F495295

General Info

Members Datasets Scaffolds Average Seq Length
1676 685 3353 433

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0003198|Ga0451576_0003198_18684_20090
Length 468
Sequence LKALDAKKAFKPWPLPEPIPSMLLPQEIIRLKRDGAPLDAAHIQAFVRGLVDGSWSEGQAAALAMAIFFRGMDMPERVALTRAMMTSGDVLDWRTADLGGPVLDKHSTGGVGDKVSLMLAPWVAACGGFVPMISGRGLGHTGGTLDKFDSIPGYQTAPSLDLLRQTVAQVGCAIIGQTADLAPADRRLYGIRDVTATVESVPLITASILSKKLAAGLQGLVMDVKVGNGAFADNLPMAQELAQSLVTVAQGAGLPTRALLTDMNQVLGTTAGNAVEMQEAVDFLTGTQREHRLWEVTRALAADMLLLGGLAATEAEALARLDHALDSGAAAERFERMVHALGGPSNFLANSAQHLPAAPVQLTVTAPQAGWLSAVRTRDVGVAVIELGGGRRKAADPVDHAVGYTHLPAIGQPVQAGDRLATVHARDAASAERAAQALRAAFTWSDTACSAQPVLVQRVQAQAAGASA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
115 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
116 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
117 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
183 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
235 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
236 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
240 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
244 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
245 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
246 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
247 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
251 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
256 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
371 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
372 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
403 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
404 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
405 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
408 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
409 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
410 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
411 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
412 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
415 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
416 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
420 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
421 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
422 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
423 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
424 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
428 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
431 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
436 2506520008 Serratia plymuthica AS12 Isolate Unclassified
437 2508501050 Microvirga lupini Lut6 Isolate Nodule
438 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
439 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
440 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
441 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
442 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
443 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
444 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
445 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
446 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
447 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
448 2547132181 Kosakonia sacchari SP1 Isolate Stem
449 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
450 2561511199 Enterobacter sp. R4-368 Isolate Nodule
451 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
452 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
453 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
454 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
455 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
456 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
457 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
458 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
459 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
460 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
461 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
462 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
463 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
464 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
465 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
466 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
467 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
468 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
469 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
470 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
471 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
472 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
473 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
474 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
475 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
476 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
477 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
478 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
479 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
480 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
481 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
482 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
483 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
484 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
485 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
486 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
487 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
488 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
489 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
490 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
491 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
492 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
493 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
494 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
495 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
496 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
497 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
498 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
499 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
500 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
501 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
502 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
503 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
504 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
505 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
506 2636415599 Klebsiella variicola DX120E Isolate Unclassified
507 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
508 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
509 2643221556 Massilia sp. Root1485 Isolate Unclassified
510 2643221580 Devosia sp. Root635 Isolate Unclassified
511 2643221585 Pelomonas sp. Root662 Isolate Unclassified
512 2643221591 Devosia sp. Root685 Isolate Unclassified
513 2643221629 Devosia sp. Root105 Isolate Unclassified
514 2643221638 Duganella sp. Root336D2 Isolate Unclassified
515 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
516 2643221645 Massilia sp. Root351 Isolate Unclassified
517 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
518 2643221656 Pelomonas sp. Root405 Isolate Unclassified
519 2643221662 Devosia sp. Root413D1 Isolate Unclassified
520 2643221664 Massilia sp. Root418 Isolate Unclassified
521 2643221674 Devosia sp. Root436 Isolate Unclassified
522 2643221684 Massilia sp. Root133 Isolate Unclassified
523 2643221733 Bosea sp. Root381 Isolate Unclassified
524 2643221736 Bosea sp. Root483D1 Isolate Unclassified
525 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
526 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
527 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
528 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
529 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
530 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
531 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
532 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
533 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
534 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
535 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
536 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
537 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
538 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
539 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
540 2738541280 Massilia sp. GV090 Isolate Unclassified
541 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
542 2738541297 Duganella sp. GV083 Isolate Unclassified
543 2738541300 Massilia sp. GV016 Isolate Unclassified
544 2738541337 Pelomonas sp. BT06 Isolate Unclassified
545 2738541357 Duganella sp. GV053 Isolate Unclassified
546 2738543003 Duganella sp. GV066 Isolate Unclassified
547 2738543018 Massilia sp. GV045 Isolate Unclassified
548 2738543026 Duganella sp. GV089 Isolate Unclassified
549 2738543029 Duganella sp. GV039 Isolate Unclassified
550 2738543030 Massilia sp. GV097 Isolate Unclassified
551 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
552 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
553 2751185917 Enterobacter sp. HK169 Isolate Unclassified
554 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
555 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
556 2773857925 Microvirga vignae BR3299 Isolate Unclassified
557 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
558 2775507074 Klebsiella sp. D5A Isolate Unclassified
559 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
560 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
561 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
562 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
563 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
564 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
565 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
566 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
567 2821118458 Enterobacter asburiae 609 Isolate Unclassified
568 2821131069 Duganella sp. 1224 Isolate Unclassified
569 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
570 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
571 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
572 2831864461 Roseateles noduli HZ7 Isolate Nodule
573 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
574 2841760612 Bosea sp. Tri-49 Isolate Nodule
575 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
576 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
577 2842711865 Duganella sp. R-73148 Isolate Unclassified
578 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
579 2844104063 Bosea sp. Tri-39 Isolate Nodule
580 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
581 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
582 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
583 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
584 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
585 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
586 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
587 2847085930 Erwinia persicina B64 Isolate Bulb
588 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
589 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
590 2851182111 Bosea sp. Tri-44 Isolate Nodule
591 2851246043 Bosea sp. Tri-54 Isolate Nodule
592 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
593 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
594 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
595 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
596 2857553236 Duganella sp. R-74557 Isolate Unclassified
597 2857558681 Duganella sp. R-74565 Isolate Unclassified
598 2857564685 Duganella sp. R-74599 Isolate Unclassified
599 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
600 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
601 2865014394 Pantoea sp. R-71966 Isolate Unclassified
602 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
603 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
604 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
605 2876601092 Pantoea endophytica 596 Isolate Unclassified
606 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
607 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
608 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
609 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
610 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
611 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
612 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
613 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
614 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
615 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
616 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
617 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
618 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
619 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
620 2902330777 Methylobacterium sp. 2A Isolate Unclassified
621 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
622 2904424332 Duganella sp. 1411 Isolate Rhizosphere
623 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
624 2904504865 Serratia marcescens 1822 Isolate Unclassified
625 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
626 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
627 2909042592 Labrys sp. LIt4 Isolate Nodule
628 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
629 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
630 2919150387 Rahnella aceris 1817 Isolate Unclassified
631 2919476304 Duganella sp. 3397 Isolate Unclassified
632 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
633 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
634 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
635 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
636 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
637 2927143783 Rahnella sp. 2050 Isolate Unclassified
638 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
639 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
640 2932401849 Devosia sp. 2618 Isolate Rhizosphere
641 2932406140 Serratia sp. 2723 Isolate Rhizosphere
642 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
643 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
644 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
645 2937539931 Pantoea sp. LS15 Isolate Unclassified
646 2937967321 Serratia sp. YC16 Isolate Unclassified
647 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
648 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
649 2939577877 Serratia sp. 509 Isolate Rhizosphere
650 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
651 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
652 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
653 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
654 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
655 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
656 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
657 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
658 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
659 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
660 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
661 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
662 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
663 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
664 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
665 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
666 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
667 640753048 Serratia proteamaculans 568 Isolate Endosphere
668 8004592986 Serratia sp. S119 Isolate Unclassified
669 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
670 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
671 8018221730 Enterobacter sp. CM29 Isolate Unclassified
672 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
673 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
674 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
675 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
676 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
677 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
678 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
679 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
680 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
681 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
682 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
683 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
684 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
685 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.96
Metatranscriptomes 0
Isolates 15.04

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0.06
Endosphere 10.44
Nodule 2.33
Rhizoplane 5.01
Rhizosphere 64.8
Stem 0.06
Stem Tuber 0.42
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0003198 3300045051 Bacteria 22848
2 JGI24739J22299_10000002 3300001989 Bacteria 83810
3 JGI25162J39368_1000006 3300002737 Bacteria 405267
4 JGI25154J39366_1001582 3300002738 Bacteria 7782
5 JGI25163J39215_1000001 3300002771 Bacteria 314282
6 JGI25164J39214_1000001 3300002772 Bacteria 477015
7 JGI25152J39213_1000151 3300002773 Bacteria 47538
8 JGI25152J39213_1000281 3300002773 Bacteria 34001
9 JGI25150J39212_1000795 3300002774 Bacteria 10748
10 JGI25150J39212_1001464 3300002774 Bacteria 6574
11 JGI25159J45721_1015369 3300002987 Bacteria 1679
12 JGI25151J46595_10000166 3300003187 Bacteria 85475
13 JGI25151J46595_10002653 3300003187 Bacteria 10514
14 JGI25151J46595_10031052 3300003187 Bacteria 2091
15 JGI25153J46596_10002171 3300003215 Bacteria 11457
16 rootH2_10020955 3300003320 Bacteria 23433
17 rootH2_10048183 3300003320 Bacteria 3312
18 rootL2_10003345 3300003322 Bacteria 38796
19 rootH1_10000605 3300003316 Bacteria 10873
20 rootH1_10000605 3300003323 Bacteria 6862
21 rootH1_10037021 3300003323 Bacteria 4939
22 JGI25160J50197_1011043 3300003354 Bacteria 3228
23 JGI25161J50226_1002707 3300003374 Bacteria 4392
24 JGI25161J50226_1003994 3300003374 Bacteria 3199
25 Ga0055538_1000004 3300003751 Bacteria 615646
26 Ga0055539_1000004 3300003752 Bacteria 615646
27 Ga0055533_1000007 3300003756 Bacteria 615646
28 Ga0055532_1000389 3300003758 Bacteria 22062
29 Ga0055532_1001254 3300003758 Bacteria 7448
30 Ga0055532_1001590 3300003758 Bacteria 6023
31 Ga0055525_1000007 3300003759 Bacteria 615646
32 Ga0055527_1000097 3300003760 Bacteria 66515
33 Ga0055527_1000355 3300003760 Bacteria 22062
34 Ga0055535_1000184 3300003761 Bacteria 66515
35 Ga0055535_1000835 3300003761 Bacteria 22062
36 Ga0055542_1000833 3300003762 Bacteria 22062
37 Ga0055542_1002714 3300003762 Bacteria 5419
38 Ga0055529_1000190 3300003763 Bacteria 84003
39 Ga0055529_1000501 3300003763 Bacteria 35479
40 Ga0055526_1000035 3300003771 Bacteria 135873
41 Ga0055526_1000047 3300003771 Bacteria 120080
42 Ga0055526_1000224 3300003771 Bacteria 48194
43 Ga0055526_1005554 3300003771 Bacteria 7200
44 Ga0055526_1011175 3300003771 Bacteria 4080
45 Ga0055537_1000052 3300003773 Bacteria 82841
46 Ga0055524_1001129 3300003775 Bacteria 16068
47 Ga0055524_1001525 3300003775 Bacteria 13101
48 Ga0055524_1009293 3300003775 Bacteria 4015
49 Ga0055534_1000070 3300003784 Bacteria 80000
50 Ga0055534_1005836 3300003784 Bacteria 3219
51 Ga0055528_1000224 3300003790 Bacteria 47488
52 Ga0055530_10004792 3300003791 Bacteria 6790
53 Ga0055530_10007512 3300003791 Bacteria 4571
54 Ga0055531_10003346 3300003794 Bacteria 10256
55 Ga0055531_10005016 3300003794 Bacteria 7847
56 Ga0055531_10010282 3300003794 Bacteria 4672
57 Ga0055531_10012662 3300003794 Bacteria 3950
58 Ga0055541_1000004 3300003841 Bacteria 615646
59 Ga0058692_1000114 3300003856 Bacteria 52616
60 Ga0058692_1000729 3300003856 Bacteria 13323
61 Ga0058692_1001186 3300003856 Bacteria 9991
62 Ga0058692_1003679 3300003856 Bacteria 4686
63 Ga0058692_1004514 3300003856 Bacteria 4114
64 Ga0058692_1011845 3300003856 Bacteria 2091
65 Ga0058692_1013605 3300003856 Bacteria 1887
66 Ga0058692_1015454 3300003856 Bacteria 1719
67 Ga0058692_1016189 3300003856 Bacteria 1663
68 Ga0058692_1018622 3300003856 Bacteria 1498
69 Ga0055543_1000537 3300004625 Bacteria 21341
70 Ga0055543_1002810 3300004625 Bacteria 5503
71 Ga0065165_1000214 3300005262 Bacteria 100283
72 Ga0065165_1000287 3300005262 Bacteria 85987
73 Ga0065165_1000619 3300005262 Bacteria 51595
74 Ga0065165_1001296 3300005262 Bacteria 28110
75 Ga0065165_1001774 3300005262 Bacteria 21341
76 Ga0065714_10071591 3300005288 Bacteria 3541
77 Ga0065704_10000047 3300005289 Bacteria 72432
78 Ga0065704_10000550 3300005289 Bacteria 22784
79 Ga0065704_10002426 3300005289 Bacteria 15326
80 Ga0065704_10082571 3300005289 Bacteria 3579
81 Ga0065704_10113746 3300005289 Bacteria 1906
82 Ga0070658_10085744 3300005327 Bacteria 2590
83 Ga0070658_10196032 3300005327 Bacteria 1703
84 Ga0070676_10073340 3300005328 Bacteria 2059
85 Ga0070676_10115233 3300005328 Bacteria 1679
86 Ga0070683_100174007 3300005329 Bacteria 2044
87 Ga0070690_100092697 3300005330 Bacteria 1992
88 Ga0070660_100026769 3300005339 Bacteria 4297
89 Ga0070660_100166679 3300005339 Bacteria 1777
90 Ga0070661_100000450 3300005344 Bacteria 31406
91 Ga0070661_100013049 3300005344 Bacteria 5826
92 Ga0070661_100067536 3300005344 Bacteria 2627
93 Ga0070661_100082320 3300005344 Bacteria 2377
94 Ga0070668_100010801 3300005347 Bacteria 6792
95 Ga0070668_100016247 3300005347 Bacteria 5567
96 Ga0070668_100136720 3300005347 Bacteria 1972
97 Ga0070669_100164822 3300005353 Bacteria 1724
98 Ga0070674_100026786 3300005356 Bacteria 3770
99 Ga0070659_100052893 3300005366 Bacteria 3195
100 Ga0070659_100070781 3300005366 Bacteria 2771
101 Ga0070667_100005029 3300005367 Bacteria 11066
102 Ga0070708_100014571 3300005445 Bacteria 6476
103 Ga0070706_100000708 3300005467 Bacteria 37511
104 Ga0070706_100268717 3300005467 Bacteria 1592
105 Ga0070707_100004899 3300005468 Bacteria 12547
106 Ga0070707_100010379 3300005468 Bacteria 8673
107 Ga0068853_100005963 3300005539 Bacteria 9628
108 Ga0068853_100031955 3300005539 Bacteria 4456
109 Ga0068853_100038697 3300005539 Bacteria 4063
110 Ga0068853_100049288 3300005539 Bacteria 3619
111 Ga0070696_100016002 3300005546 Bacteria 5044
112 Ga0070696_100065974 3300005546 Bacteria 2538
113 Ga0070665_100000140 3300005548 Bacteria 135833
114 Ga0070665_100025192 3300005548 Bacteria 5994
115 Ga0068855_100030619 3300005563 Bacteria 6434
116 Ga0068855_100101590 3300005563 Bacteria 3310
117 Ga0068855_100113892 3300005563 Bacteria 3102
118 Ga0070664_100241228 3300005564 Bacteria 1622
119 Ga0068857_100001114 3300005577 Bacteria 20896
120 Ga0068854_100004812 3300005578 Bacteria 8521
121 Ga0068856_100006640 3300005614 Bacteria 11334
122 Ga0068856_100084902 3300005614 Bacteria 3145
123 Ga0068856_100093375 3300005614 Bacteria 2994
124 Ga0068852_100001705 3300005616 Bacteria 14977
125 Ga0068852_100004453 3300005616 Bacteria 9902
126 Ga0068852_100009952 3300005616 Bacteria 7075
127 Ga0068859_100197818 3300005617 Bacteria 2094
128 Ga0068864_100048582 3300005618 Bacteria 3648
129 Ga0068851_10000551 3300005834 Bacteria 16320
130 Ga0068863_100244821 3300005841 Bacteria 1731
131 Ga0068860_100248199 3300005843 Bacteria 1733
132 Ga0068862_100028361 3300005844 Bacteria 4714
133 Ga0081538_10014182 3300005981 Bacteria 6260
134 Ga0081540_1016882 3300005983 Bacteria 4545
135 Ga0075365_10004753 3300006038 Bacteria 7241
136 Ga0075365_10030996 3300006038 Bacteria 3429
137 Ga0075365_10048470 3300006038 Bacteria 2796
138 Ga0075365_10151294 3300006038 Bacteria 1614
139 Ga0075364_10006922 3300006051 Bacteria 6696
140 Ga0075364_10015682 3300006051 Bacteria 4703
141 Ga0075367_10017205 3300006178 Bacteria 3963
142 Ga0075367_10018371 3300006178 Bacteria 3857
143 Ga0075367_10080668 3300006178 Bacteria 1968
144 Ga0075367_10098187 3300006178 Bacteria 1787
145 Ga0075369_10011410 3300006186 Bacteria 3496
146 Ga0075366_10044096 3300006195 Bacteria 2643
147 Ga0097621_100246600 3300006237 Bacteria 1563
148 Ga0075370_10005225 3300006353 Bacteria 6423
149 Ga0075370_10044821 3300006353 Bacteria 2501
150 Ga0075370_10061484 3300006353 Bacteria 2139
151 Ga0075428_100020716 3300006844 Bacteria 7280
152 Ga0075428_100112697 3300006844 Bacteria 2963
153 Ga0075430_100000421 3300006846 Bacteria 31581
154 Ga0075430_100001834 3300006846 Bacteria 17384
155 Ga0075431_100001088 3300006847 Bacteria 24327
156 Ga0075431_100004097 3300006847 Bacteria 14230
157 Ga0075434_100125790 3300006871 Bacteria 2580
158 Ga0075429_100000553 3300006880 Bacteria 28584
159 Ga0075429_100064728 3300006880 Bacteria 3184
160 Ga0068865_100170142 3300006881 Bacteria 1669
161 Ga0097620_100197824 3300006931 Bacteria 2094
162 Ga0099823_1002035 3300006944 Bacteria 17811
163 Ga0079104_1000046 3300006946 Bacteria 183396
164 Ga0079104_1000403 3300006946 Bacteria 49953
165 Ga0079104_1000446 3300006946 Bacteria 46720
166 Ga0079104_1000656 3300006946 Bacteria 33068
167 Ga0079104_1001144 3300006946 Bacteria 19309
168 Ga0079104_1001838 3300006946 Bacteria 12992
169 Ga0079104_1008796 3300006946 Bacteria 3479
170 Ga0079104_1009419 3300006946 Bacteria 3310
171 Ga0079104_1011437 3300006946 Bacteria 2853
172 Ga0099826_10000006 3300006948 Bacteria 432260
173 Ga0105251_10000198 3300009011 Bacteria 60848
174 Ga0105251_10000710 3300009011 Bacteria 30647
175 Ga0105251_10000897 3300009011 Bacteria 26672
176 Ga0105251_10001329 3300009011 Bacteria 21340
177 Ga0105251_10001671 3300009011 Bacteria 18708
178 Ga0105251_10002717 3300009011 Bacteria 13563
179 Ga0105251_10003082 3300009011 Bacteria 12386
180 Ga0105251_10003283 3300009011 Bacteria 11856
181 Ga0105251_10007365 3300009011 Bacteria 6797
182 Ga0105251_10011349 3300009011 Bacteria 5093
183 Ga0105251_10028750 3300009011 Bacteria 2806
184 Ga0105251_10049129 3300009011 Bacteria 2021
185 Ga0105251_10074554 3300009011 Bacteria 1576
186 Ga0105244_10000023 3300009036 Bacteria 233110
187 Ga0105244_10000097 3300009036 Bacteria 91426
188 Ga0105244_10000247 3300009036 Bacteria 55392
189 Ga0105244_10000255 3300009036 Bacteria 54462
190 Ga0105244_10001300 3300009036 Bacteria 20444
191 Ga0105244_10001840 3300009036 Bacteria 16580
192 Ga0105244_10002203 3300009036 Bacteria 14887
193 Ga0105244_10002845 3300009036 Bacteria 12840
194 Ga0105244_10002920 3300009036 Bacteria 12625
195 Ga0105244_10004900 3300009036 Bacteria 9072
196 Ga0105244_10013704 3300009036 Bacteria 4721
197 Ga0105244_10019589 3300009036 Bacteria 3773
198 Ga0105244_10034988 3300009036 Bacteria 2641
199 Ga0105250_10000028 3300009092 Bacteria 204198
200 Ga0105250_10000045 3300009092 Bacteria 127333
201 Ga0105250_10000223 3300009092 Bacteria 47350
202 Ga0105250_10000389 3300009092 Bacteria 32748
203 Ga0105250_10004542 3300009092 Bacteria 6369
204 Ga0105250_10057695 3300009092 Bacteria 1558
205 Ga0105240_10002532 3300009093 Bacteria 29322
206 Ga0105240_10109413 3300009093 Bacteria 3346
207 Ga0105240_10135504 3300009093 Bacteria 2949
208 Ga0105240_10142489 3300009093 Bacteria 2864
209 Ga0111539_10000042 3300009094 Bacteria 129513
210 Ga0105245_10212811 3300009098 Bacteria 1861
211 Ga0105247_10002979 3300009101 Bacteria 11235
212 Ga0114129_10056865 3300009147 Bacteria 5476
213 Ga0114129_10068985 3300009147 Bacteria 4928
214 Ga0105243_10002639 3300009148 Bacteria 14899
215 Ga0105241_10000008 3300009174 Bacteria 334281
216 Ga0105241_10071242 3300009174 Bacteria 2698
217 Ga0105242_10022642 3300009176 Bacteria 4945
218 Ga0105237_10226564 3300009545 Bacteria 1869
219 Ga0105238_10029570 3300009551 Bacteria 5581
220 Ga0105238_10052519 3300009551 Bacteria 4097
221 Ga0105238_10243699 3300009551 Bacteria 1775
222 Ga0105249_10092455 3300009553 Bacteria 2832
223 Ga0105249_10205390 3300009553 Bacteria 1930
224 Ga0105249_10247766 3300009553 Bacteria 1765
225 Ga0105239_10006388 3300010375 Bacteria 13693
226 Ga0105246_10020957 3300011119 Bacteria 4198
227 Ga0157319_1000035 3300012497 Bacteria 40594
228 Ga0157373_10003379 3300013100 Bacteria 12074
229 Ga0157373_10017315 3300013100 Bacteria 5246
230 Ga0157373_10021059 3300013100 Bacteria 4734
231 Ga0157373_10042305 3300013100 Bacteria 3256
232 Ga0157371_10000010 3300013102 Bacteria 384921
233 Ga0157371_10000020 3300013102 Bacteria 304987
234 Ga0157371_10000249 3300013102 Bacteria 75638
235 Ga0157371_10000589 3300013102 Bacteria 43110
236 Ga0157371_10001050 3300013102 Bacteria 30276
237 Ga0157371_10021774 3300013102 Bacteria 4703
238 Ga0157370_10000190 3300013104 Bacteria 76683
239 Ga0157370_10002280 3300013104 Bacteria 23274
240 Ga0157370_10022002 3300013104 Bacteria 6348
241 Ga0157370_10127004 3300013104 Bacteria 2380
242 Ga0157369_10000183 3300013105 Bacteria 86986
243 Ga0157369_10012953 3300013105 Bacteria 9449
244 Ga0163162_10042393 3300013306 Bacteria 4555
245 Ga0163162_10054839 3300013306 Bacteria 4010
246 Ga0163162_10185491 3300013306 Bacteria 2207
247 Ga0157372_10000263 3300013307 Bacteria 58072
248 Ga0157372_10016784 3300013307 Bacteria 7859
249 Ga0157372_10042885 3300013307 Bacteria 5007
250 Ga0182008_10000041 3300014497 Bacteria 118254
251 Ga0182008_10000145 3300014497 Bacteria 54865
252 Ga0182008_10009743 3300014497 Bacteria 5171
253 Ga0182006_1000004 3300015261 Bacteria 622190
254 Ga0182006_1000019 3300015261 Bacteria 294192
255 Ga0182006_1000025 3300015261 Bacteria 255969
256 Ga0182006_1013994 3300015261 Bacteria 3464
257 Ga0182006_1023255 3300015261 Bacteria 2568
258 Ga0182006_1026649 3300015261 Bacteria 2364
259 Ga0182007_10000028 3300015262 Bacteria 167122
260 Ga0182007_10013981 3300015262 Bacteria 3041
261 Ga0182005_1000003 3300015265 Bacteria 683269
262 Ga0182005_1000011 3300015265 Bacteria 420605
263 Ga0183366_1003 3300015679 Bacteria 453474
264 Ga0183370_1003 3300015680 Bacteria 454044
265 Ga0183369_1005 3300015685 Bacteria 453680
266 Ga0183368_1006 3300015687 Bacteria 551576
267 Ga0163161_10000002 3300017792 Bacteria 411983
268 Ga0163161_10066460 3300017792 Bacteria 2633
269 Ga0213872_10000075 3300021361 Bacteria 90871
270 Ga0213872_10000200 3300021361 Bacteria 53095
271 Ga0213872_10000333 3300021361 Bacteria 40014
272 Ga0213872_10000951 3300021361 Bacteria 20255
273 Ga0213872_10007305 3300021361 Bacteria 5450
274 Ga0213872_10016608 3300021361 Bacteria 3414
275 Ga0213872_10029949 3300021361 Bacteria 2496
276 Ga0213874_10013632 3300021377 Bacteria 2110
277 Ga0213876_10000132 3300021384 Bacteria 81285
278 Ga0213876_10002133 3300021384 Bacteria 11691
279 Ga0213876_10006362 3300021384 Bacteria 6434
280 Ga0209760_100063 3300025207 Bacteria 92173
281 Ga0209436_100221 3300025208 Bacteria 26236
282 Ga0209784_100001 3300025224 Bacteria 3600592
283 Ga0209566_100001 3300025225 Bacteria 3600765
284 Ga0209674_100002 3300025226 Bacteria 3600592
285 Ga0209672_100075 3300025228 Bacteria 159275
286 Ga0209672_100097 3300025228 Bacteria 110837
287 Ga0209147_100021 3300025229 Bacteria 464719
288 Ga0209147_100106 3300025229 Bacteria 156899
289 Ga0209147_101125 3300025229 Bacteria 11029
290 Ga0209563_100008 3300025230 Bacteria 1554545
291 Ga0209563_100022 3300025230 Bacteria 643318
292 Ga0207427_100002 3300025231 Bacteria 1355321
293 Ga0209437_100046 3300025233 Bacteria 405293
294 Ga0209437_100171 3300025233 Bacteria 140721
295 Ga0209258_100153 3300025242 Bacteria 159275
296 Ga0209258_100157 3300025242 Bacteria 156898
297 Ga0207425_1000013 3300025245 Bacteria 497384
298 Ga0207425_1000141 3300025245 Bacteria 63719
299 Ga0207425_1000349 3300025245 Bacteria 32189
300 Ga0209646_1000256 3300025246 Bacteria 52374
301 Ga0209677_100004 3300025253 Bacteria 1554545
302 Ga0209148_1000150 3300025254 Bacteria 156898
303 Ga0209148_1000554 3300025254 Bacteria 35482
304 Ga0209759_1004966 3300025256 Bacteria 4805
305 Ga0209129_1000008 3300025258 Bacteria 640959
306 Ga0209129_1000106 3300025258 Bacteria 156102
307 Ga0209129_1007469 3300025258 Bacteria 3249
308 Ga0209233_1003996 3300025261 Bacteria 5110
309 Ga0209565_1000035 3300025263 Bacteria 298125
310 Ga0209565_1017236 3300025263 Bacteria 1587
311 Ga0209455_1000033 3300025272 Bacteria 504606
312 Ga0209455_1000132 3300025272 Bacteria 156899
313 Ga0209455_1000676 3300025272 Bacteria 20350
314 Ga0209673_1000006 3300025273 Bacteria 650600
315 Ga0209673_1000782 3300025273 Bacteria 42522
316 Ga0209673_1001809 3300025273 Bacteria 17590
317 Ga0209673_1010521 3300025273 Bacteria 3894
318 Ga0209130_1000045 3300025284 Bacteria 240278
319 Ga0209130_1000086 3300025284 Bacteria 157063
320 Ga0209130_1000422 3300025284 Bacteria 45627
321 Ga0209130_1000803 3300025284 Bacteria 26632
322 Ga0209130_1007832 3300025284 Bacteria 3239
323 Ga0209675_1000005 3300025291 Bacteria 849192
324 Ga0209675_1000762 3300025291 Bacteria 21604
325 Ga0209675_1005290 3300025291 Bacteria 5439
326 Ga0209676_1000197 3300025292 Bacteria 135043
327 Ga0209025_1000053 3300025294 Bacteria 317600
328 Ga0209025_1002554 3300025294 Bacteria 18994
329 Ga0209025_1002612 3300025294 Bacteria 18532
330 Ga0209564_1000003 3300025295 Bacteria 1585848
331 Ga0209564_1000028 3300025295 Bacteria 510986
332 Ga0209564_1000032 3300025295 Bacteria 464041
333 Ga0209564_1000083 3300025295 Bacteria 259272
334 Ga0209564_1000852 3300025295 Bacteria 40733
335 Ga0209564_1006504 3300025295 Bacteria 6283
336 Ga0209758_1000031 3300025297 Bacteria 497252
337 Ga0209758_1001001 3300025297 Bacteria 37597
338 Ga0209758_1002556 3300025297 Bacteria 18318
339 Ga0209050_1000078 3300025298 Bacteria 278409
340 Ga0209050_1000226 3300025298 Bacteria 124227
341 Ga0209050_1001494 3300025298 Bacteria 24797
342 Ga0209050_1003886 3300025298 Bacteria 10607
343 Ga0209050_1010303 3300025298 Bacteria 4623
344 Ga0209256_1000322 3300025299 Bacteria 82681
345 Ga0209256_1000333 3300025299 Bacteria 78935
346 Ga0209256_1000398 3300025299 Bacteria 68796
347 Ga0209256_1001193 3300025299 Bacteria 29103
348 Ga0209256_1002559 3300025299 Bacteria 14528
349 Ga0209256_1006472 3300025299 Bacteria 6177
350 Ga0207426_1000198 3300025302 Bacteria 146241
351 Ga0207426_1006840 3300025302 Bacteria 4875
352 Ga0207426_1010121 3300025302 Bacteria 3683
353 Ga0209051_1001335 3300025303 Bacteria 21466
354 Ga0209051_1007045 3300025303 Bacteria 6221
355 Ga0209257_1000017 3300025304 Bacteria 866287
356 Ga0209257_1000097 3300025304 Bacteria 259243
357 Ga0209257_1000799 3300025304 Bacteria 45956
358 Ga0209257_1005062 3300025304 Bacteria 9572
359 Ga0209257_1016358 3300025304 Bacteria 3005
360 Ga0207696_1000009 3300025711 Bacteria 564405
361 Ga0207696_1000027 3300025711 Bacteria 412783
362 Ga0207696_1000048 3300025711 Bacteria 284649
363 Ga0207696_1000093 3300025711 Bacteria 184278
364 Ga0207696_1000140 3300025711 Bacteria 127393
365 Ga0207696_1000142 3300025711 Bacteria 123519
366 Ga0207696_1000578 3300025711 Bacteria 28590
367 Ga0207696_1002998 3300025711 Bacteria 7884
368 Ga0207696_1007481 3300025711 Bacteria 4268
369 Ga0207696_1008359 3300025711 Bacteria 3969
370 Ga0207655_1000017 3300025728 Bacteria 544403
371 Ga0207655_1000026 3300025728 Bacteria 445528
372 Ga0207655_1000047 3300025728 Bacteria 302548
373 Ga0207655_1000054 3300025728 Bacteria 281894
374 Ga0207655_1000056 3300025728 Bacteria 279166
375 Ga0207655_1000101 3300025728 Bacteria 185883
376 Ga0207655_1000146 3300025728 Bacteria 132221
377 Ga0207655_1000629 3300025728 Bacteria 42354
378 Ga0207655_1001740 3300025728 Bacteria 19089
379 Ga0207655_1003438 3300025728 Bacteria 11786
380 Ga0207655_1003656 3300025728 Bacteria 11350
381 Ga0207655_1007852 3300025728 Bacteria 6863
382 Ga0207655_1013493 3300025728 Bacteria 4688
383 Ga0207655_1016412 3300025728 Bacteria 4050
384 Ga0207655_1043062 3300025728 Bacteria 1915
385 Ga0207713_1000028 3300025735 Bacteria 309074
386 Ga0207713_1000034 3300025735 Bacteria 266214
387 Ga0207713_1000046 3300025735 Bacteria 232796
388 Ga0207713_1000055 3300025735 Bacteria 221387
389 Ga0207713_1000110 3300025735 Bacteria 135907
390 Ga0207713_1000419 3300025735 Bacteria 45136
391 Ga0207713_1002658 3300025735 Bacteria 12826
392 Ga0207713_1002840 3300025735 Bacteria 12185
393 Ga0207713_1005077 3300025735 Bacteria 8357
394 Ga0207713_1006201 3300025735 Bacteria 7330
395 Ga0207713_1031157 3300025735 Bacteria 2362
396 Ga0207710_10000015 3300025900 Bacteria 393018
397 Ga0207645_10057695 3300025907 Bacteria 2479
398 Ga0207705_10008492 3300025909 Bacteria 7494
399 Ga0207684_10003312 3300025910 Bacteria 15814
400 Ga0207684_10192217 3300025910 Bacteria 1761
401 Ga0207654_10000009 3300025911 Bacteria 334291
402 Ga0207695_10001423 3300025913 Bacteria 40252
403 Ga0207695_10033423 3300025913 Bacteria 5608
404 Ga0207695_10040895 3300025913 Bacteria 4965
405 Ga0207695_10100423 3300025913 Bacteria 2889
406 Ga0207671_10137547 3300025914 Bacteria 1879
407 Ga0207657_10060722 3300025919 Bacteria 3243
408 Ga0207649_10001235 3300025920 Bacteria 15298
409 Ga0207649_10007427 3300025920 Bacteria 5960
410 Ga0207646_10008292 3300025922 Bacteria 10431
411 Ga0207646_10018226 3300025922 Bacteria 6552
412 Ga0207706_10012194 3300025933 Bacteria 7833
413 Ga0207709_10002430 3300025935 Bacteria 11708
414 Ga0207709_10084054 3300025935 Bacteria 2060
415 Ga0207669_10086048 3300025937 Bacteria 2031
416 Ga0207689_10049505 3300025942 Bacteria 3466
417 Ga0207667_10025070 3300025949 Bacteria 6537
418 Ga0207667_10161188 3300025949 Bacteria 2307
419 Ga0207668_10018955 3300025972 Bacteria 4338
420 Ga0207640_10190206 3300025981 Bacteria 1547
421 Ga0207658_10000576 3300025986 Bacteria 33039
422 Ga0207639_10056705 3300026041 Bacteria 3003
423 Ga0207639_10107593 3300026041 Bacteria 2265
424 Ga0207702_10004783 3300026078 Bacteria 11934
425 Ga0207702_10020446 3300026078 Bacteria 5483
426 Ga0207641_10227870 3300026088 Bacteria 1731
427 Ga0207674_10002994 3300026116 Bacteria 20952
428 Ga0207674_10107832 3300026116 Bacteria 2762
429 Ga0207675_100018961 3300026118 Bacteria 6423
430 Ga0207698_10022122 3300026142 Bacteria 4411
431 Ga0207698_10045455 3300026142 Bacteria 3308
432 Ga0209281_1000022 3300027111 Bacteria 522913
433 Ga0209281_1000054 3300027111 Bacteria 309505
434 Ga0209281_1000060 3300027111 Bacteria 295683
435 Ga0209281_1000120 3300027111 Bacteria 206692
436 Ga0209281_1000145 3300027111 Bacteria 170793
437 Ga0209281_1000223 3300027111 Bacteria 121161
438 Ga0209281_1000384 3300027111 Bacteria 70059
439 Ga0209281_1000489 3300027111 Bacteria 54514
440 Ga0209281_1001188 3300027111 Bacteria 17854
441 Ga0209281_1001296 3300027111 Bacteria 16009
442 Ga0209281_1007282 3300027111 Bacteria 2787
443 Ga0209281_1008583 3300027111 Bacteria 2466
444 Ga0209389_1045994 3300027296 Bacteria 3186
445 Ga0209371_1000014 3300027312 Bacteria 661118
446 Ga0209371_1000030 3300027312 Bacteria 423605
447 Ga0209371_1000049 3300027312 Bacteria 279132
448 Ga0209371_1000054 3300027312 Bacteria 259676
449 Ga0209371_1000062 3300027312 Bacteria 219057
450 Ga0209371_1000184 3300027312 Bacteria 90920
451 Ga0209371_1000246 3300027312 Bacteria 67449
452 Ga0209371_1000438 3300027312 Bacteria 42301
453 Ga0209371_1000535 3300027312 Bacteria 36069
454 Ga0209371_1001222 3300027312 Bacteria 18480
455 Ga0209371_1001361 3300027312 Bacteria 16912
456 Ga0209371_1001547 3300027312 Bacteria 15186
457 Ga0209371_1001896 3300027312 Bacteria 12820
458 Ga0209371_1002425 3300027312 Bacteria 10459
459 Ga0209371_1003163 3300027312 Bacteria 8335
460 Ga0209371_1006833 3300027312 Bacteria 4127
461 Ga0209282_1000003 3300027666 Bacteria 856377
462 Ga0207428_10000092 3300027907 Bacteria 123897
463 Ga0268266_10000143 3300028379 Bacteria 135829
464 Ga0268266_10115517 3300028379 Bacteria 2383
465 Ga0268265_10017393 3300028380 Bacteria 4960
466 Ga0265318_10005442 3300028577 Bacteria 5980
467 Ga0307517_10000922 3300028786 Bacteria 49832
468 Ga0307515_10000494 3300028794 Bacteria 94354
469 Ga0307515_10003110 3300028794 Bacteria 35101
470 Ga0307515_10006825 3300028794 Bacteria 22711
471 Ga0307515_10020687 3300028794 Bacteria 11721
472 Ga0307515_10036249 3300028794 Bacteria 7986
473 Ga0307515_10074907 3300028794 Bacteria 4519
474 Ga0307515_10109134 3300028794 Bacteria 3253
475 Ga0307515_10128856 3300028794 Bacteria 2803
476 Ga0307515_10220502 3300028794 Bacteria 1716
477 Ga0265324_10038636 3300029957 Bacteria 1655
478 Ga0268256_1000012 3300030500 Bacteria 794553
479 Ga0268256_1000021 3300030500 Bacteria 542735
480 Ga0268256_1000025 3300030500 Bacteria 484317
481 Ga0268256_1000031 3300030500 Bacteria 425730
482 Ga0268256_1000062 3300030500 Bacteria 215802
483 Ga0268256_1000154 3300030500 Bacteria 91615
484 Ga0268256_1000225 3300030500 Bacteria 61749
485 Ga0268256_1000416 3300030500 Bacteria 38477
486 Ga0268256_1000883 3300030500 Bacteria 20764
487 Ga0268256_1001169 3300030500 Bacteria 16912
488 Ga0268256_1001324 3300030500 Bacteria 15186
489 Ga0268256_1002154 3300030500 Bacteria 10462
490 Ga0268256_1002848 3300030500 Bacteria 8335
491 Ga0268256_1003805 3300030500 Bacteria 6601
492 Ga0268256_1006948 3300030500 Bacteria 4127
493 Ga0268256_1009716 3300030500 Bacteria 3162
494 Ga0307512_10011174 3300030522 Bacteria 8522
495 Ga0307512_10116514 3300030522 Bacteria 1736
496 Ga0316181_1110574 3300030744 Bacteria 3898
497 Ga0265330_10028710 3300031235 Bacteria 2505
498 Ga0265332_10000037 3300031238 Bacteria 134250
499 Ga0265320_10045057 3300031240 Bacteria 2169
500 Ga0265325_10001150 3300031241 Bacteria 19009
501 Ga0265325_10001470 3300031241 Bacteria 16580
502 Ga0265325_10044674 3300031241 Bacteria 2307
503 Ga0265340_10000430 3300031247 Bacteria 22538
504 Ga0265340_10002126 3300031247 Bacteria 11354
505 Ga0265339_10000398 3300031249 Bacteria 34347
506 Ga0265339_10003572 3300031249 Bacteria 10870
507 Ga0265331_10047198 3300031250 Bacteria 2073
508 Ga0265331_10058635 3300031250 Bacteria 1822
509 Ga0265316_10003635 3300031344 Bacteria 15540
510 Ga0265316_10079131 3300031344 Bacteria 2522
511 Ga0307513_10028052 3300031456 Bacteria 6447
512 Ga0307513_10045530 3300031456 Bacteria 4795
513 Ga0307513_10050737 3300031456 Bacteria 4482
514 Ga0307513_10058328 3300031456 Bacteria 4105
515 Ga0307509_10003895 3300031507 Bacteria 22089
516 Ga0307509_10012929 3300031507 Bacteria 9921
517 Ga0307408_100000086 3300031548 Bacteria 101944
518 Ga0307408_100000596 3300031548 Bacteria 31031
519 Ga0307408_100148946 3300031548 Bacteria 1845
520 Ga0265313_10000668 3300031595 Bacteria 35331
521 Ga0265313_10001592 3300031595 Bacteria 21059
522 Ga0265313_10002199 3300031595 Bacteria 17245
523 Ga0265313_10002786 3300031595 Bacteria 14745
524 Ga0265313_10024418 3300031595 Bacteria 3229
525 Ga0307508_10000113 3300031616 Bacteria 95378
526 Ga0307508_10002073 3300031616 Bacteria 21646
527 Ga0307508_10008713 3300031616 Bacteria 9361
528 Ga0307508_10085665 3300031616 Bacteria 2734
529 Ga0307508_10091783 3300031616 Bacteria 2625
530 Ga0307508_10101916 3300031616 Bacteria 2467
531 Ga0265314_10008772 3300031711 Bacteria 8644
532 Ga0265314_10021296 3300031711 Bacteria 4989
533 Ga0265314_10037449 3300031711 Bacteria 3515
534 Ga0265314_10043672 3300031711 Bacteria 3185
535 Ga0265314_10059326 3300031711 Bacteria 2618
536 Ga0265314_10090552 3300031711 Bacteria 1992
537 Ga0265342_10087211 3300031712 Bacteria 1793
538 Ga0307516_10006620 3300031730 Bacteria 13542
539 Ga0307516_10009989 3300031730 Bacteria 10508
540 Ga0307516_10026471 3300031730 Bacteria 5888
541 Ga0307516_10119749 3300031730 Bacteria 2425
542 Ga0307413_10015865 3300031824 Bacteria 3873
543 Ga0307518_10100499 3300031838 Bacteria 2071
544 Ga0307412_10149443 3300031911 Bacteria 1722
545 Ga0307414_10012798 3300032004 Bacteria 4977
546 Ga0307414_10018634 3300032004 Bacteria 4280
547 Ga0307414_10091515 3300032004 Bacteria 2261
548 Ga0307411_10001320 3300032005 Bacteria 9982
549 Ga0307510_10105783 3300033180 Bacteria 2580
550 Ga0373951_0016520 3300035091 Bacteria 1665
551 Ga0373939_0000017 3300035114 Bacteria 61924
552 Ga0373960_0000109 3300035121 Bacteria 13152
553 Ga0373942_0004863 3300035207 Bacteria 3116
554 Ga0373962_0023490 3300035242 Bacteria 1643
555 Ga0373931_0000641 3300035691 Bacteria 14534
556 Ga0373927_0096672 3300035695 Bacteria 1920
557 Ga0395899_0002939 3300037312 Bacteria 13660
558 Ga0395900_0000328 3300037418 Bacteria 70344
559 Ga0395900_0001093 3300037418 Bacteria 34498
560 Ga0395900_0019162 3300037418 Bacteria 6978
561 Ga0395900_0024296 3300037418 Bacteria 6205
562 Ga0395898_0010844 3300037466 Bacteria 9519
563 Ga0395898_0139909 3300037466 Bacteria 2317
564 Ga0395905_0000733 3300037471 Bacteria 43190
565 Ga0395905_0101736 3300037471 Bacteria 2697
566 Ga0395905_0217999 3300037471 Bacteria 1786
567 Ga0395905_0243411 3300037471 Bacteria 1680
568 Ga0395905_0338234 3300037471 Bacteria 1396
569 Ga0395905_0423428 3300037471 Bacteria 1228
570 Ga0436364_0309744 3300037853 Bacteria 3253
571 Ga0395901_0000845 3300038443 Bacteria 33703
572 Ga0395901_0004026 3300038443 Bacteria 14802
573 Ga0395901_0219357 3300038443 Bacteria 1988
574 Ga0436365_0009436 3300039437 Bacteria 2634
575 Ga0436365_0019788 3300039437 Bacteria 14929
576 Ga0436365_0084998 3300039437 Bacteria 507888
577 Ga0436365_0172682 3300039437 Bacteria 7920
578 Ga0436361_0021035 3300039447 Bacteria 49397
579 Ga0436361_0039233 3300039447 Bacteria 5063
580 Ga0436361_0273059 3300039447 Bacteria 5929
581 Ga0436361_0595288 3300039447 Bacteria 2738
582 Ga0436361_0784288 3300039447 Bacteria 7589
583 Ga0436361_0891393 3300039447 Bacteria 99242
584 Ga0436361_0909611 3300039447 Bacteria 23210
585 Ga0436361_1052705 3300039447 Bacteria 2721
586 Ga0436361_1223937 3300039447 Bacteria 32602
587 Ga0436363_1324421 3300039450 Bacteria 12597
588 Ga0436362_0790008 3300039453 Bacteria 8589
589 Ga0436362_1190416 3300039453 Bacteria 6432
590 Ga0439438_000003 3300041405 Bacteria 464587
591 Ga0439438_007960 3300041405 Bacteria 3570
592 Ga0439438_011494 3300041405 Bacteria 2753
593 Ga0439438_015183 3300041405 Bacteria 2273
594 Ga0439447_004372 3300041407 Bacteria 4874
595 Ga0439447_005845 3300041407 Bacteria 4049
596 Ga0439466_0000004 3300041411 Bacteria 462654
597 Ga0451793_0482489 3300041452 Bacteria 2930
598 Ga0451853_4050226 3300041512 Bacteria 2960
599 Ga0439431_0017112 3300041997 Bacteria 1702
600 Ga0439433_0014592 3300041999 Bacteria 1731
601 Ga0439432_006041 3300042006 Bacteria 4345
602 Ga0439432_020914 3300042006 Bacteria 2172
603 Ga0439452_000005 3300042010 Bacteria 646919
604 Ga0439452_000007 3300042010 Bacteria 613625
605 Ga0439452_000009 3300042010 Bacteria 569493
606 Ga0439452_000041 3300042010 Bacteria 142405
607 Ga0439452_000306 3300042010 Bacteria 31584
608 Ga0439452_005523 3300042010 Bacteria 4060
609 Ga0450917_000087 3300042120 Bacteria 5456
610 Ga0450890_000295 3300042127 Bacteria 7255
611 Ga0450904_000781 3300042139 Bacteria 5460
612 Ga0450889_000476 3300042144 Bacteria 4449
613 Ga0450907_000014 3300042146 Bacteria 87405
614 Ga0439434_0044407 3300042435 Bacteria 1369
615 Ga0439459_0005386 3300042438 Bacteria 2101
616 Ga0439464_0003359 3300042439 Bacteria 4029
617 Ga0439464_0012263 3300042439 Bacteria 2280
618 Ga0450893_0001682 3300042532 Bacteria 3400
619 Ga0451577_0001953 3300042876 Bacteria 25998
620 Ga0451577_0007501 3300042876 Bacteria 10712
621 Ga0451577_0104665 3300042876 Bacteria 2529
622 Ga0466969_0052151 3300044656 Bacteria 2010
623 Ga0466972_0018575 3300044658 Bacteria 3477
624 Ga0466972_0038110 3300044658 Bacteria 2349
625 Ga0466981_0000014 3300044669 Bacteria 109658
626 Ga0466982_0121487 3300044672 Bacteria 1611
627 Ga0453683_0008603 3300044673 Bacteria 6844
628 Ga0466965_0010968 3300044683 Bacteria 4238
629 Ga0466966_0038292 3300044684 Bacteria 3090
630 Ga0466966_0077569 3300044684 Bacteria 2073
631 Ga0466961_0029395 3300044693 Bacteria 3533
632 Ga0466964_0005156 3300044706 Bacteria 4841
633 Ga0466964_0031249 3300044706 Bacteria 2110
634 Ga0453684_0000122 3300044712 Bacteria 340529
635 Ga0453684_0001547 3300044712 Bacteria 64267
636 Ga0453684_0155848 3300044712 Bacteria 2708
637 Ga0453684_0365111 3300044712 Bacteria 1624
638 Ga0466968_0015048 3300044735 Bacteria 3064
639 Ga0466968_0023481 3300044735 Bacteria 2513
640 Ga0466968_0035648 3300044735 Bacteria 2083
641 Ga0466957_0005984 3300044842 Bacteria 6864
642 Ga0466960_0155650 3300044901 Bacteria 1224
643 Ga0451576_0000757 3300045051 Bacteria 64267
644 Ga0451576_0006570 3300045051 Bacteria 14226
645 Ga0451576_0011216 3300045051 Bacteria 10210
646 Ga0451576_0037016 3300045051 Bacteria 5170
647 Ga0451576_0055149 3300045051 Bacteria 4159
648 Ga0451576_0301504 3300045051 Bacteria 1676
649 Ga0466958_0000243 3300045836 Bacteria 20957
650 Ga0466967_0057075 3300045976 Bacteria 3445
651 Ga0466967_0178150 3300045976 Bacteria 2003
652 Ga0495617_000014 3300046452 Bacteria 286979
653 Ga0495617_000023 3300046452 Bacteria 183865
654 Ga0495617_000876 3300046452 Bacteria 14182
655 Ga0495617_001491 3300046452 Bacteria 10229
656 Ga0495617_003235 3300046452 Bacteria 6184
657 Ga0495627_000016 3300046453 Bacteria 318947
658 Ga0495627_000042 3300046453 Bacteria 189845
659 Ga0495627_000061 3300046453 Bacteria 139366
660 Ga0495627_004730 3300046453 Bacteria 5626
661 Ga0495627_033102 3300046453 Bacteria 1622
662 Ga0495603_0080055 3300046455 Bacteria 1914
663 Ga0495590_0000019 3300046457 Bacteria 213272
664 Ga0495590_0000043 3300046457 Bacteria 120012
665 Ga0495590_0000682 3300046457 Bacteria 15629
666 Ga0495590_0010889 3300046457 Bacteria 3408
667 Ga0495591_000004 3300046458 Bacteria 410200
668 Ga0495591_000141 3300046458 Bacteria 76864
669 Ga0495591_000187 3300046458 Bacteria 64594
670 Ga0495591_000659 3300046458 Bacteria 25513
671 Ga0495591_013242 3300046458 Bacteria 3029
672 Ga0495629_0146645 3300046459 Bacteria 1641
673 Ga0495638_0000115 3300046460 Bacteria 129129
674 Ga0495638_0000736 3300046460 Bacteria 35217
675 Ga0495638_0007861 3300046460 Bacteria 7608
676 Ga0495638_0065009 3300046460 Bacteria 2246
677 Ga0495641_0014310 3300046461 Bacteria 4300
678 Ga0495653_0000014 3300046463 Bacteria 215253
679 Ga0495653_0035201 3300046463 Bacteria 3953
680 Ga0495653_0037561 3300046463 Bacteria 3804
681 Ga0495650_0000004 3300046471 Bacteria 779487
682 Ga0495650_0000028 3300046471 Bacteria 473012
683 Ga0495650_0000113 3300046471 Bacteria 196536
684 Ga0495650_0000142 3300046471 Bacteria 168326
685 Ga0495650_0000178 3300046471 Bacteria 138967
686 Ga0495650_0000181 3300046471 Bacteria 137791
687 Ga0495650_0000193 3300046471 Bacteria 131834
688 Ga0495650_0000336 3300046471 Bacteria 83752
689 Ga0495650_0000824 3300046471 Bacteria 37485
690 Ga0495650_0000921 3300046471 Bacteria 34549
691 Ga0495650_0009582 3300046471 Bacteria 5494
692 Ga0495650_0010854 3300046471 Bacteria 5048
693 Ga0495650_0025252 3300046471 Bacteria 2789
694 Ga0495580_0026298 3300046472 Bacteria 4244
695 Ga0495605_0000010 3300046474 Bacteria 319487
696 Ga0495605_0000258 3300046474 Bacteria 62052
697 Ga0495605_0006518 3300046474 Bacteria 6704
698 Ga0495605_0019832 3300046474 Bacteria 3583
699 Ga0495605_0020581 3300046474 Bacteria 3505
700 Ga0495605_0022339 3300046474 Bacteria 3342
701 Ga0495605_0047205 3300046474 Bacteria 2112
702 Ga0495639_0014414 3300046475 Bacteria 3422
703 Ga0495584_0000065 3300046491 Bacteria 75724
704 Ga0495584_0000138 3300046491 Bacteria 50345
705 Ga0495584_0000163 3300046491 Bacteria 46893
706 Ga0495584_0000922 3300046491 Bacteria 18715
707 Ga0495584_0001769 3300046491 Bacteria 12574
708 Ga0495584_0001801 3300046491 Bacteria 12467
709 Ga0495584_0009868 3300046491 Bacteria 4910
710 Ga0495584_0011083 3300046491 Bacteria 4623
711 Ga0495584_0020493 3300046491 Bacteria 3358
712 Ga0495584_0032880 3300046491 Bacteria 2624
713 Ga0495585_0000125 3300046492 Bacteria 83087
714 Ga0495585_0000160 3300046492 Bacteria 72066
715 Ga0495585_0000289 3300046492 Bacteria 50499
716 Ga0495585_0000304 3300046492 Bacteria 49074
717 Ga0495585_0000875 3300046492 Bacteria 25638
718 Ga0495585_0001072 3300046492 Bacteria 22580
719 Ga0495585_0004953 3300046492 Bacteria 8514
720 Ga0495585_0005994 3300046492 Bacteria 7604
721 Ga0495585_0011575 3300046492 Bacteria 5216
722 Ga0495585_0013702 3300046492 Bacteria 4739
723 Ga0495585_0016715 3300046492 Bacteria 4250
724 Ga0495585_0042944 3300046492 Bacteria 2530
725 Ga0495585_0052010 3300046492 Bacteria 2268
726 Ga0495594_0008632 3300046499 Bacteria 5249
727 Ga0495594_0008889 3300046499 Bacteria 5180
728 Ga0495594_0024866 3300046499 Bacteria 3218
729 Ga0495596_0000325 3300046500 Bacteria 31112
730 Ga0495596_0001727 3300046500 Bacteria 12266
731 Ga0495596_0002068 3300046500 Bacteria 11025
732 Ga0495596_0002935 3300046500 Bacteria 8846
733 Ga0495596_0004148 3300046500 Bacteria 7121
734 Ga0495596_0005642 3300046500 Bacteria 5880
735 Ga0495596_0010888 3300046500 Bacteria 3943
736 Ga0495596_0012256 3300046500 Bacteria 3676
737 Ga0495596_0014807 3300046500 Bacteria 3281
738 Ga0495596_0040231 3300046500 Bacteria 1845
739 Ga0495596_0051802 3300046500 Bacteria 1607
740 Ga0495607_0000076 3300046501 Bacteria 99256
741 Ga0495607_0000626 3300046501 Bacteria 34296
742 Ga0495607_0000966 3300046501 Bacteria 26588
743 Ga0495607_0002304 3300046501 Bacteria 15680
744 Ga0495607_0003797 3300046501 Bacteria 11411
745 Ga0495607_0006041 3300046501 Bacteria 8573
746 Ga0495607_0012560 3300046501 Bacteria 5584
747 Ga0495607_0016378 3300046501 Bacteria 4784
748 Ga0495607_0019241 3300046501 Bacteria 4339
749 Ga0495607_0025993 3300046501 Bacteria 3635
750 Ga0495607_0030657 3300046501 Bacteria 3300
751 Ga0495607_0031514 3300046501 Bacteria 3246
752 Ga0495607_0037308 3300046501 Bacteria 2920
753 Ga0495583_0000057 3300046506 Bacteria 200688
754 Ga0495583_0000065 3300046506 Bacteria 192022
755 Ga0495583_0000126 3300046506 Bacteria 128985
756 Ga0495583_0000640 3300046506 Bacteria 46312
757 Ga0495583_0001000 3300046506 Bacteria 32368
758 Ga0495583_0001397 3300046506 Bacteria 24653
759 Ga0495583_0005639 3300046506 Bacteria 8429
760 Ga0495583_0007411 3300046506 Bacteria 6901
761 Ga0495583_0011177 3300046506 Bacteria 5172
762 Ga0495606_0000004 3300046507 Bacteria 406209
763 Ga0495606_0000085 3300046507 Bacteria 158006
764 Ga0495606_0000165 3300046507 Bacteria 116607
765 Ga0495606_0000217 3300046507 Bacteria 101671
766 Ga0495606_0000250 3300046507 Bacteria 94676
767 Ga0495606_0000391 3300046507 Bacteria 74077
768 Ga0495606_0000498 3300046507 Bacteria 64198
769 Ga0495606_0000583 3300046507 Bacteria 57929
770 Ga0495606_0003143 3300046507 Bacteria 17899
771 Ga0495606_0004388 3300046507 Bacteria 14135
772 Ga0495606_0021818 3300046507 Bacteria 4684
773 Ga0495606_0024696 3300046507 Bacteria 4324
774 Ga0495606_0029578 3300046507 Bacteria 3842
775 Ga0495610_0000007 3300046512 Bacteria 820919
776 Ga0495610_0006070 3300046512 Bacteria 8432
777 Ga0495610_0007564 3300046512 Bacteria 7195
778 Ga0495610_0017182 3300046512 Bacteria 4132
779 Ga0495610_0040825 3300046512 Bacteria 2334
780 Ga0495610_0045498 3300046512 Bacteria 2171
781 Ga0495610_0050188 3300046512 Bacteria 2038
782 Ga0495616_0000443 3300046513 Bacteria 31659
783 Ga0495616_0001756 3300046513 Bacteria 14745
784 Ga0495616_0003332 3300046513 Bacteria 10320
785 Ga0495616_0010767 3300046513 Bacteria 5273
786 Ga0495616_0022602 3300046513 Bacteria 3395
787 Ga0495616_0032271 3300046513 Bacteria 2737
788 Ga0495616_0034870 3300046513 Bacteria 2608
789 Ga0495616_0036177 3300046513 Bacteria 2550
790 Ga0495616_0046939 3300046513 Bacteria 2177
791 Ga0495616_0060748 3300046513 Bacteria 1855
792 Ga0495620_0004652 3300046515 Bacteria 7709
793 Ga0495620_0044687 3300046515 Bacteria 1923
794 Ga0495631_0000385 3300046518 Bacteria 30461
795 Ga0495631_0000989 3300046518 Bacteria 17631
796 Ga0495631_0001661 3300046518 Bacteria 13229
797 Ga0495631_0009926 3300046518 Bacteria 4733
798 Ga0495631_0011022 3300046518 Bacteria 4462
799 Ga0495631_0030919 3300046518 Bacteria 2426
800 Ga0495631_0036845 3300046518 Bacteria 2182
801 Ga0495632_0000041 3300046519 Bacteria 145509
802 Ga0495632_0000138 3300046519 Bacteria 74488
803 Ga0495632_0000336 3300046519 Bacteria 44682
804 Ga0495632_0002105 3300046519 Bacteria 15559
805 Ga0495632_0002541 3300046519 Bacteria 13831
806 Ga0495632_0003341 3300046519 Bacteria 11431
807 Ga0495632_0005598 3300046519 Bacteria 8266
808 Ga0495632_0037208 3300046519 Bacteria 2471
809 Ga0495632_0040497 3300046519 Bacteria 2346
810 Ga0495637_0000119 3300046520 Bacteria 58062
811 Ga0495637_0000236 3300046520 Bacteria 42996
812 Ga0495637_0001529 3300046520 Bacteria 13534
813 Ga0495637_0020103 3300046520 Bacteria 3076
814 Ga0495637_0030504 3300046520 Bacteria 2391
815 Ga0495637_0038915 3300046520 Bacteria 2056
816 Ga0495637_0055686 3300046520 Bacteria 1639
817 Ga0495643_0000130 3300046522 Bacteria 121749
818 Ga0495643_0000264 3300046522 Bacteria 76021
819 Ga0495643_0000418 3300046522 Bacteria 55699
820 Ga0495643_0000524 3300046522 Bacteria 47789
821 Ga0495643_0001261 3300046522 Bacteria 24237
822 Ga0495643_0006614 3300046522 Bacteria 7613
823 Ga0495643_0011842 3300046522 Bacteria 5288
824 Ga0495643_0070059 3300046522 Bacteria 1842
825 Ga0495643_0125919 3300046522 Bacteria 1290
826 Ga0495644_0001767 3300046523 Bacteria 8725
827 Ga0495644_0001840 3300046523 Bacteria 8556
828 Ga0495644_0005822 3300046523 Bacteria 4813
829 Ga0495644_0007878 3300046523 Bacteria 4102
830 Ga0495644_0008437 3300046523 Bacteria 3970
831 Ga0495644_0013959 3300046523 Bacteria 3079
832 Ga0495644_0018993 3300046523 Bacteria 2623
833 Ga0495644_0022358 3300046523 Bacteria 2410
834 Ga0495644_0026291 3300046523 Bacteria 2209
835 Ga0495644_0035843 3300046523 Bacteria 1872
836 Ga0495648_0000004 3300046524 Bacteria 373639
837 Ga0495648_0000053 3300046524 Bacteria 159860
838 Ga0495648_0000104 3300046524 Bacteria 105792
839 Ga0495648_0001605 3300046524 Bacteria 22013
840 Ga0495648_0002531 3300046524 Bacteria 16766
841 Ga0495648_0004704 3300046524 Bacteria 11577
842 Ga0495648_0009677 3300046524 Bacteria 7431
843 Ga0495648_0011683 3300046524 Bacteria 6593
844 Ga0495648_0013011 3300046524 Bacteria 6176
845 Ga0495648_0014445 3300046524 Bacteria 5782
846 Ga0495648_0022056 3300046524 Bacteria 4395
847 Ga0495648_0024275 3300046524 Bacteria 4133
848 Ga0495648_0027535 3300046524 Bacteria 3802
849 Ga0495648_0056772 3300046524 Bacteria 2352
850 Ga0495648_0077536 3300046524 Bacteria 1904
851 Ga0495663_0002662 3300046525 Bacteria 5324
852 Ga0495666_0000502 3300046526 Bacteria 17352
853 Ga0495666_0008906 3300046526 Bacteria 5024
854 Ga0495666_0012060 3300046526 Bacteria 4313
855 Ga0495642_0000017 3300046528 Bacteria 111313
856 Ga0495642_0000284 3300046528 Bacteria 28539
857 Ga0495642_0000627 3300046528 Bacteria 17708
858 Ga0495642_0004294 3300046528 Bacteria 5540
859 Ga0495642_0017905 3300046528 Bacteria 2769
860 Ga0495642_0019789 3300046528 Bacteria 2638
861 Ga0495642_0027515 3300046528 Bacteria 2263
862 Ga0495642_0035714 3300046528 Bacteria 2006
863 Ga0495642_0086790 3300046528 Bacteria 1322
864 Ga0495652_0006725 3300046529 Bacteria 10671
865 Ga0495654_0000034 3300046530 Bacteria 196519
866 Ga0495654_0000057 3300046530 Bacteria 140176
867 Ga0495654_0000342 3300046530 Bacteria 40679
868 Ga0495654_0000395 3300046530 Bacteria 37242
869 Ga0495654_0005337 3300046530 Bacteria 7487
870 Ga0495654_0020863 3300046530 Bacteria 3412
871 Ga0495654_0059963 3300046530 Bacteria 1830
872 Ga0495665_0066658 3300046531 Bacteria 1900
873 Ga0495640_0022370 3300046533 Bacteria 4621
874 Ga0495586_0025267 3300046535 Bacteria 3177
875 Ga0495609_0000005 3300046538 Bacteria 439165
876 Ga0495609_0000164 3300046538 Bacteria 69576
877 Ga0495609_0000521 3300046538 Bacteria 30882
878 Ga0495609_0000533 3300046538 Bacteria 30301
879 Ga0495609_0002413 3300046538 Bacteria 11487
880 Ga0495609_0003306 3300046538 Bacteria 9296
881 Ga0495609_0003682 3300046538 Bacteria 8679
882 Ga0495609_0005422 3300046538 Bacteria 6707
883 Ga0495609_0008657 3300046538 Bacteria 4966
884 Ga0495609_0010716 3300046538 Bacteria 4386
885 Ga0495609_0020724 3300046538 Bacteria 3035
886 Ga0495609_0025637 3300046538 Bacteria 2702
887 Ga0495597_0000046 3300046542 Bacteria 104533
888 Ga0495597_0000143 3300046542 Bacteria 63995
889 Ga0495597_0001013 3300046542 Bacteria 21531
890 Ga0495597_0001089 3300046542 Bacteria 20605
891 Ga0495597_0001799 3300046542 Bacteria 14715
892 Ga0495597_0005803 3300046542 Bacteria 6471
893 Ga0495597_0007928 3300046542 Bacteria 5352
894 Ga0495597_0033689 3300046542 Bacteria 2318
895 Ga0495597_0036168 3300046542 Bacteria 2225
896 Ga0495597_0037767 3300046542 Bacteria 2167
897 Ga0495597_0044743 3300046542 Bacteria 1967
898 Ga0495597_0084926 3300046542 Bacteria 1349
899 Ga0495645_0108440 3300046543 Bacteria 1967
900 Ga0495622_0000011 3300046557 Bacteria 201507
901 Ga0495622_0000142 3300046557 Bacteria 61706
902 Ga0495622_0004623 3300046557 Bacteria 6376
903 Ga0495633_0000065 3300046558 Bacteria 139197
904 Ga0495633_0000146 3300046558 Bacteria 94353
905 Ga0495633_0000912 3300046558 Bacteria 25055
906 Ga0495633_0003500 3300046558 Bacteria 10417
907 Ga0495633_0004225 3300046558 Bacteria 9197
908 Ga0495633_0005677 3300046558 Bacteria 7555
909 Ga0495633_0010173 3300046558 Bacteria 5148
910 Ga0495633_0010777 3300046558 Bacteria 4971
911 Ga0495633_0019249 3300046558 Bacteria 3453
912 Ga0495633_0023824 3300046558 Bacteria 3029
913 Ga0495633_0026271 3300046558 Bacteria 2858
914 Ga0495656_0018936 3300046615 Bacteria 2650
915 Ga0495656_0059575 3300046615 Bacteria 1662
916 Ga0495668_0000030 3300046616 Bacteria 262663
917 Ga0495668_0000117 3300046616 Bacteria 122379
918 Ga0495668_0000251 3300046616 Bacteria 76262
919 Ga0495668_0000786 3300046616 Bacteria 36791
920 Ga0495668_0000808 3300046616 Bacteria 35909
921 Ga0495668_0001628 3300046616 Bacteria 20979
922 Ga0495668_0005872 3300046616 Bacteria 8177
923 Ga0495668_0023355 3300046616 Bacteria 3528
924 Ga0495668_0026362 3300046616 Bacteria 3298
925 Ga0495668_0055696 3300046616 Bacteria 2183
926 Ga0495634_0028031 3300046642 Bacteria 3912
927 Ga0495611_0000148 3300046648 Bacteria 49996
928 Ga0495611_0004500 3300046648 Bacteria 6017
929 Ga0495611_0008131 3300046648 Bacteria 4448
930 Ga0495611_0015591 3300046648 Bacteria 3248
931 Ga0495611_0017833 3300046648 Bacteria 3040
932 Ga0495611_0060239 3300046648 Bacteria 1724
933 Ga0495625_0000369 3300046660 Bacteria 68884
934 Ga0495625_0000609 3300046660 Bacteria 51864
935 Ga0495625_0007438 3300046660 Bacteria 9528
936 Ga0495625_0009627 3300046660 Bacteria 8061
937 Ga0495625_0015469 3300046660 Bacteria 6043
938 Ga0495625_0016675 3300046660 Bacteria 5771
939 Ga0495625_0027860 3300046660 Bacteria 4244
940 Ga0495625_0028169 3300046660 Bacteria 4217
941 Ga0495625_0036606 3300046660 Bacteria 3606
942 Ga0495625_0049705 3300046660 Bacteria 3012
943 Ga0495625_0054391 3300046660 Bacteria 2859
944 Ga0495625_0068336 3300046660 Bacteria 2498
945 Ga0495625_0089098 3300046660 Bacteria 2136
946 Ga0495635_0244494 3300046663 Bacteria 1210
947 Ga0495659_0000071 3300046664 Bacteria 43110
948 Ga0495659_0000148 3300046664 Bacteria 30682
949 Ga0495659_0017515 3300046664 Bacteria 2375
950 Ga0495661_0000102 3300046665 Bacteria 104814
951 Ga0495661_0000446 3300046665 Bacteria 43763
952 Ga0495661_0000487 3300046665 Bacteria 41672
953 Ga0495661_0004869 3300046665 Bacteria 9613
954 Ga0495661_0006505 3300046665 Bacteria 8212
955 Ga0495661_0008208 3300046665 Bacteria 7231
956 Ga0495661_0013333 3300046665 Bacteria 5525
957 Ga0495661_0014311 3300046665 Bacteria 5318
958 Ga0495661_0019173 3300046665 Bacteria 4488
959 Ga0495661_0019724 3300046665 Bacteria 4413
960 Ga0495661_0049519 3300046665 Bacteria 2547
961 Ga0495661_0088353 3300046665 Bacteria 1769
962 Ga0495588_0000126 3300046674 Bacteria 128815
963 Ga0495588_0006662 3300046674 Bacteria 5217
964 Ga0495588_0036695 3300046674 Bacteria 2487
965 Ga0495588_0051704 3300046674 Bacteria 2116
966 Ga0495588_0089010 3300046674 Bacteria 1616
967 Ga0495623_0021767 3300046679 Bacteria 4140
968 Ga0495623_0056956 3300046679 Bacteria 2460
969 Ga0495669_0000077 3300046684 Bacteria 65061
970 Ga0495669_0000403 3300046684 Bacteria 21114
971 Ga0495669_0000878 3300046684 Bacteria 12653
972 Ga0495669_0004606 3300046684 Bacteria 5711
973 Ga0495669_0025361 3300046684 Bacteria 2585
974 Ga0495613_0006584 3300046689 Bacteria 8684
975 Ga0495613_0066890 3300046689 Bacteria 2623
976 Ga0495670_0005040 3300046691 Bacteria 6495
977 Ga0495670_0008970 3300046691 Bacteria 4919
978 Ga0495670_0021488 3300046691 Bacteria 3183
979 Ga0495670_0060918 3300046691 Bacteria 1896
980 Ga0495670_0065643 3300046691 Bacteria 1829
981 Ga0495671_0000009 3300046692 Bacteria 369875
982 Ga0495671_0000053 3300046692 Bacteria 129715
983 Ga0495671_0000068 3300046692 Bacteria 99674
984 Ga0495671_0004576 3300046692 Bacteria 8230
985 Ga0495671_0005438 3300046692 Bacteria 7457
986 Ga0495671_0015009 3300046692 Bacteria 4160
987 Ga0495649_0000074 3300046694 Bacteria 85874
988 Ga0495649_0000954 3300046694 Bacteria 22832
989 Ga0495649_0001489 3300046694 Bacteria 17593
990 Ga0495649_0003489 3300046694 Bacteria 10593
991 Ga0495649_0006972 3300046694 Bacteria 6971
992 Ga0495649_0007158 3300046694 Bacteria 6850
993 Ga0495649_0018185 3300046694 Bacteria 3959
994 Ga0495589_0000005 3300046794 Bacteria 405112
995 Ga0495589_0000024 3300046794 Bacteria 191021
996 Ga0495589_0000124 3300046794 Bacteria 72335
997 Ga0495589_0000310 3300046794 Bacteria 38833
998 Ga0495589_0002267 3300046794 Bacteria 10814
999 Ga0495589_0004034 3300046794 Bacteria 7868
1000 Ga0495589_0006735 3300046794 Bacteria 6051
1001 Ga0495589_0023613 3300046794 Bacteria 3131
1002 Ga0495589_0025283 3300046794 Bacteria 3014
1003 Ga0495589_0057657 3300046794 Bacteria 1910
1004 Ga0495589_0094730 3300046794 Bacteria 1448
1005 Ga0495600_0046750 3300046809 Bacteria 2823
1006 Ga0495660_0000013 3300046810 Bacteria 350283
1007 Ga0495660_0000034 3300046810 Bacteria 201261
1008 Ga0495660_0000068 3300046810 Bacteria 119060
1009 Ga0495660_0001663 3300046810 Bacteria 14900
1010 Ga0495660_0002615 3300046810 Bacteria 11441
1011 Ga0495660_0005394 3300046810 Bacteria 7656
1012 Ga0495660_0005516 3300046810 Bacteria 7583
1013 Ga0495660_0011902 3300046810 Bacteria 5047
1014 Ga0495660_0014295 3300046810 Bacteria 4596
1015 Ga0495660_0026095 3300046810 Bacteria 3315
1016 Ga0495660_0027960 3300046810 Bacteria 3188
1017 Ga0495581_0002343 3300047315 Bacteria 10679
1018 Ga0495604_0138873 3300047317 Bacteria 1738
1019 Ga0495636_0000073 3300047318 Bacteria 42681
1020 Ga0495636_0007843 3300047318 Bacteria 4203
1021 Ga0495636_0037255 3300047318 Bacteria 2008
1022 Ga0495674_0058443 3300047319 Bacteria 3371
1023 Ga0495672_0000005 3300047320 Bacteria 593294
1024 Ga0495672_0000025 3300047320 Bacteria 365425
1025 Ga0495672_0000029 3300047320 Bacteria 305231
1026 Ga0495672_0000051 3300047320 Bacteria 237883
1027 Ga0495672_0000099 3300047320 Bacteria 140634
1028 Ga0495672_0000364 3300047320 Bacteria 57893
1029 Ga0495672_0000371 3300047320 Bacteria 56105
1030 Ga0495672_0000572 3300047320 Bacteria 41556
1031 Ga0495672_0000611 3300047320 Bacteria 40018
1032 Ga0495672_0008034 3300047320 Bacteria 7849
1033 Ga0495672_0080319 3300047320 Bacteria 1819
1034 Ga0495676_0000028 3300047321 Bacteria 140879
1035 Ga0495676_0047937 3300047321 Bacteria 3449
1036 Ga0495676_0054324 3300047321 Bacteria 3185
1037 Ga0495676_0090612 3300047321 Bacteria 2288
1038 Ga0495683_0000067 3300047323 Bacteria 111573
1039 Ga0495683_0000376 3300047323 Bacteria 36449
1040 Ga0495683_0000396 3300047323 Bacteria 34970
1041 Ga0495683_0006349 3300047323 Bacteria 6460
1042 Ga0495683_0041655 3300047323 Bacteria 2316
1043 Ga0495683_0053224 3300047323 Bacteria 2019
1044 Ga0495687_000008 3300047443 Bacteria 546666
1045 Ga0495687_000052 3300047443 Bacteria 199186
1046 Ga0495687_000085 3300047443 Bacteria 145052
1047 Ga0495687_000318 3300047443 Bacteria 62538
1048 Ga0495687_000868 3300047443 Bacteria 32039
1049 Ga0495687_000880 3300047443 Bacteria 31776
1050 Ga0495687_001551 3300047443 Bacteria 20888
1051 Ga0495687_004283 3300047443 Bacteria 9742
1052 Ga0495687_004307 3300047443 Bacteria 9694
1053 Ga0495677_0000007 3300047445 Bacteria 181193
1054 Ga0495677_0000063 3300047445 Bacteria 58478
1055 Ga0495677_0000436 3300047445 Bacteria 17823
1056 Ga0495677_0001164 3300047445 Bacteria 10515
1057 Ga0495677_0015701 3300047445 Bacteria 2749
1058 Ga0495677_0047526 3300047445 Bacteria 1575
1059 Ga0495679_000014 3300047446 Bacteria 292767
1060 Ga0495679_004777 3300047446 Bacteria 6134
1061 Ga0495679_008657 3300047446 Bacteria 4119
1062 Ga0495679_012397 3300047446 Bacteria 3247
1063 Ga0495679_013112 3300047446 Bacteria 3125
1064 Ga0495679_016965 3300047446 Bacteria 2618
1065 Ga0495679_018716 3300047446 Bacteria 2451
1066 Ga0495685_000024 3300047447 Bacteria 64011
1067 Ga0495673_0000031 3300047469 Bacteria 447868
1068 Ga0495673_0000032 3300047469 Bacteria 375856
1069 Ga0495673_0000047 3300047469 Bacteria 266522
1070 Ga0495673_0000105 3300047469 Bacteria 170731
1071 Ga0495673_0000517 3300047469 Bacteria 40822
1072 Ga0495681_0000277 3300047470 Bacteria 40972
1073 Ga0495681_0000959 3300047470 Bacteria 22090
1074 Ga0495681_0005340 3300047470 Bacteria 8617
1075 Ga0495681_0005810 3300047470 Bacteria 8198
1076 Ga0495681_0006925 3300047470 Bacteria 7351
1077 Ga0495681_0015553 3300047470 Bacteria 4299
1078 Ga0495686_0000156 3300047472 Bacteria 131196
1079 Ga0495686_0000203 3300047472 Bacteria 110612
1080 Ga0495686_0000370 3300047472 Bacteria 73065
1081 Ga0495686_0004712 3300047472 Bacteria 11045
1082 Ga0495686_0041057 3300047472 Bacteria 2947
1083 Ga0495593_0010432 3300047673 Bacteria 5368
1084 Ga0495593_0011870 3300047673 Bacteria 4994
1085 Ga0495614_0005153 3300048089 Bacteria 5896
1086 Ga0495614_0078848 3300048089 Bacteria 1425
1087 Ga0495626_0000054 3300048091 Bacteria 154997
1088 Ga0495626_0000149 3300048091 Bacteria 86385
1089 Ga0495626_0001212 3300048091 Bacteria 21271
1090 Ga0495626_0001272 3300048091 Bacteria 20617
1091 Ga0495626_0001527 3300048091 Bacteria 18179
1092 Ga0495626_0001963 3300048091 Bacteria 15256
1093 Ga0495626_0023427 3300048091 Bacteria 3040
1094 Ga0495626_0029700 3300048091 Bacteria 2643
1095 Ga0495626_0039301 3300048091 Bacteria 2240
1096 Ga0495626_0050495 3300048091 Bacteria 1921
1097 Ga0496100_0024792 3300048903 Bacteria 3663
1098 Ga0496100_0026496 3300048903 Bacteria 3555
1099 Ga0496101_0012431 3300048904 Bacteria 5681
1100 Ga0496101_0035542 3300048904 Bacteria 3524
1101 Ga0496102_0000290 3300048905 Bacteria 64278
1102 Ga0496102_0000369 3300048905 Bacteria 54037
1103 Ga0496102_0017169 3300048905 Bacteria 6337
1104 Ga0496102_0031028 3300048905 Bacteria 4789
1105 Ga0496102_0173845 3300048905 Bacteria 2028
1106 Ga0496103_0001902 3300048906 Bacteria 13579
1107 Ga0496103_0041110 3300048906 Bacteria 2841
1108 Ga0496103_0089381 3300048906 Bacteria 1943
1109 Ga0496104_0000302 3300048907 Bacteria 43843
1110 Ga0496104_0000668 3300048907 Bacteria 29410
1111 Ga0496105_0064987 3300048908 Bacteria 3011
1112 Ga0496106_0002901 3300048909 Bacteria 12750
1113 Ga0496106_0081909 3300048909 Bacteria 2480
1114 Ga0496107_0041590 3300048910 Bacteria 3300
1115 Ga0496109_0069578 3300048912 Bacteria 3228
1116 Ga0496110_0002616 3300048913 Bacteria 13554
1117 Ga0496110_0008561 3300048913 Bacteria 8236
1118 Ga0496111_0121962 3300048914 Bacteria 1925
1119 Ga0496113_0002670 3300048916 Bacteria 10453
1120 Ga0496113_0019442 3300048916 Bacteria 4751
1121 Ga0496113_0139153 3300048916 Unclassified 1909
1122 Ga0496114_0109814 3300048917 Bacteria 2362
1123 Ga0496115_0021738 3300048918 Bacteria 4960
1124 Ga0496115_0055552 3300048918 Bacteria 3181
1125 Ga0496116_0000015 3300048919 Bacteria 560702
1126 Ga0496116_0000016 3300048919 Bacteria 555146
1127 Ga0496116_0000065 3300048919 Bacteria 265193
1128 Ga0496116_0000835 3300048919 Bacteria 38885
1129 Ga0496116_0001042 3300048919 Bacteria 33795
1130 Ga0496116_0026923 3300048919 Bacteria 4193
1131 Ga0496116_0027008 3300048919 Bacteria 4185
1132 Ga0496116_0035744 3300048919 Bacteria 3486
1133 Ga0496116_0074425 3300048919 Bacteria 2136
1134 Ga0496117_0000011 3300048920 Bacteria 610930
1135 Ga0496117_0000043 3300048920 Bacteria 309583
1136 Ga0496117_0000143 3300048920 Bacteria 156096
1137 Ga0496117_0000183 3300048920 Bacteria 127679
1138 Ga0496117_0000544 3300048920 Bacteria 61933
1139 Ga0496117_0003495 3300048920 Bacteria 18226
1140 Ga0496117_0004149 3300048920 Bacteria 16193
1141 Ga0496117_0005640 3300048920 Bacteria 13063
1142 Ga0496117_0009075 3300048920 Bacteria 9347
1143 Ga0496117_0025318 3300048920 Bacteria 4667
1144 Ga0496117_0028069 3300048920 Bacteria 4363
1145 Ga0496117_0046689 3300048920 Bacteria 3113
1146 Ga0496117_0100783 3300048920 Bacteria 1828
1147 Ga0496118_0000010 3300048921 Bacteria 610930
1148 Ga0496118_0000187 3300048921 Bacteria 108334
1149 Ga0496118_0000242 3300048921 Bacteria 96394
1150 Ga0496118_0000342 3300048921 Bacteria 79311
1151 Ga0496118_0001298 3300048921 Bacteria 38055
1152 Ga0496118_0002104 3300048921 Bacteria 27943
1153 Ga0496118_0002946 3300048921 Bacteria 22116
1154 Ga0496118_0054468 3300048921 Bacteria 3029
1155 Ga0496118_0128287 3300048921 Bacteria 1634
1156 Ga0496119_0000026 3300048922 Bacteria 254759
1157 Ga0496119_0000031 3300048922 Bacteria 239685
1158 Ga0496119_0000059 3300048922 Bacteria 173056
1159 Ga0496119_0000261 3300048922 Bacteria 74726
1160 Ga0496119_0000391 3300048922 Bacteria 60498
1161 Ga0496119_0002834 3300048922 Bacteria 18539
1162 Ga0496119_0002994 3300048922 Bacteria 17918
1163 Ga0496119_0005310 3300048922 Bacteria 12395
1164 Ga0496119_0005915 3300048922 Bacteria 11527
1165 Ga0496119_0011235 3300048922 Bacteria 7447
1166 Ga0496119_0012893 3300048922 Bacteria 6734
1167 Ga0496119_0013708 3300048922 Bacteria 6425
1168 Ga0496119_0019891 3300048922 Bacteria 4919
1169 Ga0496119_0031790 3300048922 Bacteria 3530
1170 Ga0496120_0000017 3300048923 Bacteria 269222
1171 Ga0496120_0000049 3300048923 Bacteria 187654
1172 Ga0496120_0000141 3300048923 Bacteria 120086
1173 Ga0496120_0000317 3300048923 Bacteria 79762
1174 Ga0496120_0000551 3300048923 Bacteria 57249
1175 Ga0496120_0000887 3300048923 Bacteria 42156
1176 Ga0496120_0001006 3300048923 Bacteria 37957
1177 Ga0496120_0001022 3300048923 Bacteria 37416
1178 Ga0496120_0002864 3300048923 Bacteria 16598
1179 Ga0496120_0008580 3300048923 Bacteria 7395
1180 Ga0496120_0009923 3300048923 Bacteria 6701
1181 Ga0496120_0011084 3300048923 Bacteria 6221
1182 Ga0496120_0025382 3300048923 Bacteria 3679
1183 Ga0496120_0038320 3300048923 Bacteria 2836
1184 Ga0496120_0070739 3300048923 Bacteria 1918
1185 Ga0496120_0088579 3300048923 Bacteria 1658
1186 Ga0496121_0000057 3300048924 Bacteria 294291
1187 Ga0496121_0001372 3300048924 Bacteria 41423
1188 Ga0496121_0005503 3300048924 Bacteria 16197
1189 Ga0496121_0007929 3300048924 Bacteria 12693
1190 Ga0496121_0008025 3300048924 Bacteria 12591
1191 Ga0496121_0023521 3300048924 Bacteria 5929
1192 Ga0496121_0049723 3300048924 Bacteria 3550
1193 Ga0496121_0073776 3300048924 Bacteria 2733
1194 Ga0496121_0180718 3300048924 Bacteria 1523
1195 Ga0496121_0195232 3300048924 Bacteria 1447
1196 Ga0496122_0000075 3300048925 Bacteria 219099
1197 Ga0496122_0000125 3300048925 Bacteria 179659
1198 Ga0496122_0000864 3300048925 Bacteria 57030
1199 Ga0496122_0001095 3300048925 Bacteria 46975
1200 Ga0496122_0001101 3300048925 Bacteria 46741
1201 Ga0496122_0001334 3300048925 Bacteria 40363
1202 Ga0496122_0001674 3300048925 Bacteria 34397
1203 Ga0496122_0007868 3300048925 Bacteria 11704
1204 Ga0496122_0010041 3300048925 Bacteria 9841
1205 Ga0496122_0017808 3300048925 Bacteria 6607
1206 Ga0496122_0019115 3300048925 Bacteria 6281
1207 Ga0496122_0020890 3300048925 Bacteria 5887
1208 Ga0496122_0022568 3300048925 Bacteria 5589
1209 Ga0496122_0038899 3300048925 Bacteria 3801
1210 Ga0496123_0000019 3300048926 Bacteria 400216
1211 Ga0496123_0000092 3300048926 Bacteria 179551
1212 Ga0496123_0000099 3300048926 Bacteria 170756
1213 Ga0496123_0000377 3300048926 Bacteria 83811
1214 Ga0496123_0000418 3300048926 Bacteria 77315
1215 Ga0496123_0001378 3300048926 Bacteria 34031
1216 Ga0496123_0001673 3300048926 Bacteria 29676
1217 Ga0496123_0003390 3300048926 Bacteria 17974
1218 Ga0496123_0004994 3300048926 Bacteria 13585
1219 Ga0496123_0007012 3300048926 Bacteria 10742
1220 Ga0496123_0007340 3300048926 Bacteria 10437
1221 Ga0496123_0010307 3300048926 Bacteria 8289
1222 Ga0496123_0021293 3300048926 Bacteria 5043
1223 Ga0496123_0024565 3300048926 Bacteria 4577
1224 Ga0496124_0000058 3300048927 Bacteria 242191
1225 Ga0496124_0000238 3300048927 Bacteria 106881
1226 Ga0496124_0000528 3300048927 Bacteria 65079
1227 Ga0496124_0000860 3300048927 Bacteria 49581
1228 Ga0496124_0002687 3300048927 Bacteria 22763
1229 Ga0496124_0003362 3300048927 Bacteria 19661
1230 Ga0496124_0003484 3300048927 Bacteria 19160
1231 Ga0496124_0007923 3300048927 Bacteria 11185
1232 Ga0496124_0009929 3300048927 Bacteria 9728
1233 Ga0496124_0012109 3300048927 Bacteria 8549
1234 Ga0496124_0014922 3300048927 Bacteria 7479
1235 Ga0496124_0016793 3300048927 Bacteria 6938
1236 Ga0496124_0018238 3300048927 Bacteria 6580
1237 Ga0496124_0063031 3300048927 Bacteria 3099
1238 Ga0496124_0065289 3300048927 Bacteria 3035
1239 Ga0496124_0090983 3300048927 Bacteria 2487
1240 Ga0496124_0114183 3300048927 Bacteria 2169
1241 Ga0496124_0122859 3300048927 Bacteria 2072
1242 Ga0496124_0144159 3300048927 Bacteria 1876
1243 Ga0496125_0000032 3300048928 Bacteria 354078
1244 Ga0496125_0000384 3300048928 Bacteria 82197
1245 Ga0496125_0001264 3300048928 Bacteria 37681
1246 Ga0496125_0002423 3300048928 Bacteria 24257
1247 Ga0496125_0005530 3300048928 Bacteria 13992
1248 Ga0496125_0007546 3300048928 Bacteria 11556
1249 Ga0496125_0008637 3300048928 Bacteria 10628
1250 Ga0496125_0010503 3300048928 Bacteria 9364
1251 Ga0496125_0022631 3300048928 Bacteria 5830
1252 Ga0496125_0032791 3300048928 Bacteria 4608
1253 Ga0496125_0103653 3300048928 Bacteria 2086
1254 Ga0496126_0000109 3300048929 Bacteria 196717
1255 Ga0496126_0002309 3300048929 Bacteria 26185
1256 Ga0496126_0003362 3300048929 Bacteria 20286
1257 Ga0496126_0008614 3300048929 Bacteria 10969
1258 Ga0496126_0101293 3300048929 Bacteria 2519
1259 Ga0496126_0114106 3300048929 Bacteria 2351
1260 Ga0495678_000001 3300049459 Bacteria 1060340
1261 Ga0495678_000053 3300049459 Bacteria 154277
1262 Ga0495678_000225 3300049459 Bacteria 65737
1263 Ga0495678_000994 3300049459 Bacteria 24294
1264 Ga0495678_001139 3300049459 Bacteria 22089
1265 Ga0495678_001144 3300049459 Bacteria 22045
1266 Ga0495678_001471 3300049459 Bacteria 18440
1267 Ga0495678_001802 3300049459 Bacteria 15804
1268 Ga0495678_013609 3300049459 Bacteria 3812
1269 Ga0495682_0000003 3300049460 Bacteria 515787
1270 Ga0495682_0000053 3300049460 Bacteria 107313
1271 Ga0495682_0000612 3300049460 Bacteria 24080
1272 Ga0495682_0002863 3300049460 Bacteria 7939
1273 Ga0495682_0004724 3300049460 Bacteria 5760
1274 Ga0495682_0005637 3300049460 Bacteria 5180
1275 Ga0501031_0058390 3300049568 Bacteria 2514
1276 Ga0501032_0002210 3300049569 Bacteria 15321
1277 Ga0501033_0024418 3300049570 Bacteria 4560
1278 Ga0501033_0157069 3300049570 Bacteria 1639
1279 Ga0501034_0000796 3300049571 Bacteria 46919
1280 Ga0501034_0006544 3300049571 Bacteria 12513
1281 Ga0501034_0007675 3300049571 Bacteria 11480
1282 Ga0501034_0021329 3300049571 Bacteria 6605
1283 Ga0501034_0041497 3300049571 Bacteria 4656
1284 Ga0501034_0064438 3300049571 Bacteria 3679
1285 Ga0501034_0077255 3300049571 Bacteria 3335
1286 Ga0501034_0083948 3300049571 Bacteria 3187
1287 Ga0501034_0084598 3300049571 Bacteria 3174
1288 Ga0501034_0138358 3300049571 Bacteria 2415
1289 Ga0501034_0146984 3300049571 Bacteria 2334
1290 Ga0501034_0188858 3300049571 Bacteria 2023
1291 Ga0501034_0260908 3300049571 Bacteria 1675
1292 Ga0501036_0004850 3300049572 Bacteria 10870
1293 Ga0501036_0005392 3300049572 Bacteria 10360
1294 Ga0501036_0037639 3300049572 Bacteria 4092
1295 Ga0501036_0095997 3300049572 Bacteria 2506
1296 Ga0501036_0141145 3300049572 Bacteria 2033
1297 Ga0501036_0150811 3300049572 Bacteria 1961
1298 Ga0501037_0059689 3300049573 Bacteria 2782
1299 Ga0501038_0023535 3300049574 Bacteria 5506
1300 Ga0501038_0060833 3300049574 Bacteria 3231
1301 Ga0501038_0142917 3300049574 Bacteria 1956
1302 Ga0501039_0006301 3300049575 Bacteria 9011
1303 Ga0501039_0035972 3300049575 Bacteria 3820
1304 Ga0501039_0135554 3300049575 Bacteria 1933
1305 Ga0501039_0135897 3300049575 Bacteria 1930
1306 Ga0501039_0150147 3300049575 Bacteria 1831
1307 Ga0501040_0015717 3300049576 Bacteria 5003
1308 Ga0501040_0105671 3300049576 Bacteria 1967
1309 Ga0501040_0156375 3300049576 Bacteria 1610
1310 Ga0501040_0183039 3300049576 Bacteria 1485
1311 Ga0501041_0000595 3300049577 Bacteria 18891
1312 Ga0501042_0107794 3300049578 Bacteria 2005
1313 Ga0501043_0000968 3300049579 Bacteria 25400
1314 Ga0501043_0011997 3300049579 Bacteria 6778
1315 Ga0501043_0015809 3300049579 Bacteria 5915
1316 Ga0501043_0023122 3300049579 Bacteria 4875
1317 Ga0501046_0068465 3300049580 Bacteria 2763
1318 Ga0501047_0002405 3300049581 Bacteria 17885
1319 Ga0501047_0046221 3300049581 Bacteria 4207
1320 Ga0501047_0048700 3300049581 Bacteria 4092
1321 Ga0501047_0092700 3300049581 Bacteria 2899
1322 Ga0501048_0034333 3300049582 Bacteria 3660
1323 Ga0501048_0038363 3300049582 Bacteria 3437
1324 Ga0501048_0130554 3300049582 Bacteria 1776
1325 Ga0501067_0158456 3300049583 Bacteria 1261
1326 Ga0501068_0002617 3300049584 Bacteria 9531
1327 Ga0501068_0024198 3300049584 Bacteria 3565
1328 Ga0501068_0030856 3300049584 Bacteria 3182
1329 Ga0501068_0072373 3300049584 Bacteria 2105
1330 Ga0501069_0051884 3300049585 Bacteria 2283
1331 Ga0501070_0007638 3300049586 Bacteria 9178
1332 Ga0501070_0008540 3300049586 Bacteria 8660
1333 Ga0501070_0013485 3300049586 Bacteria 6889
1334 Ga0501070_0055670 3300049586 Bacteria 3278
1335 Ga0501071_0004558 3300049587 Bacteria 8786
1336 Ga0501071_0007947 3300049587 Bacteria 6998
1337 Ga0501071_0130990 3300049587 Bacteria 1863
1338 Ga0501072_0001774 3300049588 Bacteria 16050
1339 Ga0501072_0003342 3300049588 Bacteria 12065
1340 Ga0501072_0009049 3300049588 Bacteria 7570
1341 Ga0501073_0003357 3300049589 Bacteria 12035
1342 Ga0501073_0019661 3300049589 Bacteria 4873
1343 Ga0501073_0102042 3300049589 Bacteria 1992
1344 Ga0501074_0007746 3300049590 Bacteria 7777
1345 Ga0501074_0009044 3300049590 Bacteria 7233
1346 Ga0501075_0000022 3300049591 Bacteria 64965
1347 Ga0501075_0012917 3300049591 Bacteria 5949
1348 Ga0501075_0084305 3300049591 Bacteria 2407
1349 Ga0501075_0242484 3300049591 Bacteria 1374
1350 Ga0501076_0000064 3300049592 Bacteria 53698
1351 Ga0501076_0005444 3300049592 Bacteria 9156
1352 Ga0501076_0080723 3300049592 Bacteria 2611
1353 Ga0501211_001107 3300049658 Bacteria 2848
1354 Ga0501079_0018023 3300049741 Bacteria 5392
1355 Ga0501079_0034862 3300049741 Bacteria 3872
1356 Ga0501079_0133224 3300049741 Bacteria 1934
1357 Ga0501080_0000215 3300049742 Bacteria 42962
1358 Ga0501080_0015214 3300049742 Bacteria 7091
1359 Ga0501080_0015700 3300049742 Bacteria 6982
1360 Ga0501080_0055837 3300049742 Bacteria 3678
1361 Ga0501080_0074541 3300049742 Bacteria 3156
1362 Ga0501080_0136053 3300049742 Bacteria 2274
1363 Ga0501081_0001088 3300049743 Bacteria 16317
1364 Ga0501081_0010150 3300049743 Bacteria 6145
1365 Ga0501081_0015534 3300049743 Bacteria 5026
1366 Ga0501081_0064583 3300049743 Bacteria 2543
1367 Ga0501081_0084778 3300049743 Bacteria 2223
1368 Ga0501083_0000789 3300049744 Bacteria 20775
1369 Ga0501083_0031849 3300049744 Bacteria 3618
1370 Ga0501269_000020 3300049766 Bacteria 54011
1371 Ga0501274_000600 3300049771 Bacteria 2597
1372 Ga0501279_000207 3300049775 Bacteria 8173
1373 Ga0501035_0032945 3300049822 Bacteria 4713
1374 Ga0501035_0046242 3300049822 Bacteria 3915
1375 Ga0501044_0042984 3300049823 Bacteria 4696
1376 Ga0501044_0144288 3300049823 Bacteria 2367
1377 Ga0501044_0228285 3300049823 Bacteria 1810
1378 Ga0501045_0000675 3300049824 Bacteria 21663
1379 nmdc:mga03683_875_c1 3300050489 Bacteria 8684
1380 nmdc:mga00v17_26842_c1 3300050491 Bacteria 3358
1381 nmdc:mga00v17_2902_c1 3300050491 Bacteria 4856
1382 nmdc:mga00v17_8646_c1 3300050491 Bacteria 5484
1383 nmdc:mga0k408_105246_c1 3300050493 Bacteria 1666
1384 nmdc:mga06z11_107269_c1 3300050494 Bacteria 1541
1385 nmdc:mga06z11_155858_c1 3300050494 Bacteria 1302
1386 nmdc:mga06z11_36014_c1 3300050494 Bacteria 2440
1387 nmdc:mga07m45_11762_c2 3300050496 Bacteria 2581
1388 nmdc:mga07m45_1241_c1 3300050496 Bacteria 11565
1389 nmdc:mga07m45_98600_c1 3300050496 Bacteria 1678
1390 nmdc:mga05p37_110000_c1 3300050507 Bacteria 3390
1391 nmdc:mga05p37_44215_c1 3300050507 Bacteria 5480
1392 nmdc:mga05p37_99354_c1 3300050507 Bacteria 3211
1393 nmdc:mga09592_1482_c1 3300050508 Bacteria 18865
1394 nmdc:mga09592_92414_c1 3300050508 Bacteria 2586
1395 nmdc:mga0qj67_1316_c1 3300050509 Bacteria 17441
1396 nmdc:mga0qj67_2105_c1 3300050509 Bacteria 14179
1397 nmdc:mga06r32_673_c1 3300050510 Bacteria 29768
1398 nmdc:mga08y16_47_c1 3300050511 Bacteria 111829
1399 nmdc:mga08y16_496914_c1 3300050511 Bacteria 1240
1400 nmdc:mga0a205_258341_c1 3300050515 Bacteria 1620
1401 Ga0500583_0010177 3300053092 Bacteria 3478
1402 Ga0500641_0013363 3300053096 Bacteria 3015
1403 Ga0500594_0008324 3300053118 Bacteria 2361
1404 Ga0500594_0030718 3300053118 Bacteria 1412
1405 Ga0500618_022912 3300053125 Bacteria 1514
1406 Ga0500621_000034 3300053126 Bacteria 27593
1407 Ga0500586_000088 3300053145 Bacteria 15964
1408 Ga0500604_0002607 3300053151 Bacteria 4915
1409 Ga0500616_0027204 3300053153 Bacteria 3160
1410 Ga0500622_0000097 3300053156 Bacteria 89802
1411 Ga0500622_0001549 3300053156 Bacteria 18205
1412 Ga0500634_0000157 3300053161 Bacteria 22993
1413 Ga0500636_0037199 3300053177 Bacteria 2880
1414 Ga0500552_000074 3300053733 Bacteria 8066
1415 Ga0501084_0009032 3300054114 Bacteria 8251
1416 Ga0501084_0021317 3300054114 Bacteria 5402
1417 Ga0501082_0003439 3300060353 Bacteria 13817
1418 Ga0501082_0030634 3300060353 Bacteria 4636
1419 Ga0501082_0053680 3300060353 Bacteria 3473
1420 Ga0501082_0134641 3300060353 Bacteria 2144
1421 Ga0466962_0030745 3300061719 Bacteria 2571
1422 Ga0530510_0000334 3300061734 Bacteria 30281
1423 Ga0530510_0003950 3300061734 Bacteria 10226
1424 Ga0530510_0107945 3300061734 Bacteria 2038
1425 Ga0530510_0137828 3300061734 Bacteria 1797
1426 2506576637 2506520007 Bacteria 5442880
1427 2506581775 2506520008 Bacteria 5443009
1428 2508727683 2508501050 Bacteria 9633614
1429 2508850579 2508501071 Bacteria 5454741
1430 2509079887 2508501114 Bacteria 7082538
1431 2511379082 2511231025 Bacteria 5324661
1432 2511437391 2511231035 Bacteria 5341610
1433 2512036312 2511231221 Bacteria 6846400
1434 2523106638 2522572158 Bacteria 6514390
1435 2523467758 2523231067 Bacteria 5230452
1436 2524611179 2524023250 Bacteria 5457705
1437 2538426321 2537561728 Bacteria 5149301
1438 2547371150 2547132103 Bacteria 5115736
1439 2547696525 2547132181 Bacteria 4945084
1440 2555262018 2554235234 Bacteria 5762085
1441 2562465892 2561511199 Bacteria 5155034
1442 2585826221 2585427591 Bacteria 5482980
1443 2585830749 2585427592 Bacteria 5370892
1444 2587730364 2585428057 Bacteria 6737412
1445 2587736865 2585428058 Bacteria 6853932
1446 2587756620 2585428062 Bacteria 6842168
1447 2588291769 2588253510 Bacteria 6901809
1448 2596375400 2595698237 Bacteria 6712432
1449 2599101549 2597490356 Bacteria 7030811
1450 2599412894 2599185169 Bacteria 5441380
1451 2599928646 2599185299 Bacteria 4854625
1452 2601525635 2600255254 Bacteria 5281859
1453 2601530756 2600255255 Bacteria 5282785
1454 2601533936 2600255256 Bacteria 5597742
1455 2601540104 2600255257 Bacteria 5597196
1456 2601617755 2600255280 Bacteria 5292309
1457 2601622790 2600255281 Bacteria 5288753
1458 2601644665 2600255287 Bacteria 5210468
1459 2601651063 2600255288 Bacteria 5282738
1460 2601656112 2600255289 Bacteria 5281907
1461 2601661036 2600255290 Bacteria 5282218
1462 2601664830 2600255291 Bacteria 5217298
1463 2601669210 2600255292 Bacteria 6300551
1464 2601697302 2600255298 Bacteria 5215185
1465 2601702690 2600255299 Bacteria 5218662
1466 2601708878 2600255300 Bacteria 5287774
1467 2601713916 2600255301 Bacteria 5280532
1468 2601718961 2600255302 Bacteria 5288235
1469 2601722651 2600255303 Bacteria 5219315
1470 2601728918 2600255304 Bacteria 5283973
1471 2601733907 2600255305 Bacteria 5282329
1472 2601738883 2600255306 Bacteria 5281613
1473 2601743309 2600255307 Bacteria 5439064
1474 2601754435 2600255309 Bacteria 5431045
1475 2601758913 2600255310 Bacteria 5600903
1476 2601762737 2600255311 Bacteria 5598766
1477 2602021376 2600255392 Bacteria 5437392
1478 2603640589 2602042046 Bacteria 5483348
1479 2603644629 2602042047 Bacteria 4697674
1480 2603662853 2602042052 Bacteria 5215873
1481 2603667750 2602042053 Bacteria 5214361
1482 2603700482 2602042066 Bacteria 4423871
1483 2603705903 2602042067 Bacteria 4863713
1484 2603841432 2602042103 Bacteria 5284714
1485 2603846439 2602042104 Bacteria 5281639
1486 2603851514 2602042105 Bacteria 5282303
1487 2603856645 2602042106 Bacteria 5282744
1488 2603868497 2602042109 Bacteria 5152801
1489 2603874161 2602042110 Bacteria 5283285
1490 2603878559 2602042111 Bacteria 5212080
1491 2606051404 2603880178 Bacteria 5283018
1492 2606072319 2603880184 Bacteria 5217896
1493 2606149090 2603880202 Bacteria 5284684
1494 2606179232 2603880211 Bacteria 5284226
1495 2608671122 2608642108 Bacteria 4104624
1496 2609912008 2609459761 Bacteria 5513740
1497 2637227191 2636415599 Bacteria 5718434
1498 2643745762 2643221544 Bacteria 5886209
1499 2643789721 2643221554 Bacteria 6603920
1500 2643796836 2643221556 Bacteria 7251154
1501 2643912750 2643221580 Bacteria 3816678
1502 2643936834 2643221585 Bacteria 5812563
1503 2643966733 2643221591 Bacteria 4397626
1504 2644165619 2643221629 Bacteria 5850260
1505 2644214552 2643221638 Bacteria 6579467
1506 2644221665 2643221639 Bacteria 6649903
1507 2644249923 2643221645 Bacteria 7207331
1508 2644257570 2643221646 Bacteria 6433402
1509 2644318735 2643221656 Bacteria 5809961
1510 2644348539 2643221662 Bacteria 5851492
1511 2644358602 2643221664 Bacteria 7272945
1512 2644413252 2643221674 Bacteria 3919126
1513 2644470059 2643221684 Bacteria 7145183
1514 2644729630 2643221733 Bacteria 5690728
1515 2644743822 2643221736 Bacteria 6608466
1516 2649121482 2648501241 Bacteria 5312320
1517 2650898222 2648501693 Bacteria 5069560
1518 2652974400 2651869818 Bacteria 5864031
1519 2656276467 2654587920 Bacteria 5475511
1520 2671103744 2667528172 Bacteria 5170840
1521 2671106530 2667528173 Bacteria 5375747
1522 2671586831 2671180115 Bacteria 5353919
1523 2676409844 2675903046 Bacteria 5451247
1524 2681996818 2681812866 Bacteria 4552357
1525 2682008592 2681812869 Bacteria 5014465
1526 2686355136 2684622997 Bacteria 4624240
1527 2689443014 2687453601 Bacteria 5546041
1528 2707101642 2706794495 Bacteria 4536932
1529 2712472375 2711768156 Bacteria 4471618
1530 2715499061 2713897090 Bacteria 3353799
1531 2738739518 2738541280 Bacteria 6630198
1532 2738745318 2738541281 Bacteria 5112672
1533 2738827601 2738541297 Bacteria 6549566
1534 2738846095 2738541300 Bacteria 6675882
1535 2739058556 2738541337 Bacteria 6183410
1536 2739151397 2738541357 Bacteria 6549408
1537 2739193317 2738543003 Bacteria 6549560
1538 2739275752 2738543018 Bacteria 6718814
1539 2739319793 2738543026 Bacteria 6549408
1540 2739338034 2738543029 Bacteria 6549249
1541 2739344796 2738543030 Bacteria 6719714
1542 2739349208 2738543031 Bacteria 5769731
1543 2739354548 2738543032 Bacteria 5115625
1544 2753854537 2751185917 Bacteria 4551186
1545 2765587389 2765235842 Bacteria 4799256
1546 2772437168 2772190666 Bacteria 5117644
1547 2774869130 2773857925 Bacteria 6472445
1548 2775540778 2775506706 Bacteria 4873073
1549 2777021589 2775507074 Bacteria 5532402
1550 2791924225 2791354903 Bacteria 4937680
1551 2792313299 2791355010 Bacteria 4864581
1552 2793406955 2791355275 Bacteria 4429597
1553 2807177926 2806310673 Bacteria 4801221
1554 2809127501 2808606414 Bacteria 4917181
1555 2809147162 2808606418 Bacteria 6724496
1556 2813730650 2811995292 Bacteria 5303342
1557 2814698257 2814123068 Bacteria 5687681
1558 2821121400 2821118458 Bacteria 4714306
1559 2821136022 2821131069 Bacteria 6108407
1560 2821444390 2821443989 Bacteria 7658172
1561 2823377492 2823373977 Bacteria 4779415
1562 2829749764 2829745981 Bacteria 5406054
1563 2831866642 2831864461 Bacteria 6502356
1564 2835319679 2835312727 Bacteria 7413381
1565 2841764860 2841760612 Bacteria 6454112
1566 2842338716 2842333319 Bacteria 8899485
1567 2842703090 2842698319 Bacteria 5190321
1568 2842713022 2842711865 Bacteria 7155354
1569 2843691642 2843690924 Bacteria 5169057
1570 2844107692 2844104063 Bacteria 6440972
1571 2844426090 2844425489 Bacteria 4854065
1572 2844530183 2844528606 Bacteria 4733806
1573 2844539647 2844533157 Bacteria 7517899
1574 2846037068 2846033681 Bacteria 4377894
1575 2846040140 2846037992 Bacteria 4526407
1576 2846540983 2846540461 Bacteria 5471451
1577 2846953726 2846952575 Bacteria 6587527
1578 2847089150 2847085930 Bacteria 5070450
1579 2847798138 2847797336 Bacteria 5176640
1580 2848860090 2848858292 Bacteria 7391279
1581 2851183547 2851182111 Bacteria 6047226
1582 2851249798 2851246043 Bacteria 6439203
1583 2852106149 2852103415 Bacteria 5193810
1584 2854603093 2854601825 Bacteria 4797592
1585 2855196638 2855195626 Bacteria 4927512
1586 2857549342 2857547612 Bacteria 6179999
1587 2857555575 2857553236 Bacteria 6166726
1588 2857562984 2857558681 Bacteria 6617694
1589 2857569223 2857564685 Bacteria 6290584
1590 2858466515 2858466076 Bacteria 4722413
1591 2861693477 2861691609 Bacteria 5628931
1592 2865016460 2865014394 Bacteria 4764573
1593 2869552418 2869551831 Bacteria 5474685
1594 2871273288 2871272651 Bacteria 5042015
1595 2871282647 2871282230 Bacteria 4917173
1596 2876605334 2876601092 Bacteria 5114497
1597 2881612968 2881609920 Bacteria 4405319
1598 2881716614 2881714928 Bacteria 2469486
1599 2882457641 2882456835 Bacteria 6863978
1600 2884090565 2884086401 Bacteria 5005459
1601 2884301193 2884298095 Bacteria 3823049
1602 2885085983 2885080285 Bacteria 6355622
1603 2886853241 2886848708 Bacteria 5632523
1604 2888367220 2888366609 Bacteria 5155009
1605 2888375115 2888373701 Bacteria 5098052
1606 2889310042 2889306138 Bacteria 6358934
1607 2891672293 2891670763 Bacteria 4967099
1608 2894236137 2894232714 Bacteria 8834183
1609 2897806983 2897803580 Bacteria 7000062
1610 2900054722 2900051742 Bacteria 4985156
1611 2900055939 2900051742 Bacteria 4985156
1612 2902333883 2902330777 Bacteria 6395352
1613 2902405635 2902405164 Bacteria 6784948
1614 2904429396 2904424332 Bacteria 7633521
1615 2904474322 2904474040 Bacteria 5504324
1616 2904507089 2904504865 Bacteria 5152820
1617 2904516086 2904513164 Bacteria 5476410
1618 2908673080 2908669403 Bacteria 5740494
1619 2909042723 2909042592 Bacteria 6499737
1620 2917554545 2917554339 Bacteria 4987857
1621 2919112801 2919108558 Bacteria 5897419
1622 2919150669 2919150387 Bacteria 5500879
1623 2919479369 2919476304 Bacteria 5888696
1624 2919496725 2919493220 Bacteria 4598500
1625 2919498240 2919497567 Bacteria 4408621
1626 2919545301 2919543075 Bacteria 4728703
1627 2923526953 2923525760 Bacteria 4472324
1628 2923637920 2923634449 Bacteria 4753480
1629 2927145542 2927143783 Bacteria 5504251
1630 2927835635 2927833300 Bacteria 4923934
1631 2928129612 2928125067 Bacteria 5937560
1632 2932404908 2932401849 Bacteria 4262978
1633 2932406520 2932406140 Bacteria 5134491
1634 2932414464 2932410948 Bacteria 6312192
1635 2932421015 2932416698 Bacteria 6315112
1636 2935627891 2935625433 Bacteria 5042964
1637 2937540055 2937539931 Bacteria 4639830
1638 2937970785 2937967321 Bacteria 5094075
1639 2939571619 2939568625 Bacteria 4542555
1640 2939575995 2939573065 Bacteria 4926053
1641 2939578058 2939577877 Bacteria 5132791
1642 2939605970 2939602548 Bacteria 4950493
1643 2939609526 2939607340 Bacteria 4719256
1644 2939619690 2939617950 Bacteria 4820956
1645 2939645974 2939642701 Bacteria 4475280
1646 2939673491 2939669807 Bacteria 5028511
1647 2945879834 2945874760 Bacteria 5527237
1648 2969084205 2969079654 Bacteria 5439582
1649 2971825712 2971820967 Bacteria 5823634
1650 2974313680 2974310843 Bacteria 4947816
1651 2974436919 2974435778 Bacteria 4876478
1652 2978978153 2978975091 Bacteria 4704313
1653 2984495131 2984494565 Bacteria 5000175
1654 2984561285 2984559226 Bacteria 5683096
1655 2984599355 2984595703 Bacteria 5682994
1656 2990263211 2990261002 Bacteria 4919493
1657 3000380568 3000376612 Bacteria 4705565
1658 3003670689 3003665799 Bacteria 7279786
1659 640936172 640753048 Bacteria 5495657
1660 8004597880 8004592986 Bacteria 5122074
1661 8015396098 8015394850 Bacteria 5064660
1662 8016734410 8016733728 Bacteria 5274317
1663 8018224975 8018221730 Bacteria 4616064
1664 8018409977 8018405270 Bacteria 4978981
1665 8019503470 8019499862 Bacteria 5169538
1666 8019506788 8019504834 Bacteria 4819156
1667 8047676897 8047673197 Bacteria 7395230
1668 8054008459 8054002106 Bacteria 7987183
1669 8054360722 8054357960 Bacteria 2867777
1670 8054848619 8054844752 Bacteria 4450330
1671 8054850079 8054849141 Bacteria 5232694
1672 8055091498 8055087960 Bacteria 4784273
1673 8055092801 8055092621 Bacteria 4873875
1674 8055100714 8055097453 Bacteria 4865496
1675 8055694613 8055693939 Bacteria 4772047
1676 8057307388 8057304971 Bacteria 4649742
1677 8057533116 8057529695 Bacteria 6306553
1678 Ga0451576_0003198
1679 JGI24739J22299_10000002
1680 JGI25162J39368_1000006
1681 JGI25154J39366_1001582
1682 JGI25163J39215_1000001
1683 JGI25164J39214_1000001
1684 JGI25152J39213_1000151
1685 JGI25152J39213_1000281
1686 JGI25150J39212_1000795
1687 JGI25150J39212_1001464
1688 JGI25159J45721_1015369
1689 JGI25151J46595_10000166
1690 JGI25151J46595_10002653
1691 JGI25151J46595_10031052
1692 JGI25153J46596_10002171
1693 rootH2_10020955
1694 rootH2_10048183
1695 rootL2_10003345
1696 rootH1_10000605
1697 rootH1_10037021
1698 JGI25160J50197_1011043
1699 JGI25161J50226_1002707
1700 JGI25161J50226_1003994
1701 Ga0055538_1000004
1702 Ga0055539_1000004
1703 Ga0055533_1000007
1704 Ga0055532_1000389
1705 Ga0055532_1001254
1706 Ga0055532_1001590
1707 Ga0055525_1000007
1708 Ga0055527_1000097
1709 Ga0055527_1000355
1710 Ga0055535_1000184
1711 Ga0055535_1000835
1712 Ga0055542_1000833
1713 Ga0055542_1002714
1714 Ga0055529_1000190
1715 Ga0055529_1000501
1716 Ga0055526_1000035
1717 Ga0055526_1000047
1718 Ga0055526_1000224
1719 Ga0055526_1005554
1720 Ga0055526_1011175
1721 Ga0055537_1000052
1722 Ga0055524_1001129
1723 Ga0055524_1001525
1724 Ga0055524_1009293
1725 Ga0055534_1000070
1726 Ga0055534_1005836
1727 Ga0055528_1000224
1728 Ga0055530_10004792
1729 Ga0055530_10007512
1730 Ga0055531_10003346
1731 Ga0055531_10005016
1732 Ga0055531_10010282
1733 Ga0055531_10012662
1734 Ga0055541_1000004
1735 Ga0058692_1000114
1736 Ga0058692_1000729
1737 Ga0058692_1001186
1738 Ga0058692_1003679
1739 Ga0058692_1004514
1740 Ga0058692_1011845
1741 Ga0058692_1013605
1742 Ga0058692_1015454
1743 Ga0058692_1016189
1744 Ga0058692_1018622
1745 Ga0055543_1000537
1746 Ga0055543_1002810
1747 Ga0065165_1000214
1748 Ga0065165_1000287
1749 Ga0065165_1000619
1750 Ga0065165_1001296
1751 Ga0065165_1001774
1752 Ga0065714_10071591
1753 Ga0065704_10000047
1754 Ga0065704_10000550
1755 Ga0065704_10002426
1756 Ga0065704_10082571
1757 Ga0065704_10113746
1758 Ga0070658_10085744
1759 Ga0070658_10196032
1760 Ga0070676_10073340
1761 Ga0070676_10115233
1762 Ga0070683_100174007
1763 Ga0070690_100092697
1764 Ga0070660_100026769
1765 Ga0070660_100166679
1766 Ga0070661_100000450
1767 Ga0070661_100013049
1768 Ga0070661_100067536
1769 Ga0070661_100082320
1770 Ga0070668_100010801
1771 Ga0070668_100016247
1772 Ga0070668_100136720
1773 Ga0070669_100164822
1774 Ga0070674_100026786
1775 Ga0070659_100052893
1776 Ga0070659_100070781
1777 Ga0070667_100005029
1778 Ga0070708_100014571
1779 Ga0070706_100000708
1780 Ga0070706_100268717
1781 Ga0070707_100004899
1782 Ga0070707_100010379
1783 Ga0068853_100005963
1784 Ga0068853_100031955
1785 Ga0068853_100038697
1786 Ga0068853_100049288
1787 Ga0070696_100016002
1788 Ga0070696_100065974
1789 Ga0070665_100000140
1790 Ga0070665_100025192
1791 Ga0068855_100030619
1792 Ga0068855_100101590
1793 Ga0068855_100113892
1794 Ga0070664_100241228
1795 Ga0068857_100001114
1796 Ga0068854_100004812
1797 Ga0068856_100006640
1798 Ga0068856_100084902
1799 Ga0068856_100093375
1800 Ga0068852_100001705
1801 Ga0068852_100004453
1802 Ga0068852_100009952
1803 Ga0068859_100197818
1804 Ga0068864_100048582
1805 Ga0068851_10000551
1806 Ga0068863_100244821
1807 Ga0068860_100248199
1808 Ga0068862_100028361
1809 Ga0081538_10014182
1810 Ga0081540_1016882
1811 Ga0075365_10004753
1812 Ga0075365_10030996
1813 Ga0075365_10048470
1814 Ga0075365_10151294
1815 Ga0075364_10006922
1816 Ga0075364_10015682
1817 Ga0075367_10017205
1818 Ga0075367_10018371
1819 Ga0075367_10080668
1820 Ga0075367_10098187
1821 Ga0075369_10011410
1822 Ga0075366_10044096
1823 Ga0097621_100246600
1824 Ga0075370_10005225
1825 Ga0075370_10044821
1826 Ga0075370_10061484
1827 Ga0075428_100020716
1828 Ga0075428_100112697
1829 Ga0075430_100000421
1830 Ga0075430_100001834
1831 Ga0075431_100001088
1832 Ga0075431_100004097
1833 Ga0075434_100125790
1834 Ga0075429_100000553
1835 Ga0075429_100064728
1836 Ga0068865_100170142
1837 Ga0097620_100197824
1838 Ga0099823_1002035
1839 Ga0079104_1000046
1840 Ga0079104_1000403
1841 Ga0079104_1000446
1842 Ga0079104_1000656
1843 Ga0079104_1001144
1844 Ga0079104_1001838
1845 Ga0079104_1008796
1846 Ga0079104_1009419
1847 Ga0079104_1011437
1848 Ga0099826_10000006
1849 Ga0105251_10000198
1850 Ga0105251_10000710
1851 Ga0105251_10000897
1852 Ga0105251_10001329
1853 Ga0105251_10001671
1854 Ga0105251_10002717
1855 Ga0105251_10003082
1856 Ga0105251_10003283
1857 Ga0105251_10007365
1858 Ga0105251_10011349
1859 Ga0105251_10028750
1860 Ga0105251_10049129
1861 Ga0105251_10074554
1862 Ga0105244_10000023
1863 Ga0105244_10000097
1864 Ga0105244_10000247
1865 Ga0105244_10000255
1866 Ga0105244_10001300
1867 Ga0105244_10001840
1868 Ga0105244_10002203
1869 Ga0105244_10002845
1870 Ga0105244_10002920
1871 Ga0105244_10004900
1872 Ga0105244_10013704
1873 Ga0105244_10019589
1874 Ga0105244_10034988
1875 Ga0105250_10000028
1876 Ga0105250_10000045
1877 Ga0105250_10000223
1878 Ga0105250_10000389
1879 Ga0105250_10004542
1880 Ga0105250_10057695
1881 Ga0105240_10002532
1882 Ga0105240_10109413
1883 Ga0105240_10135504
1884 Ga0105240_10142489
1885 Ga0111539_10000042
1886 Ga0105245_10212811
1887 Ga0105247_10002979
1888 Ga0114129_10056865
1889 Ga0114129_10068985
1890 Ga0105243_10002639
1891 Ga0105241_10000008
1892 Ga0105241_10071242
1893 Ga0105242_10022642
1894 Ga0105237_10226564
1895 Ga0105238_10029570
1896 Ga0105238_10052519
1897 Ga0105238_10243699
1898 Ga0105249_10092455
1899 Ga0105249_10205390
1900 Ga0105249_10247766
1901 Ga0105239_10006388
1902 Ga0105246_10020957
1903 Ga0157319_1000035
1904 Ga0157373_10003379
1905 Ga0157373_10017315
1906 Ga0157373_10021059
1907 Ga0157373_10042305
1908 Ga0157371_10000010
1909 Ga0157371_10000020
1910 Ga0157371_10000249
1911 Ga0157371_10000589
1912 Ga0157371_10001050
1913 Ga0157371_10021774
1914 Ga0157370_10000190
1915 Ga0157370_10002280
1916 Ga0157370_10022002
1917 Ga0157370_10127004
1918 Ga0157369_10000183
1919 Ga0157369_10012953
1920 Ga0163162_10042393
1921 Ga0163162_10054839
1922 Ga0163162_10185491
1923 Ga0157372_10000263
1924 Ga0157372_10016784
1925 Ga0157372_10042885
1926 Ga0182008_10000041
1927 Ga0182008_10000145
1928 Ga0182008_10009743
1929 Ga0182006_1000004
1930 Ga0182006_1000019
1931 Ga0182006_1000025
1932 Ga0182006_1013994
1933 Ga0182006_1023255
1934 Ga0182006_1026649
1935 Ga0182007_10000028
1936 Ga0182007_10013981
1937 Ga0182005_1000003
1938 Ga0182005_1000011
1939 Ga0183366_1003
1940 Ga0183370_1003
1941 Ga0183369_1005
1942 Ga0183368_1006
1943 Ga0163161_10000002
1944 Ga0163161_10066460
1945 Ga0213872_10000075
1946 Ga0213872_10000200
1947 Ga0213872_10000333
1948 Ga0213872_10000951
1949 Ga0213872_10007305
1950 Ga0213872_10016608
1951 Ga0213872_10029949
1952 Ga0213874_10013632
1953 Ga0213876_10000132
1954 Ga0213876_10002133
1955 Ga0213876_10006362
1956 Ga0209760_100063
1957 Ga0209436_100221
1958 Ga0209784_100001
1959 Ga0209566_100001
1960 Ga0209674_100002
1961 Ga0209672_100075
1962 Ga0209672_100097
1963 Ga0209147_100021
1964 Ga0209147_100106
1965 Ga0209147_101125
1966 Ga0209563_100008
1967 Ga0209563_100022
1968 Ga0207427_100002
1969 Ga0209437_100046
1970 Ga0209437_100171
1971 Ga0209258_100153
1972 Ga0209258_100157
1973 Ga0207425_1000013
1974 Ga0207425_1000141
1975 Ga0207425_1000349
1976 Ga0209646_1000256
1977 Ga0209677_100004
1978 Ga0209148_1000150
1979 Ga0209148_1000554
1980 Ga0209759_1004966
1981 Ga0209129_1000008
1982 Ga0209129_1000106
1983 Ga0209129_1007469
1984 Ga0209233_1003996
1985 Ga0209565_1000035
1986 Ga0209565_1017236
1987 Ga0209455_1000033
1988 Ga0209455_1000132
1989 Ga0209455_1000676
1990 Ga0209673_1000006
1991 Ga0209673_1000782
1992 Ga0209673_1001809
1993 Ga0209673_1010521
1994 Ga0209130_1000045
1995 Ga0209130_1000086
1996 Ga0209130_1000422
1997 Ga0209130_1000803
1998 Ga0209130_1007832
1999 Ga0209675_1000005
2000 Ga0209675_1000762
2001 Ga0209675_1005290
2002 Ga0209676_1000197
2003 Ga0209025_1000053
2004 Ga0209025_1002554
2005 Ga0209025_1002612
2006 Ga0209564_1000003
2007 Ga0209564_1000028
2008 Ga0209564_1000032
2009 Ga0209564_1000083
2010 Ga0209564_1000852
2011 Ga0209564_1006504
2012 Ga0209758_1000031
2013 Ga0209758_1001001
2014 Ga0209758_1002556
2015 Ga0209050_1000078
2016 Ga0209050_1000226
2017 Ga0209050_1001494
2018 Ga0209050_1003886
2019 Ga0209050_1010303
2020 Ga0209256_1000322
2021 Ga0209256_1000333
2022 Ga0209256_1000398
2023 Ga0209256_1001193
2024 Ga0209256_1002559
2025 Ga0209256_1006472
2026 Ga0207426_1000198
2027 Ga0207426_1006840
2028 Ga0207426_1010121
2029 Ga0209051_1001335
2030 Ga0209051_1007045
2031 Ga0209257_1000017
2032 Ga0209257_1000097
2033 Ga0209257_1000799
2034 Ga0209257_1005062
2035 Ga0209257_1016358
2036 Ga0207696_1000009
2037 Ga0207696_1000027
2038 Ga0207696_1000048
2039 Ga0207696_1000093
2040 Ga0207696_1000140
2041 Ga0207696_1000142
2042 Ga0207696_1000578
2043 Ga0207696_1002998
2044 Ga0207696_1007481
2045 Ga0207696_1008359
2046 Ga0207655_1000017
2047 Ga0207655_1000026
2048 Ga0207655_1000047
2049 Ga0207655_1000054
2050 Ga0207655_1000056
2051 Ga0207655_1000101
2052 Ga0207655_1000146
2053 Ga0207655_1000629
2054 Ga0207655_1001740
2055 Ga0207655_1003438
2056 Ga0207655_1003656
2057 Ga0207655_1007852
2058 Ga0207655_1013493
2059 Ga0207655_1016412
2060 Ga0207655_1043062
2061 Ga0207713_1000028
2062 Ga0207713_1000034
2063 Ga0207713_1000046
2064 Ga0207713_1000055
2065 Ga0207713_1000110
2066 Ga0207713_1000419
2067 Ga0207713_1002658
2068 Ga0207713_1002840
2069 Ga0207713_1005077
2070 Ga0207713_1006201
2071 Ga0207713_1031157
2072 Ga0207710_10000015
2073 Ga0207645_10057695
2074 Ga0207705_10008492
2075 Ga0207684_10003312
2076 Ga0207684_10192217
2077 Ga0207654_10000009
2078 Ga0207695_10001423
2079 Ga0207695_10033423
2080 Ga0207695_10040895
2081 Ga0207695_10100423
2082 Ga0207671_10137547
2083 Ga0207657_10060722
2084 Ga0207649_10001235
2085 Ga0207649_10007427
2086 Ga0207646_10008292
2087 Ga0207646_10018226
2088 Ga0207706_10012194
2089 Ga0207709_10002430
2090 Ga0207709_10084054
2091 Ga0207669_10086048
2092 Ga0207689_10049505
2093 Ga0207667_10025070
2094 Ga0207667_10161188
2095 Ga0207668_10018955
2096 Ga0207640_10190206
2097 Ga0207658_10000576
2098 Ga0207639_10056705
2099 Ga0207639_10107593
2100 Ga0207702_10004783
2101 Ga0207702_10020446
2102 Ga0207641_10227870
2103 Ga0207674_10002994
2104 Ga0207674_10107832
2105 Ga0207675_100018961
2106 Ga0207698_10022122
2107 Ga0207698_10045455
2108 Ga0209281_1000022
2109 Ga0209281_1000054
2110 Ga0209281_1000060
2111 Ga0209281_1000120
2112 Ga0209281_1000145
2113 Ga0209281_1000223
2114 Ga0209281_1000384
2115 Ga0209281_1000489
2116 Ga0209281_1001188
2117 Ga0209281_1001296
2118 Ga0209281_1007282
2119 Ga0209281_1008583
2120 Ga0209389_1045994
2121 Ga0209371_1000014
2122 Ga0209371_1000030
2123 Ga0209371_1000049
2124 Ga0209371_1000054
2125 Ga0209371_1000062
2126 Ga0209371_1000184
2127 Ga0209371_1000246
2128 Ga0209371_1000438
2129 Ga0209371_1000535
2130 Ga0209371_1001222
2131 Ga0209371_1001361
2132 Ga0209371_1001547
2133 Ga0209371_1001896
2134 Ga0209371_1002425
2135 Ga0209371_1003163
2136 Ga0209371_1006833
2137 Ga0209282_1000003
2138 Ga0207428_10000092
2139 Ga0268266_10000143
2140 Ga0268266_10115517
2141 Ga0268265_10017393
2142 Ga0265318_10005442
2143 Ga0307517_10000922
2144 Ga0307515_10000494
2145 Ga0307515_10003110
2146 Ga0307515_10006825
2147 Ga0307515_10020687
2148 Ga0307515_10036249
2149 Ga0307515_10074907
2150 Ga0307515_10109134
2151 Ga0307515_10128856
2152 Ga0307515_10220502
2153 Ga0265324_10038636
2154 Ga0268256_1000012
2155 Ga0268256_1000021
2156 Ga0268256_1000025
2157 Ga0268256_1000031
2158 Ga0268256_1000062
2159 Ga0268256_1000154
2160 Ga0268256_1000225
2161 Ga0268256_1000416
2162 Ga0268256_1000883
2163 Ga0268256_1001169
2164 Ga0268256_1001324
2165 Ga0268256_1002154
2166 Ga0268256_1002848
2167 Ga0268256_1003805
2168 Ga0268256_1006948
2169 Ga0268256_1009716
2170 Ga0307512_10011174
2171 Ga0307512_10116514
2172 Ga0316181_1110574
2173 Ga0265330_10028710
2174 Ga0265332_10000037
2175 Ga0265320_10045057
2176 Ga0265325_10001150
2177 Ga0265325_10001470
2178 Ga0265325_10044674
2179 Ga0265340_10000430
2180 Ga0265340_10002126
2181 Ga0265339_10000398
2182 Ga0265339_10003572
2183 Ga0265331_10047198
2184 Ga0265331_10058635
2185 Ga0265316_10003635
2186 Ga0265316_10079131
2187 Ga0307513_10028052
2188 Ga0307513_10045530
2189 Ga0307513_10050737
2190 Ga0307513_10058328
2191 Ga0307509_10003895
2192 Ga0307509_10012929
2193 Ga0307408_100000086
2194 Ga0307408_100000596
2195 Ga0307408_100148946
2196 Ga0265313_10000668
2197 Ga0265313_10001592
2198 Ga0265313_10002199
2199 Ga0265313_10002786
2200 Ga0265313_10024418
2201 Ga0307508_10000113
2202 Ga0307508_10002073
2203 Ga0307508_10008713
2204 Ga0307508_10085665
2205 Ga0307508_10091783
2206 Ga0307508_10101916
2207 Ga0265314_10008772
2208 Ga0265314_10021296
2209 Ga0265314_10037449
2210 Ga0265314_10043672
2211 Ga0265314_10059326
2212 Ga0265314_10090552
2213 Ga0265342_10087211
2214 Ga0307516_10006620
2215 Ga0307516_10009989
2216 Ga0307516_10026471
2217 Ga0307516_10119749
2218 Ga0307413_10015865
2219 Ga0307518_10100499
2220 Ga0307412_10149443
2221 Ga0307414_10012798
2222 Ga0307414_10018634
2223 Ga0307414_10091515
2224 Ga0307411_10001320
2225 Ga0307510_10105783
2226 Ga0373951_0016520
2227 Ga0373939_0000017
2228 Ga0373960_0000109
2229 Ga0373942_0004863
2230 Ga0373962_0023490
2231 Ga0373931_0000641
2232 Ga0373927_0096672
2233 Ga0395899_0002939
2234 Ga0395900_0000328
2235 Ga0395900_0001093
2236 Ga0395900_0019162
2237 Ga0395900_0024296
2238 Ga0395898_0010844
2239 Ga0395898_0139909
2240 Ga0395905_0000733
2241 Ga0395905_0101736
2242 Ga0395905_0217999
2243 Ga0395905_0243411
2244 Ga0395905_0338234
2245 Ga0395905_0423428
2246 Ga0436364_0309744
2247 Ga0395901_0000845
2248 Ga0395901_0004026
2249 Ga0395901_0219357
2250 Ga0436365_0009436
2251 Ga0436365_0019788
2252 Ga0436365_0084998
2253 Ga0436365_0172682
2254 Ga0436361_0021035
2255 Ga0436361_0039233
2256 Ga0436361_0273059
2257 Ga0436361_0595288
2258 Ga0436361_0784288
2259 Ga0436361_0891393
2260 Ga0436361_0909611
2261 Ga0436361_1052705
2262 Ga0436361_1223937
2263 Ga0436363_1324421
2264 Ga0436362_0790008
2265 Ga0436362_1190416
2266 Ga0439438_000003
2267 Ga0439438_007960
2268 Ga0439438_011494
2269 Ga0439438_015183
2270 Ga0439447_004372
2271 Ga0439447_005845
2272 Ga0439466_0000004
2273 Ga0451793_0482489
2274 Ga0451853_4050226
2275 Ga0439431_0017112
2276 Ga0439433_0014592
2277 Ga0439432_006041
2278 Ga0439432_020914
2279 Ga0439452_000005
2280 Ga0439452_000007
2281 Ga0439452_000009
2282 Ga0439452_000041
2283 Ga0439452_000306
2284 Ga0439452_005523
2285 Ga0450917_000087
2286 Ga0450890_000295
2287 Ga0450904_000781
2288 Ga0450889_000476
2289 Ga0450907_000014
2290 Ga0439434_0044407
2291 Ga0439459_0005386
2292 Ga0439464_0003359
2293 Ga0439464_0012263
2294 Ga0450893_0001682
2295 Ga0451577_0001953
2296 Ga0451577_0007501
2297 Ga0451577_0104665
2298 Ga0466969_0052151
2299 Ga0466972_0018575
2300 Ga0466972_0038110
2301 Ga0466981_0000014
2302 Ga0466982_0121487
2303 Ga0453683_0008603
2304 Ga0466965_0010968
2305 Ga0466966_0038292
2306 Ga0466966_0077569
2307 Ga0466961_0029395
2308 Ga0466964_0005156
2309 Ga0466964_0031249
2310 Ga0453684_0000122
2311 Ga0453684_0001547
2312 Ga0453684_0155848
2313 Ga0453684_0365111
2314 Ga0466968_0015048
2315 Ga0466968_0023481
2316 Ga0466968_0035648
2317 Ga0466957_0005984
2318 Ga0466960_0155650
2319 Ga0451576_0000757
2320 Ga0451576_0006570
2321 Ga0451576_0011216
2322 Ga0451576_0037016
2323 Ga0451576_0055149
2324 Ga0451576_0301504
2325 Ga0466958_0000243
2326 Ga0466967_0057075
2327 Ga0466967_0178150
2328 Ga0495617_000014
2329 Ga0495617_000023
2330 Ga0495617_000876
2331 Ga0495617_001491
2332 Ga0495617_003235
2333 Ga0495627_000016
2334 Ga0495627_000042
2335 Ga0495627_000061
2336 Ga0495627_004730
2337 Ga0495627_033102
2338 Ga0495603_0080055
2339 Ga0495590_0000019
2340 Ga0495590_0000043
2341 Ga0495590_0000682
2342 Ga0495590_0010889
2343 Ga0495591_000004
2344 Ga0495591_000141
2345 Ga0495591_000187
2346 Ga0495591_000659
2347 Ga0495591_013242
2348 Ga0495629_0146645
2349 Ga0495638_0000115
2350 Ga0495638_0000736
2351 Ga0495638_0007861
2352 Ga0495638_0065009
2353 Ga0495641_0014310
2354 Ga0495653_0000014
2355 Ga0495653_0035201
2356 Ga0495653_0037561
2357 Ga0495650_0000004
2358 Ga0495650_0000028
2359 Ga0495650_0000113
2360 Ga0495650_0000142
2361 Ga0495650_0000178
2362 Ga0495650_0000181
2363 Ga0495650_0000193
2364 Ga0495650_0000336
2365 Ga0495650_0000824
2366 Ga0495650_0000921
2367 Ga0495650_0009582
2368 Ga0495650_0010854
2369 Ga0495650_0025252
2370 Ga0495580_0026298
2371 Ga0495605_0000010
2372 Ga0495605_0000258
2373 Ga0495605_0006518
2374 Ga0495605_0019832
2375 Ga0495605_0020581
2376 Ga0495605_0022339
2377 Ga0495605_0047205
2378 Ga0495639_0014414
2379 Ga0495584_0000065
2380 Ga0495584_0000138
2381 Ga0495584_0000163
2382 Ga0495584_0000922
2383 Ga0495584_0001769
2384 Ga0495584_0001801
2385 Ga0495584_0009868
2386 Ga0495584_0011083
2387 Ga0495584_0020493
2388 Ga0495584_0032880
2389 Ga0495585_0000125
2390 Ga0495585_0000160
2391 Ga0495585_0000289
2392 Ga0495585_0000304
2393 Ga0495585_0000875
2394 Ga0495585_0001072
2395 Ga0495585_0004953
2396 Ga0495585_0005994
2397 Ga0495585_0011575
2398 Ga0495585_0013702
2399 Ga0495585_0016715
2400 Ga0495585_0042944
2401 Ga0495585_0052010
2402 Ga0495594_0008632
2403 Ga0495594_0008889
2404 Ga0495594_0024866
2405 Ga0495596_0000325
2406 Ga0495596_0001727
2407 Ga0495596_0002068
2408 Ga0495596_0002935
2409 Ga0495596_0004148
2410 Ga0495596_0005642
2411 Ga0495596_0010888
2412 Ga0495596_0012256
2413 Ga0495596_0014807
2414 Ga0495596_0040231
2415 Ga0495596_0051802
2416 Ga0495607_0000076
2417 Ga0495607_0000626
2418 Ga0495607_0000966
2419 Ga0495607_0002304
2420 Ga0495607_0003797
2421 Ga0495607_0006041
2422 Ga0495607_0012560
2423 Ga0495607_0016378
2424 Ga0495607_0019241
2425 Ga0495607_0025993
2426 Ga0495607_0030657
2427 Ga0495607_0031514
2428 Ga0495607_0037308
2429 Ga0495583_0000057
2430 Ga0495583_0000065
2431 Ga0495583_0000126
2432 Ga0495583_0000640
2433 Ga0495583_0001000
2434 Ga0495583_0001397
2435 Ga0495583_0005639
2436 Ga0495583_0007411
2437 Ga0495583_0011177
2438 Ga0495606_0000004
2439 Ga0495606_0000085
2440 Ga0495606_0000165
2441 Ga0495606_0000217
2442 Ga0495606_0000250
2443 Ga0495606_0000391
2444 Ga0495606_0000498
2445 Ga0495606_0000583
2446 Ga0495606_0003143
2447 Ga0495606_0004388
2448 Ga0495606_0021818
2449 Ga0495606_0024696
2450 Ga0495606_0029578
2451 Ga0495610_0000007
2452 Ga0495610_0006070
2453 Ga0495610_0007564
2454 Ga0495610_0017182
2455 Ga0495610_0040825
2456 Ga0495610_0045498
2457 Ga0495610_0050188
2458 Ga0495616_0000443
2459 Ga0495616_0001756
2460 Ga0495616_0003332
2461 Ga0495616_0010767
2462 Ga0495616_0022602
2463 Ga0495616_0032271
2464 Ga0495616_0034870
2465 Ga0495616_0036177
2466 Ga0495616_0046939
2467 Ga0495616_0060748
2468 Ga0495620_0004652
2469 Ga0495620_0044687
2470 Ga0495631_0000385
2471 Ga0495631_0000989
2472 Ga0495631_0001661
2473 Ga0495631_0009926
2474 Ga0495631_0011022
2475 Ga0495631_0030919
2476 Ga0495631_0036845
2477 Ga0495632_0000041
2478 Ga0495632_0000138
2479 Ga0495632_0000336
2480 Ga0495632_0002105
2481 Ga0495632_0002541
2482 Ga0495632_0003341
2483 Ga0495632_0005598
2484 Ga0495632_0037208
2485 Ga0495632_0040497
2486 Ga0495637_0000119
2487 Ga0495637_0000236
2488 Ga0495637_0001529
2489 Ga0495637_0020103
2490 Ga0495637_0030504
2491 Ga0495637_0038915
2492 Ga0495637_0055686
2493 Ga0495643_0000130
2494 Ga0495643_0000264
2495 Ga0495643_0000418
2496 Ga0495643_0000524
2497 Ga0495643_0001261
2498 Ga0495643_0006614
2499 Ga0495643_0011842
2500 Ga0495643_0070059
2501 Ga0495643_0125919
2502 Ga0495644_0001767
2503 Ga0495644_0001840
2504 Ga0495644_0005822
2505 Ga0495644_0007878
2506 Ga0495644_0008437
2507 Ga0495644_0013959
2508 Ga0495644_0018993
2509 Ga0495644_0022358
2510 Ga0495644_0026291
2511 Ga0495644_0035843
2512 Ga0495648_0000004
2513 Ga0495648_0000053
2514 Ga0495648_0000104
2515 Ga0495648_0001605
2516 Ga0495648_0002531
2517 Ga0495648_0004704
2518 Ga0495648_0009677
2519 Ga0495648_0011683
2520 Ga0495648_0013011
2521 Ga0495648_0014445
2522 Ga0495648_0022056
2523 Ga0495648_0024275
2524 Ga0495648_0027535
2525 Ga0495648_0056772
2526 Ga0495648_0077536
2527 Ga0495663_0002662
2528 Ga0495666_0000502
2529 Ga0495666_0008906
2530 Ga0495666_0012060
2531 Ga0495642_0000017
2532 Ga0495642_0000284
2533 Ga0495642_0000627
2534 Ga0495642_0004294
2535 Ga0495642_0017905
2536 Ga0495642_0019789
2537 Ga0495642_0027515
2538 Ga0495642_0035714
2539 Ga0495642_0086790
2540 Ga0495652_0006725
2541 Ga0495654_0000034
2542 Ga0495654_0000057
2543 Ga0495654_0000342
2544 Ga0495654_0000395
2545 Ga0495654_0005337
2546 Ga0495654_0020863
2547 Ga0495654_0059963
2548 Ga0495665_0066658
2549 Ga0495640_0022370
2550 Ga0495586_0025267
2551 Ga0495609_0000005
2552 Ga0495609_0000164
2553 Ga0495609_0000521
2554 Ga0495609_0000533
2555 Ga0495609_0002413
2556 Ga0495609_0003306
2557 Ga0495609_0003682
2558 Ga0495609_0005422
2559 Ga0495609_0008657
2560 Ga0495609_0010716
2561 Ga0495609_0020724
2562 Ga0495609_0025637
2563 Ga0495597_0000046
2564 Ga0495597_0000143
2565 Ga0495597_0001013
2566 Ga0495597_0001089
2567 Ga0495597_0001799
2568 Ga0495597_0005803
2569 Ga0495597_0007928
2570 Ga0495597_0033689
2571 Ga0495597_0036168
2572 Ga0495597_0037767
2573 Ga0495597_0044743
2574 Ga0495597_0084926
2575 Ga0495645_0108440
2576 Ga0495622_0000011
2577 Ga0495622_0000142
2578 Ga0495622_0004623
2579 Ga0495633_0000065
2580 Ga0495633_0000146
2581 Ga0495633_0000912
2582 Ga0495633_0003500
2583 Ga0495633_0004225
2584 Ga0495633_0005677
2585 Ga0495633_0010173
2586 Ga0495633_0010777
2587 Ga0495633_0019249
2588 Ga0495633_0023824
2589 Ga0495633_0026271
2590 Ga0495656_0018936
2591 Ga0495656_0059575
2592 Ga0495668_0000030
2593 Ga0495668_0000117
2594 Ga0495668_0000251
2595 Ga0495668_0000786
2596 Ga0495668_0000808
2597 Ga0495668_0001628
2598 Ga0495668_0005872
2599 Ga0495668_0023355
2600 Ga0495668_0026362
2601 Ga0495668_0055696
2602 Ga0495634_0028031
2603 Ga0495611_0000148
2604 Ga0495611_0004500
2605 Ga0495611_0008131
2606 Ga0495611_0015591
2607 Ga0495611_0017833
2608 Ga0495611_0060239
2609 Ga0495625_0000369
2610 Ga0495625_0000609
2611 Ga0495625_0007438
2612 Ga0495625_0009627
2613 Ga0495625_0015469
2614 Ga0495625_0016675
2615 Ga0495625_0027860
2616 Ga0495625_0028169
2617 Ga0495625_0036606
2618 Ga0495625_0049705
2619 Ga0495625_0054391
2620 Ga0495625_0068336
2621 Ga0495625_0089098
2622 Ga0495635_0244494
2623 Ga0495659_0000071
2624 Ga0495659_0000148
2625 Ga0495659_0017515
2626 Ga0495661_0000102
2627 Ga0495661_0000446
2628 Ga0495661_0000487
2629 Ga0495661_0004869
2630 Ga0495661_0006505
2631 Ga0495661_0008208
2632 Ga0495661_0013333
2633 Ga0495661_0014311
2634 Ga0495661_0019173
2635 Ga0495661_0019724
2636 Ga0495661_0049519
2637 Ga0495661_0088353
2638 Ga0495588_0000126
2639 Ga0495588_0006662
2640 Ga0495588_0036695
2641 Ga0495588_0051704
2642 Ga0495588_0089010
2643 Ga0495623_0021767
2644 Ga0495623_0056956
2645 Ga0495669_0000077
2646 Ga0495669_0000403
2647 Ga0495669_0000878
2648 Ga0495669_0004606
2649 Ga0495669_0025361
2650 Ga0495613_0006584
2651 Ga0495613_0066890
2652 Ga0495670_0005040
2653 Ga0495670_0008970
2654 Ga0495670_0021488
2655 Ga0495670_0060918
2656 Ga0495670_0065643
2657 Ga0495671_0000009
2658 Ga0495671_0000053
2659 Ga0495671_0000068
2660 Ga0495671_0004576
2661 Ga0495671_0005438
2662 Ga0495671_0015009
2663 Ga0495649_0000074
2664 Ga0495649_0000954
2665 Ga0495649_0001489
2666 Ga0495649_0003489
2667 Ga0495649_0006972
2668 Ga0495649_0007158
2669 Ga0495649_0018185
2670 Ga0495589_0000005
2671 Ga0495589_0000024
2672 Ga0495589_0000124
2673 Ga0495589_0000310
2674 Ga0495589_0002267
2675 Ga0495589_0004034
2676 Ga0495589_0006735
2677 Ga0495589_0023613
2678 Ga0495589_0025283
2679 Ga0495589_0057657
2680 Ga0495589_0094730
2681 Ga0495600_0046750
2682 Ga0495660_0000013
2683 Ga0495660_0000034
2684 Ga0495660_0000068
2685 Ga0495660_0001663
2686 Ga0495660_0002615
2687 Ga0495660_0005394
2688 Ga0495660_0005516
2689 Ga0495660_0011902
2690 Ga0495660_0014295
2691 Ga0495660_0026095
2692 Ga0495660_0027960
2693 Ga0495581_0002343
2694 Ga0495604_0138873
2695 Ga0495636_0000073
2696 Ga0495636_0007843
2697 Ga0495636_0037255
2698 Ga0495674_0058443
2699 Ga0495672_0000005
2700 Ga0495672_0000025
2701 Ga0495672_0000029
2702 Ga0495672_0000051
2703 Ga0495672_0000099
2704 Ga0495672_0000364
2705 Ga0495672_0000371
2706 Ga0495672_0000572
2707 Ga0495672_0000611
2708 Ga0495672_0008034
2709 Ga0495672_0080319
2710 Ga0495676_0000028
2711 Ga0495676_0047937
2712 Ga0495676_0054324
2713 Ga0495676_0090612
2714 Ga0495683_0000067
2715 Ga0495683_0000376
2716 Ga0495683_0000396
2717 Ga0495683_0006349
2718 Ga0495683_0041655
2719 Ga0495683_0053224
2720 Ga0495687_000008
2721 Ga0495687_000052
2722 Ga0495687_000085
2723 Ga0495687_000318
2724 Ga0495687_000868
2725 Ga0495687_000880
2726 Ga0495687_001551
2727 Ga0495687_004283
2728 Ga0495687_004307
2729 Ga0495677_0000007
2730 Ga0495677_0000063
2731 Ga0495677_0000436
2732 Ga0495677_0001164
2733 Ga0495677_0015701
2734 Ga0495677_0047526
2735 Ga0495679_000014
2736 Ga0495679_004777
2737 Ga0495679_008657
2738 Ga0495679_012397
2739 Ga0495679_013112
2740 Ga0495679_016965
2741 Ga0495679_018716
2742 Ga0495685_000024
2743 Ga0495673_0000031
2744 Ga0495673_0000032
2745 Ga0495673_0000047
2746 Ga0495673_0000105
2747 Ga0495673_0000517
2748 Ga0495681_0000277
2749 Ga0495681_0000959
2750 Ga0495681_0005340
2751 Ga0495681_0005810
2752 Ga0495681_0006925
2753 Ga0495681_0015553
2754 Ga0495686_0000156
2755 Ga0495686_0000203
2756 Ga0495686_0000370
2757 Ga0495686_0004712
2758 Ga0495686_0041057
2759 Ga0495593_0010432
2760 Ga0495593_0011870
2761 Ga0495614_0005153
2762 Ga0495614_0078848
2763 Ga0495626_0000054
2764 Ga0495626_0000149
2765 Ga0495626_0001212
2766 Ga0495626_0001272
2767 Ga0495626_0001527
2768 Ga0495626_0001963
2769 Ga0495626_0023427
2770 Ga0495626_0029700
2771 Ga0495626_0039301
2772 Ga0495626_0050495
2773 Ga0496100_0024792
2774 Ga0496100_0026496
2775 Ga0496101_0012431
2776 Ga0496101_0035542
2777 Ga0496102_0000290
2778 Ga0496102_0000369
2779 Ga0496102_0017169
2780 Ga0496102_0031028
2781 Ga0496102_0173845
2782 Ga0496103_0001902
2783 Ga0496103_0041110
2784 Ga0496103_0089381
2785 Ga0496104_0000302
2786 Ga0496104_0000668
2787 Ga0496105_0064987
2788 Ga0496106_0002901
2789 Ga0496106_0081909
2790 Ga0496107_0041590
2791 Ga0496109_0069578
2792 Ga0496110_0002616
2793 Ga0496110_0008561
2794 Ga0496111_0121962
2795 Ga0496113_0002670
2796 Ga0496113_0019442
2797 Ga0496113_0139153
2798 Ga0496114_0109814
2799 Ga0496115_0021738
2800 Ga0496115_0055552
2801 Ga0496116_0000015
2802 Ga0496116_0000016
2803 Ga0496116_0000065
2804 Ga0496116_0000835
2805 Ga0496116_0001042
2806 Ga0496116_0026923
2807 Ga0496116_0027008
2808 Ga0496116_0035744
2809 Ga0496116_0074425
2810 Ga0496117_0000011
2811 Ga0496117_0000043
2812 Ga0496117_0000143
2813 Ga0496117_0000183
2814 Ga0496117_0000544
2815 Ga0496117_0003495
2816 Ga0496117_0004149
2817 Ga0496117_0005640
2818 Ga0496117_0009075
2819 Ga0496117_0025318
2820 Ga0496117_0028069
2821 Ga0496117_0046689
2822 Ga0496117_0100783
2823 Ga0496118_0000010
2824 Ga0496118_0000187
2825 Ga0496118_0000242
2826 Ga0496118_0000342
2827 Ga0496118_0001298
2828 Ga0496118_0002104
2829 Ga0496118_0002946
2830 Ga0496118_0054468
2831 Ga0496118_0128287
2832 Ga0496119_0000026
2833 Ga0496119_0000031
2834 Ga0496119_0000059
2835 Ga0496119_0000261
2836 Ga0496119_0000391
2837 Ga0496119_0002834
2838 Ga0496119_0002994
2839 Ga0496119_0005310
2840 Ga0496119_0005915
2841 Ga0496119_0011235
2842 Ga0496119_0012893
2843 Ga0496119_0013708
2844 Ga0496119_0019891
2845 Ga0496119_0031790
2846 Ga0496120_0000017
2847 Ga0496120_0000049
2848 Ga0496120_0000141
2849 Ga0496120_0000317
2850 Ga0496120_0000551
2851 Ga0496120_0000887
2852 Ga0496120_0001006
2853 Ga0496120_0001022
2854 Ga0496120_0002864
2855 Ga0496120_0008580
2856 Ga0496120_0009923
2857 Ga0496120_0011084
2858 Ga0496120_0025382
2859 Ga0496120_0038320
2860 Ga0496120_0070739
2861 Ga0496120_0088579
2862 Ga0496121_0000057
2863 Ga0496121_0001372
2864 Ga0496121_0005503
2865 Ga0496121_0007929
2866 Ga0496121_0008025
2867 Ga0496121_0023521
2868 Ga0496121_0049723
2869 Ga0496121_0073776
2870 Ga0496121_0180718
2871 Ga0496121_0195232
2872 Ga0496122_0000075
2873 Ga0496122_0000125
2874 Ga0496122_0000864
2875 Ga0496122_0001095
2876 Ga0496122_0001101
2877 Ga0496122_0001334
2878 Ga0496122_0001674
2879 Ga0496122_0007868
2880 Ga0496122_0010041
2881 Ga0496122_0017808
2882 Ga0496122_0019115
2883 Ga0496122_0020890
2884 Ga0496122_0022568
2885 Ga0496122_0038899
2886 Ga0496123_0000019
2887 Ga0496123_0000092
2888 Ga0496123_0000099
2889 Ga0496123_0000377
2890 Ga0496123_0000418
2891 Ga0496123_0001378
2892 Ga0496123_0001673
2893 Ga0496123_0003390
2894 Ga0496123_0004994
2895 Ga0496123_0007012
2896 Ga0496123_0007340
2897 Ga0496123_0010307
2898 Ga0496123_0021293
2899 Ga0496123_0024565
2900 Ga0496124_0000058
2901 Ga0496124_0000238
2902 Ga0496124_0000528
2903 Ga0496124_0000860
2904 Ga0496124_0002687
2905 Ga0496124_0003362
2906 Ga0496124_0003484
2907 Ga0496124_0007923
2908 Ga0496124_0009929
2909 Ga0496124_0012109
2910 Ga0496124_0014922
2911 Ga0496124_0016793
2912 Ga0496124_0018238
2913 Ga0496124_0063031
2914 Ga0496124_0065289
2915 Ga0496124_0090983
2916 Ga0496124_0114183
2917 Ga0496124_0122859
2918 Ga0496124_0144159
2919 Ga0496125_0000032
2920 Ga0496125_0000384
2921 Ga0496125_0001264
2922 Ga0496125_0002423
2923 Ga0496125_0005530
2924 Ga0496125_0007546
2925 Ga0496125_0008637
2926 Ga0496125_0010503
2927 Ga0496125_0022631
2928 Ga0496125_0032791
2929 Ga0496125_0103653
2930 Ga0496126_0000109
2931 Ga0496126_0002309
2932 Ga0496126_0003362
2933 Ga0496126_0008614
2934 Ga0496126_0101293
2935 Ga0496126_0114106
2936 Ga0495678_000001
2937 Ga0495678_000053
2938 Ga0495678_000225
2939 Ga0495678_000994
2940 Ga0495678_001139
2941 Ga0495678_001144
2942 Ga0495678_001471
2943 Ga0495678_001802
2944 Ga0495678_013609
2945 Ga0495682_0000003
2946 Ga0495682_0000053
2947 Ga0495682_0000612
2948 Ga0495682_0002863
2949 Ga0495682_0004724
2950 Ga0495682_0005637
2951 Ga0501031_0058390
2952 Ga0501032_0002210
2953 Ga0501033_0024418
2954 Ga0501033_0157069
2955 Ga0501034_0000796
2956 Ga0501034_0006544
2957 Ga0501034_0007675
2958 Ga0501034_0021329
2959 Ga0501034_0041497
2960 Ga0501034_0064438
2961 Ga0501034_0077255
2962 Ga0501034_0083948
2963 Ga0501034_0084598
2964 Ga0501034_0138358
2965 Ga0501034_0146984
2966 Ga0501034_0188858
2967 Ga0501034_0260908
2968 Ga0501036_0004850
2969 Ga0501036_0005392
2970 Ga0501036_0037639
2971 Ga0501036_0095997
2972 Ga0501036_0141145
2973 Ga0501036_0150811
2974 Ga0501037_0059689
2975 Ga0501038_0023535
2976 Ga0501038_0060833
2977 Ga0501038_0142917
2978 Ga0501039_0006301
2979 Ga0501039_0035972
2980 Ga0501039_0135554
2981 Ga0501039_0135897
2982 Ga0501039_0150147
2983 Ga0501040_0015717
2984 Ga0501040_0105671
2985 Ga0501040_0156375
2986 Ga0501040_0183039
2987 Ga0501041_0000595
2988 Ga0501042_0107794
2989 Ga0501043_0000968
2990 Ga0501043_0011997
2991 Ga0501043_0015809
2992 Ga0501043_0023122
2993 Ga0501046_0068465
2994 Ga0501047_0002405
2995 Ga0501047_0046221
2996 Ga0501047_0048700
2997 Ga0501047_0092700
2998 Ga0501048_0034333
2999 Ga0501048_0038363
3000 Ga0501048_0130554
3001 Ga0501067_0158456
3002 Ga0501068_0002617
3003 Ga0501068_0024198
3004 Ga0501068_0030856
3005 Ga0501068_0072373
3006 Ga0501069_0051884
3007 Ga0501070_0007638
3008 Ga0501070_0008540
3009 Ga0501070_0013485
3010 Ga0501070_0055670
3011 Ga0501071_0004558
3012 Ga0501071_0007947
3013 Ga0501071_0130990
3014 Ga0501072_0001774
3015 Ga0501072_0003342
3016 Ga0501072_0009049
3017 Ga0501073_0003357
3018 Ga0501073_0019661
3019 Ga0501073_0102042
3020 Ga0501074_0007746
3021 Ga0501074_0009044
3022 Ga0501075_0000022
3023 Ga0501075_0012917
3024 Ga0501075_0084305
3025 Ga0501075_0242484
3026 Ga0501076_0000064
3027 Ga0501076_0005444
3028 Ga0501076_0080723
3029 Ga0501211_001107
3030 Ga0501079_0018023
3031 Ga0501079_0034862
3032 Ga0501079_0133224
3033 Ga0501080_0000215
3034 Ga0501080_0015214
3035 Ga0501080_0015700
3036 Ga0501080_0055837
3037 Ga0501080_0074541
3038 Ga0501080_0136053
3039 Ga0501081_0001088
3040 Ga0501081_0010150
3041 Ga0501081_0015534
3042 Ga0501081_0064583
3043 Ga0501081_0084778
3044 Ga0501083_0000789
3045 Ga0501083_0031849
3046 Ga0501269_000020
3047 Ga0501274_000600
3048 Ga0501279_000207
3049 Ga0501035_0032945
3050 Ga0501035_0046242
3051 Ga0501044_0042984
3052 Ga0501044_0144288
3053 Ga0501044_0228285
3054 Ga0501045_0000675
3055 nmdc:mga03683_875_c1
3056 nmdc:mga00v17_26842_c1
3057 nmdc:mga00v17_2902_c1
3058 nmdc:mga00v17_8646_c1
3059 nmdc:mga0k408_105246_c1
3060 nmdc:mga06z11_107269_c1
3061 nmdc:mga06z11_155858_c1
3062 nmdc:mga06z11_36014_c1
3063 nmdc:mga07m45_11762_c2
3064 nmdc:mga07m45_1241_c1
3065 nmdc:mga07m45_98600_c1
3066 nmdc:mga05p37_110000_c1
3067 nmdc:mga05p37_44215_c1
3068 nmdc:mga05p37_99354_c1
3069 nmdc:mga09592_1482_c1
3070 nmdc:mga09592_92414_c1
3071 nmdc:mga0qj67_1316_c1
3072 nmdc:mga0qj67_2105_c1
3073 nmdc:mga06r32_673_c1
3074 nmdc:mga08y16_47_c1
3075 nmdc:mga08y16_496914_c1
3076 nmdc:mga0a205_258341_c1
3077 Ga0500583_0010177
3078 Ga0500641_0013363
3079 Ga0500594_0008324
3080 Ga0500594_0030718
3081 Ga0500618_022912
3082 Ga0500621_000034
3083 Ga0500586_000088
3084 Ga0500604_0002607
3085 Ga0500616_0027204
3086 Ga0500622_0000097
3087 Ga0500622_0001549
3088 Ga0500634_0000157
3089 Ga0500636_0037199
3090 Ga0500552_000074
3091 Ga0501084_0009032
3092 Ga0501084_0021317
3093 Ga0501082_0003439
3094 Ga0501082_0030634
3095 Ga0501082_0053680
3096 Ga0501082_0134641
3097 Ga0466962_0030745
3098 Ga0530510_0000334
3099 Ga0530510_0003950
3100 Ga0530510_0107945
3101 Ga0530510_0137828
3102 2506576637
3103 2506581775
3104 2508727683
3105 2508850579
3106 2509079887
3107 2511379082
3108 2511437391
3109 2512036312
3110 2523106638
3111 2523467758
3112 2524611179
3113 2538426321
3114 2547371150
3115 2547696525
3116 2555262018
3117 2562465892
3118 2585826221
3119 2585830749
3120 2587730364
3121 2587736865
3122 2587756620
3123 2588291769
3124 2596375400
3125 2599101549
3126 2599412894
3127 2599928646
3128 2601525635
3129 2601530756
3130 2601533936
3131 2601540104
3132 2601617755
3133 2601622790
3134 2601644665
3135 2601651063
3136 2601656112
3137 2601661036
3138 2601664830
3139 2601669210
3140 2601697302
3141 2601702690
3142 2601708878
3143 2601713916
3144 2601718961
3145 2601722651
3146 2601728918
3147 2601733907
3148 2601738883
3149 2601743309
3150 2601754435
3151 2601758913
3152 2601762737
3153 2602021376
3154 2603640589
3155 2603644629
3156 2603662853
3157 2603667750
3158 2603700482
3159 2603705903
3160 2603841432
3161 2603846439
3162 2603851514
3163 2603856645
3164 2603868497
3165 2603874161
3166 2603878559
3167 2606051404
3168 2606072319
3169 2606149090
3170 2606179232
3171 2608671122
3172 2609912008
3173 2637227191
3174 2643745762
3175 2643789721
3176 2643796836
3177 2643912750
3178 2643936834
3179 2643966733
3180 2644165619
3181 2644214552
3182 2644221665
3183 2644249923
3184 2644257570
3185 2644318735
3186 2644348539
3187 2644358602
3188 2644413252
3189 2644470059
3190 2644729630
3191 2644743822
3192 2649121482
3193 2650898222
3194 2652974400
3195 2656276467
3196 2671103744
3197 2671106530
3198 2671586831
3199 2676409844
3200 2681996818
3201 2682008592
3202 2686355136
3203 2689443014
3204 2707101642
3205 2712472375
3206 2715499061
3207 2738739518
3208 2738745318
3209 2738827601
3210 2738846095
3211 2739058556
3212 2739151397
3213 2739193317
3214 2739275752
3215 2739319793
3216 2739338034
3217 2739344796
3218 2739349208
3219 2739354548
3220 2753854537
3221 2765587389
3222 2772437168
3223 2774869130
3224 2775540778
3225 2777021589
3226 2791924225
3227 2792313299
3228 2793406955
3229 2807177926
3230 2809127501
3231 2809147162
3232 2813730650
3233 2814698257
3234 2821121400
3235 2821136022
3236 2821444390
3237 2823377492
3238 2829749764
3239 2831866642
3240 2835319679
3241 2841764860
3242 2842338716
3243 2842703090
3244 2842713022
3245 2843691642
3246 2844107692
3247 2844426090
3248 2844530183
3249 2844539647
3250 2846037068
3251 2846040140
3252 2846540983
3253 2846953726
3254 2847089150
3255 2847798138
3256 2848860090
3257 2851183547
3258 2851249798
3259 2852106149
3260 2854603093
3261 2855196638
3262 2857549342
3263 2857555575
3264 2857562984
3265 2857569223
3266 2858466515
3267 2861693477
3268 2865016460
3269 2869552418
3270 2871273288
3271 2871282647
3272 2876605334
3273 2881612968
3274 2881716614
3275 2882457641
3276 2884090565
3277 2884301193
3278 2885085983
3279 2886853241
3280 2888367220
3281 2888375115
3282 2889310042
3283 2891672293
3284 2894236137
3285 2897806983
3286 2900054722
3287 2900055939
3288 2902333883
3289 2902405635
3290 2904429396
3291 2904474322
3292 2904507089
3293 2904516086
3294 2908673080
3295 2909042723
3296 2917554545
3297 2919112801
3298 2919150669
3299 2919479369
3300 2919496725
3301 2919498240
3302 2919545301
3303 2923526953
3304 2923637920
3305 2927145542
3306 2927835635
3307 2928129612
3308 2932404908
3309 2932406520
3310 2932414464
3311 2932421015
3312 2935627891
3313 2937540055
3314 2937970785
3315 2939571619
3316 2939575995
3317 2939578058
3318 2939605970
3319 2939609526
3320 2939619690
3321 2939645974
3322 2939673491
3323 2945879834
3324 2969084205
3325 2971825712
3326 2974313680
3327 2974436919
3328 2978978153
3329 2984495131
3330 2984561285
3331 2984599355
3332 2990263211
3333 3000380568
3334 3003670689
3335 640936172
3336 8004597880
3337 8015396098
3338 8016734410
3339 8018224975
3340 8018409977
3341 8019503470
3342 8019506788
3343 8047676897
3344 8054008459
3345 8054360722
3346 8054848619
3347 8054850079
3348 8055091498
3349 8055092801
3350 8055100714
3351 8055694613
3352 8057307388
3353 8057533116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

26

88

0.98

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

99

331

0.97

PF07831

PYNP_C

Pyrimidine nucleoside phosphorylase C-terminal domain

371

445

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ey3-assembly1.cif.gz_B x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate 0.9766 1 428
5ey3-assembly1.cif.gz_B x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate 0.9698 1 428
1azy-assembly1.cif.gz_A structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase 0.9629 1 430
1azy-assembly1.cif.gz_A structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase 0.9607 1 430
2dsj-assembly1.cif.gz_B crystal structure of project id tt0128 from thermus thermophilus hb8 0.9469 2 422
ID Description Score Start End Superfamily
af_Q2FWC1_1_67_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 1.001 2 67 1.20.970.10
4eadA02 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.998 70 336 3.40.1030.10
5olnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9963 4 67 1.20.970.10
af_P9WFS1_8_72_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.996 5 68 1.20.970.10
2j0fB01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9958 2 68 1.20.970.10
ID Description Score Start End GO Terms
AF-A0A5U6KV10-F1-model_v4 thymidine phosphorylase (EC 2.4.2.4) 1.001 1 144 GO:0004645
GO:0005829
GO:0006206
GO:0009032
AF-A0A5T6JWY9-F1-model_v4 thymidine phosphorylase (EC 2.4.2.4) 1.001 1 116 GO:0004645
GO:0005829
GO:0006206
GO:0009032
AF-A0A2J4ZLI0-F1-model_v4 Thymidine phosphorylase 1.001 1 91 GO:0004645
GO:0005829
GO:0006206
GO:0009032
AF-A0A2X2SWI6-F1-model_v4 thymidine phosphorylase (EC 2.4.2.4) 0.9996 1 265 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-A0A5C9AK12-F1-model_v4 Thymidine phosphorylase (EC 2.4.2.4) 0.999 1 297 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032

Map