070666_10041629 3300005335 Bacteria 3071
156 Ga0070682_100031262 3300005337 Bacteria 3219
157 Ga0070682_100060240 3300005337 Bacteria 2400
158 Ga0068868_100024313 3300005338 Bacteria 4596
159 Ga0070660_100000913 3300005339 Bacteria 19741
160 Ga0070660_100001317 3300005339 Bacteria 16907
161 Ga0070660_100066074 3300005339 Bacteria 2815
162 Ga0070660_100200320 3300005339 Bacteria 1619
163 Ga0070689_100042926 3300005340 Bacteria 3473
164 Ga0070689_100075030 3300005340 Bacteria 2647
165 Ga0070661_100000139 3300005344 Bacteria 60942
166 Ga0070661_100000264 3300005344 Bacteria 43037
167 Ga0070661_100071413 3300005344 Bacteria 2555
168 Ga0070668_100018633 3300005347 Bacteria 5212
169 Ga0070668_100153912 3300005347 Bacteria 1862
170 Ga0070669_100142037 3300005353 Bacteria 1852
171 Ga0070669_100165624 3300005353 Bacteria 1720
172 Ga0070675_100010734 3300005354 Bacteria 7165
173 Ga0070675_100045668 3300005354 Bacteria 3585
174 Ga0070675_100175651 3300005354 Bacteria 1849
175 Ga0070671_100018737 3300005355 Bacteria 5625
176 Ga0070671_100020806 3300005355 Bacteria 5352
177 Ga0070674_100000872 3300005356 Bacteria 15687
178 Ga0070673_100010297 3300005364 Bacteria 6325
179 Ga0070673_100115192 3300005364 Bacteria 2235
180 Ga0070659_100000798 3300005366 Bacteria 22978
181 Ga0070659_100001509 3300005366 Bacteria 16775
182 Ga0070659_100001576 3300005366 Bacteria 16422
183 Ga0070659_100064529 3300005366 Bacteria 2898
184 Ga0070659_100121600 3300005366 Bacteria 2115
185 Ga0070659_100203703 3300005366 Bacteria 1629
186 Ga0070667_100002781 3300005367 Bacteria 15106
187 Ga0070667_100027186 3300005367 Bacteria 4761
188 Ga0070667_100281596 3300005367 Bacteria 1493
189 Ga0070705_100018240 3300005440 Bacteria 3675
190 Ga0070705_100217251 3300005440 Bacteria 1321
191 Ga0070694_100028514 3300005444 Bacteria 3634
192 Ga0070708_100036779 3300005445 Bacteria 4271
193 Ga0070663_100000006 3300005455 Bacteria 208068
194 Ga0070663_100002931 3300005455 Bacteria 9711
195 Ga0070678_100006899 3300005456 Bacteria 6697
196 Ga0070678_100022537 3300005456 Bacteria 4176
197 Ga0070678_100041594 3300005456 Bacteria 3259
198 Ga0070678_100060133 3300005456 Bacteria 2795
199 Ga0070678_100194060 3300005456 Bacteria 1671
200 Ga0070681_10006689 3300005458 Bacteria 11214
201 Ga0070681_10087560 3300005458 Bacteria 3067
202 Ga0070681_10169046 3300005458 Bacteria 2108
203 Ga0068867_100000820 3300005459 Bacteria 20957
204 Ga0068867_100016759 3300005459 Bacteria 5206
205 Ga0068867_100018872 3300005459 Bacteria 4907
206 Ga0068867_100121514 3300005459 Bacteria 2019
207 Ga0068867_100171657 3300005459 Bacteria 1718
208 Ga0070685_10178037 3300005466 Bacteria 1367
209 Ga0070706_100028142 3300005467 Bacteria 5173
210 Ga0070699_100017265 3300005518 Bacteria 6197
211 Ga0070697_100001109 3300005536 Bacteria 20376
212 Ga0068853_100208762 3300005539 Bacteria 1779
213 Ga0068853_100219304 3300005539 Bacteria 1737
214 Ga0068853_100222964 3300005539 Bacteria 1723
215 Ga0068853_100281253 3300005539 Bacteria 1534
216 Ga0070672_100003864 3300005543 Bacteria 9751
217 Ga0070672_100018119 3300005543 Bacteria 5084
218 Ga0070672_100123127 3300005543 Bacteria 2125
219 Ga0070695_100027965 3300005545 Bacteria 3496
220 Ga0070665_100011739 3300005548 Bacteria 8846
221 Ga0070665_100234756 3300005548 Bacteria 1834
222 Ga0070665_100293540 3300005548 Bacteria 1628
223 Ga0070704_100014555 3300005549 Bacteria 4916
224 Ga0070704_100083446 3300005549 Bacteria 2359
225 Ga0068855_100002429 3300005563 Bacteria 23003
226 Ga0068855_100011038 3300005563 Bacteria 10902
227 Ga0068855_100040371 3300005563 Bacteria 5540
228 Ga0068855_100048665 3300005563 Bacteria 5003
229 Ga0068855_100107915 3300005563 Bacteria 3198
230 Ga0068855_100353836 3300005563 Bacteria 1617
231 Ga0070664_100000002 3300005564 Bacteria 458815
232 Ga0070664_100003853 3300005564 Bacteria 12108
233 Ga0070664_100024728 3300005564 Bacteria 4972
234 Ga0070664_100047466 3300005564 Bacteria 3627
235 Ga0070664_100160054 3300005564 Bacteria 1992
236 Ga0068857_100027590 3300005577 Bacteria 5009
237 Ga0068857_100031841 3300005577 Bacteria 4660
238 Ga0068857_100239237 3300005577 Bacteria 1662
239 Ga0068854_100000043 3300005578 Bacteria 92551
240 Ga0068854_100016517 3300005578 Bacteria 4922
241 Ga0068854_100075386 3300005578 Bacteria 2477
242 Ga0068856_100000028 3300005614 Bacteria 131498
243 Ga0068856_100001213 3300005614 Bacteria 27067
244 Ga0068856_100017575 3300005614 Bacteria 6930
245 Ga0068852_100018364 3300005616 Bacteria 5509
246 Ga0068852_100040581 3300005616 Bacteria 3928
247 Ga0068852_100143431 3300005616 Bacteria 2213
248 Ga0068852_100231748 3300005616 Bacteria 1760
249 Ga0068859_100030477 3300005617 Bacteria 5413
250 Ga0068859_100101618 3300005617 Bacteria 2932
251 Ga0068859_100159038 3300005617 Bacteria 2338
252 Ga0068864_100002247 3300005618 Bacteria 15969
253 Ga0068864_100039151 3300005618 Bacteria 4051
254 Ga0068861_100000343 3300005719 Bacteria 26498
255 Ga0068851_10074103 3300005834 Bacteria 1766
256 Ga0068863_100007447 3300005841 Bacteria 10712
257 Ga0068863_100016536 3300005841 Bacteria 7078
258 Ga0068863_100079825 3300005841 Bacteria 3099
259 Ga0068858_100012025 3300005842 Bacteria 8159
260 Ga0068860_100039691 3300005843 Bacteria 4503
261 Ga0068862_100012976 3300005844 Bacteria 6891
262 Ga0068862_100051442 3300005844 Bacteria 3524
263 Ga0075365_10020443 3300006038 Bacteria 4105
264 Ga0075365_10122504 3300006038 Bacteria 1795
265 Ga0075368_10076344 3300006042 Bacteria 1360
266 Ga0075363_100049093 3300006048 Bacteria 2246
267 Ga0075364_10000361 3300006051 Bacteria 22465
268 Ga0075364_10004201 3300006051 Bacteria 8263
269 Ga0075364_10015913 3300006051 Bacteria 4670
270 Ga0075364_10021230 3300006051 Bacteria 4092
271 Ga0075364_10096949 3300006051 Bacteria 1961
272 Ga0075432_10000339 3300006058 Bacteria 13374
273 Ga0075432_10023832 3300006058 Bacteria 2097
274 Ga0070716_100198077 3300006173 Bacteria 1332
275 Ga0075362_10001523 3300006177 Bacteria 7462
276 Ga0075362_10003993 3300006177 Bacteria 5247
277 Ga0075362_10007315 3300006177 Bacteria 4174
278 Ga0075362_10028935 3300006177 Bacteria 2384
279 Ga0075362_10033589 3300006177 Bacteria 2232
280 Ga0075367_10133290 3300006178 Bacteria 1536
281 Ga0075369_10101287 3300006186 Bacteria 1292
282 Ga0075366_10005443 3300006195 Bacteria 6899
283 Ga0075366_10006029 3300006195 Bacteria 6604
284 Ga0075366_10008662 3300006195 Bacteria 5664
285 Ga0075366_10014706 3300006195 Bacteria 4473
286 Ga0075366_10027449 3300006195 Bacteria 3339
287 Ga0075366_10030434 3300006195 Bacteria 3173
288 Ga0075366_10044456 3300006195 Bacteria 2632
289 Ga0075366_10046494 3300006195 Bacteria 2572
290 Ga0075366_10047353 3300006195 Bacteria 2549
291 Ga0075366_10049372 3300006195 Bacteria 2497
292 Ga0075366_10081180 3300006195 Bacteria 1937
293 Ga0075370_10000245 3300006353 Bacteria 19479
294 Ga0075370_10001414 3300006353 Bacteria 10381
295 Ga0075370_10001496 3300006353 Bacteria 10196
296 Ga0075370_10005283 3300006353 Bacteria 6397
297 Ga0075370_10007796 3300006353 Bacteria 5472
298 Ga0075370_10009707 3300006353 Bacteria 5011
299 Ga0075370_10011251 3300006353 Bacteria 4697
300 Ga0075370_10015818 3300006353 Bacteria 4047
301 Ga0075370_10096614 3300006353 Bacteria 1707
302 Ga0068871_100028781 3300006358 Bacteria 4360
303 Ga0075428_100000521 3300006844 Bacteria 39098
304 Ga0075430_100023615 3300006846 Bacteria 5236
305 Ga0075430_100035659 3300006846 Bacteria 4219
306 Ga0075433_10171730 3300006852 Bacteria 1929
307 Ga0075434_100053000 3300006871 Bacteria 4031
308 Ga0075429_100003825 3300006880 Bacteria 12856
309 Ga0075429_100020657 3300006880 Bacteria 5716
310 Ga0075436_100000353 3300006914 Bacteria 29366
311 Ga0075436_100006510 3300006914 Bacteria 8001
312 Ga0075436_100072438 3300006914 Bacteria 2384
313 Ga0097620_100030476 3300006931 Bacteria 5413
314 Ga0097620_100101621 3300006931 Bacteria 2932
315 Ga0097620_100159052 3300006931 Bacteria 2338
316 Ga0099823_1003573 3300006944 Bacteria 14802
317 Ga0079104_1000186 3300006946 Bacteria 87104
318 Ga0079104_1007818 3300006946 Bacteria 3817
319 Ga0079104_1010697 3300006946 Bacteria 2998
320 Ga0099826_10000001 3300006948 Bacteria 1155201
321 Ga0099826_10001313 3300006948 Bacteria 14690
322 Ga0075435_100247971 3300007076 Bacteria 1516
323 Ga0099794_10029708 3300007265 Bacteria 2547
324 Ga0099794_10043832 3300007265 Bacteria 2137
325 Ga0105244_10003650 3300009036 Bacteria 10894
326 Ga0105244_10030420 3300009036 Bacteria 2873
327 Ga0105244_10072715 3300009036 Bacteria 1713
328 Ga0105240_10005173 3300009093 Bacteria 19510
329 Ga0105240_10017343 3300009093 Bacteria 9709
330 Ga0105240_10018846 3300009093 Bacteria 9241
331 Ga0105240_10020541 3300009093 Bacteria 8804
332 Ga0105240_10058094 3300009093 Bacteria 4830
333 Ga0105240_10088709 3300009093 Bacteria 3784
334 Ga0111539_10001172 3300009094 Bacteria 34757
335 Ga0105245_10206027 3300009098 Bacteria 1891
336 Ga0105243_10003626 3300009148 Bacteria 12435
337 Ga0105243_10012597 3300009148 Bacteria 6390
338 Ga0105243_10015371 3300009148 Bacteria 5789
339 Ga0105243_10046565 3300009148 Bacteria 3412
340 Ga0105242_10000970 3300009176 Bacteria 22398
341 Ga0105242_10016812 3300009176 Bacteria 5694
342 Ga0105248_10051958 3300009177 Bacteria 4599
343 Ga0105248_10054325 3300009177 Bacteria 4491
344 Ga0105237_10000367 3300009545 Bacteria 63983
345 Ga0105237_10007511 3300009545 Bacteria 11921
346 Ga0105237_10009389 3300009545 Bacteria 10477
347 Ga0105237_10046093 3300009545 Bacteria 4386
348 Ga0105237_10091314 3300009545 Bacteria 3035
349 Ga0105238_10000367 3300009551 Bacteria 48504
350 Ga0105239_10000150 3300010375 Bacteria 100349
351 Ga0105239_10048392 3300010375 Bacteria 4663
352 Ga0105239_10126300 3300010375 Bacteria 2843
353 Ga0105239_10258439 3300010375 Bacteria 1957
354 Ga0105246_10048906 3300011119 Bacteria 2893
355 Ga0157319_1000009 3300012497 Bacteria 227971
356 Ga0157373_10002505 3300013100 Bacteria 13979
357 Ga0157373_10024986 3300013100 Bacteria 4325
358 Ga0157373_10036278 3300013100 Bacteria 3540
359 Ga0157373_10069956 3300013100 Bacteria 2480
360 Ga0157371_10000001 3300013102 Bacteria 1162285
361 Ga0157371_10000204 3300013102 Bacteria 86751
362 Ga0157371_10143951 3300013102 Bacteria 1698
363 Ga0157370_10000013 3300013104 Bacteria 198861
364 Ga0157370_10002966 3300013104 Bacteria 20185
365 Ga0157370_10198943 3300013104 Bacteria 1859
366 Ga0157369_10000724 3300013105 Bacteria 42487
367 Ga0157369_10002173 3300013105 Bacteria 23616
368 Ga0157369_10006099 3300013105 Bacteria 13993
369 Ga0157369_10126414 3300013105 Bacteria 2710
370 Ga0157374_10000067 3300013296 Bacteria 107173
371 Ga0157374_10000895 3300013296 Bacteria 25972
372 Ga0157374_10140959 3300013296 Bacteria 2340
373 Ga0157378_10012903 3300013297 Bacteria 7315
374 Ga0157378_10041290 3300013297 Bacteria 4092
375 Ga0157378_10052732 3300013297 Bacteria 3619
376 Ga0157378_10059389 3300013297 Bacteria 3412
377 Ga0157378_10074224 3300013297 Bacteria 3060
378 Ga0163162_10003353 3300013306 Bacteria 15319
379 Ga0163162_10129458 3300013306 Bacteria 2632
380 Ga0163162_10166104 3300013306 Bacteria 2331
381 Ga0163162_10176279 3300013306 Bacteria 2263
382 Ga0157372_10006459 3300013307 Bacteria 12484
383 Ga0157372_10129142 3300013307 Bacteria 2907
384 Ga0157375_10027704 3300013308 Bacteria 5301
385 Ga0157375_10030363 3300013308 Bacteria 5095
386 Ga0163163_10006006 3300014325 Bacteria 10564
387 Ga0157380_10047265 3300014326 Bacteria 3384
388 Ga0157380_10083953 3300014326 Bacteria 2610
389 Ga0182008_10000317 3300014497 Bacteria 37953
390 Ga0182008_10001784 3300014497 Bacteria 14086
391 Ga0182008_10008860 3300014497 Bacteria 5460
392 Ga0182008_10016908 3300014497 Bacteria 3784
393 Ga0182008_10019892 3300014497 Bacteria 3460
394 Ga0182008_10039546 3300014497 Bacteria 2356
395 Ga0182008_10069701 3300014497 Bacteria 1730
396 Ga0157377_10000014 3300014745 Bacteria 213961
397 Ga0157379_10023602 3300014968 Bacteria 5459
398 Ga0157379_10030186 3300014968 Bacteria 4823
399 Ga0157379_10061146 3300014968 Bacteria 3368
400 Ga0157376_10098455 3300014969 Bacteria 2550
401 Ga0157376_10327014 3300014969 Bacteria 1459
402 Ga0182006_1000002 3300015261 Bacteria 887990
403 Ga0182006_1000117 3300015261 Bacteria 85963
404 Ga0182006_1001371 3300015261 Bacteria 14825
405 Ga0182006_1002284 3300015261 Bacteria 10590
406 Ga0182006_1010814 3300015261 Bacteria 4042
407 Ga0182006_1014280 3300015261 Bacteria 3426
408 Ga0182006_1060176 3300015261 Bacteria 1436
409 Ga0182007_10000045 3300015262 Bacteria 106028
410 Ga0182007_10001215 3300015262 Bacteria 13977
411 Ga0182007_10002141 3300015262 Bacteria 10070
412 Ga0182007_10003073 3300015262 Bacteria 8035
413 Ga0182007_10006337 3300015262 Bacteria 5087
414 Ga0182007_10035831 3300015262 Bacteria 1672
415 Ga0182005_1000002 3300015265 Bacteria 908499
416 Ga0182005_1000007 3300015265 Bacteria 490994
417 Ga0182005_1000431 3300015265 Bacteria 22295
418 Ga0182005_1008518 3300015265 Bacteria 3021
419 Ga0183362_10001 3300015683 Bacteria 2046624
420 Ga0163161_10000943 3300017792 Bacteria 22389
421 Ga0163161_10033889 3300017792 Bacteria 3650
422 Ga0163161_10054079 3300017792 Bacteria 2913
423 Ga0197907_11358827 3300020069 Bacteria 6030
424 Ga0206349_1321444 3300020075 Bacteria 3053
425 Ga0206355_1123131 3300020076 Bacteria 9882
426 Ga0206351_10143154 3300020077 Bacteria 33246
427 Ga0206350_10286196 3300020080 Bacteria 3863
428 Ga0154015_1106824 3300020610 Bacteria 15314
429 Ga0213872_10000003 3300021361 Bacteria 366948
430 Ga0213872_10000004 3300021361 Bacteria 306230
431 Ga0213872_10000016 3300021361 Bacteria 180524
432 Ga0213872_10000026 3300021361 Bacteria 149852
433 Ga0213872_10000199 3300021361 Bacteria 53150
434 Ga0213872_10000552 3300021361 Bacteria 29038
435 Ga0213872_10004172 3300021361 Bacteria 7773
436 Ga0213872_10050593 3300021361 Bacteria 1886
437 Ga0213876_10047440 3300021384 Bacteria 2271
438 Ga0224712_10003779 3300022467 Bacteria 3989
439 Ga0209435_100001 3300025206 Bacteria 1424171
440 Ga0209435_100029 3300025206 Bacteria 176358
441 Ga0209435_100531 3300025206 Bacteria 7324
442 Ga0209436_100074 3300025208 Bacteria 50572
443 Ga0209436_107406 3300025208 Bacteria 2296
444 Ga0209436_107658 3300025208 Bacteria 2230
445 Ga0209784_100003 3300025224 Bacteria 1379451
446 Ga0209784_100004 3300025224 Bacteria 1378156
447 Ga0209784_100033 3300025224 Bacteria 305649
448 Ga0209784_100522 3300025224 Bacteria 14485
449 Ga0209566_100002 3300025225 Bacteria 2614868
450 Ga0209566_100004 3300025225 Bacteria 1531866
451 Ga0209566_100037 3300025225 Bacteria 305649
452 Ga0209566_100731 3300025225 Bacteria 18455
453 Ga0209566_101006 3300025225 Bacteria 12012
454 Ga0209674_100003 3300025226 Bacteria 2196646
455 Ga0209674_100006 3300025226 Bacteria 1531866
456 Ga0209674_100008 3300025226 Bacteria 1076909
457 Ga0209674_100055 3300025226 Bacteria 305649
458 Ga0209674_100217 3300025226 Bacteria 55436
459 Ga0209672_100052 3300025228 Bacteria 231179
460 Ga0209672_100190 3300025228 Bacteria 49762
461 Ga0209672_101060 3300025228 Bacteria 11768
462 Ga0209672_101759 3300025228 Bacteria 6810
463 Ga0209672_105771 3300025228 Bacteria 2087
464 Ga0209147_100002 3300025229 Bacteria 2158988
465 Ga0209147_100004 3300025229 Bacteria 1371850
466 Ga0209563_100004 3300025230 Bacteria 1814108
467 Ga0209563_100005 3300025230 Bacteria 1774893
468 Ga0209563_100007 3300025230 Bacteria 1579402
469 Ga0209563_100009 3300025230 Bacteria 1378156
470 Ga0209563_100010 3300025230 Bacteria 1337457
471 Ga0209563_100056 3300025230 Bacteria 305649
472 Ga0209563_102380 3300025230 Bacteria 4283
473 Ga0207427_101216 3300025231 Bacteria 9960
474 Ga0209437_100004 3300025233 Bacteria 1378156
475 Ga0209437_100053 3300025233 Bacteria 375580
476 Ga0209258_100002 3300025242 Bacteria 2158988
477 Ga0209258_100048 3300025242 Bacteria 365881
478 Ga0209258_100060 3300025242 Bacteria 319881
479 Ga0209258_100463 3300025242 Bacteria 44224
480 Ga0209258_100482 3300025242 Bacteria 41643
481 Ga0207425_1000001 3300025245 Bacteria 2525432
482 Ga0207425_1000089 3300025245 Bacteria 91267
483 Ga0207425_1000275 3300025245 Bacteria 37897
484 Ga0207425_1000596 3300025245 Bacteria 20990
485 Ga0207425_1003163 3300025245 Bacteria 5387
486 Ga0207425_1003233 3300025245 Bacteria 5316
487 Ga0209646_1000001 3300025246 Bacteria 3092932
488 Ga0209646_1000010 3300025246 Bacteria 573803
489 Ga0209646_1000022 3300025246 Bacteria 446621
490 Ga0209646_1000073 3300025246 Bacteria 224301
491 Ga0209646_1000109 3300025246 Bacteria 158348
492 Ga0209646_1000242 3300025246 Bacteria 56037
493 Ga0209026_1000003 3300025250 Bacteria 1060571
494 Ga0209026_1000124 3300025250 Bacteria 125673
495 Ga0209026_1000311 3300025250 Bacteria 52155
496 Ga0209026_1004281 3300025250 Bacteria 4309
497 Ga0209677_100005 3300025253 Bacteria 1378156
498 Ga0209677_100009 3300025253 Bacteria 749530
499 Ga0209677_100034 3300025253 Bacteria 305649
500 Ga0209677_100274 3300025253 Bacteria 34497
501 Ga0209677_100396 3300025253 Bacteria 26411
502 Ga0209677_103662 3300025253 Bacteria 4837
503 Ga0209677_111576 3300025253 Bacteria 1366
504 Ga0209148_1000021 3300025254 Bacteria 714645
505 Ga0209148_1000040 3300025254 Bacteria 473531
506 Ga0209148_1000241 3300025254 Bacteria 87665
507 Ga0209148_1002487 3300025254 Bacteria 6262
508 Ga0209759_1000001 3300025256 Bacteria 2799452
509 Ga0209759_1000108 3300025256 Bacteria 146393
510 Ga0209759_1000373 3300025256 Bacteria 56051
511 Ga0209759_1000412 3300025256 Bacteria 52804
512 Ga0209759_1001241 3300025256 Bacteria 15482
513 Ga0209759_1001285 3300025256 Bacteria 14981
514 Ga0209759_1001792 3300025256 Bacteria 10886
515 Ga0209759_1006296 3300025256 Bacteria 4011
516 Ga0209759_1008599 3300025256 Bacteria 3165
517 Ga0209129_1000001 3300025258 Bacteria 1452436
518 Ga0209129_1000007 3300025258 Bacteria 771325
519 Ga0209129_1000148 3300025258 Bacteria 114559
520 Ga0209129_1004204 3300025258 Bacteria 5774
521 Ga0209129_1007373 3300025258 Bacteria 3293
522 Ga0209129_1013173 3300025258 Bacteria 1839
523 Ga0209233_1000005 3300025261 Bacteria 1531866
524 Ga0209565_1000004 3300025263 Bacteria 983150
525 Ga0209565_1000009 3300025263 Bacteria 751701
526 Ga0209565_1000153 3300025263 Bacteria 92909
527 Ga0209565_1000292 3300025263 Bacteria 48172
528 Ga0209565_1000311 3300025263 Bacteria 45199
529 Ga0209565_1000606 3300025263 Bacteria 23901
530 Ga0209565_1001694 3300025263 Bacteria 9100
531 Ga0209565_1003078 3300025263 Bacteria 5601
532 Ga0209455_1000021 3300025272 Bacteria 699993
533 Ga0209455_1000093 3300025272 Bacteria 220487
534 Ga0209455_1000121 3300025272 Bacteria 173350
535 Ga0209455_1002583 3300025272 Bacteria 6904
536 Ga0209673_1000019 3300025273 Bacteria 449094
537 Ga0209673_1000074 3300025273 Bacteria 233552
538 Ga0209673_1000423 3300025273 Bacteria 73682
539 Ga0209673_1000794 3300025273 Bacteria 42072
540 Ga0209673_1003547 3300025273 Bacteria 9103
541 Ga0209673_1003649 3300025273 Bacteria 8901
542 Ga0209673_1011832 3300025273 Bacteria 3565
543 Ga0209673_1012266 3300025273 Bacteria 3464
544 Ga0209130_1000050 3300025284 Bacteria 222092
545 Ga0209130_1000143 3300025284 Bacteria 114072
546 Ga0209130_1000172 3300025284 Bacteria 93199
547 Ga0209130_1000329 3300025284 Bacteria 54511
548 Ga0209130_1000460 3300025284 Bacteria 42703
549 Ga0209130_1002121 3300025284 Bacteria 10547
550 Ga0209130_1004145 3300025284 Bacteria 5683
551 Ga0209130_1005713 3300025284 Bacteria 4226
552 Ga0209675_1000028 3300025291 Bacteria 281253
553 Ga0209675_1000044 3300025291 Bacteria 230392
554 Ga0209675_1000150 3300025291 Bacteria 92909
555 Ga0209675_1001581 3300025291 Bacteria 12882
556 Ga0209675_1001931 3300025291 Bacteria 11201
557 Ga0209675_1002255 3300025291 Bacteria 10065
558 Ga0209675_1007563 3300025291 Bacteria 4141
559 Ga0209676_1000004 3300025292 Bacteria 1138360
560 Ga0209676_1000029 3300025292 Bacteria 520536
561 Ga0209676_1002870 3300025292 Bacteria 11363
562 Ga0209676_1003529 3300025292 Bacteria 9532
563 Ga0209676_1003660 3300025292 Bacteria 9218
564 Ga0209676_1016751 3300025292 Bacteria 2629
565 Ga0209025_1000111 3300025294 Bacteria 218982
566 Ga0209025_1000624 3300025294 Bacteria 62814
567 Ga0209025_1002339 3300025294 Bacteria 20439
568 Ga0209025_1003371 3300025294 Bacteria 15273
569 Ga0209025_1005225 3300025294 Bacteria 10707
570 Ga0209025_1007741 3300025294 Bacteria 7919
571 Ga0209025_1008867 3300025294 Bacteria 7124
572 Ga0209564_1000003 3300025295 Bacteria 1585848
573 Ga0209564_1000009 3300025295 Bacteria 950196
574 Ga0209564_1000033 3300025295 Bacteria 446200
575 Ga0209564_1000058 3300025295 Bacteria 332955
576 Ga0209564_1000153 3300025295 Bacteria 166910
577 Ga0209564_1000178 3300025295 Bacteria 151982
578 Ga0209564_1000251 3300025295 Bacteria 114511
579 Ga0209564_1000470 3300025295 Bacteria 67507
580 Ga0209564_1001234 3300025295 Bacteria 28811
581 Ga0209564_1001907 3300025295 Bacteria 18654
582 Ga0209564_1005307 3300025295 Bacteria 7424
583 Ga0209564_1008824 3300025295 Bacteria 4906
584 Ga0209758_1000025 3300025297 Bacteria 586687
585 Ga0209758_1000116 3300025297 Bacteria 198356
586 Ga0209758_1000387 3300025297 Bacteria 76099
587 Ga0209758_1000439 3300025297 Bacteria 69980
588 Ga0209758_1002669 3300025297 Bacteria 17617
589 Ga0209758_1005897 3300025297 Bacteria 9126
590 Ga0209758_1012598 3300025297 Bacteria 4714
591 Ga0209050_1000002 3300025298 Bacteria 1792849
592 Ga0209050_1000003 3300025298 Bacteria 1609245
593 Ga0209050_1000412 3300025298 Bacteria 79647
594 Ga0209050_1001086 3300025298 Bacteria 33175
595 Ga0209050_1001892 3300025298 Bacteria 20072
596 Ga0209050_1005811 3300025298 Bacteria 7577
597 Ga0209050_1010897 3300025298 Bacteria 4402
598 Ga0209050_1020874 3300025298 Bacteria 2415
599 Ga0209050_1021056 3300025298 Bacteria 2396
600 Ga0209256_1000001 3300025299 Bacteria 2166974
601 Ga0209256_1000005 3300025299 Bacteria 1315082
602 Ga0209256_1000024 3300025299 Bacteria 448909
603 Ga0209256_1000093 3300025299 Bacteria 209318
604 Ga0209256_1000488 3300025299 Bacteria 58638
605 Ga0209256_1003497 3300025299 Bacteria 10949
606 Ga0207426_1000001 3300025302 Bacteria 1341301
607 Ga0207426_1000028 3300025302 Bacteria 483955
608 Ga0207426_1000071 3300025302 Bacteria 329539
609 Ga0207426_1000692 3300025302 Bacteria 40473
610 Ga0207426_1001345 3300025302 Bacteria 20882
611 Ga0209051_1000002 3300025303 Bacteria 1631846
612 Ga0209051_1000003 3300025303 Bacteria 1609245
613 Ga0209051_1000063 3300025303 Bacteria 249739
614 Ga0209051_1000268 3300025303 Bacteria 87155
615 Ga0209051_1001146 3300025303 Bacteria 24136
616 Ga0209051_1001878 3300025303 Bacteria 16472
617 Ga0209051_1003892 3300025303 Bacteria 9535
618 Ga0209051_1005038 3300025303 Bacteria 7868
619 Ga0209051_1014865 3300025303 Bacteria 3612
620 Ga0209051_1053509 3300025303 Bacteria 1325
621 Ga0209257_1000002 3300025304 Bacteria 1767052
622 Ga0209257_1000018 3300025304 Bacteria 836016
623 Ga0209257_1000275 3300025304 Bacteria 116952
624 Ga0209257_1000354 3300025304 Bacteria 93718
625 Ga0209257_1001690 3300025304 Bacteria 24813
626 Ga0209257_1002262 3300025304 Bacteria 19671
627 Ga0209257_1002313 3300025304 Bacteria 19265
628 Ga0209257_1002999 3300025304 Bacteria 15302
629 Ga0209257_1004776 3300025304 Bacteria 10103
630 Ga0209257_1019761 3300025304 Bacteria 2521
631 Ga0207697_10004138 3300025315 Bacteria 6997
632 Ga0207697_10011975 3300025315 Bacteria 3651
633 Ga0207655_1003482 3300025728 Bacteria 11692
634 Ga0207655_1006002 3300025728 Bacteria 8126
635 Ga0207682_10003292 3300025893 Bacteria 7058
636 Ga0207682_10013079 3300025893 Bacteria 3234
637 Ga0207680_10003056 3300025903 Bacteria 7852
638 Ga0207647_10000176 3300025904 Bacteria 51278
639 Ga0207645_10006398 3300025907 Bacteria 8458
640 Ga0207645_10009991 3300025907 Bacteria 6536
641 Ga0207643_10035733 3300025908 Bacteria 2787
642 Ga0207643_10067634 3300025908 Bacteria 2051
643 Ga0207643_10102057 3300025908 Bacteria 1683
644 Ga0207705_10000768 3300025909 Bacteria 26407
645 Ga0207705_10112464 3300025909 Bacteria 2013
646 Ga0207684_10104042 3300025910 Bacteria 2427
647 Ga0207654_10005978 3300025911 Bacteria 6125
648 Ga0207707_10012991 3300025912 Bacteria 7250
649 Ga0207707_10070211 3300025912 Bacteria 3053
650 Ga0207695_10001614 3300025913 Bacteria 36581
651 Ga0207695_10002501 3300025913 Bacteria 27018
652 Ga0207695_10004682 3300025913 Bacteria 18530
653 Ga0207695_10005439 3300025913 Bacteria 16890
654 Ga0207695_10036213 3300025913 Bacteria 5338
655 Ga0207695_10292937 3300025913 Bacteria 1519
656 Ga0207671_10000808 3300025914 Bacteria 39539
657 Ga0207671_10026808 3300025914 Bacteria 4312
658 Ga0207671_10050814 3300025914 Bacteria 3070
659 Ga0207657_10000843 3300025919 Bacteria 32461
660 Ga0207657_10002514 3300025919 Bacteria 19834
661 Ga0207657_10044157 3300025919 Bacteria 3920
662 Ga0207649_10000193 3300025920 Bacteria 50158
663 Ga0207649_10002218 3300025920 Bacteria 10971
664 Ga0207649_10116089 3300025920 Bacteria 1797
665 Ga0207646_10351787 3300025922 Bacteria 1331
666 Ga0207681_10004604 3300025923 Bacteria 8484
667 Ga0207681_10102846 3300025923 Bacteria 2063
668 Ga0207650_10000913 3300025925 Bacteria 22271
669 Ga0207659_10000189 3300025926 Bacteria 36771
670 Ga0207659_10004058 3300025926 Bacteria 8834
671 Ga0207659_10004477 3300025926 Bacteria 8457
672 Ga0207687_10070281 3300025927 Bacteria 2499
673 Ga0207687_10274339 3300025927 Bacteria 1349
674 Ga0207644_10029379 3300025931 Bacteria 3813
675 Ga0207690_10000541 3300025932 Bacteria 24643
676 Ga0207690_10005319 3300025932 Bacteria 7587
677 Ga0207690_10007244 3300025932 Bacteria 6586
678 Ga0207690_10007619 3300025932 Bacteria 6422
679 Ga0207690_10153749 3300025932 Bacteria 1708
680 Ga0207706_10034951 3300025933 Bacteria 4471
681 Ga0207706_10049695 3300025933 Bacteria 3706
682 Ga0207706_10061811 3300025933 Bacteria 3299
683 Ga0207706_10128454 3300025933 Bacteria 2229
684 Ga0207686_10000809 3300025934 Bacteria 19195
685 Ga0207709_10001797 3300025935 Bacteria 14374
686 Ga0207709_10004048 3300025935 Bacteria 8536
687 Ga0207709_10009473 3300025935 Bacteria 5357
688 Ga0207670_10186134 3300025936 Bacteria 1567
689 Ga0207669_10001570 3300025937 Bacteria 9743
690 Ga0207669_10005261 3300025937 Bacteria 5784
691 Ga0207669_10094735 3300025937 Bacteria 1955
692 Ga0207669_10105297 3300025937 Bacteria 1876
693 Ga0207704_10072874 3300025938 Bacteria 2185
694 Ga0207704_10087309 3300025938 Bacteria 2037
695 Ga0207665_10007367 3300025939 Bacteria 7272
696 Ga0207665_10104367 3300025939 Bacteria 1983
697 Ga0207691_10002491 3300025940 Bacteria 18008
698 Ga0207691_10013616 3300025940 Bacteria 7773
699 Ga0207691_10017166 3300025940 Bacteria 6866
700 Ga0207691_10019152 3300025940 Bacteria 6480
701 Ga0207711_10030824 3300025941 Bacteria 4524
702 Ga0207711_10041281 3300025941 Bacteria 3929
703 Ga0207689_10069464 3300025942 Bacteria 2894
704 Ga0207689_10099680 3300025942 Bacteria 2387
705 Ga0207679_10000001 3300025945 Bacteria 777444
706 Ga0207679_10001861 3300025945 Bacteria 13115
707 Ga0207679_10027731 3300025945 Bacteria 3921
708 Ga0207667_10000034 3300025949 Bacteria 304569
709 Ga0207667_10037117 3300025949 Bacteria 5212
710 Ga0207667_10054097 3300025949 Bacteria 4222
711 Ga0207667_10072367 3300025949 Bacteria 3583
712 Ga0207667_10126610 3300025949 Bacteria 2631
713 Ga0207667_10284418 3300025949 Bacteria 1690
714 Ga0207651_10007212 3300025960 Bacteria 5909
715 Ga0207651_10037955 3300025960 Bacteria 3160
716 Ga0207651_10124579 3300025960 Bacteria 1961
717 Ga0207712_10035285 3300025961 Bacteria 3396
718 Ga0207668_10139821 3300025972 Bacteria 1860
719 Ga0207640_10000098 3300025981 Bacteria 66901
720 Ga0207640_10018472 3300025981 Bacteria 4099
721 Ga0207658_10006468 3300025986 Bacteria 7996
722 Ga0207658_10009255 3300025986 Bacteria 6682
723 Ga0207658_10053784 3300025986 Bacteria 2976
724 Ga0207658_10109335 3300025986 Bacteria 2182
725 Ga0207677_10006156 3300026023 Bacteria 6555
726 Ga0207703_10003102 3300026035 Bacteria 14039
727 Ga0207703_10080568 3300026035 Bacteria 2711
728 Ga0207639_10205305 3300026041 Bacteria 1693
729 Ga0207639_10219849 3300026041 Bacteria 1640
730 Ga0207678_10000001 3300026067 Bacteria 433184
731 Ga0207678_10002552 3300026067 Bacteria 16593
732 Ga0207678_10093712 3300026067 Bacteria 2566
733 Ga0207708_10077055 3300026075 Bacteria 2558
734 Ga0207702_10000009 3300026078 Bacteria 305906
735 Ga0207702_10002147 3300026078 Bacteria 18951
736 Ga0207702_10094379 3300026078 Bacteria 2626
737 Ga0207641_10003303 3300026088 Bacteria 14346
738 Ga0207641_10036723 3300026088 Bacteria 4090
739 Ga0207641_10043576 3300026088 Bacteria 3769
740 Ga0207648_10000142 3300026089 Bacteria 71593
741 Ga0207648_10001133 3300026089 Bacteria 29959
742 Ga0207648_10021300 3300026089 Bacteria 5827
743 Ga0207648_10175045 3300026089 Bacteria 1898
744 Ga0207648_10196930 3300026089 Bacteria 1786
745 Ga0207648_10318847 3300026089 Bacteria 1397
746 Ga0207676_10005300 3300026095 Bacteria 9134
747 Ga0207676_10138952 3300026095 Bacteria 2077
748 Ga0207674_10001006 3300026116 Bacteria 36821
749 Ga0207674_10014389 3300026116 Bacteria 8740
750 Ga0207674_10046656 3300026116 Bacteria 4447
751 Ga0207675_100001246 3300026118 Bacteria 25396
752 Ga0207675_100025406 3300026118 Bacteria 5514
753 Ga0207683_10022902 3300026121 Bacteria 5368
754 Ga0207683_10026909 3300026121 Bacteria 4969
755 Ga0207683_10061741 3300026121 Bacteria 3299
756 Ga0207683_10089363 3300026121 Bacteria 2741
757 Ga0207683_10113081 3300026121 Bacteria 2432
758 Ga0207683_10142555 3300026121 Bacteria 2160
759 Ga0207698_10018066 3300026142 Bacteria 4798
760 Ga0207698_10074454 3300026142 Bacteria 2709
761 Ga0207698_10118215 3300026142 Bacteria 2238
762 Ga0207698_10331714 3300026142 Bacteria 1429
763 Ga0209281_1000442 3300027111 Bacteria 59796
764 Ga0209281_1004821 3300027111 Bacteria 3923
765 Ga0209389_1009757 3300027296 Bacteria 8616
766 Ga0209371_1007787 3300027312 Bacteria 3664
767 Ga0209967_1002266 3300027364 Bacteria 2498
768 Ga0209967_1006672 3300027364 Bacteria 1571
769 Ga0209981_1002288 3300027378 Bacteria 2435
770 Ga0209995_1004707 3300027471 Bacteria 2191
771 Ga0209968_1001087 3300027526 Bacteria 4149
772 Ga0209999_1004774 3300027543 Bacteria 2436
773 Ga0209999_1013436 3300027543 Bacteria 1485
774 Ga0209999_1017424 3300027543 Bacteria 1310
775 Ga0209970_1000814 3300027614 Bacteria 5470
776 Ga0209282_1000001 3300027666 Bacteria 2450367
777 Ga0209588_1046569 3300027671 Bacteria 1403
778 Ga0209971_1019615 3300027682 Bacteria 1606
779 Ga0209966_1000004 3300027695 Bacteria 108133
780 Ga0209974_10002324 3300027876 Bacteria 6898
781 Ga0209974_10002377 3300027876 Bacteria 6822
782 Ga0207428_10000830 3300027907 Bacteria 34841
783 Ga0268266_10145296 3300028379 Bacteria 2132
784 Ga0268265_10040740 3300028380 Bacteria 3432
785 Ga0268264_10039604 3300028381 Bacteria 3894
786 Ga0268264_10096750 3300028381 Bacteria 2558
787 Ga0265336_10000062 3300028666 Bacteria 101023
788 Ga0307515_10000022 3300028794 Bacteria 404064
789 Ga0307515_10000191 3300028794 Bacteria 149201
790 Ga0307515_10000208 3300028794 Bacteria 144484
791 Ga0307515_10003517 3300028794 Bacteria 32929
792 Ga0307515_10003519 3300028794 Bacteria 32915
793 Ga0307515_10011870 3300028794 Bacteria 16472
794 Ga0307515_10015490 3300028794 Bacteria 14042
795 Ga0307515_10036876 3300028794 Bacteria 7888
796 Ga0307515_10174390 3300028794 Bacteria 2127
797 Ga0265338_10077449 3300028800 Bacteria 2811
798 Ga0265324_10000928 3300029957 Bacteria 18416
799 Ga0268256_1008034 3300030500 Bacteria 3664
800 Ga0316180_1024577 3300030736 Bacteria 6853
801 Ga0316181_1063388 3300030744 Bacteria 3265
802 Ga0316182_1344291 3300030745 Bacteria 6659
803 Ga0265330_10000032 3300031235 Bacteria 130592
804 Ga0265332_10000001 3300031238 Bacteria 863783
805 Ga0265332_10000003 3300031238 Bacteria 482849
806 Ga0265328_10000004 3300031239 Bacteria 242356
807 Ga0265328_10001293 3300031239 Bacteria 11554
808 Ga0265325_10006034 3300031241 Bacteria 7411
809 Ga0265340_10011616 3300031247 Bacteria 4675
810 Ga0265331_10008102 3300031250 Bacteria 6001
811 Ga0265331_10060231 3300031250 Bacteria 1794
812 Ga0265327_10000043 3300031251 Bacteria 285108
813 Ga0265327_10000184 3300031251 Bacteria 133023
814 Ga0265327_10000261 3300031251 Bacteria 104627
815 Ga0265327_10000956 3300031251 Bacteria 41506
816 Ga0265327_10014403 3300031251 Bacteria 5175
817 Ga0265327_10025250 3300031251 Bacteria 3469
818 Ga0265327_10050447 3300031251 Bacteria 2177
819 Ga0265316_10231625 3300031344 Bacteria 1360
820 Ga0307513_10000014 3300031456 Bacteria 303157
821 Ga0307513_10000019 3300031456 Bacteria 231194
822 Ga0307513_10011299 3300031456 Bacteria 11111
823 Ga0307513_10089327 3300031456 Bacteria 3146
824 Ga0307509_10022521 3300031507 Bacteria 7100
825 Ga0307509_10041706 3300031507 Bacteria 4978
826 Ga0307408_100000008 3300031548 Bacteria 456355
827 Ga0307408_100000513 3300031548 Bacteria 33428
828 Ga0307408_100001235 3300031548 Bacteria 19185
829 Ga0307408_100010270 3300031548 Bacteria 6176
830 Ga0307408_100014180 3300031548 Bacteria 5295
831 Ga0307408_100028168 3300031548 Bacteria 3879
832 Ga0307408_100034061 3300031548 Bacteria 3564
833 Ga0307508_10000017 3300031616 Bacteria 203567
834 Ga0307514_10001461 3300031649 Bacteria 28839
835 Ga0307514_10004466 3300031649 Bacteria 12861
836 Ga0307514_10007672 3300031649 Bacteria 9285
837 Ga0316575_10030592 3300031665 Bacteria 2105
838 Ga0265314_10000022 3300031711 Bacteria 297299
839 Ga0265314_10002666 3300031711 Bacteria 17890
840 Ga0265314_10055744 3300031711 Bacteria 2725
841 Ga0307516_10000254 3300031730 Bacteria 68771
842 Ga0307516_10003632 3300031730 Bacteria 19615
843 Ga0307516_10004780 3300031730 Bacteria 16517
844 Ga0307516_10006776 3300031730 Bacteria 13382
845 Ga0307405_10048866 3300031731 Bacteria 2611
846 Ga0307413_10037276 3300031824 Bacteria 2807
847 Ga0307406_10000279 3300031901 Bacteria 30071
848 Ga0307406_10001221 3300031901 Bacteria 14382
849 Ga0307406_10010426 3300031901 Bacteria 5240
850 Ga0307406_10042774 3300031901 Bacteria 2830
851 Ga0307407_10002597 3300031903 Bacteria 7130
852 Ga0307412_10021521 3300031911 Bacteria 3940
853 Ga0307412_10073409 3300031911 Bacteria 2340
854 Ga0307409_100125018 3300031995 Bacteria 2186
855 Ga0307416_100013315 3300032002 Bacteria 5586
856 Ga0307416_100092334 3300032002 Bacteria 2603
857 Ga0307416_100107319 3300032002 Bacteria 2450
858 Ga0307416_100140365 3300032002 Bacteria 2195
859 Ga0307416_100162230 3300032002 Bacteria 2068
860 Ga0307414_10022373 3300032004 Bacteria 3985
861 Ga0307414_10078226 3300032004 Bacteria 2410
862 Ga0307411_10002201 3300032005 Bacteria 8479
863 Ga0307411_10015220 3300032005 Bacteria 4313
864 Ga0307411_10170435 3300032005 Bacteria 1641
865 Ga0307415_100028737 3300032126 Bacteria 3543
866 Ga0307507_10064219 3300033179 Bacteria 3390
867 Ga0373951_0015022 3300035091 Bacteria 1742
868 Ga0373932_0018160 3300035112 Bacteria 1815
869 Ga0373939_0000164 3300035114 Bacteria 18449
870 Ga0373960_0015650 3300035121 Bacteria 1939
871 Ga0373960_0018371 3300035121 Bacteria 1822
872 Ga0373942_0047325 3300035207 Bacteria 1195
873 Ga0316574_0002074 3300035398 Bacteria 9911
874 Ga0373931_0000346 3300035691 Bacteria 19115
875 Ga0373931_0183747 3300035691 Bacteria 1240
876 Ga0373937_0147098 3300036401 Bacteria 2206
877 Ga0373937_0209036 3300036401 Bacteria 1836
878 Ga0373937_0267318 3300036401 Bacteria 1613
879 Ga0395899_0000028 3300037312 Bacteria 334378
880 Ga0395899_0001707 3300037312 Bacteria 18303
881 Ga0395899_0001829 3300037312 Bacteria 17620
882 Ga0395899_0002713 3300037312 Bacteria 14270
883 Ga0395899_0002722 3300037312 Bacteria 14257
884 Ga0395899_0089861 3300037312 Bacteria 2227
885 Ga0395899_0129776 3300037312 Bacteria 1800
886 Ga0395899_0190098 3300037312 Bacteria 1437
887 Ga0395900_0000188 3300037418 Bacteria 99195
888 Ga0395900_0000404 3300037418 Bacteria 62102
889 Ga0395900_0006862 3300037418 Bacteria 11810
890 Ga0395900_0007487 3300037418 Bacteria 11275
891 Ga0395900_0019397 3300037418 Bacteria 6935
892 Ga0395900_0030419 3300037418 Bacteria 5545
893 Ga0395900_0047771 3300037418 Bacteria 4409
894 Ga0395900_0061956 3300037418 Bacteria 3845
895 Ga0395900_0071579 3300037418 Bacteria 3564
896 Ga0395900_0145451 3300037418 Bacteria 2424
897 Ga0395898_0002535 3300037466 Bacteria 21422
898 Ga0395898_0021367 3300037466 Bacteria 6563
899 Ga0395898_0056071 3300037466 Bacteria 3842
900 Ga0395898_0075075 3300037466 Bacteria 3265
901 Ga0395898_0130013 3300037466 Bacteria 2412
902 Ga0395898_0173483 3300037466 Bacteria 2061
903 Ga0395898_0193475 3300037466 Bacteria 1943
904 Ga0395905_0000373 3300037471 Bacteria 63927
905 Ga0395905_0001392 3300037471 Bacteria 29351
906 Ga0395905_0002403 3300037471 Bacteria 20823
907 Ga0395905_0002964 3300037471 Bacteria 18450
908 Ga0395905_0019259 3300037471 Bacteria 6470
909 Ga0395905_0019945 3300037471 Bacteria 6353
910 Ga0395905_0022852 3300037471 Bacteria 5912
911 Ga0395905_0044762 3300037471 Bacteria 4152
912 Ga0395905_0051956 3300037471 Bacteria 3838
913 Ga0395905_0052375 3300037471 Bacteria 3821
914 Ga0395905_0055716 3300037471 Bacteria 3700
915 Ga0395905_0082668 3300037471 Bacteria 3009
916 Ga0395901_0000217 3300038443 Bacteria 72615
917 Ga0395901_0002151 3300038443 Bacteria 20134
918 Ga0395901_0019360 3300038443 Bacteria 6958
919 Ga0395901_0034202 3300038443 Bacteria 5248
920 Ga0395901_0041955 3300038443 Bacteria 4742
921 Ga0395901_0136007 3300038443 Bacteria 2583
922 Ga0395901_0271617 3300038443 Bacteria 1763
923 Ga0400483_219566 3300039062 Bacteria 1608
924 Ga0436365_0325012 3300039437 Bacteria 6680
925 Ga0436361_0052780 3300039447 Bacteria 22118
926 Ga0436361_0089504 3300039447 Bacteria 11531
927 Ga0436361_0136744 3300039447 Bacteria 34867
928 Ga0436361_0376061 3300039447 Bacteria 200571
929 Ga0436361_0583521 3300039447 Bacteria 71514
930 Ga0436361_0681193 3300039447 Bacteria 39405
931 Ga0436361_0974268 3300039447 Bacteria 66829
932 Ga0436361_1205067 3300039447 Bacteria 1717
933 Ga0439436_0000600 3300041404 Bacteria 9558
934 Ga0439436_0002999 3300041404 Bacteria 5121
935 Ga0439439_0030834 3300041406 Bacteria 1364
936 Ga0439439_0045999 3300041406 Bacteria 1139
937 Ga0439461_0008822 3300041410 Bacteria 1817
938 Ga0439465_0001850 3300041413 Bacteria 6925
939 Ga0439465_0022298 3300041413 Bacteria 1989
940 Ga0451789_0718700 3300041443 Bacteria 2927
941 Ga0451793_1814855 3300041452 Bacteria 2046
942 Ga0451849_0021782 3300041505 Bacteria 1626
943 Ga0439431_0001330 3300041997 Bacteria 5441
944 Ga0439431_0006327 3300041997 Bacteria 2616
945 Ga0439433_0000095 3300041999 Bacteria 12239
946 Ga0439442_009072 3300042002 Bacteria 2011
947 Ga0439445_0002081 3300042004 Bacteria 4428
948 Ga0439448_0000095 3300042005 Bacteria 15826
949 Ga0439432_001088 3300042006 Bacteria 10324
950 Ga0439449_0000064 3300042007 Bacteria 33150
951 Ga0439449_0000770 3300042007 Bacteria 12325
952 Ga0439449_0009218 3300042007 Bacteria 3740
953 Ga0439450_010822 3300042008 Bacteria 1770
954 Ga0439452_002075 3300042010 Bacteria 7604
955 Ga0439455_0001605 3300042012 Bacteria 3852
956 Ga0439455_0021277 3300042012 Bacteria 1545
957 Ga0439462_0002409 3300042015 Bacteria 4341
958 Ga0450920_003022 3300042122 Bacteria 2902
959 Ga0450923_010893 3300042125 Bacteria 1625
960 Ga0450888_001438 3300042126 Bacteria 2284
961 Ga0450890_004653 3300042127 Bacteria 1788
962 Ga0450896_003283 3300042133 Bacteria 2141
963 Ga0450889_000167 3300042144 Bacteria 6955
964 Ga0439446_0013167 3300042156 Bacteria 2268
965 Ga0439458_0013844 3300042157 Bacteria 1817
966 Ga0450908_005451 3300042184 Bacteria 2438
967 Ga0439434_0013333 3300042435 Bacteria 2440
968 Ga0439434_0026727 3300042435 Bacteria 1743
969 Ga0439464_0003043 3300042439 Bacteria 4192
970 Ga0439460_0029524 3300042461 Bacteria 1553
971 Ga0450918_000566 3300042531 Bacteria 7868
972 Ga0450893_0001807 3300042532 Bacteria 3292
973 Ga0451577_0000457 3300042876 Bacteria 71078
974 Ga0451577_0001608 3300042876 Bacteria 29360
975 Ga0451577_0005822 3300042876 Bacteria 12479
976 Ga0451577_0015192 3300042876 Bacteria 7163
977 Ga0451577_0054386 3300042876 Bacteria 3573
978 Ga0466969_0000002 3300044656 Bacteria 178693
979 Ga0466969_0009674 3300044656 Bacteria 5110
980 Ga0466972_0000041 3300044658 Bacteria 132242
981 Ga0466972_0010214 3300044658 Bacteria 4715
982 Ga0466972_0016157 3300044658 Bacteria 3730
983 Ga0466972_0050698 3300044658 Bacteria 2003
984 Ga0453683_0016829 3300044673 Bacteria 4714
985 Ga0453683_0026293 3300044673 Bacteria 3696
986 Ga0466965_0003357 3300044683 Bacteria 7018
987 Ga0466965_0013125 3300044683 Bacteria 3904
988 Ga0466965_0014917 3300044683 Bacteria 3683
989 Ga0466965_0017774 3300044683 Bacteria 3401
990 Ga0466965_0024321 3300044683 Bacteria 2929
991 Ga0466965_0030808 3300044683 Bacteria 2614
992 Ga0466965_0076770 3300044683 Bacteria 1686
993 Ga0466965_0112273 3300044683 Bacteria 1401
994 Ga0466966_0009856 3300044684 Bacteria 6333
995 Ga0466966_0014323 3300044684 Bacteria 5250
996 Ga0466966_0048125 3300044684 Bacteria 2716
997 Ga0466961_0000197 3300044693 Bacteria 40589
998 Ga0466961_0008940 3300044693 Bacteria 6392
999 Ga0466961_0030032 3300044693 Bacteria 3492
1000 Ga0466963_0066792 3300044694 Bacteria 2413
1001 Ga0466963_0095559 3300044694 Bacteria 2028
1002 Ga0466964_0004825 3300044706 Bacteria 4984
1003 Ga0466964_0007990 3300044706 Bacteria 3962
1004 Ga0466964_0009532 3300044706 Bacteria 3659
1005 Ga0453684_0000005 3300044712 Bacteria 1431632
1006 Ga0453684_0011680 3300044712 Bacteria 14651
1007 Ga0453684_0022088 3300044712 Bacteria 9464
1008 Ga0453684_0051481 3300044712 Bacteria 5397
1009 Ga0453684_0054587 3300044712 Bacteria 5203
1010 Ga0453684_0146319 3300044712 Bacteria 2814
1011 Ga0453684_0150699 3300044712 Bacteria 2764
1012 Ga0453684_0296104 3300044712 Bacteria 1840
1013 Ga0453684_0342818 3300044712 Bacteria 1687
1014 Ga0453684_0488559 3300044712 Bacteria 1365
1015 Ga0466971_0005732 3300044719 Bacteria 5400
1016 Ga0466971_0032905 3300044719 Bacteria 2322
1017 Ga0466968_0000328 3300044735 Bacteria 15269
1018 Ga0466968_0003733 3300044735 Bacteria 5646
1019 Ga0466968_0020319 3300044735 Bacteria 2680
1020 Ga0466970_0001953 3300044765 Bacteria 9971
1021 Ga0466970_0017427 3300044765 Bacteria 3711
1022 Ga0466970_0020495 3300044765 Bacteria 3436
1023 Ga0466970_0085316 3300044765 Bacteria 1710
1024 Ga0466957_0000791 3300044842 Bacteria 16187
1025 Ga0466957_0015722 3300044842 Bacteria 4421
1026 Ga0466957_0039113 3300044842 Bacteria 2860
1027 Ga0466960_0127746 3300044901 Bacteria 1338
1028 Ga0466959_0001562 3300045049 Bacteria 14096
1029 Ga0466959_0004663 3300045049 Bacteria 9223
1030 Ga0466959_0019040 3300045049 Bacteria 5046
1031 Ga0466959_0035280 3300045049 Bacteria 3700
1032 Ga0466959_0090620 3300045049 Bacteria 2196
1033 Ga0451576_0001449 3300045051 Bacteria 40328
1034 Ga0451576_0009855 3300045051 Bacteria 11039
1035 Ga0451576_0015538 3300045051 Bacteria 8427
1036 Ga0451576_0034054 3300045051 Bacteria 5411
1037 Ga0451576_0090482 3300045051 Bacteria 3183
1038 Ga0451576_0202995 3300045051 Bacteria 2070
1039 Ga0451576_0304663 3300045051 Bacteria 1667
1040 Ga0451576_0639959 3300045051 Bacteria 1117
1041 Ga0466967_0027465 3300045976 Bacteria 4735
1042 Ga0466967_0132584 3300045976 Bacteria 2314
1043 Ga0495617_000029 3300046452 Bacteria 153239
1044 Ga0495617_000050 3300046452 Bacteria 109761
1045 Ga0495617_001265 3300046452 Bacteria 11311
1046 Ga0495627_000055 3300046453 Bacteria 149482
1047 Ga0495627_006898 3300046453 Bacteria 4414
1048 Ga0495592_0000656 3300046454 Bacteria 24042
1049 Ga0495592_0022299 3300046454 Bacteria 4818
1050 Ga0495603_0047614 3300046455 Bacteria 2552
1051 Ga0495590_0000032 3300046457 Bacteria 139575
1052 Ga0495590_0000060 3300046457 Bacteria 89639
1053 Ga0495591_000596 3300046458 Bacteria 27314
1054 Ga0495629_0025793 3300046459 Bacteria 4177
1055 Ga0495629_0031756 3300046459 Bacteria 3738
1056 Ga0495629_0044071 3300046459 Bacteria 3131
1057 Ga0495638_0000562 3300046460 Bacteria 42310
1058 Ga0495638_0019435 3300046460 Bacteria 4496
1059 Ga0495638_0045974 3300046460 Bacteria 2744
1060 Ga0495651_0002000 3300046462 Bacteria 15759
1061 Ga0495653_0000081 3300046463 Bacteria 80385
1062 Ga0495653_0081582 3300046463 Bacteria 2390
1063 Ga0495650_0000048 3300046471 Bacteria 334427
1064 Ga0495650_0000161 3300046471 Bacteria 149996
1065 Ga0495650_0000890 3300046471 Bacteria 35207
1066 Ga0495650_0002372 3300046471 Bacteria 15460
1067 Ga0495650_0003041 3300046471 Bacteria 12656
1068 Ga0495650_0009337 3300046471 Bacteria 5589
1069 Ga0495582_0017401 3300046473 Bacteria 3933
1070 Ga0495605_0000044 3300046474 Bacteria 182513
1071 Ga0495605_0000180 3300046474 Bacteria 78538
1072 Ga0495605_0000494 3300046474 Bacteria 33913
1073 Ga0495605_0002894 3300046474 Bacteria 10420
1074 Ga0495605_0087919 3300046474 Bacteria 1444
1075 Ga0495639_0002696 3300046475 Bacteria 7719
1076 Ga0495662_0027003 3300046476 Bacteria 2773
1077 Ga0495584_0000613 3300046491 Bacteria 23870
1078 Ga0495584_0009159 3300046491 Bacteria 5107
1079 Ga0495584_0010710 3300046491 Bacteria 4709
1080 Ga0495584_0012788 3300046491 Bacteria 4282
1081 Ga0495584_0024369 3300046491 Bacteria 3068
1082 Ga0495585_0001109 3300046492 Bacteria 22188
1083 Ga0495585_0004398 3300046492 Bacteria 9142
1084 Ga0495585_0021342 3300046492 Bacteria 3718
1085 Ga0495585_0038591 3300046492 Bacteria 2687
1086 Ga0495585_0044172 3300046492 Bacteria 2490
1087 Ga0495594_0022012 3300046499 Bacteria 3407
1088 Ga0495596_0000481 3300046500 Bacteria 25324
1089 Ga0495596_0001056 3300046500 Bacteria 16369
1090 Ga0495596_0009863 3300046500 Bacteria 4184
1091 Ga0495607_0002872 3300046501 Bacteria 13617
1092 Ga0495607_0012437 3300046501 Bacteria 5618
1093 Ga0495607_0017013 3300046501 Bacteria 4680
1094 Ga0495607_0022647 3300046501 Bacteria 3941
1095 Ga0495607_0039947 3300046501 Bacteria 2797
1096 Ga0495607_0064366 3300046501 Bacteria 2071
1097 Ga0495607_0094293 3300046501 Bacteria 1615
1098 Ga0495583_0000145 3300046506 Bacteria 119890
1099 Ga0495583_0000153 3300046506 Bacteria 115755
1100 Ga0495583_0000155 3300046506 Bacteria 114870
1101 Ga0495583_0000622 3300046506 Bacteria 47571
1102 Ga0495583_0014837 3300046506 Bacteria 4269
1103 Ga0495583_0014978 3300046506 Bacteria 4244
1104 Ga0495606_0000232 3300046507 Bacteria 98402
1105 Ga0495606_0000510 3300046507 Bacteria 63022
1106 Ga0495606_0000904 3300046507 Bacteria 44069
1107 Ga0495606_0001037 3300046507 Bacteria 40238
1108 Ga0495606_0002667 3300046507 Bacteria 20265
1109 Ga0495606_0025667 3300046507 Bacteria 4215
1110 Ga0495606_0133542 3300046507 Bacteria 1473
1111 Ga0495608_0002698 3300046511 Bacteria 12749
1112 Ga0495610_0000003 3300046512 Bacteria 1203910
1113 Ga0495610_0000683 3300046512 Bacteria 32754
1114 Ga0495610_0001267 3300046512 Bacteria 22640
1115 Ga0495610_0005108 3300046512 Bacteria 9439
1116 Ga0495610_0012154 3300046512 Bacteria 5204
1117 Ga0495610_0044864 3300046512 Bacteria 2191
1118 Ga0495616_0000368 3300046513 Bacteria 35195
1119 Ga0495616_0002113 3300046513 Bacteria 13325
1120 Ga0495616_0002290 3300046513 Bacteria 12809
1121 Ga0495616_0008854 3300046513 Bacteria 5921
1122 Ga0495616_0009537 3300046513 Bacteria 5668
1123 Ga0495616_0012032 3300046513 Bacteria 4926
1124 Ga0495616_0052526 3300046513 Bacteria 2029
1125 Ga0495616_0055107 3300046513 Bacteria 1969
1126 Ga0495628_0001041 3300046516 Bacteria 25381
1127 Ga0495628_0002970 3300046516 Bacteria 15210
1128 Ga0495628_0011231 3300046516 Bacteria 7578
1129 Ga0495630_0078444 3300046517 Bacteria 2490
1130 Ga0495631_0006567 3300046518 Bacteria 5992
1131 Ga0495631_0010855 3300046518 Bacteria 4500
1132 Ga0495631_0012627 3300046518 Bacteria 4120
1133 Ga0495632_0000675 3300046519 Bacteria 31125
1134 Ga0495632_0000792 3300046519 Bacteria 28132
1135 Ga0495632_0015558 3300046519 Bacteria 4259
1136 Ga0495632_0019623 3300046519 Bacteria 3678
1137 Ga0495632_0028407 3300046519 Bacteria 2919
1138 Ga0495632_0040734 3300046519 Bacteria 2337
1139 Ga0495637_0000004 3300046520 Bacteria 589740
1140 Ga0495637_0000656 3300046520 Bacteria 24104
1141 Ga0495637_0009348 3300046520 Bacteria 4784
1142 Ga0495643_0000228 3300046522 Bacteria 84885
1143 Ga0495643_0001906 3300046522 Bacteria 17615
1144 Ga0495643_0013184 3300046522 Bacteria 4958
1145 Ga0495643_0017990 3300046522 Bacteria 4117
1146 Ga0495644_0005754 3300046523 Bacteria 4840
1147 Ga0495648_0000125 3300046524 Bacteria 90565
1148 Ga0495648_0001315 3300046524 Bacteria 24611
1149 Ga0495648_0035276 3300046524 Bacteria 3243
1150 Ga0495648_0042665 3300046524 Bacteria 2851
1151 Ga0495648_0078035 3300046524 Bacteria 1895
1152 Ga0495663_0008647 3300046525 Bacteria 2824
1153 Ga0495666_0017689 3300046526 Bacteria 3549
1154 Ga0495666_0047683 3300046526 Bacteria 2063
1155 Ga0495642_0019418 3300046528 Bacteria 2664
1156 Ga0495642_0023200 3300046528 Bacteria 2448
1157 Ga0495642_0029751 3300046528 Bacteria 2182
1158 Ga0495642_0053184 3300046528 Bacteria 1668
1159 Ga0495652_0038674 3300046529 Bacteria 4131
1160 Ga0495652_0039001 3300046529 Bacteria 4110
1161 Ga0495654_0000161 3300046530 Bacteria 66649
1162 Ga0495654_0025295 3300046530 Bacteria 3059
1163 Ga0495665_0009055 3300046531 Bacteria 5398
1164 Ga0495665_0011262 3300046531 Bacteria 4842
1165 Ga0495665_0070394 3300046531 Bacteria 1843
1166 Ga0495640_0002796 3300046533 Bacteria 14038
1167 Ga0495586_0000700 3300046535 Bacteria 19011
1168 Ga0495586_0001459 3300046535 Bacteria 13035
1169 Ga0495587_0043411 3300046536 Bacteria 2677
1170 Ga0495587_0153173 3300046536 Bacteria 1314
1171 Ga0495609_0000059 3300046538 Bacteria 142403
1172 Ga0495609_0006386 3300046538 Bacteria 6017
1173 Ga0495609_0062901 3300046538 Bacteria 1638
1174 Ga0495621_0000945 3300046539 Bacteria 7400
1175 Ga0495597_0000507 3300046542 Bacteria 32361
1176 Ga0495597_0001639 3300046542 Bacteria 15655
1177 Ga0495597_0003206 3300046542 Bacteria 9738
1178 Ga0495597_0018497 3300046542 Bacteria 3270
1179 Ga0495597_0051766 3300046542 Bacteria 1809
1180 Ga0495597_0054921 3300046542 Bacteria 1747
1181 Ga0495597_0056798 3300046542 Bacteria 1713
1182 Ga0495645_0016673 3300046543 Bacteria 5252
1183 Ga0495622_0000078 3300046557 Bacteria 86309
1184 Ga0495633_0000797 3300046558 Bacteria 28130
1185 Ga0495633_0010563 3300046558 Bacteria 5030
1186 Ga0495633_0013087 3300046558 Bacteria 4386
1187 Ga0495633_0020919 3300046558 Bacteria 3280
1188 Ga0495633_0021646 3300046558 Bacteria 3213
1189 Ga0495633_0022848 3300046558 Bacteria 3104
1190 Ga0495667_0001556 3300046559 Bacteria 15231
1191 Ga0495656_0000076 3300046615 Bacteria 44185
1192 Ga0495668_0000368 3300046616 Bacteria 59517
1193 Ga0495668_0000657 3300046616 Bacteria 41502
1194 Ga0495668_0002551 3300046616 Bacteria 14810
1195 Ga0495668_0006775 3300046616 Bacteria 7445
1196 Ga0495668_0012859 3300046616 Bacteria 4955
1197 Ga0495668_0024425 3300046616 Bacteria 3437
1198 Ga0495634_0002308 3300046642 Bacteria 15958
1199 Ga0495634_0011874 3300046642 Bacteria 6329
1200 Ga0495634_0150923 3300046642 Bacteria 1469
1201 Ga0495611_0020391 3300046648 Bacteria 2852
1202 Ga0495611_0034656 3300046648 Bacteria 2232
1203 Ga0495625_0000436 3300046660 Bacteria 62756
1204 Ga0495625_0004994 3300046660 Bacteria 12316
1205 Ga0495625_0006820 3300046660 Bacteria 10092
1206 Ga0495625_0007896 3300046660 Bacteria 9161
1207 Ga0495625_0012120 3300046660 Bacteria 6994
1208 Ga0495625_0016825 3300046660 Bacteria 5741
1209 Ga0495625_0028305 3300046660 Bacteria 4204
1210 Ga0495625_0042342 3300046660 Bacteria 3311
1211 Ga0495625_0048793 3300046660 Bacteria 3046
1212 Ga0495635_0155289 3300046663 Bacteria 1558
1213 Ga0495659_0000122 3300046664 Bacteria 34041
1214 Ga0495659_0002747 3300046664 Bacteria 5659
1215 Ga0495661_0002354 3300046665 Bacteria 14588
1216 Ga0495661_0006604 3300046665 Bacteria 8147
1217 Ga0495661_0015281 3300046665 Bacteria 5125
1218 Ga0495661_0015765 3300046665 Bacteria 5033
1219 Ga0495661_0034833 3300046665 Bacteria 3164
1220 Ga0495661_0055909 3300046665 Bacteria 2363
1221 Ga0495661_0134382 3300046665 Bacteria 1352
1222 Ga0495588_0000189 3300046674 Bacteria 66785
1223 Ga0495588_0023206 3300046674 Bacteria 3070
1224 Ga0495588_0053574 3300046674 Bacteria 2080
1225 Ga0495588_0088646 3300046674 Bacteria 1619
1226 Ga0495599_0000399 3300046678 Bacteria 24819
1227 Ga0495599_0009316 3300046678 Bacteria 5997
1228 Ga0495623_0006506 3300046679 Bacteria 7606
1229 Ga0495623_0048215 3300046679 Bacteria 2702
1230 Ga0495646_0001572 3300046680 Bacteria 13606
1231 Ga0495646_0069395 3300046680 Bacteria 2079
1232 Ga0495647_0008788 3300046681 Bacteria 3402
1233 Ga0495658_0006586 3300046683 Bacteria 5705
1234 Ga0495658_0006812 3300046683 Bacteria 5626
1235 Ga0495669_0000508 3300046684 Bacteria 17675
1236 Ga0495669_0008827 3300046684 Bacteria 4246
1237 Ga0495613_0009379 3300046689 Bacteria 7262
1238 Ga0495613_0014523 3300046689 Bacteria 5843
1239 Ga0495670_0002575 3300046691 Bacteria 8956
1240 Ga0495670_0032566 3300046691 Bacteria 2592
1241 Ga0495670_0052998 3300046691 Bacteria 2031
1242 Ga0495671_0000001 3300046692 Bacteria 1169494
1243 Ga0495671_0000430 3300046692 Bacteria 33279
1244 Ga0495649_0001263 3300046694 Bacteria 19477
1245 Ga0495649_0013899 3300046694 Bacteria 4629
1246 Ga0495589_0000052 3300046794 Bacteria 111467
1247 Ga0495589_0000317 3300046794 Bacteria 38407
1248 Ga0495589_0008909 3300046794 Bacteria 5221
1249 Ga0495589_0023095 3300046794 Bacteria 3170
1250 Ga0495589_0026040 3300046794 Bacteria 2965
1251 Ga0495600_0000629 3300046809 Bacteria 18215
1252 Ga0495600_0029278 3300046809 Bacteria 3565
1253 Ga0495600_0100965 3300046809 Bacteria 1881
1254 Ga0495660_0002980 3300046810 Bacteria 10569
1255 Ga0495660_0004826 3300046810 Bacteria 8133
1256 Ga0495660_0013093 3300046810 Bacteria 4807
1257 Ga0495581_0041096 3300047315 Bacteria 2675
1258 Ga0495581_0052322 3300047315 Bacteria 2358
1259 Ga0495604_0008571 3300047317 Bacteria 8077
1260 Ga0495604_0020547 3300047317 Bacteria 5273
1261 Ga0495604_0025805 3300047317 Bacteria 4679
1262 Ga0495636_0000336 3300047318 Bacteria 18003
1263 Ga0495636_0000461 3300047318 Bacteria 15077
1264 Ga0495636_0002901 3300047318 Bacteria 6629
1265 Ga0495636_0022513 3300047318 Bacteria 2548
1266 Ga0495672_0000093 3300047320 Bacteria 145111
1267 Ga0495672_0000176 3300047320 Bacteria 92728
1268 Ga0495672_0000342 3300047320 Bacteria 59691
1269 Ga0495672_0001378 3300047320 Bacteria 23962
1270 Ga0495672_0030482 3300047320 Bacteria 3382
1271 Ga0495676_0019249 3300047321 Bacteria 6006
1272 Ga0495676_0037983 3300047321 Bacteria 4003
1273 Ga0495680_0002481 3300047322 Bacteria 18867
1274 Ga0495683_0000248 3300047323 Bacteria 48653
1275 Ga0495683_0000343 3300047323 Bacteria 38546
1276 Ga0495683_0002649 3300047323 Bacteria 10686
1277 Ga0495687_000087 3300047443 Bacteria 142540
1278 Ga0495687_000395 3300047443 Bacteria 54190
1279 Ga0495687_000598 3300047443 Bacteria 42075
1280 Ga0495687_000913 3300047443 Bacteria 30782
1281 Ga0495687_001142 3300047443 Bacteria 25716
1282 Ga0495687_002075 3300047443 Bacteria 16835
1283 Ga0495687_002391 3300047443 Bacteria 15136
1284 Ga0495687_007698 3300047443 Bacteria 6289
1285 Ga0495675_0028624 3300047444 Bacteria 3552
1286 Ga0495677_0000070 3300047445 Bacteria 52431
1287 Ga0495677_0018251 3300047445 Bacteria 2542
1288 Ga0495677_0020382 3300047445 Bacteria 2403
1289 Ga0495679_009305 3300047446 Bacteria 3942
1290 Ga0495679_009792 3300047446 Bacteria 3807
1291 Ga0495685_000323 3300047447 Bacteria 15390
1292 Ga0495685_018588 3300047447 Bacteria 2386
1293 Ga0495673_0000006 3300047469 Bacteria 908691
1294 Ga0495673_0000024 3300047469 Bacteria 521349
1295 Ga0495673_0000049 3300047469 Bacteria 265878
1296 Ga0495681_0002290 3300047470 Bacteria 13763
1297 Ga0495681_0002823 3300047470 Bacteria 12290
1298 Ga0495681_0006653 3300047470 Bacteria 7549
1299 Ga0495686_0001319 3300047472 Bacteria 27837
1300 Ga0495686_0002420 3300047472 Bacteria 17652
1301 Ga0495686_0009713 3300047472 Bacteria 6907
1302 Ga0495686_0071230 3300047472 Bacteria 2140
1303 Ga0495593_0003834 3300047673 Bacteria 8977
1304 Ga0495593_0022003 3300047673 Bacteria 3557
1305 Ga0495602_0054070 3300048088 Bacteria 3548
1306 Ga0495614_0000563 3300048089 Bacteria 15425
1307 Ga0495626_0000085 3300048091 Bacteria 125255
1308 Ga0495626_0000178 3300048091 Bacteria 77592
1309 Ga0495626_0001048 3300048091 Bacteria 23645
1310 Ga0495626_0005716 3300048091 Bacteria 7190
1311 Ga0495626_0016181 3300048091 Bacteria 3796
1312 Ga0495626_0016736 3300048091 Bacteria 3717
1313 Ga0496100_0011298 3300048903 Bacteria 5081
1314 Ga0496101_0021767 3300048904 Bacteria 4406
1315 Ga0496101_0042206 3300048904 Bacteria 3256
1316 Ga0496101_0051336 3300048904 Bacteria 2971
1317 Ga0496102_0011990 3300048905 Bacteria 7488
1318 Ga0496102_0029346 3300048905 Bacteria 4922
1319 Ga0496102_0037961 3300048905 Bacteria 4345
1320 Ga0496102_0078090 3300048905 Bacteria 3047
1321 Ga0496102_0086355 3300048905 Bacteria 2897
1322 Ga0496104_0261480 3300048907 Bacteria 1643
1323 Ga0496104_0382512 3300048907 Bacteria 1320
1324 Ga0496105_0001580 3300048908 Bacteria 16149
1325 Ga0496105_0188494 3300048908 Bacteria 1687
1326 Ga0496106_0047710 3300048909 Bacteria 3224
1327 Ga0496109_0038419 3300048912 Bacteria 4328
1328 Ga0496110_0028201 3300048913 Bacteria 4819
1329 Ga0496110_0035522 3300048913 Bacteria 4324
1330 Ga0496110_0105558 3300048913 Bacteria 2527
1331 Ga0496110_0270295 3300048913 Bacteria 1548
1332 Ga0496111_0069687 3300048914 Bacteria 2557
1333 Ga0496114_0048729 3300048917 Bacteria 3524
1334 Ga0496114_0055953 3300048917 Bacteria 3290
1335 Ga0496114_0218225 3300048917 Bacteria 1674
1336 Ga0496115_0007765 3300048918 Bacteria 7910
1337 Ga0496115_0058190 3300048918 Bacteria 3110
1338 Ga0496116_0005336 3300048919 Bacteria 11978
1339 Ga0496116_0109107 3300048919 Bacteria 1632
1340 Ga0496117_0000001 3300048920 Bacteria 2526244
1341 Ga0496117_0014655 3300048920 Bacteria 6739
1342 Ga0496118_0000078 3300048921 Bacteria 190946
1343 Ga0496118_0030575 3300048921 Bacteria 4491
1344 Ga0496118_0061288 3300048921 Bacteria 2786
1345 Ga0496118_0149690 3300048921 Bacteria 1463
1346 Ga0496118_0155114 3300048921 Bacteria 1426
1347 Ga0496121_0036731 3300048924 Bacteria 4361
1348 Ga0496121_0041851 3300048924 Bacteria 3996
1349 Ga0496121_0062576 3300048924 Bacteria 3047
1350 Ga0496121_0092447 3300048924 Bacteria 2358
1351 Ga0496121_0255477 3300048924 Bacteria 1213
1352 Ga0496122_0000103 3300048925 Bacteria 196819
1353 Ga0496122_0000472 3300048925 Bacteria 83803
1354 Ga0496122_0002104 3300048925 Bacteria 29499
1355 Ga0496122_0040011 3300048925 Bacteria 3732
1356 Ga0496123_0000261 3300048926 Bacteria 106547
1357 Ga0496123_0000361 3300048926 Bacteria 85609
1358 Ga0496123_0001654 3300048926 Bacteria 29944
1359 Ga0496123_0026803 3300048926 Bacteria 4308
1360 Ga0496123_0054174 3300048926 Bacteria 2643
1361 Ga0496123_0096880 3300048926 Bacteria 1730
1362 Ga0496123_0107743 3300048926 Bacteria 1602
1363 Ga0496124_0000151 3300048927 Bacteria 142761
1364 Ga0496124_0000155 3300048927 Bacteria 138529
1365 Ga0496124_0004832 3300048927 Bacteria 15496
1366 Ga0496124_0045923 3300048927 Bacteria 3743
1367 Ga0496125_0005102 3300048928 Bacteria 14777
1368 Ga0496125_0005971 3300048928 Bacteria 13330
1369 Ga0496125_0009461 3300048928 Bacteria 10006
1370 Ga0496125_0029672 3300048928 Bacteria 4910
1371 Ga0496125_0035455 3300048928 Bacteria 4374
1372 Ga0496125_0161292 3300048928 Bacteria 1522
1373 Ga0501310_000578 3300049130 Bacteria 3214
1374 Ga0495678_000223 3300049459 Bacteria 65751
1375 Ga0495678_000439 3300049459 Bacteria 41538
1376 Ga0495678_000771 3300049459 Bacteria 28941
1377 Ga0495678_002291 3300049459 Bacteria 13267
1378 Ga0495678_003472 3300049459 Bacteria 9743
1379 Ga0495678_039382 3300049459 Bacteria 1907
1380 Ga0495682_0001584 3300049460 Bacteria 11830
1381 Ga0495682_0029415 3300049460 Bacteria 2034
1382 Ga0501295_002376 3300049518 Bacteria 2138
1383 Ga0501298_013028 3300049521 Bacteria 1466
1384 Ga0501300_000967 3300049523 Bacteria 4392
1385 Ga0501031_0001583 3300049568 Bacteria 14189
1386 Ga0501031_0138779 3300049568 Bacteria 1588
1387 Ga0501038_0101445 3300049574 Bacteria 2396
1388 Ga0501039_0006011 3300049575 Bacteria 9208
1389 Ga0501039_0165594 3300049575 Bacteria 1738
1390 Ga0501043_0000141 3300049579 Bacteria 67326
1391 Ga0501043_0070134 3300049579 Bacteria 2753
1392 Ga0501046_0000047 3300049580 Bacteria 140344
1393 Ga0501046_0029614 3300049580 Bacteria 4450
1394 Ga0501047_0000058 3300049581 Bacteria 139202
1395 Ga0501047_0066255 3300049581 Bacteria 3481
1396 Ga0501048_0002761 3300049582 Bacteria 13396
1397 Ga0501070_0001800 3300049586 Bacteria 18908
1398 Ga0501070_0077838 3300049586 Bacteria 2744
1399 Ga0501074_0005316 3300049590 Bacteria 9267
1400 Ga0501074_0249547 3300049590 Bacteria 1262
1401 Ga0501075_0022681 3300049591 Bacteria 4588
1402 Ga0501198_000002 3300049649 Bacteria 197356
1403 Ga0501222_000002 3300049662 Bacteria 169093
1404 Ga0501223_003895 3300049663 Bacteria 3224
1405 Ga0501253_006016 3300049683 Bacteria 1623
1406 Ga0501258_001545 3300049687 Bacteria 1904
1407 Ga0501229_000963 3300049706 Bacteria 3265
1408 Ga0501262_000587 3300049759 Bacteria 4323
1409 Ga0501262_003280 3300049759 Bacteria 1849
1410 Ga0501266_000061 3300049763 Bacteria 16407
1411 Ga0501279_014401 3300049775 Bacteria 1089
1412 Ga0501280_000779 3300049776 Bacteria 6936
1413 Ga0501282_003594 3300049778 Bacteria 1672
1414 Ga0501035_0006524 3300049822 Bacteria 10950
1415 Ga0501044_0000070 3300049823 Bacteria 124889
1416 Ga0501044_0000379 3300049823 Bacteria 55288
1417 Ga0501044_0239282 3300049823 Bacteria 1759
1418 nmdc:mga03683_1058_c1 3300050489 Bacteria 8058
1419 nmdc:mga03683_1137_c1 3300050489 Bacteria 7817
1420 nmdc:mga03n38_22459_c1 3300050490 Bacteria 2554
1421 nmdc:mga00v17_19444_c1 3300050491 Bacteria 3877
1422 nmdc:mga00v17_30066_c1 3300050491 Bacteria 3193
1423 nmdc:mga00v17_31656_c1 3300050491 Bacteria 3121
1424 nmdc:mga00v17_3261_c1 3300050491 Bacteria 8362
1425 nmdc:mga00v17_59130_c1 3300050491 Bacteria 2350
1426 nmdc:mga0yw44_149906_c1 3300050492 Bacteria 1520
1427 nmdc:mga0yw44_18828_c1 3300050492 Bacteria 3792
1428 nmdc:mga0yw44_4617_c1 3300050492 Bacteria 6354
1429 nmdc:mga0k408_123753_c1 3300050493 Bacteria 1533
1430 nmdc:mga0k408_129286_c1 3300050493 Bacteria 1499
1431 nmdc:mga0k408_15735_c1 3300050493 Bacteria 4187
1432 nmdc:mga0k408_21431_c2 3300050493 Bacteria 3437
1433 nmdc:mga0k408_28418_c1 3300050493 Bacteria 3180
1434 nmdc:mga0k408_4539_c1 3300050493 Bacteria 4229
1435 nmdc:mga0k408_84428_c1 3300050493 Bacteria 1863
1436 nmdc:mga0k408_8464_c1 3300050493 Bacteria 5525
1437 nmdc:mga06z11_12650_c1 3300050494 Bacteria 3676
1438 nmdc:mga06z11_28742_c1 3300050494 Bacteria 2671
1439 nmdc:mga06z11_60760_c1 3300050494 Bacteria 1968
1440 nmdc:mga04h51_11267_c1 3300050495 Bacteria 2478
1441 nmdc:mga07m45_110521_c1 3300050496 Bacteria 1583
1442 nmdc:mga07m45_11535_c1 3300050496 Bacteria 4647
1443 nmdc:mga07m45_12754_c1 3300050496 Bacteria 4444
1444 nmdc:mga07m45_182_c1 3300050496 Bacteria 25233
1445 nmdc:mga07m45_19387_c1 3300050496 Bacteria 3685
1446 nmdc:mga07m45_21169_c1 3300050496 Bacteria 3538
1447 nmdc:mga07m45_23333_c1 3300050496 Bacteria 3382
1448 nmdc:mga07m45_35932_c1 3300050496 Bacteria 2757
1449 nmdc:mga07m45_51285_c1 3300050496 Bacteria 2327
1450 nmdc:mga07m45_831_c1 3300050496 Bacteria 13365
1451 nmdc:mga09592_17028_c1 3300050508 Bacteria 5949
1452 nmdc:mga09592_3371_c1 3300050508 Bacteria 12912
1453 nmdc:mga0qj67_13392_c1 3300050509 Bacteria 6186
1454 nmdc:mga08y16_34516_c1 3300050511 Bacteria 5313
1455 nmdc:mga08y16_4675_c1 3300050511 Bacteria 14265
1456 nmdc:mga0n895_202668_c1 3300050512 Bacteria 2015
1457 nmdc:mga0n895_286054_c1 3300050512 Bacteria 1671
1458 nmdc:mga0rr50_240967_c1 3300050513 Bacteria 1499
1459 nmdc:mga0rr50_45174_c1 3300050513 Bacteria 3236
1460 nmdc:mga08x19_144_c1 3300050514 Bacteria 61986
1461 nmdc:mga08x19_20211_c1 3300050514 Bacteria 4100
1462 nmdc:mga08x19_5478_c1 3300050514 Bacteria 7507
1463 nmdc:mga0sz30_20039_c1 3300050516 Bacteria 2695
1464 nmdc:mga0sz30_30537_c1 3300050516 Bacteria 2226
1465 Ga0500610_0020964 3300053079 Bacteria 3199
1466 Ga0500635_0000033 3300053080 Bacteria 97175
1467 Ga0500578_0000002 3300053086 Bacteria 293507
1468 Ga0500644_0001013 3300053088 Bacteria 8603
1469 Ga0500646_0004257 3300053090 Bacteria 3627
1470 Ga0500646_0004453 3300053090 Bacteria 3550
1471 Ga0500651_0000042 3300053093 Bacteria 87895
1472 Ga0500651_0027361 3300053093 Bacteria 3586
1473 Ga0500650_0021345 3300053098 Bacteria 2852
1474 Ga0500569_035869 3300053109 Bacteria 1424
1475 Ga0500571_000096 3300053110 Bacteria 28934
1476 Ga0500593_000815 3300053117 Bacteria 11655
1477 Ga0500593_007672 3300053117 Bacteria 4404
1478 Ga0500607_002839 3300053121 Bacteria 13391
1479 Ga0500618_000469 3300053125 Bacteria 26219
1480 Ga0500618_001201 3300053125 Bacteria 12380
1481 Ga0500652_000102 3300053131 Bacteria 33562
1482 Ga0500658_0000966 3300053134 Bacteria 11734
1483 Ga0500658_0001050 3300053134 Bacteria 11300
1484 Ga0500559_0004514 3300053136 Bacteria 6584
1485 Ga0500574_000611 3300053141 Bacteria 4610
1486 Ga0500577_0007624 3300053142 Bacteria 3044
1487 Ga0500604_0004883 3300053151 Bacteria 3556
1488 Ga0500616_0017939 3300053153 Bacteria 4007
1489 Ga0500619_000015 3300053154 Bacteria 54620
1490 Ga0500619_001041 3300053154 Bacteria 4799
1491 Ga0500622_0000001 3300053156 Bacteria 657715
1492 Ga0500622_0000236 3300053156 Bacteria 57393
1493 Ga0500622_0003109 3300053156 Bacteria 11424
1494 Ga0500624_001676 3300053157 Bacteria 3303
1495 Ga0500636_0000870 3300053177 Bacteria 16194
1496 Ga0500636_0009640 3300053177 Bacteria 5619
1497 Ga0500637_0062352 3300053178 Bacteria 2136
1498 Ga0500570_060536 3300053724 Bacteria 1836
1499 Ga0500625_008812 3300053729 Bacteria 4478
1500 Ga0500645_002026 3300053730 Bacteria 9465
1501 Ga0500645_002056 3300053730 Bacteria 9358
1502 Ga0500645_009453 3300053730 Bacteria 3274
1503 Ga0590071_005391 3300059421 Bacteria 3075
1504 Ga0587084_000476 3300059477 Bacteria 3181
1505 Ga0587084_002643 3300059477 Bacteria 1885
1506 Ga0587070_000720 3300059491 Bacteria 2999
1507 Ga0587070_007438 3300059491 Bacteria 1519
1508 Ga0587073_0004837 3300059492 Bacteria 1963
1509 Ga0587077_008527 3300059493 Bacteria 1529
1510 Ga0587082_000566 3300059504 Bacteria 3212
1511 Ga0587083_0002910 3300059505 Bacteria 2199
1512 Ga0587083_0004811 3300059505 Bacteria 1907
1513 Ga0587086_000607 3300059507 Bacteria 2714
1514 Ga0587088_001141 3300059508 Bacteria 2643
1515 Ga0587090_000296 3300059510 Bacteria 3850
1516 Ga0587090_003114 3300059510 Bacteria 1894
1517 Ga0587098_002515 3300059604 Bacteria 1557
1518 Ga0587106_002524 3300059605 Bacteria 1810
1519 Ga0587101_000694 3300059623 Bacteria 2546
1520 Ga0587101_000876 3300059623 Bacteria 2391
1521 Ga0587101_003309 3300059623 Bacteria 1626
1522 Ga0587128_005367 3300059630 Bacteria 1528
1523 Ga0587067_000005 3300059640 Bacteria 10011
1524 Ga0587068_000631 3300059641 Bacteria 3388
1525 Ga0587072_000020 3300059643 Bacteria 9919
1526 Ga0587075_002891 3300059644 Bacteria 1865
1527 Ga0587075_005763 3300059644 Bacteria 1495
1528 Ga0587076_000849 3300059645 Bacteria 2829
1529 Ga0587076_005786 3300059645 Bacteria 1617
1530 Ga0587079_000879 3300059647 Bacteria 3063
1531 Ga0587104_000148 3300059650 Bacteria 2334
1532 Ga0587111_0001500 3300060346 Bacteria 2829
1533 Ga0587111_0006959 3300060346 Bacteria 1817
1534 Ga0587111_0007265 3300060346 Bacteria 1794
1535 2509131313 2508501125 Bacteria 7208311
1536 2511245735 2511231002 Bacteria 5042903
1537 2511248486 2511231003 Bacteria 5606035
1538 2511386751 2511231026 Bacteria 5225445
1539 2513226675 2513020051 Bacteria 6053213
1540 2521558835 2521172590 Bacteria 5047645
1541 2526213701 2526164512 Bacteria 4025691
1542 2548500236 2547132374 Bacteria 5530232
1543 2550695498 2548876994 Bacteria 4904866
1544 2553003632 2551306416 Bacteria 6152985
1545 2587727680 2585428057 Bacteria 6737412
1546 2587733055 2585428058 Bacteria 6853932
1547 2587755175 2585428062 Bacteria 6842168
1548 2588291353 2588253510 Bacteria 6901809
1549 2597028707 2596583598 Bacteria 5251611
1550 2599445389 2599185178 Bacteria 5365746
1551 2599625004 2599185214 Bacteria 8209958
1552 2599673016 2599185226 Bacteria 8233575
1553 2599682534 2599185227 Bacteria 8246414
1554 2599694624 2599185229 Bacteria 8216126
1555 2601667389 2600255292 Bacteria 6300551
1556 2643742687 2643221544 Bacteria 5886209
1557 2643787334 2643221554 Bacteria 6603920
1558 2643802032 2643221556 Bacteria 7251154
1559 2643864739 2643221570 Bacteria 5103772
1560 2643936207 2643221585 Bacteria 5812563
1561 2643969500 2643221592 Bacteria 6608788
1562 2643991115 2643221596 Bacteria 5006805
1563 2644028881 2643221603 Bacteria 6147767
1564 2644075575 2643221611 Bacteria 6820941
1565 2644143800 2643221625 Bacteria 6512927
1566 2644159385 2643221628 Bacteria 5745828
1567 2644214150 2643221638 Bacteria 6579467
1568 2644217706 2643221639 Bacteria 6649903
1569 2644243139 2643221644 Bacteria 6865017
1570 2644252370 2643221645 Bacteria 7207331
1571 2644258556 2643221646 Bacteria 6433402
1572 2644276494 2643221648 Bacteria 6521465
1573 2644294030 2643221652 Bacteria 5140275
1574 2644316852 2643221656 Bacteria 5809961
1575 2644329311 2643221658 Bacteria 6064537
1576 2644357139 2643221664 Bacteria 7272945
1577 2644401184 2643221672 Bacteria 6322190
1578 2644467934 2643221683 Bacteria 5749203
1579 2644473818 2643221684 Bacteria 7145183
1580 2644644447 2643221717 Bacteria 5676132
1581 2738717446 2738541277 Bacteria 7458140
1582 2738741602 2738541280 Bacteria 6630198
1583 2738829558 2738541297 Bacteria 6549566
1584 2738843782 2738541300 Bacteria 6675882
1585 2738879051 2738541307 Bacteria 8606193
1586 2739056739 2738541337 Bacteria 6183410
1587 2739153354 2738541357 Bacteria 6549408
1588 2739195274 2738543003 Bacteria 6549560
1589 2739248845 2738543013 Bacteria 5618633
1590 2739275137 2738543018 Bacteria 6718814
1591 2739278132 2738543019 Bacteria 7459457
1592 2739321750 2738543026 Bacteria 6549408
1593 2739339694 2738543029 Bacteria 6549249
1594 2739344181 2738543030 Bacteria 6719714
1595 2739613000 2739367655 Bacteria 4051151
1596 2765569994 2765235838 Bacteria 5445269
1597 2808981716 2808606386 Bacteria 4471946
1598 2809131346 2808606415 Bacteria 4576710
1599 2809145125 2808606418 Bacteria 6724496
1600 2809150968 2808606419 Bacteria 4576925
1601 2816476184 2816332133 Bacteria 7249298
1602 2819544962 2818991436 Bacteria 5376622
1603 2819593435 2818991445 Bacteria 4955017
1604 2819596959 2818991446 Bacteria 7757362
1605 2819615363 2818991449 Bacteria 5518009
1606 2821131270 2821131069 Bacteria 6108407
1607 2831266041 2831265667 Bacteria 7184833
1608 2831866345 2831864461 Bacteria 6502356
1609 2838057830 2838054893 Bacteria 7451788
1610 2839097066 2839094727 Bacteria 5534556
1611 2842679098 2842677519 Bacteria 5615038
1612 2842714386 2842711865 Bacteria 7155354
1613 2842721251 2842718218 Bacteria 4560148
1614 2842735956 2842733646 Bacteria 5716726
1615 2842748346 2842747753 Bacteria 5578255
1616 2852622753 2852618963 Bacteria 4577824
1617 2857545405 2857542790 Bacteria 5326616
1618 2857551886 2857547612 Bacteria 6179999
1619 2857554158 2857553236 Bacteria 6166726
1620 2857561507 2857558681 Bacteria 6617694
1621 2857565057 2857564685 Bacteria 6290584
1622 2881102209 2881101125 Bacteria 4590519
1623 2881930902 2881927736 Bacteria 3993927
1624 2884839967 2884836552 Bacteria 5219991
1625 2884857265 2884852848 Bacteria 5221161
1626 2885083888 2885080285 Bacteria 6355622
1627 2885197469 2885192300 Bacteria 5882526
1628 2885203700 2885198086 Bacteria 7212419
1629 2885216950 2885211737 Bacteria 7212420
1630 2885266961 2885266251 Bacteria 4796748
1631 2886849617 2886848708 Bacteria 5632523
1632 2887378569 2887375801 Bacteria 5334027
1633 2894026786 2894023352 Bacteria 5167372
1634 2896157852 2896154374 Bacteria 5221518
1635 2899930299 2899924645 Bacteria 7487985
1636 2900580112 2900577576 Bacteria 5438534
1637 2904426378 2904424332 Bacteria 7633521
1638 2904444735 2904439833 Bacteria 5931679
1639 2904456226 2904449895 Bacteria 6927402
1640 2904457582 2904456579 Bacteria 6819253
1641 2904480237 2904479285 Bacteria 5073931
1642 2904534618 2904530477 Bacteria 5876334
1643 2904543664 2904541872 Bacteria 8915136
1644 2904584503 2904584206 Bacteria 6028872
1645 2904590971 2904589729 Bacteria 6113573
1646 2904605405 2904601388 Bacteria 5884906
1647 2919047424 2919046199 Bacteria 5567169
1648 2919080910 2919079590 Bacteria 5946433
1649 2919466938 2919462493 Bacteria 5817112
1650 2919478711 2919476304 Bacteria 5888696
1651 2919704845 2919704043 Bacteria 5560311
1652 2923512484 2923510766 Bacteria 5926163
1653 2928039412 2928037797 Bacteria 7273642
1654 2928044983 2928044640 Bacteria 7271509
1655 2928052784 2928051484 Bacteria 7773759
1656 2928062719 2928058823 Bacteria 5520022
1657 2928064543 2928064002 Bacteria 7419480
1658 2928075041 2928070936 Bacteria 8062541
1659 2928088220 2928084124 Bacteria 7159212
1660 2928116296 2928115317 Bacteria 6477646
1661 2928132517 2928130867 Bacteria 5467269
1662 2929162785 2929160207 Bacteria 9075316
1663 2929527373 2929520902 Bacteria 6765052
1664 2932411008 2932410948 Bacteria 6312192
1665 2932419425 2932416698 Bacteria 6315112
1666 2932426490 2932422444 Bacteria 4678430
1667 2945911298 2945909444 Bacteria 7065066
1668 2945947310 2945945610 Bacteria 5951079
1669 2945977669 2945972063 Bacteria 6086495
1670 2945986414 2945984333 Bacteria 7358892
1671 2954772650 2954767861 Bacteria 5535784
1672 2974322656 2974320154 Bacteria 4571377
1673 2990711802 2990710928 Bacteria 5002431
1674 8002394724 8002392321 Bacteria 4159911
1675 8047674105 8047673197 Bacteria 7395230
1676 8055227047 8055225921 Bacteria 3341787
1677 Ga0466969_0011332
1678 JGI24741J21665_1000199
1679 JGI24740J21852_10000895
1680 JGI24740J21852_10001585
1681 JGI24740J21852_10004992
1682 JGI25155J39150_1000002
1683 JGI25155J39150_1001127
1684 JGI25155J39150_1001208
1685 JGI25156J39149_1000003
1686 JGI25156J39149_1000581
1687 JGI25156J39149_1001438
1688 JGI25156J39149_1001520
1689 JGI25156J39149_1003958
1690 JGI25156J39149_1005219
1691 JGI25162J39368_1000015
1692 JGI25162J39368_1007808
1693 JGI25154J39366_1000009
1694 JGI25154J39366_1000235
1695 JGI25154J39366_1001232
1696 JGI25154J39366_1001235
1697 JGI25154J39366_1001307
1698 JGI25154J39366_1001714
1699 JGI25158J39367_1005220
1700 JGI25157J39369_1000002
1701 JGI25157J39369_1000163
1702 JGI25157J39369_1000420
1703 JGI25157J39369_1001343
1704 JGI25152J39213_1000550
1705 JGI25150J39212_1001844
1706 JGI25150J39212_1002871
1707 JGI25159J45721_1000800
1708 JGI25159J45721_1004502
1709 JGI25159J45721_1005712
1710 JGI25159J45721_1009490
1711 JGI25159J45721_1012145
1712 Ga0006759J45824_1003446
1713 JGI25151J46595_10005733
1714 JGI25151J46595_10012448
1715 JGI25151J46595_10022540
1716 JGI25165J46597_1000001
1717 JGI25153J46596_10003458
1718 JGI25153J46596_10008695
1719 JGI25153J46596_10012758
1720 JGI25153J46596_10021011
1721 Ga0006777J48905_1005637
1722 rootH1_10015076
1723 rootL2_10000199
1724 rootH1_10066204
1725 JGI26128J50194_1000545
1726 JGI25160J50197_1000257
1727 JGI25160J50197_1000586
1728 JGI26145J50221_1002406
1729 JGI25161J50226_1000018
1730 Ga0007417J51691_1021004
1731 Ga0007410J51695_1007930
1732 Ga0007410J51695_1013383
1733 Ga0007410J51695_1013461
1734 Ga0007409J51694_1007957
1735 Ga0007409J51694_1014187
1736 Ga0007416J51690_1015392
1737 Ga0007416J51690_1017208
1738 Ga0006562J51391_1019774
1739 Ga0032354_1010901
1740 Ga0032354_1037686
1741 Ga0055538_1000001
1742 Ga0055539_1000001
1743 Ga0055539_1000021
1744 Ga0055539_1000172
1745 Ga0055539_1003113
1746 Ga0055533_1000003
1747 Ga0055533_1000006
1748 Ga0055533_1000029
1749 Ga0055532_1000002
1750 Ga0055532_1000029
1751 Ga0055532_1000050
1752 Ga0055525_1000001
1753 Ga0055525_1000026
1754 Ga0055525_1000033
1755 Ga0055525_1000087
1756 Ga0055525_1000662
1757 Ga0055535_1000270
1758 Ga0055535_1000881
1759 Ga0055542_1000027
1760 Ga0055542_1001549
1761 Ga0055542_1007204
1762 Ga0055529_1000062
1763 Ga0055529_1000095
1764 Ga0055529_1000175
1765 Ga0055526_1000256
1766 Ga0055526_1000412
1767 Ga0055526_1003759
1768 Ga0055526_1011228
1769 Ga0055526_1019259
1770 Ga0055526_1019561
1771 Ga0055537_1000008
1772 Ga0055537_1000143
1773 Ga0055537_1000638
1774 Ga0055537_1003491
1775 Ga0055524_1000083
1776 Ga0055524_1000161
1777 Ga0055536_1011405
1778 Ga0055534_1000226
1779 Ga0055534_1000304
1780 Ga0055534_1000742
1781 Ga0055534_1002938
1782 Ga0055534_1009543
1783 Ga0055528_1002845
1784 Ga0055528_1006547
1785 Ga0055530_10000211
1786 Ga0055530_10002691
1787 Ga0055530_10009042
1788 Ga0055530_10009823
1789 Ga0055540_1000012
1790 Ga0055540_1000062
1791 Ga0055540_1002597
1792 Ga0055540_1006225
1793 Ga0055540_1007759
1794 Ga0055540_1018181
1795 Ga0055531_10000481
1796 Ga0055531_10000823
1797 Ga0055531_10002967
1798 Ga0055531_10008585
1799 Ga0055531_10009809
1800 Ga0055531_10018344
1801 Ga0055541_1000001
1802 Ga0055541_1000029
1803 Ga0055541_1000045
1804 Ga0055541_1000370
1805 Ga0055541_1000532
1806 Ga0055543_1000993
1807 Ga0055543_1001717
1808 Ga0055543_1002038
1809 Ga0055543_1002844
1810 Ga0055543_1002954
1811 Ga0055543_1005341
1812 Ga0065165_1000006
1813 Ga0065165_1000268
1814 Ga0065165_1001911
1815 Ga0065165_1005783
1816 Ga0065165_1016274
1817 Ga0065165_1042039
1818 Ga0065704_10087556
1819 Ga0065715_10137524
1820 Ga0070658_10099644
1821 Ga0070658_10166852
1822 Ga0070676_10058257
1823 Ga0070676_10060174
1824 Ga0070676_10065730
1825 Ga0070690_100030769
1826 Ga0070690_100152895
1827 Ga0070670_100000334
1828 Ga0070677_10002685
1829 Ga0068869_100052976
1830 Ga0070666_10003592
1831 Ga0070666_10041629
1832 Ga0070682_100031262
1833 Ga0070682_100060240
1834 Ga0068868_100024313
1835 Ga0070660_100000913
1836 Ga0070660_100001317
1837 Ga0070660_100066074
1838 Ga0070660_100200320
1839 Ga0070689_100042926
1840 Ga0070689_100075030
1841 Ga0070661_100000139
1842 Ga0070661_100000264
1843 Ga0070661_100071413
1844 Ga0070668_100018633
1845 Ga0070668_100153912
1846 Ga0070669_100142037
1847 Ga0070669_100165624
1848 Ga0070675_100010734
1849 Ga0070675_100045668
1850 Ga0070675_100175651
1851 Ga0070671_100018737
1852 Ga0070671_100020806
1853 Ga0070674_100000872
1854 Ga0070673_100010297
1855 Ga0070673_100115192
1856 Ga0070659_100000798
1857 Ga0070659_100001509
1858 Ga0070659_100001576
1859 Ga0070659_100064529
1860 Ga0070659_100121600
1861 Ga0070659_100203703
1862 Ga0070667_100002781
1863 Ga0070667_100027186
1864 Ga0070667_100281596
1865 Ga0070705_100018240
1866 Ga0070705_100217251
1867 Ga0070694_100028514
1868 Ga0070708_100036779
1869 Ga0070663_100000006
1870 Ga0070663_100002931
1871 Ga0070678_100006899
1872 Ga0070678_100022537
1873 Ga0070678_100041594
1874 Ga0070678_100060133
1875 Ga0070678_100194060
1876 Ga0070681_10006689
1877 Ga0070681_10087560
1878 Ga0070681_10169046
1879 Ga0068867_100000820
1880 Ga0068867_100016759
1881 Ga0068867_100018872
1882 Ga0068867_100121514
1883 Ga0068867_100171657
1884 Ga0070685_10178037
1885 Ga0070706_100028142
1886 Ga0070699_100017265
1887 Ga0070697_100001109
1888 Ga0068853_100208762
1889 Ga0068853_100219304
1890 Ga0068853_100222964
1891 Ga0068853_100281253
1892 Ga0070672_100003864
1893 Ga0070672_100018119
1894 Ga0070672_100123127
1895 Ga0070695_100027965
1896 Ga0070665_100011739
1897 Ga0070665_100234756
1898 Ga0070665_100293540
1899 Ga0070704_100014555
1900 Ga0070704_100083446
1901 Ga0068855_100002429
1902 Ga0068855_100011038
1903 Ga0068855_100040371
1904 Ga0068855_100048665
1905 Ga0068855_100107915
1906 Ga0068855_100353836
1907 Ga0070664_100000002
1908 Ga0070664_100003853
1909 Ga0070664_100024728
1910 Ga0070664_100047466
1911 Ga0070664_100160054
1912 Ga0068857_100027590
1913 Ga0068857_100031841
1914 Ga0068857_100239237
1915 Ga0068854_100000043
1916 Ga0068854_100016517
1917 Ga0068854_100075386
1918 Ga0068856_100000028
1919 Ga0068856_100001213
1920 Ga0068856_100017575
1921 Ga0068852_100018364
1922 Ga0068852_100040581
1923 Ga0068852_100143431
1924 Ga0068852_100231748
1925 Ga0068859_100030477
1926 Ga0068859_100101618
1927 Ga0068859_100159038
1928 Ga0068864_100002247
1929 Ga0068864_100039151
1930 Ga0068861_100000343
1931 Ga0068851_10074103
1932 Ga0068863_100007447
1933 Ga0068863_100016536
1934 Ga0068863_100079825
1935 Ga0068858_100012025
1936 Ga0068860_100039691
1937 Ga0068862_100012976
1938 Ga0068862_100051442
1939 Ga0075365_10020443
1940 Ga0075365_10122504
1941 Ga0075368_10076344
1942 Ga0075363_100049093
1943 Ga0075364_10000361
1944 Ga0075364_10004201
1945 Ga0075364_10015913
1946 Ga0075364_10021230
1947 Ga0075364_10096949
1948 Ga0075432_10000339
1949 Ga0075432_10023832
1950 Ga0070716_100198077
1951 Ga0075362_10001523
1952 Ga0075362_10003993
1953 Ga0075362_10007315
1954 Ga0075362_10028935
1955 Ga0075362_10033589
1956 Ga0075367_10133290
1957 Ga0075369_10101287
1958 Ga0075366_10005443
1959 Ga0075366_10006029
1960 Ga0075366_10008662
1961 Ga0075366_10014706
1962 Ga0075366_10027449
1963 Ga0075366_10030434
1964 Ga0075366_10044456
1965 Ga0075366_10046494
1966 Ga0075366_10047353
1967 Ga0075366_10049372
1968 Ga0075366_10081180
1969 Ga0075370_10000245
1970 Ga0075370_10001414
1971 Ga0075370_10001496
1972 Ga0075370_10005283
1973 Ga0075370_10007796
1974 Ga0075370_10009707
1975 Ga0075370_10011251
1976 Ga0075370_10015818
1977 Ga0075370_10096614
1978 Ga0068871_100028781
1979 Ga0075428_100000521
1980 Ga0075430_100023615
1981 Ga0075430_100035659
1982 Ga0075433_10171730
1983 Ga0075434_100053000
1984 Ga0075429_100003825
1985 Ga0075429_100020657
1986 Ga0075436_100000353
1987 Ga0075436_100006510
1988 Ga0075436_100072438
1989 Ga0097620_100030476
1990 Ga0097620_100101621
1991 Ga0097620_100159052
1992 Ga0099823_1003573
1993 Ga0079104_1000186
1994 Ga0079104_1007818
1995 Ga0079104_1010697
1996 Ga0099826_10000001
1997 Ga0099826_10001313
1998 Ga0075435_100247971
1999 Ga0099794_10029708
2000 Ga0099794_10043832
2001 Ga0105244_10003650
2002 Ga0105244_10030420
2003 Ga0105244_10072715
2004 Ga0105240_10005173
2005 Ga0105240_10017343
2006 Ga0105240_10018846
2007 Ga0105240_10020541
2008 Ga0105240_10058094
2009 Ga0105240_10088709
2010 Ga0111539_10001172
2011 Ga0105245_10206027
2012 Ga0105243_10003626
2013 Ga0105243_10012597
2014 Ga0105243_10015371
2015 Ga0105243_10046565
2016 Ga0105242_10000970
2017 Ga0105242_10016812
2018 Ga0105248_10051958
2019 Ga0105248_10054325
2020 Ga0105237_10000367
2021 Ga0105237_10007511
2022 Ga0105237_10009389
2023 Ga0105237_10046093
2024 Ga0105237_10091314
2025 Ga0105238_10000367
2026 Ga0105239_10000150
2027 Ga0105239_10048392
2028 Ga0105239_10126300
2029 Ga0105239_10258439
2030 Ga0105246_10048906
2031 Ga0157319_1000009
2032 Ga0157373_10002505
2033 Ga0157373_10024986
2034 Ga0157373_10036278
2035 Ga0157373_10069956
2036 Ga0157371_10000001
2037 Ga0157371_10000204
2038 Ga0157371_10143951
2039 Ga0157370_10000013
2040 Ga0157370_10002966
2041 Ga0157370_10198943
2042 Ga0157369_10000724
2043 Ga0157369_10002173
2044 Ga0157369_10006099
2045 Ga0157369_10126414
2046 Ga0157374_10000067
2047 Ga0157374_10000895
2048 Ga0157374_10140959
2049 Ga0157378_10012903
2050 Ga0157378_10041290
2051 Ga0157378_10052732
2052 Ga0157378_10059389
2053 Ga0157378_10074224
2054 Ga0163162_10003353
2055 Ga0163162_10129458
2056 Ga0163162_10166104
2057 Ga0163162_10176279
2058 Ga0157372_10006459
2059 Ga0157372_10129142
2060 Ga0157375_10027704
2061 Ga0157375_10030363
2062 Ga0163163_10006006
2063 Ga0157380_10047265
2064 Ga0157380_10083953
2065 Ga0182008_10000317
2066 Ga0182008_10001784
2067 Ga0182008_10008860
2068 Ga0182008_10016908
2069 Ga0182008_10019892
2070 Ga0182008_10039546
2071 Ga0182008_10069701
2072 Ga0157377_10000014
2073 Ga0157379_10023602
2074 Ga0157379_10030186
2075 Ga0157379_10061146
2076 Ga0157376_10098455
2077 Ga0157376_10327014
2078 Ga0182006_1000002
2079 Ga0182006_1000117
2080 Ga0182006_1001371
2081 Ga0182006_1002284
2082 Ga0182006_1010814
2083 Ga0182006_1014280
2084 Ga0182006_1060176
2085 Ga0182007_10000045
2086 Ga0182007_10001215
2087 Ga0182007_10002141
2088 Ga0182007_10003073
2089 Ga0182007_10006337
2090 Ga0182007_10035831
2091 Ga0182005_1000002
2092 Ga0182005_1000007
2093 Ga0182005_1000431
2094 Ga0182005_1008518
2095 Ga0183362_10001
2096 Ga0163161_10000943
2097 Ga0163161_10033889
2098 Ga0163161_10054079
2099 Ga0197907_11358827
2100 Ga0206349_1321444
2101 Ga0206355_1123131
2102 Ga0206351_10143154
2103 Ga0206350_10286196
2104 Ga0154015_1106824
2105 Ga0213872_10000003
2106 Ga0213872_10000004
2107 Ga0213872_10000016
2108 Ga0213872_10000026
2109 Ga0213872_10000199
2110 Ga0213872_10000552
2111 Ga0213872_10004172
2112 Ga0213872_10050593
2113 Ga0213876_10047440
2114 Ga0224712_10003779
2115 Ga0209435_100001
2116 Ga0209435_100029
2117 Ga0209435_100531
2118 Ga0209436_100074
2119 Ga0209436_107406
2120 Ga0209436_107658
2121 Ga0209784_100003
2122 Ga0209784_100004
2123 Ga0209784_100033
2124 Ga0209784_100522
2125 Ga0209566_100002
2126 Ga0209566_100004
2127 Ga0209566_100037
2128 Ga0209566_100731
2129 Ga0209566_101006
2130 Ga0209674_100003
2131 Ga0209674_100006
2132 Ga0209674_100008
2133 Ga0209674_100055
2134 Ga0209674_100217
2135 Ga0209672_100052
2136 Ga0209672_100190
2137 Ga0209672_101060
2138 Ga0209672_101759
2139 Ga0209672_105771
2140 Ga0209147_100002
2141 Ga0209147_100004
2142 Ga0209563_100004
2143 Ga0209563_100005
2144 Ga0209563_100007
2145 Ga0209563_100009
2146 Ga0209563_100010
2147 Ga0209563_100056
2148 Ga0209563_102380
2149 Ga0207427_101216
2150 Ga0209437_100004
2151 Ga0209437_100053
2152 Ga0209258_100002
2153 Ga0209258_100048
2154 Ga0209258_100060
2155 Ga0209258_100463
2156 Ga0209258_100482
2157 Ga0207425_1000001
2158 Ga0207425_1000089
2159 Ga0207425_1000275
2160 Ga0207425_1000596
2161 Ga0207425_1003163
2162 Ga0207425_1003233
2163 Ga0209646_1000001
2164 Ga0209646_1000010
2165 Ga0209646_1000022
2166 Ga0209646_1000073
2167 Ga0209646_1000109
2168 Ga0209646_1000242
2169 Ga0209026_1000003
2170 Ga0209026_1000124
2171 Ga0209026_1000311
2172 Ga0209026_1004281
2173 Ga0209677_100005
2174 Ga0209677_100009
2175 Ga0209677_100034
2176 Ga0209677_100274
2177 Ga0209677_100396
2178 Ga0209677_103662
2179 Ga0209677_111576
2180 Ga0209148_1000021
2181 Ga0209148_1000040
2182 Ga0209148_1000241
2183 Ga0209148_1002487
2184 Ga0209759_1000001
2185 Ga0209759_1000108
2186 Ga0209759_1000373
2187 Ga0209759_1000412
2188 Ga0209759_1001241
2189 Ga0209759_1001285
2190 Ga0209759_1001792
2191 Ga0209759_1006296
2192 Ga0209759_1008599
2193 Ga0209129_1000001
2194 Ga0209129_1000007
2195 Ga0209129_1000148
2196 Ga0209129_1004204
2197 Ga0209129_1007373
2198 Ga0209129_1013173
2199 Ga0209233_1000005
2200 Ga0209565_1000004
2201 Ga0209565_1000009
2202 Ga0209565_1000153
2203 Ga0209565_1000292
2204 Ga0209565_1000311
2205 Ga0209565_1000606
2206 Ga0209565_1001694
2207 Ga0209565_1003078
2208 Ga0209455_1000021
2209 Ga0209455_1000093
2210 Ga0209455_1000121
2211 Ga0209455_1002583
2212 Ga0209673_1000019
2213 Ga0209673_1000074
2214 Ga0209673_1000423
2215 Ga0209673_1000794
2216 Ga0209673_1003547
2217 Ga0209673_1003649
2218 Ga0209673_1011832
2219 Ga0209673_1012266
2220 Ga0209130_1000050
2221 Ga0209130_1000143
2222 Ga0209130_1000172
2223 Ga0209130_1000329
2224 Ga0209130_1000460
2225 Ga0209130_1002121
2226 Ga0209130_1004145
2227 Ga0209130_1005713
2228 Ga0209675_1000028
2229 Ga0209675_1000044
2230 Ga0209675_1000150
2231 Ga0209675_1001581
2232 Ga0209675_1001931
2233 Ga0209675_1002255
2234 Ga0209675_1007563
2235 Ga0209676_1000004
2236 Ga0209676_1000029
2237 Ga0209676_1002870
2238 Ga0209676_1003529
2239 Ga0209676_1003660
2240 Ga0209676_1016751
2241 Ga0209025_1000111
2242 Ga0209025_1000624
2243 Ga0209025_1002339
2244 Ga0209025_1003371
2245 Ga0209025_1005225
2246 Ga0209025_1007741
2247 Ga0209025_1008867
2248 Ga0209564_1000003
2249 Ga0209564_1000009
2250 Ga0209564_1000033
2251 Ga0209564_1000058
2252 Ga0209564_1000153
2253 Ga0209564_1000178
2254 Ga0209564_1000251
2255 Ga0209564_1000470
2256 Ga0209564_1001234
2257 Ga0209564_1001907
2258 Ga0209564_1005307
2259 Ga0209564_1008824
2260 Ga0209758_1000025
2261 Ga0209758_1000116
2262 Ga0209758_1000387
2263 Ga0209758_1000439
2264 Ga0209758_1002669
2265 Ga0209758_1005897
2266 Ga0209758_1012598
2267 Ga0209050_1000002
2268 Ga0209050_1000003
2269 Ga0209050_1000412
2270 Ga0209050_1001086
2271 Ga0209050_1001892
2272 Ga0209050_1005811
2273 Ga0209050_1010897
2274 Ga0209050_1020874
2275 Ga0209050_1021056
2276 Ga0209256_1000001
2277 Ga0209256_1000005
2278 Ga0209256_1000024
2279 Ga0209256_1000093
2280 Ga0209256_1000488
2281 Ga0209256_1003497
2282 Ga0207426_1000001
2283 Ga0207426_1000028
2284 Ga0207426_1000071
2285 Ga0207426_1000692
2286 Ga0207426_1001345
2287 Ga0209051_1000002
2288 Ga0209051_1000003
2289 Ga0209051_1000063
2290 Ga0209051_1000268
2291 Ga0209051_1001146
2292 Ga0209051_1001878
2293 Ga0209051_1003892
2294 Ga0209051_1005038
2295 Ga0209051_1014865
2296 Ga0209051_1053509
2297 Ga0209257_1000002
2298 Ga0209257_1000018
2299 Ga0209257_1000275
2300 Ga0209257_1000354
2301 Ga0209257_1001690
2302 Ga0209257_1002262
2303 Ga0209257_1002313
2304 Ga0209257_1002999
2305 Ga0209257_1004776
2306 Ga0209257_1019761
2307 Ga0207697_10004138
2308 Ga0207697_10011975
2309 Ga0207655_1003482
2310 Ga0207655_1006002
2311 Ga0207682_10003292
2312 Ga0207682_10013079
2313 Ga0207680_10003056
2314 Ga0207647_10000176
2315 Ga0207645_10006398
2316 Ga0207645_10009991
2317 Ga0207643_10035733
2318 Ga0207643_10067634
2319 Ga0207643_10102057
2320 Ga0207705_10000768
2321 Ga0207705_10112464
2322 Ga0207684_10104042
2323 Ga0207654_10005978
2324 Ga0207707_10012991
2325 Ga0207707_10070211
2326 Ga0207695_10001614
2327 Ga0207695_10002501
2328 Ga0207695_10004682
2329 Ga0207695_10005439
2330 Ga0207695_10036213
2331 Ga0207695_10292937
2332 Ga0207671_10000808
2333 Ga0207671_10026808
2334 Ga0207671_10050814
2335 Ga0207657_10000843
2336 Ga0207657_10002514
2337 Ga0207657_10044157
2338 Ga0207649_10000193
2339 Ga0207649_10002218
2340 Ga0207649_10116089
2341 Ga0207646_10351787
2342 Ga0207681_10004604
2343 Ga0207681_10102846
2344 Ga0207650_10000913
2345 Ga0207659_10000189
2346 Ga0207659_10004058
2347 Ga0207659_10004477
2348 Ga0207687_10070281
2349 Ga0207687_10274339
2350 Ga0207644_10029379
2351 Ga0207690_10000541
2352 Ga0207690_10005319
2353 Ga0207690_10007244
2354 Ga0207690_10007619
2355 Ga0207690_10153749
2356 Ga0207706_10034951
2357 Ga0207706_10049695
2358 Ga0207706_10061811
2359 Ga0207706_10128454
2360 Ga0207686_10000809
2361 Ga0207709_10001797
2362 Ga0207709_10004048
2363 Ga0207709_10009473
2364 Ga0207670_10186134
2365 Ga0207669_10001570
2366 Ga0207669_10005261
2367 Ga0207669_10094735
2368 Ga0207669_10105297
2369 Ga0207704_10072874
2370 Ga0207704_10087309
2371 Ga0207665_10007367
2372 Ga0207665_10104367
2373 Ga0207691_10002491
2374 Ga0207691_10013616
2375 Ga0207691_10017166
2376 Ga0207691_10019152
2377 Ga0207711_10030824
2378 Ga0207711_10041281
2379 Ga0207689_10069464
2380 Ga0207689_10099680
2381 Ga0207679_10000001
2382 Ga0207679_10001861
2383 Ga0207679_10027731
2384 Ga0207667_10000034
2385 Ga0207667_10037117
2386 Ga0207667_10054097
2387 Ga0207667_10072367
2388 Ga0207667_10126610
2389 Ga0207667_10284418
2390 Ga0207651_10007212
2391 Ga0207651_10037955
2392 Ga0207651_10124579
2393 Ga0207712_10035285
2394 Ga0207668_10139821
2395 Ga0207640_10000098
2396 Ga0207640_10018472
2397 Ga0207658_10006468
2398 Ga0207658_10009255
2399 Ga0207658_10053784
2400 Ga0207658_10109335
2401 Ga0207677_10006156
2402 Ga0207703_10003102
2403 Ga0207703_10080568
2404 Ga0207639_10205305
2405 Ga0207639_10219849
2406 Ga0207678_10000001
2407 Ga0207678_10002552
2408 Ga0207678_10093712
2409 Ga0207708_10077055
2410 Ga0207702_10000009
2411 Ga0207702_10002147
2412 Ga0207702_10094379
2413 Ga0207641_10003303
2414 Ga0207641_10036723
2415 Ga0207641_10043576
2416 Ga0207648_10000142
2417 Ga0207648_10001133
2418 Ga0207648_10021300
2419 Ga0207648_10175045
2420 Ga0207648_10196930
2421 Ga0207648_10318847
2422 Ga0207676_10005300
2423 Ga0207676_10138952
2424 Ga0207674_10001006
2425 Ga0207674_10014389
2426 Ga0207674_10046656
2427 Ga0207675_100001246
2428 Ga0207675_100025406
2429 Ga0207683_10022902
2430 Ga0207683_10026909
2431 Ga0207683_10061741
2432 Ga0207683_10089363
2433 Ga0207683_10113081
2434 Ga0207683_10142555
2435 Ga0207698_10018066
2436 Ga0207698_10074454
2437 Ga0207698_10118215
2438 Ga0207698_10331714
2439 Ga0209281_1000442
2440 Ga0209281_1004821
2441 Ga0209389_1009757
2442 Ga0209371_1007787
2443 Ga0209967_1002266
2444 Ga0209967_1006672
2445 Ga0209981_1002288
2446 Ga0209995_1004707
2447 Ga0209968_1001087
2448 Ga0209999_1004774
2449 Ga0209999_1013436
2450 Ga0209999_1017424
2451 Ga0209970_1000814
2452 Ga0209282_1000001
2453 Ga0209588_1046569
2454 Ga0209971_1019615
2455 Ga0209966_1000004
2456 Ga0209974_10002324
2457 Ga0209974_10002377
2458 Ga0207428_10000830
2459 Ga0268266_10145296
2460 Ga0268265_10040740
2461 Ga0268264_10039604
2462 Ga0268264_10096750
2463 Ga0265336_10000062
2464 Ga0307515_10000022
2465 Ga0307515_10000191
2466 Ga0307515_10000208
2467 Ga0307515_10003517
2468 Ga0307515_10003519
2469 Ga0307515_10011870
2470 Ga0307515_10015490
2471 Ga0307515_10036876
2472 Ga0307515_10174390
2473 Ga0265338_10077449
2474 Ga0265324_10000928
2475 Ga0268256_1008034
2476 Ga0316180_1024577
2477 Ga0316181_1063388
2478 Ga0316182_1344291
2479 Ga0265330_10000032
2480 Ga0265332_10000001
2481 Ga0265332_10000003
2482 Ga0265328_10000004
2483 Ga0265328_10001293
2484 Ga0265325_10006034
2485 Ga0265340_10011616
2486 Ga0265331_10008102
2487 Ga0265331_10060231
2488 Ga0265327_10000043
2489 Ga0265327_10000184
2490 Ga0265327_10000261
2491 Ga0265327_10000956
2492 Ga0265327_10014403
2493 Ga0265327_10025250
2494 Ga0265327_10050447
2495 Ga0265316_10231625
2496 Ga0307513_10000014
2497 Ga0307513_10000019
2498 Ga0307513_10011299
2499 Ga0307513_10089327
2500 Ga0307509_10022521
2501 Ga0307509_10041706
2502 Ga0307408_100000008
2503 Ga0307408_100000513
2504 Ga0307408_100001235
2505 Ga0307408_100010270
2506 Ga0307408_100014180
2507 Ga0307408_100028168
2508 Ga0307408_100034061
2509 Ga0307508_10000017
2510 Ga0307514_10001461
2511 Ga0307514_10004466
2512 Ga0307514_10007672
2513 Ga0316575_10030592
2514 Ga0265314_10000022
2515 Ga0265314_10002666
2516 Ga0265314_10055744
2517 Ga0307516_10000254
2518 Ga0307516_10003632
2519 Ga0307516_10004780
2520 Ga0307516_10006776
2521 Ga0307405_10048866
2522 Ga0307413_10037276
2523 Ga0307406_10000279
2524 Ga0307406_10001221
2525 Ga0307406_10010426
2526 Ga0307406_10042774
2527 Ga0307407_10002597
2528 Ga0307412_10021521
2529 Ga0307412_10073409
2530 Ga0307409_100125018
2531 Ga0307416_100013315
2532 Ga0307416_100092334
2533 Ga0307416_100107319
2534 Ga0307416_100140365
2535 Ga0307416_100162230
2536 Ga0307414_10022373
2537 Ga0307414_10078226
2538 Ga0307411_10002201
2539 Ga0307411_10015220
2540 Ga0307411_10170435
2541 Ga0307415_100028737
2542 Ga0307507_10064219
2543 Ga0373951_0015022
2544 Ga0373932_0018160
2545 Ga0373939_0000164
2546 Ga0373960_0015650
2547 Ga0373960_0018371
2548 Ga0373942_0047325
2549 Ga0316574_0002074
2550 Ga0373931_0000346
2551 Ga0373931_0183747
2552 Ga0373937_0147098
2553 Ga0373937_0209036
2554 Ga0373937_0267318
2555 Ga0395899_0000028
2556 Ga0395899_0001707
2557 Ga0395899_0001829
2558 Ga0395899_0002713
2559 Ga0395899_0002722
2560 Ga0395899_0089861
2561 Ga0395899_0129776
2562 Ga0395899_0190098
2563 Ga0395900_0000188
2564 Ga0395900_0000404
2565 Ga0395900_0006862
2566 Ga0395900_0007487
2567 Ga0395900_0019397
2568 Ga0395900_0030419
2569 Ga0395900_0047771
2570 Ga0395900_0061956
2571 Ga0395900_0071579
2572 Ga0395900_0145451
2573 Ga0395898_0002535
2574 Ga0395898_0021367
2575 Ga0395898_0056071
2576 Ga0395898_0075075
2577 Ga0395898_0130013
2578 Ga0395898_0173483
2579 Ga0395898_0193475
2580 Ga0395905_0000373
2581 Ga0395905_0001392
2582 Ga0395905_0002403
2583 Ga0395905_0002964
2584 Ga0395905_0019259
2585 Ga0395905_0019945
2586 Ga0395905_0022852
2587 Ga0395905_0044762
2588 Ga0395905_0051956
2589 Ga0395905_0052375
2590 Ga0395905_0055716
2591 Ga0395905_0082668
2592 Ga0395901_0000217
2593 Ga0395901_0002151
2594 Ga0395901_0019360
2595 Ga0395901_0034202
2596 Ga0395901_0041955
2597 Ga0395901_0136007
2598 Ga0395901_0271617
2599 Ga0400483_219566
2600 Ga0436365_0325012
2601 Ga0436361_0052780
2602 Ga0436361_0089504
2603 Ga0436361_0136744
2604 Ga0436361_0376061
2605 Ga0436361_0583521
2606 Ga0436361_0681193
2607 Ga0436361_0974268
2608 Ga0436361_1205067
2609 Ga0439436_0000600
2610 Ga0439436_0002999
2611 Ga0439439_0030834
2612 Ga0439439_0045999
2613 Ga0439461_0008822
2614 Ga0439465_0001850
2615 Ga0439465_0022298
2616 Ga0451789_0718700
2617 Ga0451793_1814855
2618 Ga0451849_0021782
2619 Ga0439431_0001330
2620 Ga0439431_0006327
2621 Ga0439433_0000095
2622 Ga0439442_009072
2623 Ga0439445_0002081
2624 Ga0439448_0000095
2625 Ga0439432_001088
2626 Ga0439449_0000064
2627 Ga0439449_0000770
2628 Ga0439449_0009218
2629 Ga0439450_010822
2630 Ga0439452_002075
2631 Ga0439455_0001605
2632 Ga0439455_0021277
2633 Ga0439462_0002409
2634 Ga0450920_003022
2635 Ga0450923_010893
2636 Ga0450888_001438
2637 Ga0450890_004653
2638 Ga0450896_003283
2639 Ga0450889_000167
2640 Ga0439446_0013167
2641 Ga0439458_0013844
2642 Ga0450908_005451
2643 Ga0439434_0013333
2644 Ga0439434_0026727
2645 Ga0439464_0003043
2646 Ga0439460_0029524
2647 Ga0450918_000566
2648 Ga0450893_0001807
2649 Ga0451577_0000457
2650 Ga0451577_0001608
2651 Ga0451577_0005822
2652 Ga0451577_0015192
2653 Ga0451577_0054386
2654 Ga0466969_0000002
2655 Ga0466969_0009674
2656 Ga0466972_0000041
2657 Ga0466972_0010214
2658 Ga0466972_0016157
2659 Ga0466972_0050698
2660 Ga0453683_0016829
2661 Ga0453683_0026293
2662 Ga0466965_0003357
2663 Ga0466965_0013125
2664 Ga0466965_0014917
2665 Ga0466965_0017774
2666 Ga0466965_0024321
2667 Ga0466965_0030808
2668 Ga0466965_0076770
2669 Ga0466965_0112273
2670 Ga0466966_0009856
2671 Ga0466966_0014323
2672 Ga0466966_0048125
2673 Ga0466961_0000197
2674 Ga0466961_0008940
2675 Ga0466961_0030032
2676 Ga0466963_0066792
2677 Ga0466963_0095559
2678 Ga0466964_0004825
2679 Ga0466964_0007990
2680 Ga0466964_0009532
2681 Ga0453684_0000005
2682 Ga0453684_0011680
2683 Ga0453684_0022088
2684 Ga0453684_0051481
2685 Ga0453684_0054587
2686 Ga0453684_0146319
2687 Ga0453684_0150699
2688 Ga0453684_0296104
2689 Ga0453684_0342818
2690 Ga0453684_0488559
2691 Ga0466971_0005732
2692 Ga0466971_0032905
2693 Ga0466968_0000328
2694 Ga0466968_0003733
2695 Ga0466968_0020319
2696 Ga0466970_0001953
2697 Ga0466970_0017427
2698 Ga0466970_0020495
2699 Ga0466970_0085316
2700 Ga0466957_0000791
2701 Ga0466957_0015722
2702 Ga0466957_0039113
2703 Ga0466960_0127746
2704 Ga0466959_0001562
2705 Ga0466959_0004663
2706 Ga0466959_0019040
2707 Ga0466959_0035280
2708 Ga0466959_0090620
2709 Ga0451576_0001449
2710 Ga0451576_0009855
2711 Ga0451576_0015538
2712 Ga0451576_0034054
2713 Ga0451576_0090482
2714 Ga0451576_0202995
2715 Ga0451576_0304663
2716 Ga0451576_0639959
2717 Ga0466967_0027465
2718 Ga0466967_0132584
2719 Ga0495617_000029
2720 Ga0495617_000050
2721 Ga0495617_001265
2722 Ga0495627_000055
2723 Ga0495627_006898
2724 Ga0495592_0000656
2725 Ga0495592_0022299
2726 Ga0495603_0047614
2727 Ga0495590_0000032
2728 Ga0495590_0000060
2729 Ga0495591_000596
2730 Ga0495629_0025793
2731 Ga0495629_0031756
2732 Ga0495629_0044071
2733 Ga0495638_0000562
2734 Ga0495638_0019435
2735 Ga0495638_0045974
2736 Ga0495651_0002000
2737 Ga0495653_0000081
2738 Ga0495653_0081582
2739 Ga0495650_0000048
2740 Ga0495650_0000161
2741 Ga0495650_0000890
2742 Ga0495650_0002372
2743 Ga0495650_0003041
2744 Ga0495650_0009337
2745 Ga0495582_0017401
2746 Ga0495605_0000044
2747 Ga0495605_0000180
2748 Ga0495605_0000494
2749 Ga0495605_0002894
2750 Ga0495605_0087919
2751 Ga0495639_0002696
2752 Ga0495662_0027003
2753 Ga0495584_0000613
2754 Ga0495584_0009159
2755 Ga0495584_0010710
2756 Ga0495584_0012788
2757 Ga0495584_0024369
2758 Ga0495585_0001109
2759 Ga0495585_0004398
2760 Ga0495585_0021342
2761 Ga0495585_0038591
2762 Ga0495585_0044172
2763 Ga0495594_0022012
2764 Ga0495596_0000481
2765 Ga0495596_0001056
2766 Ga0495596_0009863
2767 Ga0495607_0002872
2768 Ga0495607_0012437
2769 Ga0495607_0017013
2770 Ga0495607_0022647
2771 Ga0495607_0039947
2772 Ga0495607_0064366
2773 Ga0495607_0094293
2774 Ga0495583_0000145
2775 Ga0495583_0000153
2776 Ga0495583_0000155
2777 Ga0495583_0000622
2778 Ga0495583_0014837
2779 Ga0495583_0014978
2780 Ga0495606_0000232
2781 Ga0495606_0000510
2782 Ga0495606_0000904
2783 Ga0495606_0001037
2784 Ga0495606_0002667
2785 Ga0495606_0025667
2786 Ga0495606_0133542
2787 Ga0495608_0002698
2788 Ga0495610_0000003
2789 Ga0495610_0000683
2790 Ga0495610_0001267
2791 Ga0495610_0005108
2792 Ga0495610_0012154
2793 Ga0495610_0044864
2794 Ga0495616_0000368
2795 Ga0495616_0002113
2796 Ga0495616_0002290
2797 Ga0495616_0008854
2798 Ga0495616_0009537
2799 Ga0495616_0012032
2800 Ga0495616_0052526
2801 Ga0495616_0055107
2802 Ga0495628_0001041
2803 Ga0495628_0002970
2804 Ga0495628_0011231
2805 Ga0495630_0078444
2806 Ga0495631_0006567
2807 Ga0495631_0010855
2808 Ga0495631_0012627
2809 Ga0495632_0000675
2810 Ga0495632_0000792
2811 Ga0495632_0015558
2812 Ga0495632_0019623
2813 Ga0495632_0028407
2814 Ga0495632_0040734
2815 Ga0495637_0000004
2816 Ga0495637_0000656
2817 Ga0495637_0009348
2818 Ga0495643_0000228
2819 Ga0495643_0001906
2820 Ga0495643_0013184
2821 Ga0495643_0017990
2822 Ga0495644_0005754
2823 Ga0495648_0000125
2824 Ga0495648_0001315
2825 Ga0495648_0035276
2826 Ga0495648_0042665
2827 Ga0495648_0078035
2828 Ga0495663_0008647
2829 Ga0495666_0017689
2830 Ga0495666_0047683
2831 Ga0495642_0019418
2832 Ga0495642_0023200
2833 Ga0495642_0029751
2834 Ga0495642_0053184
2835 Ga0495652_0038674
2836 Ga0495652_0039001
2837 Ga0495654_0000161
2838 Ga0495654_0025295
2839 Ga0495665_0009055
2840 Ga0495665_0011262
2841 Ga0495665_0070394
2842 Ga0495640_0002796
2843 Ga0495586_0000700
2844 Ga0495586_0001459
2845 Ga0495587_0043411
2846 Ga0495587_0153173
2847 Ga0495609_0000059
2848 Ga0495609_0006386
2849 Ga0495609_0062901
2850 Ga0495621_0000945
2851 Ga0495597_0000507
2852 Ga0495597_0001639
2853 Ga0495597_0003206
2854 Ga0495597_0018497
2855 Ga0495597_0051766
2856 Ga0495597_0054921
2857 Ga0495597_0056798
2858 Ga0495645_0016673
2859 Ga0495622_0000078
2860 Ga0495633_0000797
2861 Ga0495633_0010563
2862 Ga0495633_0013087
2863 Ga0495633_0020919
2864 Ga0495633_0021646
2865 Ga0495633_0022848
2866 Ga0495667_0001556
2867 Ga0495656_0000076
2868 Ga0495668_0000368
2869 Ga0495668_0000657
2870 Ga0495668_0002551
2871 Ga0495668_0006775
2872 Ga0495668_0012859
2873 Ga0495668_0024425
2874 Ga0495634_0002308
2875 Ga0495634_0011874
2876 Ga0495634_0150923
2877 Ga0495611_0020391
2878 Ga0495611_0034656
2879 Ga0495625_0000436
2880 Ga0495625_0004994
2881 Ga0495625_0006820
2882 Ga0495625_0007896
2883 Ga0495625_0012120
2884 Ga0495625_0016825
2885 Ga0495625_0028305
2886 Ga0495625_0042342
2887 Ga0495625_0048793
2888 Ga0495635_0155289
2889 Ga0495659_0000122
2890 Ga0495659_0002747
2891 Ga0495661_0002354
2892 Ga0495661_0006604
2893 Ga0495661_0015281
2894 Ga0495661_0015765
2895 Ga0495661_0034833
2896 Ga0495661_0055909
2897 Ga0495661_0134382
2898 Ga0495588_0000189
2899 Ga0495588_0023206
2900 Ga0495588_0053574
2901 Ga0495588_0088646
2902 Ga0495599_0000399
2903 Ga0495599_0009316
2904 Ga0495623_0006506
2905 Ga0495623_0048215
2906 Ga0495646_0001572
2907 Ga0495646_0069395
2908 Ga0495647_0008788
2909 Ga0495658_0006586
2910 Ga0495658_0006812
2911 Ga0495669_0000508
2912 Ga0495669_0008827
2913 Ga0495613_0009379
2914 Ga0495613_0014523
2915 Ga0495670_0002575
2916 Ga0495670_0032566
2917 Ga0495670_0052998
2918 Ga0495671_0000001
2919 Ga0495671_0000430
2920 Ga0495649_0001263
2921 Ga0495649_0013899
2922 Ga0495589_0000052
2923 Ga0495589_0000317
2924 Ga0495589_0008909
2925 Ga0495589_0023095
2926 Ga0495589_0026040
2927 Ga0495600_0000629
2928 Ga0495600_0029278
2929 Ga0495600_0100965
2930 Ga0495660_0002980
2931 Ga0495660_0004826
2932 Ga0495660_0013093
2933 Ga0495581_0041096
2934 Ga0495581_0052322
2935 Ga0495604_0008571
2936 Ga0495604_0020547
2937 Ga0495604_0025805
2938 Ga0495636_0000336
2939 Ga0495636_0000461
2940 Ga0495636_0002901
2941 Ga0495636_0022513
2942 Ga0495672_0000093
2943 Ga0495672_0000176
2944 Ga0495672_0000342
2945 Ga0495672_0001378
2946 Ga0495672_0030482
2947 Ga0495676_0019249
2948 Ga0495676_0037983
2949 Ga0495680_0002481
2950 Ga0495683_0000248
2951 Ga0495683_0000343
2952 Ga0495683_0002649
2953 Ga0495687_000087
2954 Ga0495687_000395
2955 Ga0495687_000598
2956 Ga0495687_000913
2957 Ga0495687_001142
2958 Ga0495687_002075
2959 Ga0495687_002391
2960 Ga0495687_007698
2961 Ga0495675_0028624
2962 Ga0495677_0000070
2963 Ga0495677_0018251
2964 Ga0495677_0020382
2965 Ga0495679_009305
2966 Ga0495679_009792
2967 Ga0495685_000323
2968 Ga0495685_018588
2969 Ga0495673_0000006
2970 Ga0495673_0000024
2971 Ga0495673_0000049
2972 Ga0495681_0002290
2973 Ga0495681_0002823
2974 Ga0495681_0006653
2975 Ga0495686_0001319
2976 Ga0495686_0002420
2977 Ga0495686_0009713
2978 Ga0495686_0071230
2979 Ga0495593_0003834
2980 Ga0495593_0022003
2981 Ga0495602_0054070
2982 Ga0495614_0000563
2983 Ga0495626_0000085
2984 Ga0495626_0000178
2985 Ga0495626_0001048
2986 Ga0495626_0005716
2987 Ga0495626_0016181
2988 Ga0495626_0016736
2989 Ga0496100_0011298
2990 Ga0496101_0021767
2991 Ga0496101_0042206
2992 Ga0496101_0051336
2993 Ga0496102_0011990
2994 Ga0496102_0029346
2995 Ga0496102_0037961
2996 Ga0496102_0078090
2997 Ga0496102_0086355
2998 Ga0496104_0261480
2999 Ga0496104_0382512
3000 Ga0496105_0001580
3001 Ga0496105_0188494
3002 Ga0496106_0047710
3003 Ga0496109_0038419
3004 Ga0496110_0028201
3005 Ga0496110_0035522
3006 Ga0496110_0105558
3007 Ga0496110_0270295
3008 Ga0496111_0069687
3009 Ga0496114_0048729
3010 Ga0496114_0055953
3011 Ga0496114_0218225
3012 Ga0496115_0007765
3013 Ga0496115_0058190
3014 Ga0496116_0005336
3015 Ga0496116_0109107
3016 Ga0496117_0000001
3017 Ga0496117_0014655
3018 Ga0496118_0000078
3019 Ga0496118_0030575
3020 Ga0496118_0061288
3021 Ga0496118_0149690
3022 Ga0496118_0155114
3023 Ga0496121_0036731
3024 Ga0496121_0041851
3025 Ga0496121_0062576
3026 Ga0496121_0092447
3027 Ga0496121_0255477
3028 Ga0496122_0000103
3029 Ga0496122_0000472
3030 Ga0496122_0002104
3031 Ga0496122_0040011
3032 Ga0496123_0000261
3033 Ga0496123_0000361
3034 Ga0496123_0001654
3035 Ga0496123_0026803
3036 Ga0496123_0054174
3037 Ga0496123_0096880
3038 Ga0496123_0107743
3039 Ga0496124_0000151
3040 Ga0496124_0000155
3041 Ga0496124_0004832
3042 Ga0496124_0045923
3043 Ga0496125_0005102
3044 Ga0496125_0005971
3045 Ga0496125_0009461
3046 Ga0496125_0029672
3047 Ga0496125_0035455
3048 Ga0496125_0161292
3049 Ga0501310_000578
3050 Ga0495678_000223
3051 Ga0495678_000439
3052 Ga0495678_000771
3053 Ga0495678_002291
3054 Ga0495678_003472
3055 Ga0495678_039382
3056 Ga0495682_0001584
3057 Ga0495682_0029415
3058 Ga0501295_002376
3059 Ga0501298_013028
3060 Ga0501300_000967
3061 Ga0501031_0001583
3062 Ga0501031_0138779
3063 Ga0501038_0101445
3064 Ga0501039_0006011
3065 Ga0501039_0165594
3066 Ga0501043_0000141
3067 Ga0501043_0070134
3068 Ga0501046_0000047
3069 Ga0501046_0029614
3070 Ga0501047_0000058
3071 Ga0501047_0066255
3072 Ga0501048_0002761
3073 Ga0501070_0001800
3074 Ga0501070_0077838
3075 Ga0501074_0005316
3076 Ga0501074_0249547
3077 Ga0501075_0022681
3078 Ga0501198_000002
3079 Ga0501222_000002
3080 Ga0501223_003895
3081 Ga0501253_006016
3082 Ga0501258_001545
3083 Ga0501229_000963
3084 Ga0501262_000587
3085 Ga0501262_003280
3086 Ga0501266_000061
3087 Ga0501279_014401
3088 Ga0501280_000779
3089 Ga0501282_003594
3090 Ga0501035_0006524
3091 Ga0501044_0000070
3092 Ga0501044_0000379
3093 Ga0501044_0239282
3094 nmdc:mga03683_1058_c1
3095 nmdc:mga03683_1137_c1
3096 nmdc:mga03n38_22459_c1
3097 nmdc:mga00v17_19444_c1
3098 nmdc:mga00v17_30066_c1
3099 nmdc:mga00v17_31656_c1
3100 nmdc:mga00v17_3261_c1
3101 nmdc:mga00v17_59130_c1
3102 nmdc:mga0yw44_149906_c1
3103 nmdc:mga0yw44_18828_c1
3104 nmdc:mga0yw44_4617_c1
3105 nmdc:mga0k408_123753_c1
3106 nmdc:mga0k408_129286_c1
3107 nmdc:mga0k408_15735_c1
3108 nmdc:mga0k408_21431_c2
3109 nmdc:mga0k408_28418_c1
3110 nmdc:mga0k408_4539_c1
3111 nmdc:mga0k408_84428_c1
3112 nmdc:mga0k408_8464_c1
3113 nmdc:mga06z11_12650_c1
3114 nmdc:mga06z11_28742_c1
3115 nmdc:mga06z11_60760_c1
3116 nmdc:mga04h51_11267_c1
3117 nmdc:mga07m45_110521_c1
3118 nmdc:mga07m45_11535_c1
3119 nmdc:mga07m45_12754_c1
3120 nmdc:mga07m45_182_c1
3121 nmdc:mga07m45_19387_c1
3122 nmdc:mga07m45_21169_c1
3123 nmdc:mga07m45_23333_c1
3124 nmdc:mga07m45_35932_c1
3125 nmdc:mga07m45_51285_c1
3126 nmdc:mga07m45_831_c1
3127 nmdc:mga09592_17028_c1
3128 nmdc:mga09592_3371_c1
3129 nmdc:mga0qj67_13392_c1
3130 nmdc:mga08y16_34516_c1
3131 nmdc:mga08y16_4675_c1
3132 nmdc:mga0n895_202668_c1
3133 nmdc:mga0n895_286054_c1
3134 nmdc:mga0rr50_240967_c1
3135 nmdc:mga0rr50_45174_c1
3136 nmdc:mga08x19_144_c1
3137 nmdc:mga08x19_20211_c1
3138 nmdc:mga08x19_5478_c1
3139 nmdc:mga0sz30_20039_c1
3140 nmdc:mga0sz30_30537_c1
3141 Ga0500610_0020964
3142 Ga0500635_0000033
3143 Ga0500578_0000002
3144 Ga0500644_0001013
3145 Ga0500646_0004257
3146 Ga0500646_0004453
3147 Ga0500651_0000042
3148 Ga0500651_0027361
3149 Ga0500650_0021345
3150 Ga0500569_035869
3151 Ga0500571_000096
3152 Ga0500593_000815
3153 Ga0500593_007672
3154 Ga0500607_002839
3155 Ga0500618_000469
3156 Ga0500618_001201
3157 Ga0500652_000102
3158 Ga0500658_0000966
3159 Ga0500658_0001050
3160 Ga0500559_0004514
3161 Ga0500574_000611
3162 Ga0500577_0007624
3163 Ga0500604_0004883
3164 Ga0500616_0017939
3165 Ga0500619_000015
3166 Ga0500619_001041
3167 Ga0500622_0000001
3168 Ga0500622_0000236
3169 Ga0500622_0003109
3170 Ga0500624_001676
3171 Ga0500636_0000870
3172 Ga0500636_0009640
3173 Ga0500637_0062352
3174 Ga0500570_060536
3175 Ga0500625_008812
3176 Ga0500645_002026
3177 Ga0500645_002056
3178 Ga0500645_009453
3179 Ga0590071_005391
3180 Ga0587084_000476
3181 Ga0587084_002643
3182 Ga0587070_000720
3183 Ga0587070_007438
3184 Ga0587073_0004837
3185 Ga0587077_008527
3186 Ga0587082_000566
3187 Ga0587083_0002910
3188 Ga0587083_0004811
3189 Ga0587086_000607
3190 Ga0587088_001141
3191 Ga0587090_000296
3192 Ga0587090_003114
3193 Ga0587098_002515
3194 Ga0587106_002524
3195 Ga0587101_000694
3196 Ga0587101_000876
3197 Ga0587101_003309
3198 Ga0587128_005367
3199 Ga0587067_000005
3200 Ga0587068_000631
3201 Ga0587072_000020
3202 Ga0587075_002891
3203 Ga0587075_005763
3204 Ga0587076_000849
3205 Ga0587076_005786
3206 Ga0587079_000879
3207 Ga0587104_000148
3208 Ga0587111_0001500
3209 Ga0587111_0006959
3210 Ga0587111_0007265
3211 2509131313
3212 2511245735
3213 2511248486
3214 2511386751
3215 2513226675
3216 2521558835
3217 2526213701
3218 2548500236
3219 2550695498
3220 2553003632
3221 2587727680
3222 2587733055
3223 2587755175
3224 2588291353
3225 2597028707
3226 2599445389
3227 2599625004
3228 2599673016
3229 2599682534
3230 2599694624
3231 2601667389
3232 2643742687
3233 2643787334
3234 2643802032
3235 2643864739
3236 2643936207
3237 2643969500
3238 2643991115
3239 2644028881
3240 2644075575
3241 2644143800
3242 2644159385
3243 2644214150
3244 2644217706
3245 2644243139
3246 2644252370
3247 2644258556
3248 2644276494
3249 2644294030
3250 2644316852
3251 2644329311
3252 2644357139
3253 2644401184
3254 2644467934
3255 2644473818
3256 2644644447
3257 2738717446
3258 2738741602
3259 2738829558
3260 2738843782
3261 2738879051
3262 2739056739
3263 2739153354
3264 2739195274
3265 2739248845
3266 2739275137
3267 2739278132
3268 2739321750
3269 2739339694
3270 2739344181
3271 2739613000
3272 2765569994
3273 2808981716
3274 2809131346
3275 2809145125
3276 2809150968
3277 2816476184
3278 2819544962
3279 2819593435
3280 2819596959
3281 2819615363
3282 2821131270
3283 2831266041
3284 2831866345
3285 2838057830
3286 2839097066
3287 2842679098
3288 2842714386
3289 2842721251
3290 2842735956
3291 2842748346
3292 2852622753
3293 2857545405
3294 2857551886
3295 2857554158
3296 2857561507
3297 2857565057
3298 2881102209
3299 2881930902
3300 2884839967
3301 2884857265
3302 2885083888
3303 2885197469
3304 2885203700
3305 2885216950
3306 2885266961
3307 2886849617
3308 2887378569
3309 2894026786
3310 2896157852
3311 2899930299
3312 2900580112
3313 2904426378
3314 2904444735
3315 2904456226
3316 2904457582
3317 2904480237
3318 2904534618
3319 2904543664
3320 2904584503
3321 2904590971
3322 2904605405
3323 2919047424
3324 2919080910
3325 2919466938
3326 2919478711
3327 2919704845
3328 2923512484
3329 2928039412
3330 2928044983
3331 2928052784
3332 2928062719
3333 2928064543
3334 2928075041
3335 2928088220
3336 2928116296
3337 2928132517
3338 2929162785
3339 2929527373
3340 2932411008
3341 2932419425
3342 2932426490
3343 2945911298
3344 2945947310
3345 2945977669
3346 2945986414
3347 2954772650
3348 2974322656
3349 2990711802
3350 8002394724
3351 8047674105
3352 8055227047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21016

RlmN_N

Ribosomal RNA large subunit methyltransferase N-terminal domain

36

95

0.98

PF04055

Radical_SAM

Radical SAM superfamily

138

314

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9549 5 337
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9544 5 338
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9493 5 337
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9488 5 338
5hr7-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn from escherichia coli with cross-linked in vitro transcribed trna 0.9357 4 362
ID Description Score Start End Superfamily
3rfaA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9932 5 65 1.10.150.530
3rfaB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9883 5 65 1.10.150.530
4pl1B01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9845 5 65 1.10.150.530
3rf9A01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9812 3 65 1.10.150.530
af_P36979_1_78_1.10.150.530 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9699 2 65 1.10.150.530
ID Description Score Start End GO Terms
AF-A0A4Q3IUE4-F1-model_v4 deleted 0.9863 1 107
AF-A0A418Y6T8-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN (EC 2.1.1.192) 0.9841 1 341 GO:0002935
GO:0005737
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A350QFG5-F1-model_v4 Bifunctional tRNA (Adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN 0.9805 3 94 GO:0008168
GO:0030488
GO:0070475
AF-A0A352S223-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN 0.979 1 171 GO:0008168
GO:0030488
GO:0046872
GO:0051539
GO:0070475
AF-A0A3D1GPL1-F1-model_v4 deleted 0.9775 4 99

Map