F495303

General Info

Members Datasets Scaffolds Average Seq Length
1679 680 1496 251

Family's Representative Sequence

Representative Sequence 3300027512|Ga0209179_1024849|Ga0209179_10248492
Length 247
Sequence MTDAIRPLIAGNWKMNGLRASLGEFEAMRAGASEVADKADLLVCPPATLIAAFVERAGGSRTVAVGAQDCHPDASGPHTGDISAEMLADAGASAIIVGHSERRADHGETDVLVRQKTEAVWRAGLTAIVCIGETQRQRLDICRGQLNVSLPDGARADNLVVAYEPVWAIGTGLTPTAEDVEQIHRFIRELLAARFNQEGSRIRILYGGSVKPSNASELMAVANVNGALVGGASLKAADFLAIARSCP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
21 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
22 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
23 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2791355199
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
38 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
39 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
40 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
41 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
42 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
43 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
44 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
48 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
49 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
50 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
51 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
52 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
53 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
54 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
55 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
56 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
57 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
58 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
59 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
60 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
61 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
62 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
63 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
64 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
65 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
66 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
67 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
68 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
69 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
70 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
71 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
72 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
73 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
74 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
75 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
76 2904699407
77 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
78 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
79 2906610324
80 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
81 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
82 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
83 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
84 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
85 2909042592 Labrys sp. LIt4 Isolate Nodule
86 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
87 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
88 2922368715
89 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
90 2922425934
91 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
92 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
93 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
94 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
95 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
96 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
97 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
98 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
99 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
100 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
103 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
104 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
105 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
106 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
107 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
108 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
109 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
110 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
111 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
112 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
113 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
114 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
115 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
116 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
117 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
118 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
119 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
120 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
121 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
122 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
123 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
124 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
125 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
126 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
127 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
128 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
129 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
130 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
131 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
132 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
133 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
134 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
135 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
136 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
137 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
138 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
139 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
140 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
141 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
142 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
143 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
144 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
145 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
146 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
147 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
148 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
149 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
150 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
151 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
152 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
153 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
155 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
156 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
157 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
158 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
159 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
160 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
161 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
162 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
163 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
164 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
165 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
166 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
167 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
168 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
169 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
170 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
171 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
172 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
173 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
174 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
175 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
176 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
177 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
178 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
179 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
180 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
181 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
182 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
183 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
184 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
185 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
186 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
187 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
188 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
189 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
190 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
191 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
192 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
193 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
194 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
195 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
198 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
199 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
200 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
203 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
204 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
205 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
206 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
207 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
208 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
209 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
210 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
211 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
212 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
213 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
214 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
215 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
216 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
217 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
218 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
219 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
220 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
221 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
222 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
223 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
224 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
225 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
226 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
227 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
228 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
229 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
230 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
231 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
232 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
233 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
234 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
235 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
236 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
237 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
238 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
239 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
240 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
241 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
242 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
243 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
244 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
245 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
246 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
247 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
248 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
249 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
250 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
251 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
252 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
253 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
254 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
255 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
258 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
259 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
260 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
261 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
262 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
263 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
264 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
265 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
266 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
267 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
268 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
269 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
270 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
271 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
272 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
273 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
274 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
276 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
277 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
279 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
282 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
284 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
348 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
349 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
350 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
351 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
354 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
355 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
359 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
360 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
361 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
362 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
363 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
364 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
365 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
366 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
367 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
368 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
369 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
370 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
371 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
372 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
373 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
374 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
375 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
376 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
377 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
378 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
379 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
380 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
381 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
382 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
383 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
384 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
385 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
386 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
387 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
388 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
389 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
390 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
391 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
392 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
393 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
394 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
395 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
396 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
397 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
398 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
399 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
400 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
401 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
402 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
403 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
404 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
405 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
406 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
407 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
408 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
409 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
410 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
411 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
412 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
413 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
414 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
415 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
416 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
417 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
418 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
419 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
420 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
421 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
422 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
423 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
424 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
425 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
426 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
427 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
428 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
429 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
430 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
431 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
432 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
433 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
434 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
435 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
436 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
437 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
438 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
439 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
440 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
441 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
442 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
443 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
444 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
445 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
446 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
447 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
448 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
449 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
450 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
451 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
452 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
453 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
454 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
455 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
456 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
457 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
458 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
459 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
460 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
461 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
462 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
463 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
464 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
465 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
466 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
467 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
468 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
469 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
470 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
471 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
472 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
473 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
474 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
475 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
476 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
477 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
478 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
479 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
480 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
481 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
482 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
483 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
484 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
485 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
486 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
487 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
488 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
489 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
490 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
491 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
492 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
493 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
494 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
495 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
496 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
497 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
498 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
499 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
500 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
501 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
502 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
503 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
504 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
505 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
506 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
507 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
508 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
509 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
510 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
511 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
512 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
513 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
514 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
515 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
516 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
517 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
518 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
519 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
520 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
521 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
522 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
523 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
524 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
525 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
526 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
527 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
528 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
529 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
530 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
531 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
532 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
533 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
534 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
535 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
536 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
537 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
538 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
539 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
540 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
541 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
542 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
558 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
559 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
560 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
561 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
562 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
563 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
564 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
565 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
566 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
567 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
568 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
569 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
570 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
571 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
572 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
574 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
575 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
576 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
577 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
578 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
579 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
580 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
581 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
582 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
583 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
584 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
585 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
586 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
587 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
588 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
589 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
590 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
591 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
592 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
593 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
594 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
595 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
596 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
597 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
598 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
599 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
600 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
601 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
602 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
603 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
604 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
605 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
606 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
607 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
608 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
609 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
610 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
611 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
612 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
613 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
614 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
615 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
616 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
617 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
618 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
619 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
620 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
621 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
622 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
623 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
624 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
625 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
626 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
627 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
628 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
629 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
630 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
631 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
632 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
633 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
634 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
635 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
636 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
637 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
638 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
639 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
640 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
641 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
642 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
643 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
644 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
645 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
646 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
647 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
648 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
649 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
650 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
651 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
652 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
653 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
654 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
655 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
656 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
657 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
658 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
659 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
660 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
661 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
662 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
663 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
664 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
665 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
666 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
667 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
668 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
669 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
670 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
671 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
672 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
673 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
674 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
675 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
676 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
677 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
678 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
679 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
680 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.19
Metatranscriptomes 0.18
Isolates 10.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 8.22
Rhizoplane 7.03
Rhizosphere 65.46
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10006044 3300002075 Bacteria 2866
2 JGI25406J46586_10001492 3300003203 Bacteria 11045
3 JGI25153J46596_10009281 3300003215 Bacteria 4597
4 JGI25153J46596_10009680 3300003215 Bacteria 4439
5 JGI25153J46596_10014678 3300003215 Bacteria 3241
6 JGI25153J46596_10015191 3300003215 Bacteria 3153
7 JGI25160J50197_1008733 3300003354 Bacteria 3836
8 JGI25160J50197_1011756 3300003354 Bacteria 3078
9 JGI25404J52841_10015065 3300003659 Bacteria 1679
10 Ga0055530_10010917 3300003791 Bacteria 3305
11 Ga0055531_10001195 3300003794 Bacteria 19919
12 Ga0055531_10003993 3300003794 Bacteria 9150
13 Ga0070658_10338462 3300005327 Bacteria 1287
14 Ga0070658_10384769 3300005327 Bacteria 1204
15 Ga0070676_10013022 3300005328 Bacteria 4557
16 Ga0070683_100276774 3300005329 Bacteria 1597
17 Ga0070690_100331020 3300005330 Bacteria 1100
18 Ga0070670_100193124 3300005331 Bacteria 1769
19 Ga0070670_100350836 3300005331 Bacteria 1296
20 Ga0068869_100102291 3300005334 Bacteria 2168
21 Ga0068869_100114761 3300005334 Bacteria 2053
22 Ga0070680_100013526 3300005336 Bacteria 6357
23 Ga0070680_100016985 3300005336 Bacteria 5730
24 Ga0070680_100175148 3300005336 Bacteria 1806
25 Ga0070680_100435939 3300005336 Bacteria 1119
26 Ga0070682_100036640 3300005337 Bacteria 2999
27 Ga0070682_100264717 3300005337 Bacteria 1246
28 Ga0068868_100003958 3300005338 Bacteria 10340
29 Ga0068868_100011518 3300005338 Bacteria 6441
30 Ga0070660_100017870 3300005339 Bacteria 5173
31 Ga0070689_100064814 3300005340 Bacteria 2845
32 Ga0070691_10083779 3300005341 Bacteria 1565
33 Ga0070661_100101272 3300005344 Bacteria 2143
34 Ga0070668_100042528 3300005347 Bacteria 3483
35 Ga0070668_100153283 3300005347 Bacteria 1865
36 Ga0070668_100268800 3300005347 Bacteria 1420
37 Ga0070669_100090979 3300005353 Bacteria 2288
38 Ga0070669_100527332 3300005353 Bacteria 982
39 Ga0070675_100187545 3300005354 Bacteria 1791
40 Ga0070671_100011296 3300005355 Bacteria 7175
41 Ga0070671_100015678 3300005355 Bacteria 6124
42 Ga0070671_100086510 3300005355 Bacteria 2623
43 Ga0070674_100026165 3300005356 Bacteria 3808
44 Ga0070673_100425115 3300005364 Bacteria 1192
45 Ga0070688_100006780 3300005365 Bacteria 6141
46 Ga0070688_100028217 3300005365 Bacteria 3348
47 Ga0070659_100050790 3300005366 Bacteria 3260
48 Ga0070667_100028910 3300005367 Bacteria 4616
49 Ga0070667_100087889 3300005367 Bacteria 2668
50 Ga0070709_10005966 3300005434 Bacteria 6615
51 Ga0070709_10007727 3300005434 Bacteria 5904
52 Ga0070709_10015676 3300005434 Bacteria 4316
53 Ga0070709_10154349 3300005434 Bacteria 1590
54 Ga0070709_10611680 3300005434 Bacteria 840
55 Ga0070714_100009892 3300005435 Bacteria 7520
56 Ga0070714_100029375 3300005435 Bacteria 4571
57 Ga0070714_100036016 3300005435 Bacteria 4149
58 Ga0070714_100088688 3300005435 Bacteria 2707
59 Ga0070714_100130627 3300005435 Bacteria 2244
60 Ga0070713_100004379 3300005436 Bacteria 9485
61 Ga0070713_100010400 3300005436 Bacteria 6719
62 Ga0070713_100021269 3300005436 Bacteria 4986
63 Ga0070713_100074356 3300005436 Bacteria 2879
64 Ga0070713_100101791 3300005436 Bacteria 2489
65 Ga0070713_100467968 3300005436 Bacteria 1186
66 Ga0070710_10000344 3300005437 Bacteria 22093
67 Ga0070710_10000395 3300005437 Bacteria 20362
68 Ga0070710_10007756 3300005437 Bacteria 5207
69 Ga0070710_10013495 3300005437 Bacteria 4095
70 Ga0070701_10086418 3300005438 Bacteria 1709
71 Ga0070711_100000702 3300005439 Bacteria 17552
72 Ga0070711_100013855 3300005439 Bacteria 5072
73 Ga0070711_100054002 3300005439 Bacteria 2771
74 Ga0070711_100154357 3300005439 Bacteria 1734
75 Ga0070711_100263486 3300005439 Bacteria 1357
76 Ga0070663_100007150 3300005455 Bacteria 6777
77 Ga0070663_100027479 3300005455 Bacteria 3865
78 Ga0070663_100162013 3300005455 Bacteria 1722
79 Ga0070663_100227965 3300005455 Bacteria 1466
80 Ga0070678_100009881 3300005456 Bacteria 5799
81 Ga0070678_100034185 3300005456 Bacteria 3538
82 Ga0070678_100092332 3300005456 Bacteria 2325
83 Ga0070662_100117538 3300005457 Bacteria 2034
84 Ga0070662_100307659 3300005457 Bacteria 1289
85 Ga0070662_100323031 3300005457 Bacteria 1259
86 Ga0070681_10203620 3300005458 Bacteria 1897
87 Ga0070681_10209729 3300005458 Bacteria 1864
88 Ga0070681_10358218 3300005458 Bacteria 1369
89 Ga0070685_10007975 3300005466 Bacteria 5427
90 Ga0070685_10030623 3300005466 Bacteria 3000
91 Ga0070685_10201983 3300005466 Bacteria 1292
92 Ga0070679_100028788 3300005530 Bacteria 5479
93 Ga0070679_100056398 3300005530 Bacteria 3914
94 Ga0070679_100243480 3300005530 Bacteria 1756
95 Ga0070684_100021896 3300005535 Bacteria 5324
96 Ga0070684_100032076 3300005535 Bacteria 4475
97 Ga0070684_100141149 3300005535 Bacteria 2178
98 Ga0070684_100456791 3300005535 Bacteria 1181
99 Ga0068853_100007032 3300005539 Bacteria 8995
100 Ga0068853_100018974 3300005539 Bacteria 5697
101 Ga0068853_100290030 3300005539 Bacteria 1510
102 Ga0068853_100514028 3300005539 Bacteria 1132
103 Ga0070672_100115669 3300005543 Bacteria 2190
104 Ga0070672_100269487 3300005543 Bacteria 1437
105 Ga0070672_100414845 3300005543 Bacteria 1156
106 Ga0070672_100629406 3300005543 Bacteria 936
107 Ga0070686_100012110 3300005544 Bacteria 4908
108 Ga0070695_100267217 3300005545 Bacteria 1251
109 Ga0070696_100225617 3300005546 Bacteria 1407
110 Ga0070693_100034460 3300005547 Bacteria 2801
111 Ga0070665_100016641 3300005548 Bacteria 7369
112 Ga0070665_100099989 3300005548 Bacteria 2904
113 Ga0070665_100123757 3300005548 Bacteria 2588
114 Ga0070665_100259127 3300005548 Bacteria 1740
115 Ga0070665_100266730 3300005548 Bacteria 1713
116 Ga0070665_100392500 3300005548 Bacteria 1395
117 Ga0070665_100739589 3300005548 Bacteria 997
118 Ga0068855_100024338 3300005563 Bacteria 7247
119 Ga0068855_100043049 3300005563 Bacteria 5350
120 Ga0068855_100049847 3300005563 Bacteria 4936
121 Ga0068855_100076413 3300005563 Bacteria 3887
122 Ga0068855_100101580 3300005563 Bacteria 3310
123 Ga0068855_100132096 3300005563 Bacteria 2850
124 Ga0068855_100162720 3300005563 Bacteria 2531
125 Ga0068855_100482974 3300005563 Bacteria 1348
126 Ga0070664_100198428 3300005564 Bacteria 1790
127 Ga0068857_100024325 3300005577 Bacteria 5331
128 Ga0068857_100071597 3300005577 Bacteria 3088
129 Ga0068857_100192669 3300005577 Bacteria 1857
130 Ga0068857_100400913 3300005577 Bacteria 1276
131 Ga0068854_100015803 3300005578 Bacteria 5012
132 Ga0068856_100007904 3300005614 Bacteria 10390
133 Ga0068856_100063923 3300005614 Bacteria 3636
134 Ga0068856_100086868 3300005614 Bacteria 3108
135 Ga0068856_100153160 3300005614 Bacteria 2315
136 Ga0068856_100224895 3300005614 Bacteria 1892
137 Ga0068856_100549921 3300005614 Bacteria 1175
138 Ga0068852_100063265 3300005616 Bacteria 3222
139 Ga0068859_100058087 3300005617 Bacteria 3896
140 Ga0068859_100100410 3300005617 Bacteria 2949
141 Ga0068859_100978039 3300005617 Bacteria 929
142 Ga0068864_100050145 3300005618 Bacteria 3592
143 Ga0068864_100058520 3300005618 Bacteria 3331
144 Ga0068864_100186187 3300005618 Bacteria 1900
145 Ga0068864_100426410 3300005618 Bacteria 1264
146 Ga0068866_10111148 3300005718 Bacteria 1529
147 Ga0068866_10175444 3300005718 Bacteria 1261
148 Ga0068866_10186540 3300005718 Bacteria 1229
149 Ga0068866_10304992 3300005718 Bacteria 996
150 Ga0068861_100153715 3300005719 Bacteria 1890
151 Ga0068861_100180027 3300005719 Bacteria 1759
152 Ga0068861_100447729 3300005719 Bacteria 1156
153 Ga0068851_10006063 3300005834 Bacteria 5513
154 Ga0068863_100237338 3300005841 Bacteria 1760
155 Ga0068863_100273758 3300005841 Bacteria 1635
156 Ga0068858_100047295 3300005842 Bacteria 3988
157 Ga0068858_100406507 3300005842 Bacteria 1308
158 Ga0068858_100486121 3300005842 Bacteria 1192
159 Ga0068860_100000497 3300005843 Bacteria 48753
160 Ga0068860_100080702 3300005843 Bacteria 3093
161 Ga0068860_100211082 3300005843 Bacteria 1883
162 Ga0068860_100462526 3300005843 Bacteria 1262
163 Ga0068862_100245860 3300005844 Bacteria 1628
164 Ga0068862_100365685 3300005844 Bacteria 1341
165 Ga0081455_10001069 3300005937 Bacteria 34502
166 Ga0081455_10012384 3300005937 Bacteria 8511
167 Ga0081455_10016028 3300005937 Bacteria 7250
168 Ga0081455_10021328 3300005937 Bacteria 6079
169 Ga0081455_10026882 3300005937 Bacteria 5282
170 Ga0081455_10047175 3300005937 Bacteria 3733
171 Ga0081455_10057286 3300005937 Bacteria 3303
172 Ga0081538_10004388 3300005981 Bacteria 13027
173 Ga0081538_10038370 3300005981 Bacteria 3091
174 Ga0081538_10054726 3300005981 Bacteria 2356
175 Ga0081540_1002393 3300005983 Bacteria 15301
176 Ga0081540_1003961 3300005983 Bacteria 11505
177 Ga0081540_1005402 3300005983 Bacteria 9541
178 Ga0081540_1013623 3300005983 Bacteria 5273
179 Ga0081540_1016233 3300005983 Bacteria 4672
180 Ga0081540_1020841 3300005983 Bacteria 3927
181 Ga0081540_1025112 3300005983 Bacteria 3440
182 Ga0081540_1031237 3300005983 Bacteria 2933
183 Ga0081540_1034946 3300005983 Bacteria 2702
184 Ga0081540_1058821 3300005983 Bacteria 1848
185 Ga0081540_1136757 3300005983 Bacteria 991
186 Ga0081539_10000379 3300005985 Bacteria 97134
187 Ga0081539_10001555 3300005985 Bacteria 38208
188 Ga0081539_10018827 3300005985 Bacteria 4760
189 Ga0070717_10000224 3300006028 Bacteria 39308
190 Ga0070717_10002876 3300006028 Bacteria 12213
191 Ga0070717_10057087 3300006028 Bacteria 3227
192 Ga0070717_10072326 3300006028 Bacteria 2879
193 Ga0070717_10106427 3300006028 Bacteria 2388
194 Ga0070717_10107691 3300006028 Bacteria 2374
195 Ga0075365_10001527 3300006038 Bacteria 10583
196 Ga0075365_10031975 3300006038 Bacteria 3379
197 Ga0075365_10042446 3300006038 Bacteria 2973
198 Ga0075365_10066502 3300006038 Bacteria 2418
199 Ga0075365_10073284 3300006038 Bacteria 2308
200 Ga0075365_10118132 3300006038 Bacteria 1827
201 Ga0075365_10126379 3300006038 Bacteria 1767
202 Ga0075365_10258049 3300006038 Bacteria 1225
203 Ga0075368_10002837 3300006042 Bacteria 5719
204 Ga0075368_10005831 3300006042 Bacteria 4258
205 Ga0075368_10020493 3300006042 Bacteria 2505
206 Ga0075368_10032889 3300006042 Bacteria 2016
207 Ga0075368_10048271 3300006042 Bacteria 1687
208 Ga0075368_10080844 3300006042 Bacteria 1322
209 Ga0075363_100010269 3300006048 Bacteria 4436
210 Ga0075363_100017003 3300006048 Bacteria 3601
211 Ga0075363_100213795 3300006048 Bacteria 1104
212 Ga0075364_10039692 3300006051 Bacteria 3052
213 Ga0075364_10050143 3300006051 Bacteria 2724
214 Ga0075364_10060728 3300006051 Bacteria 2479
215 Ga0070715_10001633 3300006163 Bacteria 6629
216 Ga0070716_100004798 3300006173 Bacteria 6492
217 Ga0070716_100010255 3300006173 Bacteria 4694
218 Ga0070716_100013159 3300006173 Bacteria 4212
219 Ga0070716_100098727 3300006173 Bacteria 1785
220 Ga0070716_100108952 3300006173 Bacteria 1713
221 Ga0070716_100277977 3300006173 Bacteria 1154
222 Ga0070712_100009415 3300006175 Bacteria 6156
223 Ga0070712_100108299 3300006175 Bacteria 2069
224 Ga0070712_100181556 3300006175 Bacteria 1640
225 Ga0070712_100303697 3300006175 Bacteria 1292
226 Ga0070712_100633261 3300006175 Bacteria 908
227 Ga0075362_10005833 3300006177 Bacteria 4542
228 Ga0075367_10012090 3300006178 Bacteria 4590
229 Ga0075367_10240836 3300006178 Bacteria 1134
230 Ga0075367_10241596 3300006178 Bacteria 1132
231 Ga0075369_10049416 3300006186 Bacteria 1817
232 Ga0075366_10011006 3300006195 Bacteria 5093
233 Ga0075366_10068704 3300006195 Bacteria 2108
234 Ga0075366_10084529 3300006195 Bacteria 1897
235 Ga0075366_10095194 3300006195 Bacteria 1785
236 Ga0097621_100028885 3300006237 Bacteria 4375
237 Ga0097621_100348408 3300006237 Bacteria 1317
238 Ga0075370_10052522 3300006353 Bacteria 2312
239 Ga0075370_10089873 3300006353 Bacteria 1771
240 Ga0075370_10176574 3300006353 Bacteria 1256
241 Ga0068871_100042230 3300006358 Bacteria 3660
242 Ga0075428_100074465 3300006844 Bacteria 3709
243 Ga0075428_100897466 3300006844 Bacteria 940
244 Ga0075430_100024425 3300006846 Bacteria 5142
245 Ga0075434_100007100 3300006871 Bacteria 10345
246 Ga0075434_100330546 3300006871 Unclassified 1545
247 Ga0075434_100460050 3300006871 Bacteria 1293
248 Ga0075434_100613723 3300006871 Bacteria 1107
249 Ga0068865_100367686 3300006881 Bacteria 1169
250 Ga0075436_100081189 3300006914 Bacteria 2248
251 Ga0075436_100345800 3300006914 Bacteria 1071
252 Ga0097620_100058087 3300006931 Bacteria 3896
253 Ga0097620_100100398 3300006931 Bacteria 2949
254 Ga0097620_100977842 3300006931 Bacteria 929
255 Ga0099824_1003889 3300006942 Bacteria 21658
256 Ga0099822_1018677 3300006943 Bacteria 7180
257 Ga0099823_1024679 3300006944 Bacteria 5421
258 Ga0075435_100087656 3300007076 Bacteria 2565
259 Ga0099794_10003317 3300007265 Bacteria 6112
260 Ga0099794_10098671 3300007265 Bacteria 1456
261 Ga0099795_10003094 3300007788 Bacteria 4066
262 Ga0099795_10028013 3300007788 Bacteria 1911
263 Ga0105244_10074608 3300009036 Bacteria 1687
264 Ga0105240_10003456 3300009093 Bacteria 24510
265 Ga0105240_10012909 3300009093 Bacteria 11506
266 Ga0105240_10043532 3300009093 Bacteria 5712
267 Ga0105240_10071555 3300009093 Bacteria 4289
268 Ga0105240_10094483 3300009093 Bacteria 3647
269 Ga0105240_10209403 3300009093 Bacteria 2279
270 Ga0105240_10287268 3300009093 Bacteria 1887
271 Ga0105240_10354146 3300009093 Bacteria 1665
272 Ga0105240_10631035 3300009093 Bacteria 1176
273 Ga0111539_10041513 3300009094 Bacteria 5531
274 Ga0111539_10273642 3300009094 Bacteria 1965
275 Ga0111539_10288746 3300009094 Bacteria 1909
276 Ga0111539_10313558 3300009094 Bacteria 1826
277 Ga0111539_10656131 3300009094 Bacteria 1222
278 Ga0105245_10048518 3300009098 Bacteria 3799
279 Ga0105245_10062478 3300009098 Bacteria 3360
280 Ga0105245_10295203 3300009098 Bacteria 1588
281 Ga0105245_10898606 3300009098 Bacteria 927
282 Ga0105247_10033948 3300009101 Bacteria 3106
283 Ga0105247_10107324 3300009101 Bacteria 1793
284 Ga0105247_10310290 3300009101 Bacteria 1097
285 Ga0114129_10099524 3300009147 Bacteria 4024
286 Ga0114129_10100119 3300009147 Bacteria 4010
287 Ga0114129_10258935 3300009147 Bacteria 2333
288 Ga0105243_10042136 3300009148 Bacteria 3573
289 Ga0105241_10029805 3300009174 Bacteria 4074
290 Ga0105241_10082586 3300009174 Bacteria 2519
291 Ga0105241_10322680 3300009174 Bacteria 1332
292 Ga0105241_10375461 3300009174 Bacteria 1241
293 Ga0105241_10509816 3300009174 Bacteria 1074
294 Ga0105242_10278478 3300009176 Bacteria 1518
295 Ga0105242_10434735 3300009176 Bacteria 1233
296 Ga0105248_10032228 3300009177 Bacteria 5858
297 Ga0105248_10088266 3300009177 Bacteria 3490
298 Ga0105248_10221469 3300009177 Bacteria 2130
299 Ga0105248_10272994 3300009177 Bacteria 1904
300 Ga0105248_10299459 3300009177 Bacteria 1811
301 Ga0105237_10083404 3300009545 Bacteria 3188
302 Ga0105237_10205582 3300009545 Bacteria 1969
303 Ga0105237_10217788 3300009545 Bacteria 1909
304 Ga0105237_10247229 3300009545 Bacteria 1785
305 Ga0105237_10469786 3300009545 Bacteria 1264
306 Ga0105238_10015239 3300009551 Bacteria 7783
307 Ga0105238_10017873 3300009551 Bacteria 7209
308 Ga0105238_10039830 3300009551 Bacteria 4764
309 Ga0105238_10049070 3300009551 Bacteria 4253
310 Ga0105238_10056888 3300009551 Bacteria 3923
311 Ga0105238_10119143 3300009551 Bacteria 2620
312 Ga0105238_10126156 3300009551 Bacteria 2538
313 Ga0105238_10560042 3300009551 Bacteria 1148
314 Ga0105249_10088853 3300009553 Bacteria 2886
315 Ga0105249_10593228 3300009553 Bacteria 1162
316 Ga0105239_10007768 3300010375 Bacteria 12275
317 Ga0105239_10041053 3300010375 Bacteria 5070
318 Ga0105239_10047108 3300010375 Bacteria 4724
319 Ga0105239_10543654 3300010375 Bacteria 1323
320 Ga0105246_10027415 3300011119 Bacteria 3731
321 Ga0105246_10128931 3300011119 Bacteria 1886
322 Ga0105246_10142910 3300011119 Bacteria 1802
323 Ga0105246_10265888 3300011119 Bacteria 1369
324 Ga0105246_10319180 3300011119 Bacteria 1262
325 Ga0157339_1001999 3300012505 Bacteria 1330
326 Ga0157373_10054578 3300013100 Bacteria 2839
327 Ga0157373_10080298 3300013100 Bacteria 2300
328 Ga0157371_10087194 3300013102 Bacteria 2210
329 Ga0157370_10071166 3300013104 Bacteria 3282
330 Ga0157370_10245754 3300013104 Bacteria 1655
331 Ga0157369_10012284 3300013105 Bacteria 9726
332 Ga0157369_10047236 3300013105 Bacteria 4676
333 Ga0157369_10217338 3300013105 Bacteria 2001
334 Ga0157374_10038013 3300013296 Bacteria 4422
335 Ga0157374_10190078 3300013296 Bacteria 2008
336 Ga0157374_10733350 3300013296 Bacteria 1002
337 Ga0157378_10109936 3300013297 Bacteria 2525
338 Ga0157378_10438037 3300013297 Bacteria 1295
339 Ga0157378_10483300 3300013297 Bacteria 1234
340 Ga0163162_10117935 3300013306 Bacteria 2756
341 Ga0163162_10236196 3300013306 Bacteria 1958
342 Ga0157372_10061655 3300013307 Bacteria 4200
343 Ga0157372_10212623 3300013307 Bacteria 2241
344 Ga0157372_10462919 3300013307 Bacteria 1478
345 Ga0157375_10141087 3300013308 Bacteria 2537
346 Ga0157375_10195603 3300013308 Bacteria 2177
347 Ga0157375_10296391 3300013308 Bacteria 1780
348 Ga0157375_10514473 3300013308 Bacteria 1361
349 Ga0163163_10009676 3300014325 Bacteria 8623
350 Ga0163163_10036866 3300014325 Bacteria 4752
351 Ga0163163_10207624 3300014325 Bacteria 2007
352 Ga0163163_10288375 3300014325 Bacteria 1693
353 Ga0163163_10288660 3300014325 Bacteria 1693
354 Ga0157380_10080959 3300014326 Bacteria 2655
355 Ga0157380_10146325 3300014326 Bacteria 2037
356 Ga0157377_10189865 3300014745 Bacteria 1298
357 Ga0157377_10231667 3300014745 Bacteria 1188
358 Ga0157377_10270908 3300014745 Bacteria 1109
359 Ga0157379_10173043 3300014968 Bacteria 1949
360 Ga0157379_10249068 3300014968 Bacteria 1612
361 Ga0157379_10351511 3300014968 Bacteria 1349
362 Ga0157376_10059767 3300014969 Bacteria 3197
363 Ga0157376_10104151 3300014969 Bacteria 2486
364 Ga0157376_10116336 3300014969 Bacteria 2362
365 Ga0157376_10175130 3300014969 Bacteria 1956
366 Ga0163161_10113354 3300017792 Bacteria 2029
367 Ga0163161_10222549 3300017792 Bacteria 1462
368 Ga0163161_10239596 3300017792 Bacteria 1410
369 Ga0197907_11209949 3300020069 Bacteria 1419
370 Ga0206354_10920056 3300020081 Bacteria 920
371 Ga0206353_10108935 3300020082 Bacteria 874
372 Ga0209563_104891 3300025230 Bacteria 2501
373 Ga0209233_1002215 3300025261 Bacteria 7293
374 Ga0209676_1000327 3300025292 Bacteria 91596
375 Ga0209564_1001796 3300025295 Bacteria 19822
376 Ga0209564_1003203 3300025295 Bacteria 11497
377 Ga0209564_1047021 3300025295 Bacteria 1092
378 Ga0209758_1000371 3300025297 Bacteria 78923
379 Ga0209758_1001291 3300025297 Bacteria 30796
380 Ga0209758_1001559 3300025297 Bacteria 26277
381 Ga0209758_1003458 3300025297 Bacteria 14328
382 Ga0209758_1011126 3300025297 Bacteria 5256
383 Ga0209758_1014744 3300025297 Bacteria 4124
384 Ga0209758_1085607 3300025297 Bacteria 938
385 Ga0209050_1001093 3300025298 Bacteria 32922
386 Ga0207426_1000352 3300025302 Bacteria 84141
387 Ga0207426_1005546 3300025302 Bacteria 5737
388 Ga0209257_1000609 3300025304 Bacteria 58413
389 Ga0207697_10014505 3300025315 Bacteria 3268
390 Ga0207697_10070251 3300025315 Bacteria 1466
391 Ga0207656_10007348 3300025321 Bacteria 4007
392 Ga0207682_10003960 3300025893 Bacteria 6310
393 Ga0207692_10000724 3300025898 Bacteria 11629
394 Ga0207692_10010688 3300025898 Bacteria 3879
395 Ga0207692_10253297 3300025898 Bacteria 1056
396 Ga0207642_10149832 3300025899 Bacteria 1240
397 Ga0207710_10005547 3300025900 Bacteria 5429
398 Ga0207710_10216016 3300025900 Bacteria 951
399 Ga0207710_10235481 3300025900 Bacteria 912
400 Ga0207688_10033354 3300025901 Bacteria 2847
401 Ga0207688_10054478 3300025901 Bacteria 2244
402 Ga0207688_10062052 3300025901 Bacteria 2107
403 Ga0207688_10077716 3300025901 Bacteria 1892
404 Ga0207680_10052069 3300025903 Bacteria 2451
405 Ga0207680_10124672 3300025903 Bacteria 1689
406 Ga0207647_10004508 3300025904 Bacteria 10321
407 Ga0207647_10015943 3300025904 Bacteria 5137
408 Ga0207647_10166333 3300025904 Bacteria 1285
409 Ga0207685_10000490 3300025905 Bacteria 6723
410 Ga0207685_10046559 3300025905 Bacteria 1651
411 Ga0207699_10001497 3300025906 Bacteria 11087
412 Ga0207699_10002390 3300025906 Bacteria 8860
413 Ga0207699_10021380 3300025906 Bacteria 3486
414 Ga0207699_10094410 3300025906 Bacteria 1884
415 Ga0207643_10040058 3300025908 Bacteria 2637
416 Ga0207705_10100992 3300025909 Bacteria 2122
417 Ga0207705_10243255 3300025909 Bacteria 1371
418 Ga0207705_10352742 3300025909 Bacteria 1134
419 Ga0207684_10545295 3300025910 Bacteria 992
420 Ga0207654_10000344 3300025911 Bacteria 27758
421 Ga0207654_10034166 3300025911 Bacteria 2824
422 Ga0207654_10080204 3300025911 Bacteria 1962
423 Ga0207654_10200746 3300025911 Bacteria 1313
424 Ga0207707_10038828 3300025912 Bacteria 4161
425 Ga0207707_10103434 3300025912 Bacteria 2489
426 Ga0207707_10132454 3300025912 Bacteria 2180
427 Ga0207707_10387875 3300025912 Bacteria 1200
428 Ga0207695_10000015 3300025913 Bacteria 803205
429 Ga0207695_10000402 3300025913 Bacteria 96771
430 Ga0207695_10026603 3300025913 Bacteria 6456
431 Ga0207695_10037699 3300025913 Bacteria 5214
432 Ga0207695_10089621 3300025913 Bacteria 3093
433 Ga0207695_10148509 3300025913 Bacteria 2285
434 Ga0207671_10001316 3300025914 Bacteria 29070
435 Ga0207671_10053672 3300025914 Bacteria 2986
436 Ga0207693_10003086 3300025915 Bacteria 14356
437 Ga0207693_10018422 3300025915 Bacteria 5562
438 Ga0207693_10020465 3300025915 Bacteria 5262
439 Ga0207693_10035146 3300025915 Bacteria 3951
440 Ga0207693_10051463 3300025915 Bacteria 3232
441 Ga0207693_10346168 3300025915 Bacteria 1163
442 Ga0207663_10001974 3300025916 Bacteria 9722
443 Ga0207663_10005570 3300025916 Bacteria 6356
444 Ga0207663_10025028 3300025916 Bacteria 3444
445 Ga0207663_10057238 3300025916 Bacteria 2455
446 Ga0207663_10082371 3300025916 Bacteria 2110
447 Ga0207660_10002465 3300025917 Bacteria 12153
448 Ga0207660_10022470 3300025917 Bacteria 4250
449 Ga0207657_10019503 3300025919 Bacteria 6437
450 Ga0207657_10027909 3300025919 Bacteria 5161
451 Ga0207657_10066342 3300025919 Bacteria 3072
452 Ga0207657_10258441 3300025919 Bacteria 1386
453 Ga0207652_10002286 3300025921 Bacteria 16255
454 Ga0207652_10175524 3300025921 Bacteria 1924
455 Ga0207652_10533685 3300025921 Bacteria 1055
456 Ga0207681_10273578 3300025923 Bacteria 1327
457 Ga0207694_10000095 3300025924 Bacteria 99130
458 Ga0207694_10028380 3300025924 Bacteria 4266
459 Ga0207694_10040730 3300025924 Bacteria 3578
460 Ga0207694_10054256 3300025924 Bacteria 3109
461 Ga0207650_10054104 3300025925 Bacteria 2976
462 Ga0207650_10227353 3300025925 Bacteria 1504
463 Ga0207659_10152389 3300025926 Bacteria 1806
464 Ga0207687_10008392 3300025927 Bacteria 6758
465 Ga0207687_10077091 3300025927 Bacteria 2396
466 Ga0207687_10298241 3300025927 Bacteria 1297
467 Ga0207687_10316001 3300025927 Bacteria 1263
468 Ga0207687_10411048 3300025927 Bacteria 1115
469 Ga0207700_10004634 3300025928 Bacteria 8144
470 Ga0207700_10012786 3300025928 Bacteria 5428
471 Ga0207700_10017235 3300025928 Bacteria 4820
472 Ga0207700_10060010 3300025928 Bacteria 2879
473 Ga0207700_10071819 3300025928 Bacteria 2666
474 Ga0207700_10074945 3300025928 Bacteria 2620
475 Ga0207700_10092425 3300025928 Bacteria 2392
476 Ga0207700_10392555 3300025928 Bacteria 1215
477 Ga0207664_10005861 3300025929 Bacteria 8404
478 Ga0207664_10055230 3300025929 Bacteria 3151
479 Ga0207664_10060623 3300025929 Bacteria 3016
480 Ga0207664_10081041 3300025929 Bacteria 2640
481 Ga0207644_10010381 3300025931 Bacteria 6138
482 Ga0207644_10024814 3300025931 Bacteria 4118
483 Ga0207644_10284045 3300025931 Bacteria 1329
484 Ga0207644_10455504 3300025931 Bacteria 1051
485 Ga0207690_10080890 3300025932 Bacteria 2268
486 Ga0207690_10173761 3300025932 Bacteria 1616
487 Ga0207706_10012740 3300025933 Bacteria 7654
488 Ga0207706_10212076 3300025933 Bacteria 1697
489 Ga0207686_10012373 3300025934 Bacteria 4692
490 Ga0207686_10046906 3300025934 Bacteria 2668
491 Ga0207709_10052202 3300025935 Bacteria 2510
492 Ga0207670_10030422 3300025936 Bacteria 3450
493 Ga0207670_10317589 3300025936 Bacteria 1225
494 Ga0207670_10328262 3300025936 Bacteria 1205
495 Ga0207669_10033925 3300025937 Bacteria 2886
496 Ga0207669_10115076 3300025937 Bacteria 1812
497 Ga0207669_10351262 3300025937 Bacteria 1139
498 Ga0207704_10005807 3300025938 Bacteria 5708
499 Ga0207704_10050895 3300025938 Bacteria 2501
500 Ga0207704_10124949 3300025938 Bacteria 1769
501 Ga0207704_10673730 3300025938 Bacteria 854
502 Ga0207665_10000455 3300025939 Bacteria 28194
503 Ga0207665_10003636 3300025939 Bacteria 10301
504 Ga0207665_10011323 3300025939 Bacteria 5856
505 Ga0207665_10088607 3300025939 Bacteria 2141
506 Ga0207665_10292275 3300025939 Bacteria 1216
507 Ga0207691_10069954 3300025940 Bacteria 3169
508 Ga0207691_10131391 3300025940 Bacteria 2212
509 Ga0207711_10022195 3300025941 Bacteria 5307
510 Ga0207711_10095450 3300025941 Bacteria 2623
511 Ga0207689_10021472 3300025942 Bacteria 5427
512 Ga0207689_10030547 3300025942 Bacteria 4490
513 Ga0207661_10000227 3300025944 Bacteria 36896
514 Ga0207661_10043715 3300025944 Bacteria 3537
515 Ga0207661_10353844 3300025944 Bacteria 1325
516 Ga0207679_10140943 3300025945 Bacteria 1948
517 Ga0207679_10318224 3300025945 Bacteria 1346
518 Ga0207667_10037625 3300025949 Bacteria 5172
519 Ga0207667_10042452 3300025949 Bacteria 4833
520 Ga0207667_10069488 3300025949 Bacteria 3665
521 Ga0207667_10129097 3300025949 Bacteria 2603
522 Ga0207667_10258659 3300025949 Bacteria 1780
523 Ga0207667_10318937 3300025949 Bacteria 1587
524 Ga0207667_10400518 3300025949 Bacteria 1397
525 Ga0207651_10139634 3300025960 Bacteria 1869
526 Ga0207651_10155253 3300025960 Bacteria 1787
527 Ga0207651_10181556 3300025960 Bacteria 1670
528 Ga0207651_10224091 3300025960 Bacteria 1522
529 Ga0207712_10178151 3300025961 Bacteria 1667
530 Ga0207712_10203294 3300025961 Bacteria 1572
531 Ga0207668_10018976 3300025972 Bacteria 4336
532 Ga0207668_10050682 3300025972 Bacteria 2862
533 Ga0207668_10173452 3300025972 Bacteria 1693
534 Ga0207668_10252375 3300025972 Bacteria 1433
535 Ga0207640_10018371 3300025981 Bacteria 4109
536 Ga0207640_10143765 3300025981 Bacteria 1742
537 Ga0207658_10015698 3300025986 Bacteria 5199
538 Ga0207658_10018042 3300025986 Bacteria 4867
539 Ga0207658_10164950 3300025986 Bacteria 1819
540 Ga0207658_10315632 3300025986 Bacteria 1351
541 Ga0207658_10437314 3300025986 Bacteria 1156
542 Ga0207677_10009719 3300026023 Bacteria 5417
543 Ga0207677_10385440 3300026023 Bacteria 1184
544 Ga0207703_10228165 3300026035 Bacteria 1668
545 Ga0207703_10575241 3300026035 Bacteria 1064
546 Ga0207639_10049151 3300026041 Bacteria 3196
547 Ga0207639_10088929 3300026041 Bacteria 2466
548 Ga0207639_10276048 3300026041 Bacteria 1476
549 Ga0207639_10290452 3300026041 Bacteria 1441
550 Ga0207639_10647564 3300026041 Bacteria 977
551 Ga0207678_10016707 3300026067 Bacteria 6446
552 Ga0207678_10018224 3300026067 Bacteria 6166
553 Ga0207678_10144884 3300026067 Bacteria 2028
554 Ga0207678_10152456 3300026067 Bacteria 1974
555 Ga0207678_10165636 3300026067 Bacteria 1887
556 Ga0207678_10231459 3300026067 Bacteria 1582
557 Ga0207678_10243570 3300026067 Bacteria 1540
558 Ga0207678_10255834 3300026067 Bacteria 1500
559 Ga0207678_10285683 3300026067 Bacteria 1416
560 Ga0207678_10515968 3300026067 Bacteria 1043
561 Ga0207708_10347917 3300026075 Bacteria 1215
562 Ga0207702_10000025 3300026078 Bacteria 186312
563 Ga0207702_10000075 3300026078 Bacteria 112303
564 Ga0207702_10008399 3300026078 Bacteria 8713
565 Ga0207702_10139135 3300026078 Bacteria 2194
566 Ga0207702_10151415 3300026078 Bacteria 2110
567 Ga0207702_10159644 3300026078 Bacteria 2058
568 Ga0207702_10197843 3300026078 Bacteria 1861
569 Ga0207702_10614955 3300026078 Bacteria 1067
570 Ga0207641_10069289 3300026088 Bacteria 3027
571 Ga0207641_10246807 3300026088 Bacteria 1666
572 Ga0207641_10315497 3300026088 Bacteria 1481
573 Ga0207641_10493922 3300026088 Bacteria 1188
574 Ga0207676_10008170 3300026095 Bacteria 7443
575 Ga0207676_10071536 3300026095 Bacteria 2785
576 Ga0207676_10277560 3300026095 Bacteria 1520
577 Ga0207674_10022795 3300026116 Bacteria 6719
578 Ga0207674_10063245 3300026116 Bacteria 3735
579 Ga0207674_10078135 3300026116 Bacteria 3315
580 Ga0207674_10128285 3300026116 Bacteria 2501
581 Ga0207674_10176530 3300026116 Bacteria 2088
582 Ga0207674_10379881 3300026116 Bacteria 1366
583 Ga0207674_10510214 3300026116 Bacteria 1162
584 Ga0207675_100023527 3300026118 Bacteria 5731
585 Ga0207675_100148916 3300026118 Bacteria 2227
586 Ga0207675_100151263 3300026118 Bacteria 2209
587 Ga0207675_100240797 3300026118 Bacteria 1748
588 Ga0207683_10013509 3300026121 Bacteria 6968
589 Ga0207683_10020817 3300026121 Bacteria 5611
590 Ga0207683_10033981 3300026121 Bacteria 4430
591 Ga0207683_10034301 3300026121 Bacteria 4410
592 Ga0207683_10073168 3300026121 Bacteria 3031
593 Ga0207683_10079700 3300026121 Bacteria 2904
594 Ga0207683_10204096 3300026121 Bacteria 1797
595 Ga0207683_10690267 3300026121 Bacteria 946
596 Ga0207698_10011948 3300026142 Bacteria 5656
597 Ga0207698_10241062 3300026142 Bacteria 1648
598 Ga0207698_10592153 3300026142 Bacteria 1092
599 Ga0207698_10916301 3300026142 Bacteria 884
600 Ga0209389_1000132 3300027296 Bacteria 66230
601 Ga0209589_1000003 3300027357 Bacteria 629130
602 Ga0209489_100003 3300027361 Bacteria 663105
603 Ga0209489_103912 3300027361 Bacteria 28301
604 Ga0209700_100003 3300027363 Bacteria 663105
605 Ga0209700_100281 3300027363 Bacteria 90519
606 Ga0209179_1024849 3300027512 Bacteria 1191
607 Ga0209588_1004688 3300027671 Bacteria 3876
608 Ga0209813_10004019 3300027866 Bacteria 3485
609 Ga0209813_10042829 3300027866 Bacteria 1385
610 Ga0209813_10097669 3300027866 Bacteria 995
611 Ga0207428_10149772 3300027907 Bacteria 1776
612 Ga0268266_10002093 3300028379 Bacteria 22080
613 Ga0268266_10003481 3300028379 Bacteria 15689
614 Ga0268266_10004788 3300028379 Bacteria 12854
615 Ga0268266_10010224 3300028379 Bacteria 8219
616 Ga0268266_10016552 3300028379 Bacteria 6303
617 Ga0268266_10071199 3300028379 Bacteria 3013
618 Ga0268266_10481587 3300028379 Bacteria 1183
619 Ga0268265_10060380 3300028380 Bacteria 2905
620 Ga0268265_10098647 3300028380 Bacteria 2353
621 Ga0268265_10451672 3300028380 Bacteria 1200
622 Ga0268265_10547078 3300028380 Bacteria 1098
623 Ga0268264_10000022 3300028381 Bacteria 476624
624 Ga0268264_10149643 3300028381 Bacteria 2091
625 Ga0265334_10035881 3300028573 Bacteria 1960
626 Ga0307517_10000111 3300028786 Bacteria 120304
627 Ga0307515_10198993 3300028794 Bacteria 1886
628 Ga0307511_10028875 3300030521 Bacteria 5022
629 Ga0265330_10015875 3300031235 Bacteria 3479
630 Ga0265330_10028009 3300031235 Bacteria 2542
631 Ga0265332_10005648 3300031238 Bacteria 5750
632 Ga0265332_10061076 3300031238 Bacteria 1611
633 Ga0265325_10000006 3300031241 Bacteria 255758
634 Ga0265325_10005078 3300031241 Bacteria 8189
635 Ga0265340_10001029 3300031247 Bacteria 15913
636 Ga0265316_10069202 3300031344 Bacteria 2724
637 Ga0265316_10397008 3300031344 Bacteria 994
638 Ga0265316_10428241 3300031344 Bacteria 951
639 Ga0307509_10083821 3300031507 Bacteria 3285
640 Ga0307509_10204439 3300031507 Bacteria 1807
641 Ga0307509_10235360 3300031507 Bacteria 1630
642 Ga0265313_10004211 3300031595 Bacteria 11152
643 Ga0265313_10038758 3300031595 Bacteria 2370
644 Ga0307508_10000001 3300031616 Bacteria 553635
645 Ga0265314_10007699 3300031711 Bacteria 9314
646 Ga0265314_10053368 3300031711 Bacteria 2804
647 Ga0265342_10062563 3300031712 Bacteria 2190
648 Ga0265342_10143952 3300031712 Bacteria 1328
649 Ga0307516_10080872 3300031730 Bacteria 3093
650 Ga0307412_10192022 3300031911 Bacteria 1545
651 Ga0307409_100031793 3300031995 Bacteria 3815
652 Ga0307411_10162698 3300032005 Bacteria 1674
653 Ga0307415_100088179 3300032126 Bacteria 2238
654 Ga0307415_100106386 3300032126 Bacteria 2071
655 Ga0307415_100301385 3300032126 Bacteria 1328
656 Ga0307510_10001748 3300033180 Bacteria 24223
657 Ga0307510_10214854 3300033180 Bacteria 1441
658 Ga0315911_1000001 3300033442 Bacteria 1088602
659 Ga0373930_0009477 3300034816 Bacteria 1723
660 Ga0373958_0050421 3300034819 Bacteria 878
661 Ga0373959_0004888 3300034820 Bacteria 2181
662 Ga0373938_0014855 3300034957 Bacteria 1500
663 Ga0373929_0004081 3300035085 Bacteria 2617
664 Ga0373934_0002524 3300035086 Bacteria 6733
665 Ga0373934_0043127 3300035086 Bacteria 1783
666 Ga0373934_0047487 3300035086 Bacteria 1698
667 Ga0373940_0005371 3300035088 Bacteria 2772
668 Ga0373952_0000703 3300035092 Bacteria 5962
669 Ga0373932_0004218 3300035112 Bacteria 3414
670 Ga0373936_0005474 3300035113 Bacteria 4790
671 Ga0373936_0036940 3300035113 Bacteria 1949
672 Ga0373936_0054933 3300035113 Bacteria 1616
673 Ga0373941_0009331 3300035115 Bacteria 2468
674 Ga0373941_0032545 3300035115 Bacteria 1561
675 Ga0373945_0012567 3300035116 Bacteria 2814
676 Ga0373945_0024502 3300035116 Bacteria 2091
677 Ga0373945_0103450 3300035116 Bacteria 1117
678 Ga0373953_0006545 3300035117 Bacteria 3845
679 Ga0373953_0130758 3300035117 Bacteria 1070
680 Ga0373954_0001369 3300035118 Bacteria 9839
681 Ga0373956_0028711 3300035119 Bacteria 2422
682 Ga0373956_0079479 3300035119 Bacteria 1503
683 Ga0373957_0040888 3300035120 Bacteria 1744
684 Ga0373960_0009007 3300035121 Bacteria 2408
685 Ga0373943_0007816 3300035170 Bacteria 4803
686 Ga0373943_0023765 3300035170 Bacteria 2852
687 Ga0373943_0026965 3300035170 Bacteria 2695
688 Ga0373943_0039720 3300035170 Bacteria 2269
689 Ga0373946_0014662 3300035171 Bacteria 2958
690 Ga0373946_0038028 3300035171 Bacteria 1958
691 Ga0373955_0001864 3300035172 Bacteria 9068
692 Ga0373955_0027869 3300035172 Bacteria 2924
693 Ga0373955_0048107 3300035172 Bacteria 2311
694 Ga0373961_0012551 3300035241 Bacteria 2123
695 Ga0373962_0005970 3300035242 Bacteria 2939
696 Ga0373924_0004443 3300035410 Bacteria 4896
697 Ga0373924_0031770 3300035410 Bacteria 2125
698 Ga0373931_0003730 3300035691 Bacteria 6894
699 Ga0373931_0013950 3300035691 Bacteria 3920
700 Ga0373931_0014396 3300035691 Bacteria 3865
701 Ga0373935_0000110 3300035692 Bacteria 37393
702 Ga0373935_0028868 3300035692 Bacteria 3429
703 Ga0373935_0041167 3300035692 Bacteria 2901
704 Ga0373935_0203993 3300035692 Bacteria 1367
705 Ga0373927_0002008 3300035695 Bacteria 14993
706 Ga0373927_0005256 3300035695 Bacteria 8954
707 Ga0373927_0038834 3300035695 Bacteria 3090
708 Ga0373933_0000117 3300035724 Bacteria 51348
709 Ga0373933_0000863 3300035724 Bacteria 18584
710 Ga0373933_0033912 3300035724 Bacteria 2972
711 Ga0373933_0056752 3300035724 Bacteria 2351
712 Ga0373933_0154366 3300035724 Bacteria 1455
713 Ga0373933_0205792 3300035724 Bacteria 1260
714 Ga0373947_0001449 3300035725 Bacteria 14598
715 Ga0373947_0012614 3300035725 Bacteria 4847
716 Ga0373947_0096855 3300035725 Bacteria 1848
717 Ga0373947_0203348 3300035725 Bacteria 1297
718 Ga0373947_0277508 3300035725 Bacteria 1113
719 Ga0373937_0007186 3300036401 Bacteria 9632
720 Ga0373937_0031239 3300036401 Bacteria 4824
721 Ga0373937_0080469 3300036401 Bacteria 3013
722 Ga0373937_0208724 3300036401 Bacteria 1837
723 Ga0373937_0373974 3300036401 Bacteria 1351
724 Ga0373925_0000748 3300037068 Bacteria 29849
725 Ga0373925_0004770 3300037068 Bacteria 10213
726 Ga0373925_0021180 3300037068 Bacteria 4737
727 Ga0373925_0082755 3300037068 Bacteria 2443
728 Ga0373925_0087242 3300037068 Bacteria 2381
729 Ga0373925_0148842 3300037068 Bacteria 1837
730 Ga0373925_0289015 3300037068 Bacteria 1322
731 Ga0373925_0567824 3300037068 Bacteria 933
732 Ga0395900_0001759 3300037418 Bacteria 24863
733 Ga0395900_0005207 3300037418 Bacteria 13642
734 Ga0395898_0001625 3300037466 Bacteria 30490
735 Ga0395898_0055146 3300037466 Bacteria 3877
736 Ga0395898_0063202 3300037466 Bacteria 3593
737 Ga0395898_0122535 3300037466 Bacteria 2491
738 Ga0395898_0395500 3300037466 Bacteria 1318
739 Ga0395905_0002799 3300037471 Bacteria 19109
740 Ga0395905_0174543 3300037471 Bacteria 2018
741 Ga0395905_0499771 3300037471 Bacteria 1116
742 Ga0436364_0539583 3300037853 Bacteria 4923
743 Ga0395901_0043346 3300038443 Bacteria 4668
744 Ga0395901_0102918 3300038443 Bacteria 2996
745 Ga0395901_0410686 3300038443 Bacteria 1390
746 Ga0400483_060836 3300039062 Bacteria 1154
747 Ga0436365_0257418 3300039437 Bacteria 2138
748 Ga0436365_1023002 3300039437 Bacteria 2389
749 Ga0436360_0096391 3300039438 Bacteria 2568
750 Ga0436361_0480907 3300039447 Bacteria 7901
751 Ga0436361_0862295 3300039447 Bacteria 1175
752 Ga0436363_0062258 3300039450 Bacteria 1042
753 Ga0436363_1628114 3300039450 Bacteria 2395
754 Ga0439453_0006931 3300041408 Bacteria 1780
755 Ga0439435_0001490 3300042436 Bacteria 4353
756 Ga0466969_0163530 3300044656 Bacteria 1022
757 Ga0466972_0000125 3300044658 Bacteria 65105
758 Ga0466965_0313425 3300044683 Bacteria 853
759 Ga0466966_0161906 3300044684 Bacteria 1362
760 Ga0466966_0168686 3300044684 Bacteria 1331
761 Ga0466966_0214125 3300044684 Bacteria 1164
762 Ga0466961_0023660 3300044693 Bacteria 3953
763 Ga0466961_0099657 3300044693 Bacteria 1831
764 Ga0466963_0016505 3300044694 Bacteria 4592
765 Ga0466963_0105572 3300044694 Bacteria 1931
766 Ga0466957_0322588 3300044842 Bacteria 1042
767 Ga0466960_0159631 3300044901 Bacteria 1210
768 Ga0466959_0018639 3300045049 Bacteria 5098
769 Ga0466959_0360311 3300045049 Bacteria 991
770 Ga0466958_0139995 3300045836 Bacteria 1523
771 Ga0466958_0328468 3300045836 Bacteria 983
772 Ga0466967_0002462 3300045976 Bacteria 11534
773 Ga0466967_0042275 3300045976 Bacteria 3937
774 Ga0466967_0468639 3300045976 Bacteria 1233
775 Ga0466967_0546005 3300045976 Bacteria 1140
776 Ga0495617_068258 3300046452 Bacteria 1170
777 Ga0495592_0003752 3300046454 Bacteria 10963
778 Ga0495592_0030096 3300046454 Bacteria 4106
779 Ga0495592_0054979 3300046454 Bacteria 2947
780 Ga0495592_0210847 3300046454 Bacteria 1304
781 Ga0495603_0000011 3300046455 Bacteria 69832
782 Ga0495603_0016002 3300046455 Bacteria 4535
783 Ga0495603_0018500 3300046455 Bacteria 4215
784 Ga0495603_0018693 3300046455 Bacteria 4193
785 Ga0495603_0029271 3300046455 Bacteria 3321
786 Ga0495603_0126687 3300046455 Bacteria 1488
787 Ga0495603_0145321 3300046455 Bacteria 1379
788 Ga0495629_0000251 3300046459 Bacteria 46643
789 Ga0495629_0000253 3300046459 Bacteria 46595
790 Ga0495629_0002122 3300046459 Bacteria 15363
791 Ga0495638_0009386 3300046460 Bacteria 6876
792 Ga0495638_0022362 3300046460 Bacteria 4151
793 Ga0495638_0036500 3300046460 Bacteria 3131
794 Ga0495638_0039823 3300046460 Bacteria 2981
795 Ga0495638_0056366 3300046460 Bacteria 2438
796 Ga0495641_0014674 3300046461 Bacteria 4228
797 Ga0495641_0017327 3300046461 Bacteria 3757
798 Ga0495641_0039165 3300046461 Bacteria 2211
799 Ga0495651_0015572 3300046462 Bacteria 5884
800 Ga0495651_0085167 3300046462 Bacteria 2380
801 Ga0495651_0120048 3300046462 Bacteria 1932
802 Ga0495653_0000473 3300046463 Bacteria 31165
803 Ga0495653_0113012 3300046463 Bacteria 1948
804 Ga0495650_0085380 3300046471 Bacteria 1209
805 Ga0495580_0015052 3300046472 Bacteria 5853
806 Ga0495580_0018909 3300046472 Bacteria 5125
807 Ga0495580_0533797 3300046472 Bacteria 780
808 Ga0495582_0000974 3300046473 Bacteria 16016
809 Ga0495582_0027990 3300046473 Bacteria 3092
810 Ga0495605_0032938 3300046474 Bacteria 2635
811 Ga0495639_0000017 3300046475 Bacteria 76508
812 Ga0495639_0060223 3300046475 Bacteria 1739
813 Ga0495639_0198543 3300046475 Bacteria 981
814 Ga0495662_0000179 3300046476 Bacteria 25483
815 Ga0495662_0129503 3300046476 Bacteria 1240
816 Ga0495662_0220546 3300046476 Bacteria 935
817 Ga0495662_0233079 3300046476 Bacteria 907
818 Ga0495664_0035477 3300046477 Bacteria 2937
819 Ga0495664_0089776 3300046477 Bacteria 1847
820 Ga0495664_0278364 3300046477 Bacteria 1011
821 Ga0495585_0004643 3300046492 Bacteria 8861
822 Ga0495585_0088116 3300046492 Bacteria 1674
823 Ga0495594_0000094 3300046499 Bacteria 41090
824 Ga0495594_0007078 3300046499 Bacteria 5769
825 Ga0495594_0079170 3300046499 Bacteria 1834
826 Ga0495594_0098064 3300046499 Bacteria 1647
827 Ga0495594_0102898 3300046499 Bacteria 1607
828 Ga0495606_0002138 3300046507 Bacteria 23850
829 Ga0495606_0102853 3300046507 Bacteria 1736
830 Ga0495608_0007400 3300046511 Bacteria 7752
831 Ga0495608_0060453 3300046511 Bacteria 2493
832 Ga0495610_0075749 3300046512 Bacteria 1557
833 Ga0495616_0043510 3300046513 Bacteria 2281
834 Ga0495616_0052942 3300046513 Bacteria 2019
835 Ga0495616_0107873 3300046513 Bacteria 1297
836 Ga0495618_0084293 3300046514 Bacteria 2031
837 Ga0495618_0095271 3300046514 Bacteria 1903
838 Ga0495618_0189316 3300046514 Bacteria 1305
839 Ga0495618_0430564 3300046514 Bacteria 803
840 Ga0495620_0024967 3300046515 Bacteria 2836
841 Ga0495620_0121661 3300046515 Bacteria 1028
842 Ga0495628_0027034 3300046516 Bacteria 4671
843 Ga0495628_0030482 3300046516 Bacteria 4367
844 Ga0495628_0064067 3300046516 Bacteria 2878
845 Ga0495628_0180064 3300046516 Bacteria 1599
846 Ga0495628_0244898 3300046516 Bacteria 1340
847 Ga0495630_0008181 3300046517 Bacteria 7511
848 Ga0495630_0036331 3300046517 Bacteria 3683
849 Ga0495632_0130764 3300046519 Bacteria 1168
850 Ga0495632_0157335 3300046519 Bacteria 1048
851 Ga0495644_0003084 3300046523 Bacteria 6594
852 Ga0495648_0000494 3300046524 Bacteria 42434
853 Ga0495648_0001433 3300046524 Bacteria 23346
854 Ga0495648_0060116 3300046524 Bacteria 2263
855 Ga0495666_0149246 3300046526 Bacteria 1087
856 Ga0495666_0191232 3300046526 Bacteria 943
857 Ga0495642_0129722 3300046528 Bacteria 1085
858 Ga0495652_0006106 3300046529 Bacteria 11263
859 Ga0495652_0013728 3300046529 Bacteria 7286
860 Ga0495652_0091230 3300046529 Bacteria 2491
861 Ga0495652_0113263 3300046529 Bacteria 2178
862 Ga0495652_0119722 3300046529 Bacteria 2102
863 Ga0495654_0005880 3300046530 Bacteria 7057
864 Ga0495654_0032938 3300046530 Bacteria 2625
865 Ga0495654_0165740 3300046530 Bacteria 967
866 Ga0495665_0000032 3300046531 Bacteria 53670
867 Ga0495665_0023158 3300046531 Bacteria 3335
868 Ga0495640_0001724 3300046533 Bacteria 17333
869 Ga0495640_0025020 3300046533 Bacteria 4336
870 Ga0495640_0033866 3300046533 Bacteria 3629
871 Ga0495640_0196234 3300046533 Bacteria 1281
872 Ga0495586_0070505 3300046535 Bacteria 1909
873 Ga0495586_0311371 3300046535 Bacteria 903
874 Ga0495587_0010454 3300046536 Bacteria 5905
875 Ga0495587_0035328 3300046536 Bacteria 3010
876 Ga0495587_0037939 3300046536 Bacteria 2891
877 Ga0495587_0197253 3300046536 Bacteria 1139
878 Ga0495598_0006263 3300046537 Bacteria 2682
879 Ga0495609_0142147 3300046538 Bacteria 1024
880 Ga0495621_0012201 3300046539 Bacteria 2676
881 Ga0495621_0091531 3300046539 Bacteria 1147
882 Ga0495597_0046757 3300046542 Bacteria 1917
883 Ga0495597_0053866 3300046542 Bacteria 1768
884 Ga0495645_0061017 3300046543 Bacteria 2733
885 Ga0495645_0137633 3300046543 Bacteria 1707
886 Ga0495645_0263284 3300046543 Bacteria 1140
887 Ga0495622_0010235 3300046557 Bacteria 4335
888 Ga0495622_0038223 3300046557 Bacteria 2235
889 Ga0495633_0003607 3300046558 Bacteria 10240
890 Ga0495667_0000962 3300046559 Bacteria 18643
891 Ga0495667_0044797 3300046559 Bacteria 2929
892 Ga0495667_0110804 3300046559 Bacteria 1773
893 Ga0495667_0165382 3300046559 Bacteria 1422
894 Ga0495656_0001421 3300046615 Bacteria 7836
895 Ga0495656_0039306 3300046615 Bacteria 1964
896 Ga0495656_0091115 3300046615 Bacteria 1394
897 Ga0495656_0170297 3300046615 Bacteria 1064
898 Ga0495668_0000092 3300046616 Bacteria 142835
899 Ga0495668_0075201 3300046616 Bacteria 1855
900 Ga0495668_0166199 3300046616 Bacteria 1208
901 Ga0495668_0216984 3300046616 Bacteria 1047
902 Ga0495668_0298754 3300046616 Bacteria 883
903 Ga0495634_0003268 3300046642 Bacteria 13081
904 Ga0495634_0078652 3300046642 Bacteria 2160
905 Ga0495634_0085665 3300046642 Bacteria 2053
906 Ga0495634_0212154 3300046642 Bacteria 1198
907 Ga0495634_0229210 3300046642 Bacteria 1143
908 Ga0495611_0030565 3300046648 Bacteria 2369
909 Ga0495611_0133890 3300046648 Bacteria 1156
910 Ga0495625_0361214 3300046660 Bacteria 915
911 Ga0495635_0000084 3300046663 Bacteria 56456
912 Ga0495635_0003234 3300046663 Bacteria 11231
913 Ga0495635_0041900 3300046663 Bacteria 3163
914 Ga0495635_0164809 3300046663 Bacteria 1508
915 Ga0495659_0007751 3300046664 Bacteria 3406
916 Ga0495661_0019379 3300046665 Bacteria 4458
917 Ga0495661_0063366 3300046665 Bacteria 2185
918 Ga0495661_0294948 3300046665 Bacteria 813
919 Ga0495588_0034752 3300046674 Bacteria 2551
920 Ga0495588_0037169 3300046674 Bacteria 2473
921 Ga0495588_0048031 3300046674 Bacteria 2192
922 Ga0495588_0108846 3300046674 Bacteria 1459
923 Ga0495657_0005107 3300046675 Bacteria 10419
924 Ga0495657_0008437 3300046675 Bacteria 7880
925 Ga0495657_0021841 3300046675 Bacteria 4591
926 Ga0495657_0190027 3300046675 Bacteria 1256
927 Ga0495657_0224104 3300046675 Bacteria 1139
928 Ga0495599_0000457 3300046678 Bacteria 23252
929 Ga0495599_0038768 3300046678 Bacteria 2994
930 Ga0495599_0405425 3300046678 Bacteria 811
931 Ga0495623_0008556 3300046679 Bacteria 6645
932 Ga0495623_0107716 3300046679 Bacteria 1692
933 Ga0495623_0113461 3300046679 Bacteria 1639
934 Ga0495646_0042090 3300046680 Bacteria 2804
935 Ga0495646_0064091 3300046680 Bacteria 2179
936 Ga0495646_0153260 3300046680 Bacteria 1280
937 Ga0495647_0000248 3300046681 Bacteria 14792
938 Ga0495647_0010707 3300046681 Bacteria 3128
939 Ga0495647_0017500 3300046681 Bacteria 2537
940 Ga0495658_0001805 3300046683 Bacteria 11001
941 Ga0495658_0007984 3300046683 Bacteria 5242
942 Ga0495658_0106447 3300046683 Bacteria 1681
943 Ga0495658_0112424 3300046683 Bacteria 1639
944 Ga0495669_0050384 3300046684 Bacteria 1867
945 Ga0495669_0278404 3300046684 Bacteria 805
946 Ga0495613_0001580 3300046689 Bacteria 17285
947 Ga0495613_0004954 3300046689 Bacteria 9999
948 Ga0495613_0071751 3300046689 Bacteria 2524
949 Ga0495613_0121915 3300046689 Bacteria 1872
950 Ga0495624_0004094 3300046690 Bacteria 10725
951 Ga0495624_0156067 3300046690 Bacteria 1395
952 Ga0495670_0000787 3300046691 Bacteria 15234
953 Ga0495670_0010416 3300046691 Bacteria 4567
954 Ga0495670_0034134 3300046691 Bacteria 2533
955 Ga0495671_0243761 3300046692 Bacteria 868
956 Ga0495649_0094750 3300046694 Bacteria 1589
957 Ga0495600_0003042 3300046809 Bacteria 9794
958 Ga0495600_0004866 3300046809 Bacteria 8067
959 Ga0495600_0051163 3300046809 Bacteria 2696
960 Ga0495581_0000076 3300047315 Bacteria 39131
961 Ga0495581_0043435 3300047315 Bacteria 2600
962 Ga0495581_0114836 3300047315 Bacteria 1566
963 Ga0495581_0139969 3300047315 Bacteria 1411
964 Ga0495581_0203298 3300047315 Bacteria 1159
965 Ga0495581_0270429 3300047315 Bacteria 994
966 Ga0495581_0340779 3300047315 Bacteria 875
967 Ga0495604_0010464 3300047317 Bacteria 7352
968 Ga0495604_0102023 3300047317 Bacteria 2106
969 Ga0495604_0124266 3300047317 Bacteria 1863
970 Ga0495604_0133812 3300047317 Bacteria 1779
971 Ga0495674_0001109 3300047319 Bacteria 25876
972 Ga0495674_0009634 3300047319 Bacteria 9175
973 Ga0495674_0063393 3300047319 Bacteria 3215
974 Ga0495674_0070677 3300047319 Bacteria 3016
975 Ga0495674_0072742 3300047319 Bacteria 2964
976 Ga0495672_0010637 3300047320 Bacteria 6537
977 Ga0495672_0028513 3300047320 Bacteria 3531
978 Ga0495672_0242945 3300047320 Bacteria 878
979 Ga0495672_0263016 3300047320 Bacteria 832
980 Ga0495676_0036452 3300047321 Bacteria 4107
981 Ga0495676_0227178 3300047321 Bacteria 1283
982 Ga0495676_0283049 3300047321 Bacteria 1122
983 Ga0495680_0007126 3300047322 Bacteria 10297
984 Ga0495680_0010925 3300047322 Bacteria 8067
985 Ga0495680_0021814 3300047322 Bacteria 5352
986 Ga0495680_0065244 3300047322 Bacteria 2789
987 Ga0495680_0270302 3300047322 Bacteria 1200
988 Ga0495683_0166942 3300047323 Bacteria 1014
989 Ga0495687_010366 3300047443 Bacteria 5115
990 Ga0495675_0001533 3300047444 Bacteria 13942
991 Ga0495677_0174134 3300047445 Bacteria 833
992 Ga0495679_096931 3300047446 Bacteria 822
993 Ga0495673_0117193 3300047469 Bacteria 1058
994 Ga0495684_0001330 3300047471 Bacteria 19879
995 Ga0495684_0001937 3300047471 Bacteria 16591
996 Ga0495684_0010509 3300047471 Bacteria 7158
997 Ga0495686_0076759 3300047472 Bacteria 2047
998 Ga0495686_0142253 3300047472 Bacteria 1415
999 Ga0495686_0169194 3300047472 Bacteria 1272
1000 Ga0495686_0275060 3300047472 Bacteria 938
1001 Ga0495593_0002160 3300047673 Bacteria 11757
1002 Ga0495593_0002185 3300047673 Bacteria 11713
1003 Ga0495593_0004247 3300047673 Bacteria 8522
1004 Ga0495593_0048015 3300047673 Bacteria 2269
1005 Ga0495602_0062123 3300048088 Bacteria 3242
1006 Ga0495602_0084727 3300048088 Bacteria 2650
1007 Ga0495614_0035738 3300048089 Bacteria 2134
1008 Ga0495614_0045811 3300048089 Bacteria 1875
1009 Ga0495614_0199292 3300048089 Bacteria 905
1010 Ga0496100_0009708 3300048903 Bacteria 5416
1011 Ga0496100_0032941 3300048903 Bacteria 3237
1012 Ga0496100_0133547 3300048903 Bacteria 1751
1013 Ga0496100_0186477 3300048903 Bacteria 1503
1014 Ga0496100_0239403 3300048903 Bacteria 1338
1015 Ga0496101_0062075 3300048904 Bacteria 2716
1016 Ga0496101_0106071 3300048904 Bacteria 2109
1017 Ga0496101_0124410 3300048904 Bacteria 1953
1018 Ga0496101_0179040 3300048904 Bacteria 1632
1019 Ga0496101_0234968 3300048904 Bacteria 1425
1020 Ga0496101_0306525 3300048904 Bacteria 1244
1021 Ga0496102_0004998 3300048905 Bacteria 11234
1022 Ga0496102_0017053 3300048905 Bacteria 6356
1023 Ga0496102_0029309 3300048905 Bacteria 4925
1024 Ga0496102_0122324 3300048905 Bacteria 2431
1025 Ga0496102_0123553 3300048905 Bacteria 2419
1026 Ga0496102_0127267 3300048905 Bacteria 2382
1027 Ga0496102_0253023 3300048905 Bacteria 1661
1028 Ga0496103_0003807 3300048906 Bacteria 9179
1029 Ga0496103_0024359 3300048906 Bacteria 3653
1030 Ga0496103_0067753 3300048906 Bacteria 2230
1031 Ga0496104_0000331 3300048907 Bacteria 42278
1032 Ga0496104_0023465 3300048907 Bacteria 5672
1033 Ga0496104_0026932 3300048907 Bacteria 5314
1034 Ga0496104_0065839 3300048907 Bacteria 3439
1035 Ga0496104_0092178 3300048907 Bacteria 2897
1036 Ga0496104_0118811 3300048907 Bacteria 2538
1037 Ga0496104_0131351 3300048907 Bacteria 2405
1038 Ga0496104_0696809 3300048907 Bacteria 923
1039 Ga0496105_0013669 3300048908 Bacteria 6445
1040 Ga0496105_0027756 3300048908 Bacteria 4626
1041 Ga0496105_0047246 3300048908 Bacteria 3552
1042 Ga0496105_0104294 3300048908 Bacteria 2341
1043 Ga0496105_0129992 3300048908 Bacteria 2076
1044 Ga0496105_0193884 3300048908 Bacteria 1660
1045 Ga0496105_0617885 3300048908 Bacteria 839
1046 Ga0496106_0001453 3300048909 Bacteria 17793
1047 Ga0496106_0007579 3300048909 Bacteria 8029
1048 Ga0496106_0155397 3300048909 Bacteria 1806
1049 Ga0496106_0548593 3300048909 Bacteria 927
1050 Ga0496107_0012401 3300048910 Bacteria 5948
1051 Ga0496107_0057233 3300048910 Bacteria 2818
1052 Ga0496107_0074980 3300048910 Bacteria 2462
1053 Ga0496107_0080430 3300048910 Bacteria 2376
1054 Ga0496107_0131581 3300048910 Bacteria 1847
1055 Ga0496107_0139865 3300048910 Bacteria 1789
1056 Ga0496107_0140109 3300048910 Bacteria 1787
1057 Ga0496108_0001656 3300048911 Bacteria 17657
1058 Ga0496108_0007772 3300048911 Bacteria 8685
1059 Ga0496108_0015489 3300048911 Bacteria 6218
1060 Ga0496108_0081128 3300048911 Bacteria 2748
1061 Ga0496108_0132976 3300048911 Bacteria 2138
1062 Ga0496108_0279817 3300048911 Bacteria 1452
1063 Ga0496108_0369861 3300048911 Bacteria 1251
1064 Ga0496108_0389286 3300048911 Bacteria 1217
1065 Ga0496108_0435246 3300048911 Bacteria 1145
1066 Ga0496109_0002542 3300048912 Bacteria 15293
1067 Ga0496109_0005517 3300048912 Bacteria 10593
1068 Ga0496109_0037791 3300048912 Bacteria 4363
1069 Ga0496109_0253461 3300048912 Bacteria 1657
1070 Ga0496109_0296331 3300048912 Bacteria 1525
1071 Ga0496109_0430639 3300048912 Bacteria 1246
1072 Ga0496109_0548544 3300048912 Bacteria 1090
1073 Ga0496109_1016602 3300048912 Bacteria 766
1074 Ga0496110_0006911 3300048913 Bacteria 9025
1075 Ga0496110_0011557 3300048913 Bacteria 7235
1076 Ga0496110_0024579 3300048913 Bacteria 5136
1077 Ga0496110_0050759 3300048913 Bacteria 3643
1078 Ga0496110_0054426 3300048913 Bacteria 3520
1079 Ga0496110_0108630 3300048913 Bacteria 2491
1080 Ga0496110_0234218 3300048913 Bacteria 1670
1081 Ga0496110_0350302 3300048913 Bacteria 1345
1082 Ga0496110_0401456 3300048913 Bacteria 1249
1083 Ga0496110_0700215 3300048913 Bacteria 914
1084 Ga0496111_0001681 3300048914 Bacteria 12889
1085 Ga0496111_0004178 3300048914 Bacteria 9086
1086 Ga0496111_0020054 3300048914 Bacteria 4650
1087 Ga0496111_0040057 3300048914 Bacteria 3361
1088 Ga0496111_0049479 3300048914 Bacteria 3031
1089 Ga0496111_0094980 3300048914 Bacteria 2187
1090 Ga0496111_0265385 3300048914 Bacteria 1274
1091 Ga0496111_0271124 3300048914 Bacteria 1259
1092 Ga0496112_0000414 3300048915 Bacteria 28126
1093 Ga0496112_0010890 3300048915 Bacteria 8277
1094 Ga0496112_0024803 3300048915 Bacteria 5751
1095 Ga0496112_0041801 3300048915 Bacteria 4485
1096 Ga0496112_0043885 3300048915 Bacteria 4378
1097 Ga0496112_0189675 3300048915 Bacteria 2018
1098 Ga0496112_0208418 3300048915 Bacteria 1912
1099 Ga0496112_0216117 3300048915 Bacteria 1873
1100 Ga0496112_0251390 3300048915 Bacteria 1718
1101 Ga0496113_0001520 3300048916 Bacteria 12991
1102 Ga0496113_0004601 3300048916 Bacteria 8508
1103 Ga0496113_0008072 3300048916 Bacteria 6833
1104 Ga0496113_0008091 3300048916 Bacteria 6827
1105 Ga0496113_0114467 3300048916 Bacteria 2103
1106 Ga0496113_0215699 3300048916 Bacteria 1528
1107 Ga0496113_0555583 3300048916 Bacteria 921
1108 Ga0496114_0005585 3300048917 Bacteria 9860
1109 Ga0496114_0015990 3300048917 Bacteria 6038
1110 Ga0496114_0065889 3300048917 Bacteria 3035
1111 Ga0496114_0069511 3300048917 Bacteria 2957
1112 Ga0496114_0114066 3300048917 Bacteria 2317
1113 Ga0496114_0121398 3300048917 Bacteria 2247
1114 Ga0496114_0136752 3300048917 Bacteria 2119
1115 Ga0496114_0279601 3300048917 Bacteria 1471
1116 Ga0496114_0451916 3300048917 Bacteria 1138
1117 Ga0496115_0011102 3300048918 Bacteria 6750
1118 Ga0496115_0019563 3300048918 Bacteria 5212
1119 Ga0496115_0040397 3300048918 Bacteria 3709
1120 Ga0496115_0041198 3300048918 Bacteria 3674
1121 Ga0496115_0075176 3300048918 Bacteria 2744
1122 Ga0496115_0089958 3300048918 Bacteria 2507
1123 Ga0496115_0467285 3300048918 Bacteria 1017
1124 Ga0496115_0541517 3300048918 Bacteria 931
1125 Ga0496116_0002810 3300048919 Bacteria 17881
1126 Ga0496116_0181951 3300048919 Bacteria 1124
1127 Ga0496116_0254201 3300048919 Bacteria 872
1128 Ga0496117_0064775 3300048920 Bacteria 2489
1129 Ga0496117_0066143 3300048920 Bacteria 2453
1130 Ga0496117_0085429 3300048920 Bacteria 2054
1131 Ga0496118_0017101 3300048921 Bacteria 6620
1132 Ga0496118_0075568 3300048921 Bacteria 2402
1133 Ga0496118_0201703 3300048921 Bacteria 1177
1134 Ga0496118_0214644 3300048921 Bacteria 1126
1135 Ga0496119_0091345 3300048922 Bacteria 1729
1136 Ga0496119_0094144 3300048922 Bacteria 1695
1137 Ga0496119_0128632 3300048922 Bacteria 1383
1138 Ga0496119_0149169 3300048922 Bacteria 1255
1139 Ga0496119_0195140 3300048922 Bacteria 1052
1140 Ga0496121_0005592 3300048924 Bacteria 16051
1141 Ga0496121_0005961 3300048924 Bacteria 15401
1142 Ga0496121_0025691 3300048924 Bacteria 5580
1143 Ga0496121_0031537 3300048924 Bacteria 4838
1144 Ga0496121_0075028 3300048924 Bacteria 2703
1145 Ga0496121_0086316 3300048924 Bacteria 2466
1146 Ga0496121_0102204 3300048924 Bacteria 2209
1147 Ga0496121_0104069 3300048924 Bacteria 2182
1148 Ga0496121_0114227 3300048924 Bacteria 2053
1149 Ga0496121_0122569 3300048924 Bacteria 1960
1150 Ga0496121_0151531 3300048924 Bacteria 1706
1151 Ga0496121_0258853 3300048924 Bacteria 1202
1152 Ga0496121_0260947 3300048924 Bacteria 1196
1153 Ga0496122_0001850 3300048925 Bacteria 32258
1154 Ga0496122_0024253 3300048925 Bacteria 5312
1155 Ga0496122_0214035 3300048925 Bacteria 1113
1156 Ga0496123_0000498 3300048926 Bacteria 68151
1157 Ga0496123_0153571 3300048926 Bacteria 1238
1158 Ga0496124_0039002 3300048927 Bacteria 4120
1159 Ga0496124_0170336 3300048927 Bacteria 1687
1160 Ga0496124_0176486 3300048927 Bacteria 1649
1161 Ga0496125_0000850 3300048928 Bacteria 49000
1162 Ga0496125_0006132 3300048928 Bacteria 13116
1163 Ga0496125_0006453 3300048928 Bacteria 12678
1164 Ga0496125_0038920 3300048928 Bacteria 4106
1165 Ga0496125_0059762 3300048928 Bacteria 3068
1166 Ga0496125_0379689 3300048928 Bacteria 833
1167 Ga0496126_0003112 3300048929 Bacteria 21403
1168 Ga0496126_0004886 3300048929 Bacteria 15669
1169 Ga0496126_0008303 3300048929 Bacteria 11214
1170 Ga0496126_0018879 3300048929 Bacteria 6813
1171 Ga0496126_0066646 3300048929 Bacteria 3219
1172 Ga0496126_0120048 3300048929 Bacteria 2281
1173 Ga0496126_0138295 3300048929 Bacteria 2098
1174 Ga0496126_0149822 3300048929 Bacteria 2000
1175 Ga0496126_0159831 3300048929 Bacteria 1926
1176 Ga0496126_0170358 3300048929 Bacteria 1855
1177 Ga0496126_0207351 3300048929 Bacteria 1652
1178 Ga0496126_0233659 3300048929 Bacteria 1539
1179 Ga0496126_0251436 3300048929 Bacteria 1473
1180 Ga0496126_0562002 3300048929 Bacteria 904
1181 Ga0496126_0563447 3300048929 Bacteria 902
1182 Ga0496126_0600538 3300048929 Bacteria 867
1183 Ga0495682_0051559 3300049460 Bacteria 1497
1184 Ga0495682_0089363 3300049460 Bacteria 1107
1185 Ga0501031_0000253 3300049568 Bacteria 29955
1186 Ga0501031_0019009 3300049568 Bacteria 4473
1187 Ga0501031_0174039 3300049568 Bacteria 1406
1188 Ga0501032_0000273 3300049569 Bacteria 43466
1189 Ga0501032_0022067 3300049569 Bacteria 4419
1190 Ga0501032_0038462 3300049569 Bacteria 3258
1191 Ga0501032_0046242 3300049569 Bacteria 2942
1192 Ga0501032_0051051 3300049569 Bacteria 2788
1193 Ga0501032_0136588 3300049569 Bacteria 1616
1194 Ga0501033_0000098 3300049570 Bacteria 82803
1195 Ga0501033_0000332 3300049570 Bacteria 44949
1196 Ga0501033_0055981 3300049570 Bacteria 2916
1197 Ga0501033_0064916 3300049570 Bacteria 2685
1198 Ga0501033_0453318 3300049570 Bacteria 891
1199 Ga0501034_0000088 3300049571 Bacteria 166615
1200 Ga0501034_0000175 3300049571 Bacteria 119465
1201 Ga0501034_0019896 3300049571 Bacteria 6858
1202 Ga0501034_0048469 3300049571 Bacteria 4287
1203 Ga0501034_0078646 3300049571 Bacteria 3302
1204 Ga0501034_0104633 3300049571 Bacteria 2824
1205 Ga0501034_0269977 3300049571 Bacteria 1642
1206 Ga0501034_0519603 3300049571 Bacteria 1102
1207 Ga0501036_0000049 3300049572 Bacteria 75400
1208 Ga0501036_0043499 3300049572 Bacteria 3804
1209 Ga0501036_0076908 3300049572 Bacteria 2824
1210 Ga0501036_0236704 3300049572 Bacteria 1531
1211 Ga0501036_0281622 3300049572 Bacteria 1391
1212 Ga0501037_0000069 3300049573 Bacteria 95277
1213 Ga0501037_0003734 3300049573 Bacteria 11058
1214 Ga0501037_0144821 3300049573 Bacteria 1700
1215 Ga0501037_0199808 3300049573 Bacteria 1413
1216 Ga0501038_0000034 3300049574 Bacteria 128854
1217 Ga0501038_0008654 3300049574 Bacteria 9346
1218 Ga0501038_0053758 3300049574 Bacteria 3465
1219 Ga0501038_0072407 3300049574 Bacteria 2920
1220 Ga0501038_0111941 3300049574 Bacteria 2260
1221 Ga0501038_0144616 3300049574 Bacteria 1942
1222 Ga0501038_0339867 3300049574 Bacteria 1171
1223 Ga0501039_0000090 3300049575 Bacteria 63919
1224 Ga0501039_0005577 3300049575 Bacteria 9525
1225 Ga0501039_0108617 3300049575 Bacteria 2168
1226 Ga0501039_0694764 3300049575 Bacteria 796
1227 Ga0501040_0299360 3300049576 Bacteria 1150
1228 Ga0501040_0527577 3300049576 Bacteria 852
1229 Ga0501041_0280595 3300049577 Bacteria 1048
1230 Ga0501042_0021749 3300049578 Bacteria 4472
1231 Ga0501042_0111228 3300049578 Bacteria 1972
1232 Ga0501043_0000130 3300049579 Bacteria 69795
1233 Ga0501043_0010948 3300049579 Bacteria 7105
1234 Ga0501043_0136910 3300049579 Bacteria 1918
1235 Ga0501046_0000213 3300049580 Bacteria 60602
1236 Ga0501046_0007792 3300049580 Bacteria 9395
1237 Ga0501046_0020817 3300049580 Bacteria 5417
1238 Ga0501046_0032084 3300049580 Bacteria 4255
1239 Ga0501046_0181540 3300049580 Bacteria 1573
1240 Ga0501047_0000255 3300049581 Bacteria 62993
1241 Ga0501047_0016128 3300049581 Bacteria 7126
1242 Ga0501047_0039630 3300049581 Bacteria 4556
1243 Ga0501047_0074475 3300049581 Bacteria 3269
1244 Ga0501047_0087080 3300049581 Bacteria 3001
1245 Ga0501047_0087376 3300049581 Bacteria 2995
1246 Ga0501047_0109419 3300049581 Bacteria 2646
1247 Ga0501047_0329085 3300049581 Bacteria 1366
1248 Ga0501047_0546852 3300049581 Bacteria 982
1249 Ga0501048_0000252 3300049582 Bacteria 35941
1250 Ga0501048_0138363 3300049582 Bacteria 1721
1251 Ga0501067_0001929 3300049583 Bacteria 11405
1252 Ga0501067_0021939 3300049583 Bacteria 3533
1253 Ga0501067_0051104 3300049583 Bacteria 2292
1254 Ga0501067_0060356 3300049583 Bacteria 2099
1255 Ga0501067_0189962 3300049583 Bacteria 1144
1256 Ga0501068_0000197 3300049584 Bacteria 28590
1257 Ga0501068_0014839 3300049584 Bacteria 4461
1258 Ga0501069_0000614 3300049585 Bacteria 16508
1259 Ga0501069_0074684 3300049585 Bacteria 1903
1260 Ga0501069_0093592 3300049585 Bacteria 1700
1261 Ga0501069_0115171 3300049585 Bacteria 1533
1262 Ga0501070_0017034 3300049586 Bacteria 6098
1263 Ga0501070_0068644 3300049586 Bacteria 2934
1264 Ga0501070_0171049 3300049586 Bacteria 1789
1265 Ga0501070_0384853 3300049586 Bacteria 1136
1266 Ga0501071_0008255 3300049587 Bacteria 6874
1267 Ga0501071_0582273 3300049587 Bacteria 860
1268 Ga0501072_0000146 3300049588 Bacteria 52958
1269 Ga0501072_0245583 3300049588 Bacteria 1426
1270 Ga0501073_0000035 3300049589 Bacteria 94077
1271 Ga0501073_0023327 3300049589 Bacteria 4443
1272 Ga0501073_0099446 3300049589 Bacteria 2020
1273 Ga0501073_0117597 3300049589 Bacteria 1842
1274 Ga0501074_0000512 3300049590 Bacteria 23801
1275 Ga0501074_0059524 3300049590 Bacteria 2752
1276 Ga0501075_0337399 3300049591 Bacteria 1149
1277 Ga0501077_0084003 3300049593 Bacteria 2018
1278 Ga0501079_0010497 3300049741 Bacteria 7040
1279 Ga0501079_0087257 3300049741 Bacteria 2415
1280 Ga0501079_0111763 3300049741 Bacteria 2123
1281 Ga0501079_0364691 3300049741 Bacteria 1132
1282 Ga0501080_0000379 3300049742 Bacteria 34215
1283 Ga0501080_0049862 3300049742 Bacteria 3897
1284 Ga0501080_0060413 3300049742 Bacteria 3528
1285 Ga0501080_0363492 3300049742 Bacteria 1305
1286 Ga0501080_0372895 3300049742 Bacteria 1287
1287 Ga0501080_0548637 3300049742 Bacteria 1030
1288 Ga0501081_0106847 3300049743 Bacteria 1984
1289 Ga0501081_0366079 3300049743 Bacteria 1064
1290 Ga0501083_0000740 3300049744 Bacteria 21322
1291 Ga0501083_0007489 3300049744 Bacteria 7733
1292 Ga0501083_0151374 3300049744 Bacteria 1519
1293 Ga0501035_0000894 3300049822 Bacteria 31549
1294 Ga0501035_0001058 3300049822 Bacteria 28847
1295 Ga0501035_0043468 3300049822 Bacteria 4048
1296 Ga0501035_0181629 3300049822 Bacteria 1812
1297 Ga0501035_0240818 3300049822 Bacteria 1539
1298 Ga0501035_0268517 3300049822 Bacteria 1444
1299 Ga0501035_0277558 3300049822 Bacteria 1417
1300 Ga0501044_0000461 3300049823 Bacteria 49470
1301 Ga0501044_0021033 3300049823 Bacteria 6965
1302 Ga0501044_0043353 3300049823 Bacteria 4674
1303 Ga0501044_0077714 3300049823 Bacteria 3365
1304 Ga0501044_0077856 3300049823 Bacteria 3362
1305 Ga0501044_0118193 3300049823 Bacteria 2654
1306 Ga0501044_0170847 3300049823 Bacteria 2146
1307 Ga0501044_0189973 3300049823 Bacteria 2017
1308 Ga0501044_0210104 3300049823 Bacteria 1901
1309 Ga0501044_0247374 3300049823 Bacteria 1725
1310 Ga0501045_0109171 3300049824 Bacteria 2051
1311 nmdc:mga03683_17567_c1 3300050489 Bacteria 2709
1312 nmdc:mga03683_28652_c1 3300050489 Bacteria 2216
1313 nmdc:mga03683_2952_c1 3300050489 Bacteria 5375
1314 nmdc:mga03n38_15507_c1 3300050490 Bacteria 2944
1315 nmdc:mga03n38_166170_c1 3300050490 Bacteria 1120
1316 nmdc:mga03n38_20367_c1 3300050490 Bacteria 2653
1317 nmdc:mga03n38_210100_c1 3300050490 Bacteria 1011
1318 nmdc:mga03n38_613_c1 3300050490 Bacteria 9130
1319 nmdc:mga03n38_88814_c1 3300050490 Bacteria 1467
1320 nmdc:mga00v17_126620_c1 3300050491 Bacteria 1630
1321 nmdc:mga00v17_21043_c1 3300050491 Bacteria 3746
1322 nmdc:mga0yw44_124882_c1 3300050492 Bacteria 1661
1323 nmdc:mga0yw44_140144_c1 3300050492 Bacteria 1571
1324 nmdc:mga0yw44_15168_c1 3300050492 Bacteria 4119
1325 nmdc:mga0yw44_20149_c1 3300050492 Bacteria 3695
1326 nmdc:mga0yw44_202568_c1 3300050492 Bacteria 1311
1327 nmdc:mga0yw44_215952_c1 3300050492 Bacteria 1270
1328 nmdc:mga0yw44_28351_c1 3300050492 Bacteria 3220
1329 nmdc:mga0yw44_29821_c1 3300050492 Bacteria 3154
1330 nmdc:mga0yw44_32622_c1 3300050492 Bacteria 3036
1331 nmdc:mga0yw44_49130_c1 3300050492 Bacteria 2545
1332 nmdc:mga0k408_5224_c1 3300050493 Bacteria 6891
1333 nmdc:mga0k408_59721_c1 3300050493 Bacteria 2216
1334 nmdc:mga0k408_80127_c1 3300050493 Bacteria 1911
1335 nmdc:mga0k408_9852_c1 3300050493 Bacteria 5158
1336 nmdc:mga06z11_158494_c1 3300050494 Bacteria 1292
1337 nmdc:mga06z11_195578_c1 3300050494 Bacteria 1172
1338 nmdc:mga06z11_289298_c1 3300050494 Bacteria 972
1339 nmdc:mga04h51_33437_c1 3300050495 Bacteria 1637
1340 nmdc:mga04h51_5335_c1 3300050495 Bacteria 3271
1341 nmdc:mga04h51_68922_c1 3300050495 Bacteria 1230
1342 nmdc:mga07m45_102179_c1 3300050496 Bacteria 1646
1343 nmdc:mga07m45_137511_c1 3300050496 Bacteria 1414
1344 nmdc:mga07m45_1929_c1 3300050496 Bacteria 9590
1345 nmdc:mga07m45_3911_c1 3300050496 Bacteria 7237
1346 nmdc:mga05p37_4837_c1 3300050507 Bacteria 15753
1347 nmdc:mga05p37_699874_c1 3300050507 Bacteria 1126
1348 nmdc:mga0qj67_214647_c1 3300050509 Bacteria 1562
1349 nmdc:mga06r32_231017_c1 3300050510 Bacteria 1838
1350 nmdc:mga08y16_157905_c1 3300050511 Bacteria 2357
1351 nmdc:mga08y16_300163_c1 3300050511 Bacteria 1655
1352 nmdc:mga08y16_417681_c1 3300050511 Bacteria 1371
1353 nmdc:mga08y16_440743_c1 3300050511 Bacteria 1329
1354 nmdc:mga08y16_511091_c1 3300050511 Bacteria 1219
1355 nmdc:mga0n895_537959_c1 3300050512 Unclassified 1175
1356 nmdc:mga0n895_556268_c1 3300050512 Bacteria 1153
1357 nmdc:mga0n895_72053_c1 3300050512 Bacteria 3427
1358 nmdc:mga0rr50_123263_c1 3300050513 Bacteria 2066
1359 nmdc:mga08x19_258482_c1 3300050514 Unclassified 1203
1360 nmdc:mga08x19_32130_c1 3300050514 Bacteria 3306
1361 nmdc:mga0a205_180274_c1 3300050515 Bacteria 2007
1362 nmdc:mga0a205_311906_c1 3300050515 Bacteria 1445
1363 nmdc:mga0a205_329637_c1 3300050515 Bacteria 1396
1364 nmdc:mga0sz30_45978_c1 3300050516 Bacteria 1842
1365 nmdc:mga0sz30_86912_c1 3300050516 Bacteria 1358
1366 nmdc:mga0sz30_94549_c1 3300050516 Bacteria 1303
1367 Ga0495601_0056249 3300053077 Bacteria 2491
1368 Ga0495601_0099669 3300053077 Bacteria 1876
1369 Ga0495601_0121479 3300053077 Bacteria 1696
1370 Ga0495601_0167874 3300053077 Bacteria 1434
1371 Ga0495601_0207292 3300053077 Bacteria 1281
1372 Ga0495601_0268820 3300053077 Bacteria 1112
1373 Ga0495612_0005170 3300053078 Bacteria 5392
1374 Ga0495612_0005994 3300053078 Bacteria 5004
1375 Ga0495612_0022238 3300053078 Bacteria 2543
1376 Ga0495612_0137893 3300053078 Bacteria 1057
1377 Ga0500635_0014749 3300053080 Bacteria 2296
1378 Ga0495595_0000267 3300053084 Bacteria 20599
1379 Ga0495595_0001389 3300053084 Bacteria 9386
1380 Ga0495595_0048915 3300053084 Bacteria 1954
1381 Ga0495619_0000434 3300053085 Bacteria 28423
1382 Ga0495619_0000491 3300053085 Bacteria 26518
1383 Ga0495619_0037925 3300053085 Bacteria 3143
1384 Ga0495619_0055342 3300053085 Bacteria 2627
1385 Ga0495619_0418464 3300053085 Bacteria 924
1386 Ga0500643_000156 3300053087 Bacteria 68861
1387 Ga0500643_011270 3300053087 Bacteria 3270
1388 Ga0500643_032107 3300053087 Bacteria 1596
1389 Ga0500581_083803 3300053089 Bacteria 1588
1390 Ga0500646_0008643 3300053090 Bacteria 2607
1391 Ga0500647_0067702 3300053091 Bacteria 1717
1392 Ga0500651_0061060 3300053093 Bacteria 2355
1393 Ga0500651_0087129 3300053093 Bacteria 1927
1394 Ga0500651_0152455 3300053093 Bacteria 1387
1395 Ga0500651_0189508 3300053093 Bacteria 1218
1396 Ga0500566_0000091 3300053094 Bacteria 45305
1397 Ga0500566_0000990 3300053094 Bacteria 16360
1398 Ga0500566_0031382 3300053094 Bacteria 3098
1399 Ga0500566_0095435 3300053094 Bacteria 1638
1400 Ga0500566_0183280 3300053094 Bacteria 1072
1401 Ga0500640_139350 3300053095 Bacteria 944
1402 Ga0500641_0014068 3300053096 Bacteria 2948
1403 Ga0500641_0034873 3300053096 Bacteria 2005
1404 Ga0500641_0068022 3300053096 Bacteria 1494
1405 Ga0500641_0151612 3300053096 Bacteria 1000
1406 Ga0500650_0001832 3300053098 Bacteria 6668
1407 Ga0500650_0172716 3300053098 Bacteria 993
1408 Ga0500554_002104 3300053102 Bacteria 3861
1409 Ga0500555_000933 3300053103 Bacteria 10224
1410 Ga0500556_0000002 3300053104 Bacteria 773626
1411 Ga0500556_0000048 3300053104 Bacteria 123558
1412 Ga0500556_0004481 3300053104 Bacteria 3972
1413 Ga0500556_0122004 3300053104 Bacteria 1017
1414 Ga0500557_000024 3300053105 Bacteria 84960
1415 Ga0500562_012516 3300053108 Bacteria 2158
1416 Ga0500562_063985 3300053108 Bacteria 989
1417 Ga0500562_071229 3300053108 Bacteria 938
1418 Ga0500572_000309 3300053111 Bacteria 17365
1419 Ga0500572_021886 3300053111 Bacteria 1698
1420 Ga0500594_0023064 3300053118 Bacteria 1574
1421 Ga0500594_0025817 3300053118 Bacteria 1509
1422 Ga0500595_000698 3300053119 Bacteria 20065
1423 Ga0500595_002243 3300053119 Bacteria 9798
1424 Ga0500595_003813 3300053119 Bacteria 6931
1425 Ga0500595_006478 3300053119 Bacteria 4961
1426 Ga0500595_078728 3300053119 Bacteria 967
1427 Ga0500607_030662 3300053121 Bacteria 2964
1428 Ga0500607_118822 3300053121 Bacteria 1282
1429 Ga0500608_000584 3300053122 Bacteria 13396
1430 Ga0500614_012060 3300053123 Bacteria 1879
1431 Ga0500642_0000093 3300053130 Bacteria 44347
1432 Ga0500642_0000107 3300053130 Bacteria 40189
1433 Ga0500642_0071711 3300053130 Bacteria 1577
1434 Ga0500652_000219 3300053131 Bacteria 21936
1435 Ga0500655_003619 3300053133 Bacteria 2784
1436 Ga0500655_008426 3300053133 Bacteria 1856
1437 Ga0500658_0038875 3300053134 Bacteria 1898
1438 Ga0500658_0152483 3300053134 Bacteria 1042
1439 Ga0500559_0000341 3300053136 Bacteria 34924
1440 Ga0500559_0001261 3300053136 Bacteria 14832
1441 Ga0500559_0058481 3300053136 Bacteria 1714
1442 Ga0500568_0000835 3300053139 Bacteria 21662
1443 Ga0500568_0001045 3300053139 Bacteria 18906
1444 Ga0500568_0005007 3300053139 Bacteria 6946
1445 Ga0500568_0020371 3300053139 Bacteria 2869
1446 Ga0500568_0047844 3300053139 Bacteria 1693
1447 Ga0500568_0068906 3300053139 Bacteria 1357
1448 Ga0500577_0000212 3300053142 Bacteria 15416
1449 Ga0500586_096995 3300053145 Bacteria 1033
1450 Ga0500589_059000 3300053147 Bacteria 1762
1451 Ga0500590_171896 3300053148 Bacteria 951
1452 Ga0500603_031274 3300053150 Bacteria 1374
1453 Ga0500604_0007304 3300053151 Bacteria 2926
1454 Ga0500616_0000045 3300053153 Bacteria 339292
1455 Ga0500616_0000069 3300053153 Bacteria 234334
1456 Ga0500616_0051836 3300053153 Bacteria 2160
1457 Ga0500616_0101308 3300053153 Bacteria 1407
1458 Ga0500622_0001388 3300053156 Bacteria 19505
1459 Ga0500622_0015344 3300053156 Bacteria 4102
1460 Ga0500624_014333 3300053157 Bacteria 1198
1461 Ga0500627_0007562 3300053158 Bacteria 3796
1462 Ga0500627_0055077 3300053158 Bacteria 1740
1463 Ga0500627_0090051 3300053158 Bacteria 1373
1464 Ga0500627_0126335 3300053158 Bacteria 1154
1465 Ga0500634_0013070 3300053161 Bacteria 4344
1466 Ga0500634_0047748 3300053161 Bacteria 2311
1467 Ga0500634_0102260 3300053161 Bacteria 1431
1468 Ga0500634_0108303 3300053161 Bacteria 1376
1469 Ga0500638_000254 3300053162 Bacteria 11662
1470 Ga0500638_197403 3300053162 Bacteria 854
1471 Ga0500636_0003270 3300053177 Bacteria 9084
1472 Ga0500636_0009247 3300053177 Bacteria 5728
1473 Ga0500636_0069854 3300053177 Bacteria 2038
1474 Ga0500636_0111330 3300053177 Bacteria 1546
1475 Ga0500636_0128535 3300053177 Bacteria 1414
1476 Ga0500636_0241309 3300053177 Bacteria 928
1477 Ga0500637_0000216 3300053178 Bacteria 21533
1478 Ga0500637_0006416 3300053178 Bacteria 5791
1479 Ga0500637_0175014 3300053178 Bacteria 1232
1480 Ga0500576_054740 3300053725 Bacteria 1760
1481 Ga0500611_005568 3300053727 Bacteria 1782
1482 Ga0500611_021866 3300053727 Bacteria 1226
1483 Ga0500645_046945 3300053730 Bacteria 1266
1484 Ga0500645_077583 3300053730 Bacteria 949
1485 Ga0500599_000719 3300053736 Bacteria 3586
1486 Ga0500601_000724 3300053737 Bacteria 4349
1487 Ga0501084_0001610 3300054114 Bacteria 17890
1488 Ga0501084_0062496 3300054114 Bacteria 3117
1489 Ga0501084_0151219 3300054114 Bacteria 1957
1490 Ga0500661_019441 3300055283 Bacteria 1209
1491 Ga0501082_0000084 3300060353 Bacteria 70644
1492 Ga0501082_0015760 3300060353 Bacteria 6502
1493 Ga0501082_0068493 3300060353 Bacteria 3055
1494 Ga0501082_0260001 3300060353 Bacteria 1510
1495 Ga0501082_0277094 3300060353 Bacteria 1460
1496 Ga0530510_0063518 3300061734 Bacteria 2673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0430639 Ga0496109_0430639_199_945 233
2 3300005614 Ga0068856_100063923 Ga0068856_1000639234 236
3 3300006175 Ga0070712_100303697 Ga0070712_1003036972 236
4 3300025915 Ga0207693_10020465 Ga0207693_100204654 236
5 3300025916 Ga0207663_10005570 Ga0207663_100055703 236
6 3300046452 Ga0495617_068258 Ga0495617_068258_34_744 236
7 3300046472 Ga0495580_0533797 Ga0495580_0533797_49_762 236
8 3300046684 Ga0495669_0278404 Ga0495669_0278404_14_724 236
9 3300048918 Ga0496115_0075176 Ga0496115_0075176_1051_1806 236
10 3300049575 Ga0501039_0694764 Ga0501039_0694764_16_726 236
11 3300009545 Ga0105237_10083404 Ga0105237_100834042 237
12 3300026142 Ga0207698_10916301 Ga0207698_109163011 237
13 3300035241 Ga0373961_0012551 Ga0373961_0012551_26_739 237
14 3300037418 Ga0395900_0001759 Ga0395900_0001759_10655_11368 237
15 3300037466 Ga0395898_0055146 Ga0395898_0055146_1678_2391 237
16 3300037466 Ga0395898_0063202 Ga0395898_0063202_2688_3413 237
17 3300037471 Ga0395905_0499771 Ga0395905_0499771_375_1088 237
18 3300038443 Ga0395901_0043346 Ga0395901_0043346_1441_2154 237
19 3300046476 Ga0495662_0220546 Ga0495662_0220546_212_925 237
20 3300046513 Ga0495616_0052942 Ga0495616_0052942_31_744 237
21 3300046514 Ga0495618_0430564 Ga0495618_0430564_72_785 237
22 3300046526 Ga0495666_0191232 Ga0495666_0191232_27_740 237
23 3300046530 Ga0495654_0005880 Ga0495654_0005880_3818_4555 237
24 3300048907 Ga0496104_0696809 Ga0496104_0696809_179_892 237
25 3300048912 Ga0496109_1016602 Ga0496109_1016602_39_752 237
26 3300048914 Ga0496111_0265385 Ga0496111_0265385_526_1263 237
27 3300048924 Ga0496121_0151531 Ga0496121_0151531_159_875 237
28 3300048929 Ga0496126_0562002 Ga0496126_0562002_168_884 237
29 3300048929 Ga0496126_0600538 Ga0496126_0600538_119_832 237
30 3300049571 Ga0501034_0019896 Ga0501034_0019896_3883_4608 237
31 3300049572 Ga0501036_0236704 Ga0501036_0236704_430_1182 237
32 3300049580 Ga0501046_0007792 Ga0501046_0007792_6384_7109 237
33 3300049581 Ga0501047_0016128 Ga0501047_0016128_6111_6836 237
34 3300049589 Ga0501073_0099446 Ga0501073_0099446_125_850 237
35 3300049823 Ga0501044_0043353 Ga0501044_0043353_2554_3279 237
36 3300050511 nmdc:mga08y16_300163_c1 nmdc:mga08y16_300163_c1_822_1544 237
37 3300050515 nmdc:mga0a205_311906_c1 nmdc:mga0a205_311906_c1_26_739 237
38 3300053096 Ga0500641_0151612 Ga0500641_0151612_20_751 237
39 3300053118 Ga0500594_0023064 Ga0500594_0023064_10_741 237
40 3300053119 Ga0500595_078728 Ga0500595_078728_244_957 237
41 3300053157 Ga0500624_014333 Ga0500624_014333_232_969 237
42 3300053158 Ga0500627_0090051 Ga0500627_0090051_471_1208 237
43 3300053177 Ga0500636_0069854 Ga0500636_0069854_1188_1943 239
44 3300053111 Ga0500572_021886 Ga0500572_021886_482_1237 241
45 3300053177 Ga0500636_0009247 Ga0500636_0009247_1590_2345 241
46 3300031507 Ga0307509_10235360 Ga0307509_102353601 242
47 3300046664 Ga0495659_0007751 Ga0495659_0007751_2650_3381 243
48 3300047446 Ga0495679_096931 Ga0495679_096931_12_743 243
49 3300048920 Ga0496117_0085429 Ga0496117_0085429_1097_1846 243
50 3300049582 Ga0501048_0138363 Ga0501048_0138363_897_1637 243
51 3300049593 Ga0501077_0084003 Ga0501077_0084003_719_1459 243
52 3300049741 Ga0501079_0111763 Ga0501079_0111763_635_1375 243
53 3300049743 Ga0501081_0106847 Ga0501081_0106847_697_1437 243
54 3300061734 Ga0530510_0063518 Ga0530510_0063518_696_1436 243
55 3300046524 Ga0495648_0001433 Ga0495648_0001433_1883_2635 244
56 3300026067 Ga0207678_10231459 Ga0207678_102314592 245
57 iso_pu_bacteria 2721755755 2723845668 245
58 iso_pu_bacteria 2904690495 2904696335 245
59 3300005336 Ga0070680_100435939 Ga0070680_1004359391 246
60 3300005435 Ga0070714_100130627 Ga0070714_1001306272 246
61 3300005437 Ga0070710_10013495 Ga0070710_100134953 246
62 3300005439 Ga0070711_100154357 Ga0070711_1001543573 246
63 3300005535 Ga0070684_100141149 Ga0070684_1001411491 246
64 3300005547 Ga0070693_100034460 Ga0070693_1000344602 246
65 3300005563 Ga0068855_100162720 Ga0068855_1001627202 246
66 3300005614 Ga0068856_100086868 Ga0068856_1000868682 246
67 3300006048 Ga0075363_100010269 Ga0075363_1000102692 246
68 3300006177 Ga0075362_10005833 Ga0075362_100058333 246
69 3300006195 Ga0075366_10011006 Ga0075366_100110062 246
70 3300006914 Ga0075436_100081189 Ga0075436_1000811892 246
71 3300007788 Ga0099795_10003094 Ga0099795_100030943 246
72 3300009093 Ga0105240_10209403 Ga0105240_102094033 246
73 3300009551 Ga0105238_10056888 Ga0105238_100568883 246
74 3300013100 Ga0157373_10054578 Ga0157373_100545782 246
75 3300020082 Ga0206353_10108935 Ga0206353_101089351 246
76 3300025912 Ga0207707_10387875 Ga0207707_103878752 246
77 3300025913 Ga0207695_10148509 Ga0207695_101485093 246
78 3300025949 Ga0207667_10318937 Ga0207667_103189372 246
79 3300026078 Ga0207702_10151415 Ga0207702_101514151 246
80 3300027512 Ga0209179_1024849 Ga0209179_10248492 246
81 3300045836 Ga0466958_0328468 Ga0466958_0328468_218_958 246
82 3300049571 Ga0501034_0000088 Ga0501034_0000088_94853_95599 246
83 3300050489 nmdc:mga03683_17567_c1 nmdc:mga03683_17567_c1_224_967 246
84 3300050490 nmdc:mga03n38_20367_c1 nmdc:mga03n38_20367_c1_1431_2174 246
85 3300050493 nmdc:mga0k408_5224_c1 nmdc:mga0k408_5224_c1_4695_5438 246
86 iso_pu_bacteria 2513237096 2513656784 246
87 iso_pu_bacteria 2513237101 2513691937 246
88 iso_pu_bacteria 2513237137 2513857973 246
89 iso_pu_bacteria 2513237145 2513917969 246
90 iso_pu_bacteria 2517572143 2517892985 246
91 iso_pu_bacteria 2667528175 2671117610 246
92 iso_pu_bacteria 2728368998 2728750442 246
93 iso_pu_bacteria 2791355197 2793073026 246
94 iso_pu_bacteria 2791355199 2793081777 246
95 iso_pu_bacteria 2874604998 2874609710 246
96 iso_pu_bacteria 2876808645 2876811821 246
97 iso_pu_bacteria 2879110137 2879118417 246
98 iso_pu_bacteria 2885374607 2885377401 246
99 iso_pu_bacteria 2889033259 2889040474 246
100 iso_pu_bacteria 2903748898 2903751990 246
101 iso_pu_bacteria 2904699407 2904703152 246
102 iso_pu_bacteria 2906610324 2906618021 246
103 iso_pu_bacteria 2906635258 2906636048 246
104 iso_pu_bacteria 2906660503 2906661508 246
105 iso_pu_bacteria 2908756301 2908760882 246
106 iso_pu_bacteria 2922361189 2922368355 246
107 iso_pu_bacteria 2922386360 2922388196 246
108 iso_pu_bacteria 2922425934 2922429518 246
109 iso_pu_bacteria 2941507105 2941510505 246
110 iso_pu_bacteria 2941515067 2941517757 246
111 iso_pu_bacteria 2941523033 2941525774 246
112 iso_pu_bacteria 3005474847 3005479675 246
113 iso_pu_bacteria 8006964411 8006967303 246
114 iso_pu_bacteria 8006984368 8006990210 246
115 iso_pu_bacteria 8006994254 8006997541 246
116 iso_pu_bacteria 8019555841 8019557347 246
117 iso_pu_bacteria 8019565922 8019567952 246
118 iso_pu_bacteria 8056673599 8056674415 246
119 iso_pu_bacteria 8056689827 8056690093 246
120 3300009093 Ga0105240_10354146 Ga0105240_103541461 247
121 3300039062 Ga0400483_060836 Ga0400483_060836_353_1096 247
122 3300049573 Ga0501037_0144821 Ga0501037_0144821_295_1044 247
123 3300049574 Ga0501038_0339867 Ga0501038_0339867_261_1007 247
124 3300049581 Ga0501047_0109419 Ga0501047_0109419_940_1689 247
125 3300049590 Ga0501074_0059524 Ga0501074_0059524_690_1439 247
126 3300049742 Ga0501080_0060413 Ga0501080_0060413_1058_1807 247
127 3300049744 Ga0501083_0151374 Ga0501083_0151374_417_1160 247
128 3300049823 Ga0501044_0189973 Ga0501044_0189973_27_770 247
129 3300050515 nmdc:mga0a205_329637_c1 nmdc:mga0a205_329637_c1_69_839 247
130 3300053153 Ga0500616_0101308 Ga0500616_0101308_238_981 247
131 iso_pu_bacteria 2507262055 2507509238 247
132 iso_pu_bacteria 2508501009 2508543307 247
133 iso_pu_bacteria 2508501042 2508690944 247
134 iso_pu_bacteria 2508501128 2509147412 247
135 iso_pu_bacteria 2511231028 2511397211 247
136 iso_pu_bacteria 2513237095 2513646771 247
137 iso_pu_bacteria 2513237098 2513677825 247
138 iso_pu_bacteria 2513237104 2513717246 247
139 iso_pu_bacteria 2513237139 2513876592 247
140 iso_pu_bacteria 2513237141 2513892807 247
141 iso_pu_bacteria 2515154112 2515626656 247
142 iso_pu_bacteria 2517093001 2517101891 247
143 iso_pu_bacteria 2524023210 2524465192 247
144 iso_pu_bacteria 2528768022 2528852246 247
145 iso_pu_bacteria 2599185236 2599720702 247
146 iso_pu_bacteria 2602042107 2603858934 247
147 iso_pu_bacteria 2643221623 2644132141 247
148 iso_pu_bacteria 2802429603 2805919847 247
149 iso_pu_bacteria 2816332527 2818242850 247
150 iso_pu_bacteria 2824600985 2824606036 247
151 iso_pu_bacteria 2824609381 2824615975 247
152 iso_pu_bacteria 2824653114 2824658878 247
153 iso_pu_bacteria 2824661429 2824667765 247
154 iso_pu_bacteria 2824671348 2824676155 247
155 iso_pu_bacteria 2824687955 2824691828 247
156 iso_pu_bacteria 2824696289 2824699443 247
157 iso_pu_bacteria 2824704595 2824710419 247
158 iso_pu_bacteria 2824753945 2824761129 247
159 iso_pu_bacteria 2824763712 2824771181 247
160 iso_pu_bacteria 2824773399 2824779335 247
161 iso_pu_bacteria 2837651117 2837653779 247
162 iso_pu_bacteria 2841957949 2841958093 247
163 iso_pu_bacteria 2844315083 2844318476 247
164 iso_pu_bacteria 2847930680 2847935366 247
165 iso_pu_bacteria 2847939898 2847945974 247
166 iso_pu_bacteria 2857509624 2857513691 247
167 iso_pu_bacteria 2857524615 2857527959 247
168 iso_pu_bacteria 2874590934 2874597363 247
169 iso_pu_bacteria 2874620515 2874626732 247
170 iso_pu_bacteria 2874645413 2874649304 247
171 iso_pu_bacteria 2876771140 2876777840 247
172 iso_pu_bacteria 2876818435 2876823139 247
173 iso_pu_bacteria 2879074833 2879078597 247
174 iso_pu_bacteria 2879083081 2879088559 247
175 iso_pu_bacteria 2879099564 2879108058 247
176 iso_pu_bacteria 2879127579 2879132926 247
177 iso_pu_bacteria 2879142872 2879148725 247
178 iso_pu_bacteria 2885366525 2885371909 247
179 iso_pu_bacteria 2885383462 2885387649 247
180 iso_pu_bacteria 2888378607 2888383436 247
181 iso_pu_bacteria 2888388044 2888394501 247
182 iso_pu_bacteria 2888419890 2888423823 247
183 iso_pu_bacteria 2893066018 2893068376 247
184 iso_pu_bacteria 2903727486 2903730159 247
185 iso_pu_bacteria 2903768456 2903778328 247
186 iso_pu_bacteria 2904666416 2904668310 247
187 iso_pu_bacteria 2904711408 2904717271 247
188 iso_pu_bacteria 2906602504 2906603544 247
189 iso_pu_bacteria 2906626472 2906632451 247
190 iso_pu_bacteria 2906643746 2906646302 247
191 iso_pu_bacteria 2919073203 2919075360 247
192 iso_pu_bacteria 2922368715 2922373619 247
193 iso_pu_bacteria 2929615660 2929617354 247
194 iso_pu_bacteria 2929624759 2929627059 247
195 iso_pu_bacteria 2932784394 2932787610 247
196 iso_pu_bacteria 2932809354 2932813209 247
197 iso_pu_bacteria 2932818245 2932820876 247
198 iso_pu_bacteria 2932828146 2932834757 247
199 iso_pu_bacteria 2933577622 2933579311 247
200 iso_pu_bacteria 2935608549 2935611874 247
201 iso_pu_bacteria 2935616580 2935621716 247
202 iso_pu_bacteria 2935638405 2935642666 247
203 iso_pu_bacteria 2935665750 2935667768 247
204 iso_pu_bacteria 2935675223 2935682258 247
205 iso_pu_bacteria 2935684952 2935688513 247
206 iso_pu_bacteria 2935694250 2935695863 247
207 iso_pu_bacteria 2935703347 2935706608 247
208 iso_pu_bacteria 2935713505 2935715532 247
209 iso_pu_bacteria 2935722832 2935725904 247
210 iso_pu_bacteria 2935732158 2935734351 247
211 iso_pu_bacteria 2935741537 2935743730 247
212 iso_pu_bacteria 2935750917 2935754233 247
213 iso_pu_bacteria 2935760218 2935768407 247
214 iso_pu_bacteria 2935769743 2935772647 247
215 iso_pu_bacteria 2935777560 2935783197 247
216 iso_pu_bacteria 2935785616 2935790940 247
217 iso_pu_bacteria 2935793552 2935799359 247
218 iso_pu_bacteria 2935801545 2935806425 247
219 iso_pu_bacteria 2935810662 2935813017 247
220 iso_pu_bacteria 2935819856 2935821354 247
221 iso_pu_bacteria 2935827899 2935830669 247
222 iso_pu_bacteria 2935837841 2935840698 247
223 iso_pu_bacteria 2935847175 2935850387 247
224 iso_pu_bacteria 2935855204 2935859963 247
225 iso_pu_bacteria 2935864058 2935869402 247
226 iso_pu_bacteria 2935873716 2935880437 247
227 iso_pu_bacteria 2935908558 2935914003 247
228 iso_pu_bacteria 2935916978 2935921145 247
229 iso_pu_bacteria 2935926038 2935931809 247
230 iso_pu_bacteria 2935934488 2935940256 247
231 iso_pu_bacteria 2935942939 2935947919 247
232 iso_pu_bacteria 2935951376 2935956540 247
233 iso_pu_bacteria 2935959822 2935960349 247
234 iso_pu_bacteria 2935967501 2935973334 247
235 iso_pu_bacteria 2935975950 2935977585 247
236 iso_pu_bacteria 2935984226 2935989495 247
237 iso_pu_bacteria 2935992306 2935999491 247
238 iso_pu_bacteria 2936002035 2936006526 247
239 iso_pu_bacteria 2936037263 2936041605 247
240 iso_pu_bacteria 2937843397 2937846136 247
241 iso_pu_bacteria 2940556831 2940560391 247
242 iso_pu_bacteria 2941531003 2941534225 247
243 iso_pu_bacteria 2941538514 2941541172 247
244 iso_pu_bacteria 3005710791 3005714248 247
245 iso_pu_bacteria 8006926726 8006929340 247
246 iso_pu_bacteria 8016511872 8016514064 247
247 iso_pu_bacteria 8016522445 8016530249 247
248 iso_pu_bacteria 8016530956 8016535508 247
249 iso_pu_bacteria 8016539877 8016548703 247
250 iso_pu_bacteria 8016548790 8016553431 247
251 iso_pu_bacteria 8016557553 8016561807 247
252 iso_pu_bacteria 8016575299 8016577964 247
253 iso_pu_bacteria 8016595262 8016599642 247
254 iso_pu_bacteria 8016613128 8016622429 247
255 iso_pu_bacteria 8016622563 8016627356 247
256 iso_pu_bacteria 8016630954 8016631658 247
257 iso_pu_bacteria 8017057580 8017062347 247
258 iso_pu_bacteria 8019530166 8019535240 247
259 iso_pu_bacteria 8019538911 8019544242 247
260 iso_pu_bacteria 8019547302 8019554460 247
261 iso_pu_bacteria 8019576017 8019581802 247
262 iso_pu_bacteria 8019586578 8019589476 247
263 iso_pu_bacteria 8019608314 8019616762 247
264 iso_pu_bacteria 8019619141 8019627453 247
265 iso_pu_bacteria 8019629233 8019635121 247
266 iso_pu_bacteria 8019638758 8019644607 247
267 iso_pu_bacteria 8019648815 8019657628 247
268 iso_pu_bacteria 8019659431 8019662963 247
269 iso_pu_bacteria 8019668869 8019672562 247
270 iso_pu_bacteria 8019678201 8019683596 247
271 iso_pu_bacteria 8019687851 8019689340 247
272 iso_pu_bacteria 8055742211 8055747031 247
273 iso_pu_bacteria 8056681323 8056683323 247
274 3300005564 Ga0070664_100198428 Ga0070664_1001984282 248
275 3300005981 Ga0081538_10038370 Ga0081538_100383702 248
276 3300011119 Ga0105246_10142910 Ga0105246_101429101 248
277 3300044684 Ga0466966_0168686 Ga0466966_0168686_67_816 248
278 3300044694 Ga0466963_0016505 Ga0466963_0016505_2994_3743 248
279 3300044842 Ga0466957_0322588 Ga0466957_0322588_220_969 248
280 3300045976 Ga0466967_0002462 Ga0466967_0002462_2662_3411 248
281 3300049569 Ga0501032_0136588 Ga0501032_0136588_732_1478 248
282 3300049571 Ga0501034_0519603 Ga0501034_0519603_85_831 248
283 3300049573 Ga0501037_0199808 Ga0501037_0199808_164_913 248
284 3300049581 Ga0501047_0039630 Ga0501047_0039630_11_757 248
285 3300049581 Ga0501047_0087376 Ga0501047_0087376_977_1723 248
286 3300049583 Ga0501067_0189962 Ga0501067_0189962_215_964 248
287 3300049585 Ga0501069_0115171 Ga0501069_0115171_447_1193 248
288 3300049588 Ga0501072_0245583 Ga0501072_0245583_165_914 248
289 3300049744 Ga0501083_0007489 Ga0501083_0007489_3884_4633 248
290 3300049823 Ga0501044_0077856 Ga0501044_0077856_2537_3286 248
291 3300049823 Ga0501044_0170847 Ga0501044_0170847_898_1644 248
292 3300060353 Ga0501082_0015760 Ga0501082_0015760_2428_3177 248
293 iso_pu_bacteria 2643221547 2643756320 248
294 iso_pu_bacteria 2909042592 2909043908 248
295 iso_pu_bacteria 2928531327 2928535341 248
296 3300005336 Ga0070680_100175148 Ga0070680_1001751483 249
297 3300005434 Ga0070709_10015676 Ga0070709_100156762 249
298 3300005434 Ga0070709_10611680 Ga0070709_106116801 249
299 3300005436 Ga0070713_100021269 Ga0070713_1000212693 249
300 3300005439 Ga0070711_100054002 Ga0070711_1000540022 249
301 3300005439 Ga0070711_100263486 Ga0070711_1002634861 249
302 3300005457 Ga0070662_100117538 Ga0070662_1001175382 249
303 3300005618 Ga0068864_100426410 Ga0068864_1004264102 249
304 3300005841 Ga0068863_100237338 Ga0068863_1002373383 249
305 3300005842 Ga0068858_100486121 Ga0068858_1004861212 249
306 3300006028 Ga0070717_10107691 Ga0070717_101076912 249
307 3300006042 Ga0075368_10048271 Ga0075368_100482712 249
308 3300006175 Ga0070712_100181556 Ga0070712_1001815562 249
309 3300006175 Ga0070712_100633261 Ga0070712_1006332611 249
310 3300007265 Ga0099794_10003317 Ga0099794_100033172 249
311 3300009093 Ga0105240_10287268 Ga0105240_102872681 249
312 3300009174 Ga0105241_10082586 Ga0105241_100825863 249
313 3300009545 Ga0105237_10469786 Ga0105237_104697861 249
314 3300010375 Ga0105239_10543654 Ga0105239_105436541 249
315 3300014325 Ga0163163_10207624 Ga0163163_102076241 249
316 3300025906 Ga0207699_10021380 Ga0207699_100213803 249
317 3300025911 Ga0207654_10034166 Ga0207654_100341663 249
318 3300025913 Ga0207695_10000015 Ga0207695_10000015721 249
319 3300025914 Ga0207671_10001316 Ga0207671_1000131624 249
320 3300025928 Ga0207700_10074945 Ga0207700_100749452 249
321 3300025933 Ga0207706_10212076 Ga0207706_102120762 249
322 3300025936 Ga0207670_10317589 Ga0207670_103175892 249
323 3300025981 Ga0207640_10143765 Ga0207640_101437651 249
324 3300026035 Ga0207703_10575241 Ga0207703_105752412 249
325 3300026088 Ga0207641_10246807 Ga0207641_102468071 249
326 3300026095 Ga0207676_10071536 Ga0207676_100715362 249
327 3300026121 Ga0207683_10079700 Ga0207683_100797002 249
328 3300037068 Ga0373925_0148842 Ga0373925_0148842_188_937 249
329 3300046460 Ga0495638_0039823 Ga0495638_0039823_2207_2959 249
330 3300046477 Ga0495664_0278364 Ga0495664_0278364_121_870 249
331 3300046533 Ga0495640_0025020 Ga0495640_0025020_1822_2571 249
332 3300046642 Ga0495634_0085665 Ga0495634_0085665_1064_1813 249
333 3300047315 Ga0495581_0270429 Ga0495581_0270429_39_788 249
334 3300048907 Ga0496104_0000331 Ga0496104_0000331_35632_36399 249
335 3300048907 Ga0496104_0092178 Ga0496104_0092178_1536_2285 249
336 3300048908 Ga0496105_0617885 Ga0496105_0617885_42_809 249
337 3300048911 Ga0496108_0279817 Ga0496108_0279817_167_934 249
338 3300048912 Ga0496109_0037791 Ga0496109_0037791_2491_3258 249
339 3300048913 Ga0496110_0050759 Ga0496110_0050759_513_1280 249
340 3300048913 Ga0496110_0054426 Ga0496110_0054426_1292_2041 249
341 3300048914 Ga0496111_0020054 Ga0496111_0020054_3460_4227 249
342 3300048915 Ga0496112_0043885 Ga0496112_0043885_563_1330 249
343 3300048916 Ga0496113_0008072 Ga0496113_0008072_929_1696 249
344 3300048917 Ga0496114_0279601 Ga0496114_0279601_488_1237 249
345 3300048918 Ga0496115_0541517 Ga0496115_0541517_112_861 249
346 3300048925 Ga0496122_0001850 Ga0496122_0001850_1483_2235 249
347 3300048926 Ga0496123_0000498 Ga0496123_0000498_49512_50264 249
348 3300049571 Ga0501034_0048469 Ga0501034_0048469_3061_3810 249
349 3300050489 nmdc:mga03683_2952_c1 nmdc:mga03683_2952_c1_303_1055 249
350 3300050494 nmdc:mga06z11_289298_c1 nmdc:mga06z11_289298_c1_27_782 249
351 3300053078 Ga0495612_0137893 Ga0495612_0137893_221_1006 249
352 3300053104 Ga0500556_0000048 Ga0500556_0000048_40719_41471 249
353 3300053108 Ga0500562_071229 Ga0500562_071229_69_818 249
354 iso_pu_bacteria 2883291878 2883294375 249
355 3300003203 JGI25406J46586_10001492 JGI25406J46586_100014928 250
356 3300003215 JGI25153J46596_10009680 JGI25153J46596_100096803 250
357 3300003659 JGI25404J52841_10015065 JGI25404J52841_100150653 250
358 3300003791 Ga0055530_10010917 Ga0055530_100109172 250
359 3300003794 Ga0055531_10001195 Ga0055531_1000119515 250
360 3300003794 Ga0055531_10003993 Ga0055531_100039935 250
361 3300005327 Ga0070658_10338462 Ga0070658_103384621 250
362 3300005330 Ga0070690_100331020 Ga0070690_1003310201 250
363 3300005331 Ga0070670_100193124 Ga0070670_1001931241 250
364 3300005334 Ga0068869_100102291 Ga0068869_1001022912 250
365 3300005336 Ga0070680_100016985 Ga0070680_1000169855 250
366 3300005347 Ga0070668_100042528 Ga0070668_1000425283 250
367 3300005347 Ga0070668_100153283 Ga0070668_1001532832 250
368 3300005347 Ga0070668_100268800 Ga0070668_1002688002 250
369 3300005353 Ga0070669_100090979 Ga0070669_1000909791 250
370 3300005354 Ga0070675_100187545 Ga0070675_1001875452 250
371 3300005364 Ga0070673_100425115 Ga0070673_1004251152 250
372 3300005365 Ga0070688_100028217 Ga0070688_1000282172 250
373 3300005434 Ga0070709_10005966 Ga0070709_100059665 250
374 3300005435 Ga0070714_100036016 Ga0070714_1000360163 250
375 3300005436 Ga0070713_100010400 Ga0070713_1000104005 250
376 3300005437 Ga0070710_10000344 Ga0070710_1000034426 250
377 3300005439 Ga0070711_100000702 Ga0070711_1000007029 250
378 3300005455 Ga0070663_100007150 Ga0070663_1000071509 250
379 3300005455 Ga0070663_100227965 Ga0070663_1002279651 250
380 3300005456 Ga0070678_100092332 Ga0070678_1000923323 250
381 3300005458 Ga0070681_10203620 Ga0070681_102036203 250
382 3300005466 Ga0070685_10007975 Ga0070685_100079756 250
383 3300005466 Ga0070685_10201983 Ga0070685_102019831 250
384 3300005530 Ga0070679_100056398 Ga0070679_1000563982 250
385 3300005535 Ga0070684_100456791 Ga0070684_1004567911 250
386 3300005539 Ga0068853_100007032 Ga0068853_1000070321 250
387 3300005539 Ga0068853_100514028 Ga0068853_1005140282 250
388 3300005543 Ga0070672_100115669 Ga0070672_1001156692 250
389 3300005543 Ga0070672_100269487 Ga0070672_1002694871 250
390 3300005545 Ga0070695_100267217 Ga0070695_1002672171 250
391 3300005546 Ga0070696_100225617 Ga0070696_1002256172 250
392 3300005548 Ga0070665_100123757 Ga0070665_1001237572 250
393 3300005548 Ga0070665_100259127 Ga0070665_1002591273 250
394 3300005548 Ga0070665_100266730 Ga0070665_1002667302 250
395 3300005563 Ga0068855_100049847 Ga0068855_1000498478 250
396 3300005614 Ga0068856_100007904 Ga0068856_1000079046 250
397 3300005614 Ga0068856_100153160 Ga0068856_1001531602 250
398 3300005617 Ga0068859_100100410 Ga0068859_1001004103 250
399 3300005617 Ga0068859_100978039 Ga0068859_1009780391 250
400 3300005618 Ga0068864_100058520 Ga0068864_1000585203 250
401 3300005618 Ga0068864_100186187 Ga0068864_1001861872 250
402 3300005718 Ga0068866_10111148 Ga0068866_101111481 250
403 3300005718 Ga0068866_10175444 Ga0068866_101754441 250
404 3300005719 Ga0068861_100153715 Ga0068861_1001537152 250
405 3300005719 Ga0068861_100447729 Ga0068861_1004477292 250
406 3300005841 Ga0068863_100273758 Ga0068863_1002737582 250
407 3300005842 Ga0068858_100406507 Ga0068858_1004065072 250
408 3300005843 Ga0068860_100000497 Ga0068860_10000049729 250
409 3300005843 Ga0068860_100080702 Ga0068860_1000807023 250
410 3300005843 Ga0068860_100211082 Ga0068860_1002110822 250
411 3300005843 Ga0068860_100462526 Ga0068860_1004625261 250
412 3300005844 Ga0068862_100365685 Ga0068862_1003656852 250
413 3300005937 Ga0081455_10012384 Ga0081455_100123842 250
414 3300005937 Ga0081455_10016028 Ga0081455_100160289 250
415 3300005937 Ga0081455_10021328 Ga0081455_100213285 250
416 3300005937 Ga0081455_10026882 Ga0081455_100268825 250
417 3300005937 Ga0081455_10047175 Ga0081455_100471752 250
418 3300005937 Ga0081455_10057286 Ga0081455_100572865 250
419 3300005981 Ga0081538_10054726 Ga0081538_100547261 250
420 3300005983 Ga0081540_1002393 Ga0081540_10023933 250
421 3300005983 Ga0081540_1005402 Ga0081540_10054023 250
422 3300005983 Ga0081540_1013623 Ga0081540_10136235 250
423 3300005983 Ga0081540_1016233 Ga0081540_10162332 250
424 3300005983 Ga0081540_1020841 Ga0081540_10208416 250
425 3300005983 Ga0081540_1025112 Ga0081540_10251124 250
426 3300005983 Ga0081540_1031237 Ga0081540_10312372 250
427 3300005983 Ga0081540_1058821 Ga0081540_10588213 250
428 3300005983 Ga0081540_1136757 Ga0081540_11367571 250
429 3300005985 Ga0081539_10001555 Ga0081539_100015551 250
430 3300005985 Ga0081539_10018827 Ga0081539_100188274 250
431 3300006028 Ga0070717_10072326 Ga0070717_100723264 250
432 3300006038 Ga0075365_10042446 Ga0075365_100424461 250
433 3300006042 Ga0075368_10002837 Ga0075368_100028375 250
434 3300006042 Ga0075368_10020493 Ga0075368_100204932 250
435 3300006042 Ga0075368_10032889 Ga0075368_100328893 250
436 3300006048 Ga0075363_100017003 Ga0075363_1000170032 250
437 3300006048 Ga0075363_100213795 Ga0075363_1002137951 250
438 3300006051 Ga0075364_10039692 Ga0075364_100396924 250
439 3300006173 Ga0070716_100004798 Ga0070716_1000047983 250
440 3300006173 Ga0070716_100098727 Ga0070716_1000987273 250
441 3300006178 Ga0075367_10012090 Ga0075367_100120904 250
442 3300006186 Ga0075369_10049416 Ga0075369_100494162 250
443 3300006195 Ga0075366_10084529 Ga0075366_100845292 250
444 3300006195 Ga0075366_10095194 Ga0075366_100951942 250
445 3300006237 Ga0097621_100348408 Ga0097621_1003484082 250
446 3300006353 Ga0075370_10176574 Ga0075370_101765742 250
447 3300006844 Ga0075428_100074465 Ga0075428_1000744652 250
448 3300006871 Ga0075434_100007100 Ga0075434_1000071003 250
449 3300006931 Ga0097620_100100398 Ga0097620_1001003983 250
450 3300006931 Ga0097620_100977842 Ga0097620_1009778421 250
451 3300006942 Ga0099824_1003889 Ga0099824_100388916 250
452 3300006943 Ga0099822_1018677 Ga0099822_10186774 250
453 3300007076 Ga0075435_100087656 Ga0075435_1000876563 250
454 3300009093 Ga0105240_10003456 Ga0105240_1000345618 250
455 3300009093 Ga0105240_10043532 Ga0105240_100435325 250
456 3300009093 Ga0105240_10631035 Ga0105240_106310352 250
457 3300009094 Ga0111539_10041513 Ga0111539_100415133 250
458 3300009094 Ga0111539_10273642 Ga0111539_102736423 250
459 3300009094 Ga0111539_10313558 Ga0111539_103135582 250
460 3300009098 Ga0105245_10048518 Ga0105245_100485182 250
461 3300009098 Ga0105245_10062478 Ga0105245_100624782 250
462 3300009098 Ga0105245_10295203 Ga0105245_102952033 250
463 3300009147 Ga0114129_10099524 Ga0114129_100995241 250
464 3300009147 Ga0114129_10100119 Ga0114129_101001196 250
465 3300009147 Ga0114129_10258935 Ga0114129_102589352 250
466 3300009174 Ga0105241_10029805 Ga0105241_100298052 250
467 3300009174 Ga0105241_10322680 Ga0105241_103226802 250
468 3300009177 Ga0105248_10221469 Ga0105248_102214693 250
469 3300009545 Ga0105237_10205582 Ga0105237_102055822 250
470 3300009551 Ga0105238_10015239 Ga0105238_100152397 250
471 3300009551 Ga0105238_10049070 Ga0105238_100490705 250
472 3300009551 Ga0105238_10119143 Ga0105238_101191433 250
473 3300009551 Ga0105238_10560042 Ga0105238_105600422 250
474 3300009553 Ga0105249_10593228 Ga0105249_105932281 250
475 3300010375 Ga0105239_10007768 Ga0105239_100077685 250
476 3300011119 Ga0105246_10027415 Ga0105246_100274151 250
477 3300011119 Ga0105246_10128931 Ga0105246_101289311 250
478 3300013102 Ga0157371_10087194 Ga0157371_100871942 250
479 3300013104 Ga0157370_10071166 Ga0157370_100711662 250
480 3300013104 Ga0157370_10245754 Ga0157370_102457541 250
481 3300013105 Ga0157369_10012284 Ga0157369_100122845 250
482 3300013296 Ga0157374_10733350 Ga0157374_107333501 250
483 3300013297 Ga0157378_10483300 Ga0157378_104833002 250
484 3300013307 Ga0157372_10061655 Ga0157372_100616552 250
485 3300013308 Ga0157375_10141087 Ga0157375_101410871 250
486 3300014326 Ga0157380_10080959 Ga0157380_100809594 250
487 3300014745 Ga0157377_10231667 Ga0157377_102316672 250
488 3300014968 Ga0157379_10173043 Ga0157379_101730432 250
489 3300014969 Ga0157376_10104151 Ga0157376_101041513 250
490 3300017792 Ga0163161_10113354 Ga0163161_101133541 250
491 3300020081 Ga0206354_10920056 Ga0206354_109200561 250
492 3300025261 Ga0209233_1002215 Ga0209233_10022153 250
493 3300025292 Ga0209676_1000327 Ga0209676_100032776 250
494 3300025297 Ga0209758_1003458 Ga0209758_10034588 250
495 3300025297 Ga0209758_1011126 Ga0209758_10111262 250
496 3300025298 Ga0209050_1001093 Ga0209050_100109318 250
497 3300025304 Ga0209257_1000609 Ga0209257_100060915 250
498 3300025315 Ga0207697_10070251 Ga0207697_100702512 250
499 3300025893 Ga0207682_10003960 Ga0207682_100039605 250
500 3300025898 Ga0207692_10000724 Ga0207692_100007242 250
501 3300025899 Ga0207642_10149832 Ga0207642_101498322 250
502 3300025900 Ga0207710_10216016 Ga0207710_102160161 250
503 3300025901 Ga0207688_10033354 Ga0207688_100333541 250
504 3300025901 Ga0207688_10054478 Ga0207688_100544781 250
505 3300025905 Ga0207685_10046559 Ga0207685_100465592 250
506 3300025906 Ga0207699_10001497 Ga0207699_100014973 250
507 3300025908 Ga0207643_10040058 Ga0207643_100400582 250
508 3300025909 Ga0207705_10352742 Ga0207705_103527422 250
509 3300025911 Ga0207654_10000344 Ga0207654_1000034414 250
510 3300025911 Ga0207654_10200746 Ga0207654_102007462 250
511 3300025912 Ga0207707_10103434 Ga0207707_101034343 250
512 3300025912 Ga0207707_10132454 Ga0207707_101324543 250
513 3300025913 Ga0207695_10000402 Ga0207695_1000040231 250
514 3300025913 Ga0207695_10089621 Ga0207695_100896212 250
515 3300025915 Ga0207693_10035146 Ga0207693_100351466 250
516 3300025916 Ga0207663_10082371 Ga0207663_100823712 250
517 3300025919 Ga0207657_10066342 Ga0207657_100663421 250
518 3300025921 Ga0207652_10175524 Ga0207652_101755242 250
519 3300025923 Ga0207681_10273578 Ga0207681_102735782 250
520 3300025924 Ga0207694_10000095 Ga0207694_1000009582 250
521 3300025926 Ga0207659_10152389 Ga0207659_101523892 250
522 3300025927 Ga0207687_10008392 Ga0207687_100083926 250
523 3300025927 Ga0207687_10316001 Ga0207687_103160012 250
524 3300025928 Ga0207700_10012786 Ga0207700_100127862 250
525 3300025928 Ga0207700_10071819 Ga0207700_100718192 250
526 3300025929 Ga0207664_10055230 Ga0207664_100552302 250
527 3300025931 Ga0207644_10284045 Ga0207644_102840451 250
528 3300025933 Ga0207706_10012740 Ga0207706_100127403 250
529 3300025934 Ga0207686_10046906 Ga0207686_100469061 250
530 3300025936 Ga0207670_10328262 Ga0207670_103282622 250
531 3300025937 Ga0207669_10033925 Ga0207669_100339252 250
532 3300025937 Ga0207669_10115076 Ga0207669_101150761 250
533 3300025938 Ga0207704_10050895 Ga0207704_100508954 250
534 3300025938 Ga0207704_10124949 Ga0207704_101249493 250
535 3300025939 Ga0207665_10003636 Ga0207665_100036368 250
536 3300025939 Ga0207665_10292275 Ga0207665_102922752 250
537 3300025940 Ga0207691_10069954 Ga0207691_100699542 250
538 3300025940 Ga0207691_10131391 Ga0207691_101313912 250
539 3300025942 Ga0207689_10021472 Ga0207689_100214724 250
540 3300025942 Ga0207689_10030547 Ga0207689_100305477 250
541 3300025944 Ga0207661_10000227 Ga0207661_1000022710 250
542 3300025945 Ga0207679_10318224 Ga0207679_103182241 250
543 3300025949 Ga0207667_10400518 Ga0207667_104005181 250
544 3300025960 Ga0207651_10155253 Ga0207651_101552531 250
545 3300025960 Ga0207651_10181556 Ga0207651_101815562 250
546 3300025960 Ga0207651_10224091 Ga0207651_102240912 250
547 3300025961 Ga0207712_10178151 Ga0207712_101781512 250
548 3300025961 Ga0207712_10203294 Ga0207712_102032942 250
549 3300025972 Ga0207668_10018976 Ga0207668_100189762 250
550 3300025972 Ga0207668_10050682 Ga0207668_100506825 250
551 3300025972 Ga0207668_10252375 Ga0207668_102523752 250
552 3300025986 Ga0207658_10164950 Ga0207658_101649502 250
553 3300025986 Ga0207658_10315632 Ga0207658_103156322 250
554 3300026041 Ga0207639_10088929 Ga0207639_100889291 250
555 3300026041 Ga0207639_10647564 Ga0207639_106475641 250
556 3300026067 Ga0207678_10016707 Ga0207678_100167076 250
557 3300026067 Ga0207678_10018224 Ga0207678_100182244 250
558 3300026067 Ga0207678_10243570 Ga0207678_102435701 250
559 3300026067 Ga0207678_10285683 Ga0207678_102856831 250
560 3300026078 Ga0207702_10000025 Ga0207702_1000002573 250
561 3300026078 Ga0207702_10139135 Ga0207702_101391352 250
562 3300026088 Ga0207641_10315497 Ga0207641_103154971 250
563 3300026088 Ga0207641_10493922 Ga0207641_104939222 250
564 3300026095 Ga0207676_10277560 Ga0207676_102775602 250
565 3300026116 Ga0207674_10022795 Ga0207674_100227952 250
566 3300026116 Ga0207674_10063245 Ga0207674_100632453 250
567 3300026116 Ga0207674_10078135 Ga0207674_100781352 250
568 3300026116 Ga0207674_10510214 Ga0207674_105102141 250
569 3300026118 Ga0207675_100023527 Ga0207675_1000235274 250
570 3300026118 Ga0207675_100240797 Ga0207675_1002407971 250
571 3300026121 Ga0207683_10034301 Ga0207683_100343014 250
572 3300026121 Ga0207683_10204096 Ga0207683_102040963 250
573 3300026121 Ga0207683_10690267 Ga0207683_106902672 250
574 3300026142 Ga0207698_10011948 Ga0207698_100119485 250
575 3300026142 Ga0207698_10241062 Ga0207698_102410622 250
576 3300026142 Ga0207698_10592153 Ga0207698_105921532 250
577 3300027357 Ga0209589_1000003 Ga0209589_1000003103 250
578 3300027361 Ga0209489_100003 Ga0209489_100003154 250
579 3300027363 Ga0209700_100003 Ga0209700_100003154 250
580 3300027866 Ga0209813_10042829 Ga0209813_100428291 250
581 3300028379 Ga0268266_10002093 Ga0268266_1000209313 250
582 3300028379 Ga0268266_10003481 Ga0268266_100034818 250
583 3300028379 Ga0268266_10004788 Ga0268266_100047885 250
584 3300028379 Ga0268266_10071199 Ga0268266_100711991 250
585 3300028379 Ga0268266_10481587 Ga0268266_104815871 250
586 3300028380 Ga0268265_10060380 Ga0268265_100603801 250
587 3300028380 Ga0268265_10098647 Ga0268265_100986472 250
588 3300028380 Ga0268265_10451672 Ga0268265_104516722 250
589 3300028381 Ga0268264_10000022 Ga0268264_10000022141 250
590 3300028786 Ga0307517_10000111 Ga0307517_10000111109 250
591 3300028794 Ga0307515_10198993 Ga0307515_101989931 250
592 3300030521 Ga0307511_10028875 Ga0307511_100288752 250
593 3300031344 Ga0265316_10397008 Ga0265316_103970081 250
594 3300031507 Ga0307509_10083821 Ga0307509_100838212 250
595 3300031507 Ga0307509_10204439 Ga0307509_102044392 250
596 3300031616 Ga0307508_10000001 Ga0307508_100000016 250
597 3300031730 Ga0307516_10080872 Ga0307516_100808721 250
598 3300031911 Ga0307412_10192022 Ga0307412_101920221 250
599 3300031995 Ga0307409_100031793 Ga0307409_1000317931 250
600 3300032005 Ga0307411_10162698 Ga0307411_101626981 250
601 3300032126 Ga0307415_100088179 Ga0307415_1000881794 250
602 3300032126 Ga0307415_100106386 Ga0307415_1001063863 250
603 3300033180 Ga0307510_10001748 Ga0307510_1000174811 250
604 3300033442 Ga0315911_1000001 Ga0315911_1000001958 250
605 3300035086 Ga0373934_0043127 Ga0373934_0043127_31_786 250
606 3300035086 Ga0373934_0047487 Ga0373934_0047487_38_793 250
607 3300035113 Ga0373936_0036940 Ga0373936_0036940_1075_1830 250
608 3300035170 Ga0373943_0026965 Ga0373943_0026965_1174_1929 250
609 3300035172 Ga0373955_0027869 Ga0373955_0027869_1801_2556 250
610 3300035172 Ga0373955_0048107 Ga0373955_0048107_172_927 250
611 3300035410 Ga0373924_0004443 Ga0373924_0004443_3279_4034 250
612 3300035692 Ga0373935_0041167 Ga0373935_0041167_1975_2730 250
613 3300035695 Ga0373927_0038834 Ga0373927_0038834_1162_1917 250
614 3300035724 Ga0373933_0033912 Ga0373933_0033912_1768_2523 250
615 3300035724 Ga0373933_0056752 Ga0373933_0056752_353_1108 250
616 3300035725 Ga0373947_0203348 Ga0373947_0203348_221_973 250
617 3300036401 Ga0373937_0031239 Ga0373937_0031239_28_783 250
618 3300037068 Ga0373925_0082755 Ga0373925_0082755_934_1689 250
619 3300037068 Ga0373925_0289015 Ga0373925_0289015_276_1028 250
620 3300037418 Ga0395900_0005207 Ga0395900_0005207_3016_3771 250
621 3300037466 Ga0395898_0001625 Ga0395898_0001625_26574_27329 250
622 3300037471 Ga0395905_0174543 Ga0395905_0174543_484_1236 250
623 3300037853 Ga0436364_0539583 Ga0436364_0539583_420_1178 250
624 3300038443 Ga0395901_0102918 Ga0395901_0102918_1807_2562 250
625 3300038443 Ga0395901_0410686 Ga0395901_0410686_411_1163 250
626 3300039437 Ga0436365_0257418 Ga0436365_0257418_1140_2024 250
627 3300039438 Ga0436360_0096391 Ga0436360_0096391_1125_1919 250
628 3300039447 Ga0436361_0480907 Ga0436361_0480907_2166_2960 250
629 3300039450 Ga0436363_1628114 Ga0436363_1628114_1207_1962 250
630 3300041408 Ga0439453_0006931 Ga0439453_0006931_19_774 250
631 3300042436 Ga0439435_0001490 Ga0439435_0001490_1459_2214 250
632 3300044684 Ga0466966_0214125 Ga0466966_0214125_178_933 250
633 3300044693 Ga0466961_0023660 Ga0466961_0023660_1067_1822 250
634 3300044693 Ga0466961_0099657 Ga0466961_0099657_223_978 250
635 3300045049 Ga0466959_0018639 Ga0466959_0018639_4127_4882 250
636 3300045836 Ga0466958_0139995 Ga0466958_0139995_227_982 250
637 3300045976 Ga0466967_0546005 Ga0466967_0546005_73_828 250
638 3300046454 Ga0495592_0054979 Ga0495592_0054979_2021_2776 250
639 3300046455 Ga0495603_0016002 Ga0495603_0016002_2659_3411 250
640 3300046455 Ga0495603_0018693 Ga0495603_0018693_1835_2587 250
641 3300046455 Ga0495603_0145321 Ga0495603_0145321_311_1063 250
642 3300046460 Ga0495638_0056366 Ga0495638_0056366_1081_1833 250
643 3300046461 Ga0495641_0017327 Ga0495641_0017327_230_982 250
644 3300046471 Ga0495650_0085380 Ga0495650_0085380_411_1163 250
645 3300046474 Ga0495605_0032938 Ga0495605_0032938_1464_2216 250
646 3300046475 Ga0495639_0198543 Ga0495639_0198543_35_787 250
647 3300046476 Ga0495662_0129503 Ga0495662_0129503_331_1086 250
648 3300046477 Ga0495664_0035477 Ga0495664_0035477_135_911 250
649 3300046492 Ga0495585_0088116 Ga0495585_0088116_790_1542 250
650 3300046499 Ga0495594_0079170 Ga0495594_0079170_741_1493 250
651 3300046499 Ga0495594_0102898 Ga0495594_0102898_524_1276 250
652 3300046513 Ga0495616_0107873 Ga0495616_0107873_186_938 250
653 3300046514 Ga0495618_0189316 Ga0495618_0189316_487_1242 250
654 3300046515 Ga0495620_0121661 Ga0495620_0121661_255_1007 250
655 3300046516 Ga0495628_0030482 Ga0495628_0030482_2979_3734 250
656 3300046519 Ga0495632_0130764 Ga0495632_0130764_63_815 250
657 3300046519 Ga0495632_0157335 Ga0495632_0157335_80_832 250
658 3300046529 Ga0495652_0113263 Ga0495652_0113263_889_1641 250
659 3300046533 Ga0495640_0033866 Ga0495640_0033866_1634_2389 250
660 3300046535 Ga0495586_0070505 Ga0495586_0070505_604_1359 250
661 3300046536 Ga0495587_0035328 Ga0495587_0035328_1637_2392 250
662 3300046536 Ga0495587_0197253 Ga0495587_0197253_46_801 250
663 3300046539 Ga0495621_0012201 Ga0495621_0012201_86_841 250
664 3300046539 Ga0495621_0091531 Ga0495621_0091531_329_1081 250
665 3300046542 Ga0495597_0053866 Ga0495597_0053866_568_1320 250
666 3300046543 Ga0495645_0061017 Ga0495645_0061017_838_1593 250
667 3300046559 Ga0495667_0044797 Ga0495667_0044797_367_1122 250
668 3300046559 Ga0495667_0110804 Ga0495667_0110804_817_1572 250
669 3300046615 Ga0495656_0039306 Ga0495656_0039306_399_1151 250
670 3300046615 Ga0495656_0091115 Ga0495656_0091115_522_1274 250
671 3300046615 Ga0495656_0170297 Ga0495656_0170297_206_958 250
672 3300046616 Ga0495668_0000092 Ga0495668_0000092_65033_65794 250
673 3300046616 Ga0495668_0075201 Ga0495668_0075201_731_1483 250
674 3300046616 Ga0495668_0166199 Ga0495668_0166199_121_873 250
675 3300046616 Ga0495668_0298754 Ga0495668_0298754_35_787 250
676 3300046648 Ga0495611_0133890 Ga0495611_0133890_394_1146 250
677 3300046660 Ga0495625_0361214 Ga0495625_0361214_16_768 250
678 3300046663 Ga0495635_0041900 Ga0495635_0041900_2301_3056 250
679 3300046665 Ga0495661_0294948 Ga0495661_0294948_13_765 250
680 3300046674 Ga0495588_0048031 Ga0495588_0048031_175_927 250
681 3300046675 Ga0495657_0021841 Ga0495657_0021841_2043_2798 250
682 3300046678 Ga0495599_0405425 Ga0495599_0405425_34_789 250
683 3300046679 Ga0495623_0113461 Ga0495623_0113461_823_1578 250
684 3300046681 Ga0495647_0010707 Ga0495647_0010707_2238_2993 250
685 3300046683 Ga0495658_0112424 Ga0495658_0112424_183_935 250
686 3300046684 Ga0495669_0050384 Ga0495669_0050384_901_1653 250
687 3300046690 Ga0495624_0156067 Ga0495624_0156067_505_1257 250
688 3300046691 Ga0495670_0034134 Ga0495670_0034134_1103_1855 250
689 3300046809 Ga0495600_0051163 Ga0495600_0051163_40_795 250
690 3300047315 Ga0495581_0340779 Ga0495581_0340779_18_776 250
691 3300047317 Ga0495604_0124266 Ga0495604_0124266_73_828 250
692 3300047319 Ga0495674_0009634 Ga0495674_0009634_682_1437 250
693 3300047319 Ga0495674_0063393 Ga0495674_0063393_1047_1802 250
694 3300047320 Ga0495672_0010637 Ga0495672_0010637_366_1118 250
695 3300047320 Ga0495672_0263016 Ga0495672_0263016_63_815 250
696 3300047322 Ga0495680_0065244 Ga0495680_0065244_220_975 250
697 3300047445 Ga0495677_0174134 Ga0495677_0174134_62_814 250
698 3300047471 Ga0495684_0010509 Ga0495684_0010509_1258_2013 250
699 3300047472 Ga0495686_0142253 Ga0495686_0142253_383_1135 250
700 3300047673 Ga0495593_0048015 Ga0495593_0048015_618_1373 250
701 3300048088 Ga0495602_0062123 Ga0495602_0062123_1908_2663 250
702 3300048903 Ga0496100_0239403 Ga0496100_0239403_552_1310 250
703 3300048904 Ga0496101_0179040 Ga0496101_0179040_487_1239 250
704 3300048905 Ga0496102_0122324 Ga0496102_0122324_1172_1924 250
705 3300048905 Ga0496102_0127267 Ga0496102_0127267_658_1410 250
706 3300048907 Ga0496104_0065839 Ga0496104_0065839_501_1259 250
707 3300048908 Ga0496105_0013669 Ga0496105_0013669_5469_6227 250
708 3300048909 Ga0496106_0548593 Ga0496106_0548593_77_838 250
709 3300048910 Ga0496107_0074980 Ga0496107_0074980_195_947 250
710 3300048911 Ga0496108_0001656 Ga0496108_0001656_631_1389 250
711 3300048911 Ga0496108_0369861 Ga0496108_0369861_335_1087 250
712 3300048912 Ga0496109_0005517 Ga0496109_0005517_537_1295 250
713 3300048912 Ga0496109_0296331 Ga0496109_0296331_348_1106 250
714 3300048912 Ga0496109_0548544 Ga0496109_0548544_253_1005 250
715 3300048913 Ga0496110_0011557 Ga0496110_0011557_497_1255 250
716 3300048913 Ga0496110_0350302 Ga0496110_0350302_265_1023 250
717 3300048914 Ga0496111_0001681 Ga0496111_0001681_375_1133 250
718 3300048915 Ga0496112_0000414 Ga0496112_0000414_10259_11017 250
719 3300048915 Ga0496112_0208418 Ga0496112_0208418_832_1584 250
720 3300048916 Ga0496113_0001520 Ga0496113_0001520_433_1191 250
721 3300048917 Ga0496114_0069511 Ga0496114_0069511_824_1576 250
722 3300048917 Ga0496114_0136752 Ga0496114_0136752_1296_2054 250
723 3300048917 Ga0496114_0451916 Ga0496114_0451916_98_850 250
724 3300048918 Ga0496115_0011102 Ga0496115_0011102_3772_4530 250
725 3300048921 Ga0496118_0214644 Ga0496118_0214644_166_921 250
726 3300048922 Ga0496119_0128632 Ga0496119_0128632_238_990 250
727 3300048924 Ga0496121_0025691 Ga0496121_0025691_3285_4073 250
728 3300048924 Ga0496121_0075028 Ga0496121_0075028_1519_2274 250
729 3300048924 Ga0496121_0086316 Ga0496121_0086316_1037_1789 250
730 3300048924 Ga0496121_0104069 Ga0496121_0104069_1372_2124 250
731 3300048924 Ga0496121_0122569 Ga0496121_0122569_32_784 250
732 3300048927 Ga0496124_0039002 Ga0496124_0039002_2819_3580 250
733 3300048928 Ga0496125_0038920 Ga0496125_0038920_1042_1803 250
734 3300048928 Ga0496125_0379689 Ga0496125_0379689_64_816 250
735 3300048929 Ga0496126_0003112 Ga0496126_0003112_3500_4261 250
736 3300048929 Ga0496126_0008303 Ga0496126_0008303_7737_8489 250
737 3300048929 Ga0496126_0120048 Ga0496126_0120048_1185_1937 250
738 3300048929 Ga0496126_0563447 Ga0496126_0563447_109_876 250
739 3300049460 Ga0495682_0051559 Ga0495682_0051559_674_1426 250
740 3300049460 Ga0495682_0089363 Ga0495682_0089363_175_927 250
741 3300049568 Ga0501031_0000253 Ga0501031_0000253_12360_13112 250
742 3300049568 Ga0501031_0019009 Ga0501031_0019009_3572_4324 250
743 3300049568 Ga0501031_0174039 Ga0501031_0174039_632_1384 250
744 3300049569 Ga0501032_0000273 Ga0501032_0000273_6855_7607 250
745 3300049569 Ga0501032_0022067 Ga0501032_0022067_3203_3955 250
746 3300049569 Ga0501032_0038462 Ga0501032_0038462_1122_1874 250
747 3300049569 Ga0501032_0046242 Ga0501032_0046242_1287_2063 250
748 3300049569 Ga0501032_0051051 Ga0501032_0051051_426_1178 250
749 3300049570 Ga0501033_0000098 Ga0501033_0000098_8683_9435 250
750 3300049570 Ga0501033_0000332 Ga0501033_0000332_2682_3434 250
751 3300049570 Ga0501033_0064916 Ga0501033_0064916_1881_2645 250
752 3300049570 Ga0501033_0453318 Ga0501033_0453318_19_795 250
753 3300049571 Ga0501034_0000175 Ga0501034_0000175_13972_14724 250
754 3300049571 Ga0501034_0104633 Ga0501034_0104633_1311_2063 250
755 3300049571 Ga0501034_0269977 Ga0501034_0269977_526_1278 250
756 3300049572 Ga0501036_0000049 Ga0501036_0000049_19703_20455 250
757 3300049572 Ga0501036_0043499 Ga0501036_0043499_1335_2087 250
758 3300049572 Ga0501036_0076908 Ga0501036_0076908_1396_2148 250
759 3300049573 Ga0501037_0000069 Ga0501037_0000069_13669_14421 250
760 3300049573 Ga0501037_0003734 Ga0501037_0003734_8971_9723 250
761 3300049574 Ga0501038_0000034 Ga0501038_0000034_50309_51061 250
762 3300049574 Ga0501038_0008654 Ga0501038_0008654_7545_8297 250
763 3300049574 Ga0501038_0053758 Ga0501038_0053758_1825_2577 250
764 3300049574 Ga0501038_0072407 Ga0501038_0072407_1362_2114 250
765 3300049574 Ga0501038_0111941 Ga0501038_0111941_150_902 250
766 3300049575 Ga0501039_0000090 Ga0501039_0000090_7818_8570 250
767 3300049575 Ga0501039_0005577 Ga0501039_0005577_5780_6532 250
768 3300049575 Ga0501039_0108617 Ga0501039_0108617_167_919 250
769 3300049576 Ga0501040_0299360 Ga0501040_0299360_24_776 250
770 3300049577 Ga0501041_0280595 Ga0501041_0280595_59_811 250
771 3300049578 Ga0501042_0021749 Ga0501042_0021749_967_1719 250
772 3300049578 Ga0501042_0111228 Ga0501042_0111228_994_1746 250
773 3300049579 Ga0501043_0000130 Ga0501043_0000130_1490_2242 250
774 3300049579 Ga0501043_0010948 Ga0501043_0010948_2480_3232 250
775 3300049579 Ga0501043_0136910 Ga0501043_0136910_1112_1864 250
776 3300049580 Ga0501046_0000213 Ga0501046_0000213_2170_2922 250
777 3300049580 Ga0501046_0020817 Ga0501046_0020817_3850_4602 250
778 3300049580 Ga0501046_0181540 Ga0501046_0181540_158_910 250
779 3300049581 Ga0501047_0000255 Ga0501047_0000255_39141_39893 250
780 3300049581 Ga0501047_0074475 Ga0501047_0074475_95_871 250
781 3300049581 Ga0501047_0329085 Ga0501047_0329085_343_1095 250
782 3300049582 Ga0501048_0000252 Ga0501048_0000252_14112_14864 250
783 3300049583 Ga0501067_0001929 Ga0501067_0001929_1882_2634 250
784 3300049583 Ga0501067_0021939 Ga0501067_0021939_2646_3398 250
785 3300049583 Ga0501067_0060356 Ga0501067_0060356_228_980 250
786 3300049584 Ga0501068_0000197 Ga0501068_0000197_985_1737 250
787 3300049584 Ga0501068_0014839 Ga0501068_0014839_2173_2925 250
788 3300049585 Ga0501069_0000614 Ga0501069_0000614_3211_3963 250
789 3300049585 Ga0501069_0074684 Ga0501069_0074684_105_857 250
790 3300049586 Ga0501070_0017034 Ga0501070_0017034_5159_5911 250
791 3300049586 Ga0501070_0384853 Ga0501070_0384853_53_829 250
792 3300049587 Ga0501071_0008255 Ga0501071_0008255_605_1357 250
793 3300049587 Ga0501071_0582273 Ga0501071_0582273_97_849 250
794 3300049588 Ga0501072_0000146 Ga0501072_0000146_43447_44199 250
795 3300049589 Ga0501073_0000035 Ga0501073_0000035_67919_68671 250
796 3300049589 Ga0501073_0023327 Ga0501073_0023327_199_951 250
797 3300049590 Ga0501074_0000512 Ga0501074_0000512_5264_6016 250
798 3300049741 Ga0501079_0010497 Ga0501079_0010497_1383_2135 250
799 3300049741 Ga0501079_0087257 Ga0501079_0087257_41_793 250
800 3300049741 Ga0501079_0364691 Ga0501079_0364691_236_988 250
801 3300049742 Ga0501080_0000379 Ga0501080_0000379_31405_32157 250
802 3300049742 Ga0501080_0049862 Ga0501080_0049862_1075_1827 250
803 3300049742 Ga0501080_0363492 Ga0501080_0363492_77_841 250
804 3300049742 Ga0501080_0372895 Ga0501080_0372895_330_1082 250
805 3300049743 Ga0501081_0366079 Ga0501081_0366079_177_929 250
806 3300049744 Ga0501083_0000740 Ga0501083_0000740_5563_6315 250
807 3300049822 Ga0501035_0000894 Ga0501035_0000894_25407_26159 250
808 3300049822 Ga0501035_0043468 Ga0501035_0043468_1568_2320 250
809 3300049822 Ga0501035_0181629 Ga0501035_0181629_736_1488 250
810 3300049822 Ga0501035_0240818 Ga0501035_0240818_336_1112 250
811 3300049822 Ga0501035_0277558 Ga0501035_0277558_130_882 250
812 3300049823 Ga0501044_0000461 Ga0501044_0000461_23101_23853 250
813 3300049823 Ga0501044_0021033 Ga0501044_0021033_5805_6557 250
814 3300049823 Ga0501044_0077714 Ga0501044_0077714_1853_2605 250
815 3300049823 Ga0501044_0118193 Ga0501044_0118193_1660_2412 250
816 3300049823 Ga0501044_0210104 Ga0501044_0210104_214_990 250
817 3300050489 nmdc:mga03683_28652_c1 nmdc:mga03683_28652_c1_339_1091 250
818 3300050490 nmdc:mga03n38_15507_c1 nmdc:mga03n38_15507_c1_924_1676 250
819 3300050490 nmdc:mga03n38_210100_c1 nmdc:mga03n38_210100_c1_172_924 250
820 3300050490 nmdc:mga03n38_613_c1 nmdc:mga03n38_613_c1_4203_4955 250
821 3300050491 nmdc:mga00v17_21043_c1 nmdc:mga00v17_21043_c1_1214_1966 250
822 3300050492 nmdc:mga0yw44_124882_c1 nmdc:mga0yw44_124882_c1_521_1273 250
823 3300050492 nmdc:mga0yw44_15168_c1 nmdc:mga0yw44_15168_c1_3019_3771 250
824 3300050492 nmdc:mga0yw44_202568_c1 nmdc:mga0yw44_202568_c1_221_973 250
825 3300050493 nmdc:mga0k408_59721_c1 nmdc:mga0k408_59721_c1_247_999 250
826 3300050493 nmdc:mga0k408_80127_c1 nmdc:mga0k408_80127_c1_218_970 250
827 3300050494 nmdc:mga06z11_158494_c1 nmdc:mga06z11_158494_c1_208_960 250
828 3300050495 nmdc:mga04h51_33437_c1 nmdc:mga04h51_33437_c1_99_851 250
829 3300050495 nmdc:mga04h51_5335_c1 nmdc:mga04h51_5335_c1_865_1617 250
830 3300050496 nmdc:mga07m45_137511_c1 nmdc:mga07m45_137511_c1_308_1060 250
831 3300050496 nmdc:mga07m45_1929_c1 nmdc:mga07m45_1929_c1_3805_4557 250
832 3300050507 nmdc:mga05p37_4837_c1 nmdc:mga05p37_4837_c1_12631_13386 250
833 3300050507 nmdc:mga05p37_699874_c1 nmdc:mga05p37_699874_c1_245_1003 250
834 3300050511 nmdc:mga08y16_157905_c1 nmdc:mga08y16_157905_c1_572_1324 250
835 3300050511 nmdc:mga08y16_417681_c1 nmdc:mga08y16_417681_c1_429_1181 250
836 3300050511 nmdc:mga08y16_440743_c1 nmdc:mga08y16_440743_c1_58_810 250
837 3300050513 nmdc:mga0rr50_123263_c1 nmdc:mga0rr50_123263_c1_560_1315 250
838 3300050515 nmdc:mga0a205_180274_c1 nmdc:mga0a205_180274_c1_1176_1931 250
839 3300050516 nmdc:mga0sz30_45978_c1 nmdc:mga0sz30_45978_c1_263_1015 250
840 3300053077 Ga0495601_0268820 Ga0495601_0268820_35_790 250
841 3300053078 Ga0495612_0005994 Ga0495612_0005994_2082_2837 250
842 3300053084 Ga0495595_0048915 Ga0495595_0048915_273_1028 250
843 3300053085 Ga0495619_0037925 Ga0495619_0037925_873_1628 250
844 3300053085 Ga0495619_0418464 Ga0495619_0418464_20_775 250
845 3300053087 Ga0500643_032107 Ga0500643_032107_589_1341 250
846 3300053093 Ga0500651_0087129 Ga0500651_0087129_75_827 250
847 3300053094 Ga0500566_0031382 Ga0500566_0031382_2078_2830 250
848 3300053096 Ga0500641_0014068 Ga0500641_0014068_1937_2689 250
849 3300053096 Ga0500641_0034873 Ga0500641_0034873_1235_1987 250
850 3300053102 Ga0500554_002104 Ga0500554_002104_469_1221 250
851 3300053111 Ga0500572_000309 Ga0500572_000309_38_793 250
852 3300053118 Ga0500594_0025817 Ga0500594_0025817_458_1210 250
853 3300053119 Ga0500595_000698 Ga0500595_000698_4254_5006 250
854 3300053119 Ga0500595_003813 Ga0500595_003813_2323_3075 250
855 3300053119 Ga0500595_006478 Ga0500595_006478_378_1130 250
856 3300053130 Ga0500642_0071711 Ga0500642_0071711_570_1322 250
857 3300053136 Ga0500559_0000341 Ga0500559_0000341_30026_30781 250
858 3300053136 Ga0500559_0058481 Ga0500559_0058481_750_1502 250
859 3300053139 Ga0500568_0068906 Ga0500568_0068906_48_800 250
860 3300053147 Ga0500589_059000 Ga0500589_059000_978_1730 250
861 3300053150 Ga0500603_031274 Ga0500603_031274_139_891 250
862 3300053158 Ga0500627_0126335 Ga0500627_0126335_348_1100 250
863 3300053161 Ga0500634_0047748 Ga0500634_0047748_1336_2088 250
864 3300053162 Ga0500638_000254 Ga0500638_000254_6613_7365 250
865 3300053177 Ga0500636_0111330 Ga0500636_0111330_264_1019 250
866 3300053177 Ga0500636_0128535 Ga0500636_0128535_48_803 250
867 3300053177 Ga0500636_0241309 Ga0500636_0241309_89_841 250
868 3300053178 Ga0500637_0000216 Ga0500637_0000216_2351_3103 250
869 3300053725 Ga0500576_054740 Ga0500576_054740_414_1169 250
870 3300053727 Ga0500611_021866 Ga0500611_021866_200_952 250
871 3300053730 Ga0500645_046945 Ga0500645_046945_175_927 250
872 3300054114 Ga0501084_0001610 Ga0501084_0001610_15196_15948 250
873 3300054114 Ga0501084_0062496 Ga0501084_0062496_91_843 250
874 3300055283 Ga0500661_019441 Ga0500661_019441_269_1021 250
875 3300060353 Ga0501082_0068493 Ga0501082_0068493_516_1268 250
876 3300060353 Ga0501082_0260001 Ga0501082_0260001_695_1471 250
877 3300060353 Ga0501082_0277094 Ga0501082_0277094_361_1113 250
878 3300002075 JGI24738J21930_10006044 JGI24738J21930_100060441 251
879 3300003215 JGI25153J46596_10009281 JGI25153J46596_100092813 251
880 3300003215 JGI25153J46596_10014678 JGI25153J46596_100146783 251
881 3300003215 JGI25153J46596_10015191 JGI25153J46596_100151913 251
882 3300003354 JGI25160J50197_1008733 JGI25160J50197_10087332 251
883 3300003354 JGI25160J50197_1011756 JGI25160J50197_10117562 251
884 3300005327 Ga0070658_10384769 Ga0070658_103847691 251
885 3300005328 Ga0070676_10013022 Ga0070676_100130221 251
886 3300005329 Ga0070683_100276774 Ga0070683_1002767741 251
887 3300005331 Ga0070670_100350836 Ga0070670_1003508362 251
888 3300005334 Ga0068869_100114761 Ga0068869_1001147611 251
889 3300005336 Ga0070680_100013526 Ga0070680_1000135263 251
890 3300005337 Ga0070682_100036640 Ga0070682_1000366402 251
891 3300005337 Ga0070682_100264717 Ga0070682_1002647171 251
892 3300005338 Ga0068868_100003958 Ga0068868_1000039589 251
893 3300005338 Ga0068868_100011518 Ga0068868_1000115183 251
894 3300005339 Ga0070660_100017870 Ga0070660_1000178703 251
895 3300005340 Ga0070689_100064814 Ga0070689_1000648144 251
896 3300005341 Ga0070691_10083779 Ga0070691_100837791 251
897 3300005344 Ga0070661_100101272 Ga0070661_1001012722 251
898 3300005353 Ga0070669_100527332 Ga0070669_1005273321 251
899 3300005355 Ga0070671_100011296 Ga0070671_1000112963 251
900 3300005355 Ga0070671_100015678 Ga0070671_1000156784 251
901 3300005355 Ga0070671_100086510 Ga0070671_1000865102 251
902 3300005356 Ga0070674_100026165 Ga0070674_1000261652 251
903 3300005365 Ga0070688_100006780 Ga0070688_1000067803 251
904 3300005366 Ga0070659_100050790 Ga0070659_1000507903 251
905 3300005367 Ga0070667_100028910 Ga0070667_1000289103 251
906 3300005367 Ga0070667_100087889 Ga0070667_1000878892 251
907 3300005434 Ga0070709_10007727 Ga0070709_100077273 251
908 3300005434 Ga0070709_10154349 Ga0070709_101543491 251
909 3300005435 Ga0070714_100009892 Ga0070714_1000098923 251
910 3300005435 Ga0070714_100029375 Ga0070714_1000293753 251
911 3300005435 Ga0070714_100088688 Ga0070714_1000886882 251
912 3300005436 Ga0070713_100004379 Ga0070713_1000043797 251
913 3300005436 Ga0070713_100074356 Ga0070713_1000743563 251
914 3300005436 Ga0070713_100101791 Ga0070713_1001017912 251
915 3300005436 Ga0070713_100467968 Ga0070713_1004679682 251
916 3300005437 Ga0070710_10000395 Ga0070710_100003956 251
917 3300005437 Ga0070710_10007756 Ga0070710_100077563 251
918 3300005438 Ga0070701_10086418 Ga0070701_100864182 251
919 3300005439 Ga0070711_100013855 Ga0070711_1000138553 251
920 3300005455 Ga0070663_100027479 Ga0070663_1000274792 251
921 3300005455 Ga0070663_100162013 Ga0070663_1001620132 251
922 3300005456 Ga0070678_100009881 Ga0070678_1000098813 251
923 3300005456 Ga0070678_100034185 Ga0070678_1000341853 251
924 3300005457 Ga0070662_100307659 Ga0070662_1003076591 251
925 3300005457 Ga0070662_100323031 Ga0070662_1003230311 251
926 3300005458 Ga0070681_10209729 Ga0070681_102097292 251
927 3300005458 Ga0070681_10358218 Ga0070681_103582181 251
928 3300005466 Ga0070685_10030623 Ga0070685_100306233 251
929 3300005530 Ga0070679_100028788 Ga0070679_1000287884 251
930 3300005530 Ga0070679_100243480 Ga0070679_1002434802 251
931 3300005535 Ga0070684_100021896 Ga0070684_1000218963 251
932 3300005535 Ga0070684_100032076 Ga0070684_1000320763 251
933 3300005539 Ga0068853_100018974 Ga0068853_1000189741 251
934 3300005539 Ga0068853_100290030 Ga0068853_1002900302 251
935 3300005543 Ga0070672_100414845 Ga0070672_1004148451 251
936 3300005543 Ga0070672_100629406 Ga0070672_1006294061 251
937 3300005544 Ga0070686_100012110 Ga0070686_1000121103 251
938 3300005548 Ga0070665_100016641 Ga0070665_1000166413 251
939 3300005548 Ga0070665_100099989 Ga0070665_1000999893 251
940 3300005548 Ga0070665_100392500 Ga0070665_1003925002 251
941 3300005548 Ga0070665_100739589 Ga0070665_1007395891 251
942 3300005563 Ga0068855_100024338 Ga0068855_1000243387 251
943 3300005563 Ga0068855_100043049 Ga0068855_1000430493 251
944 3300005563 Ga0068855_100076413 Ga0068855_1000764132 251
945 3300005563 Ga0068855_100101580 Ga0068855_1001015802 251
946 3300005563 Ga0068855_100132096 Ga0068855_1001320962 251
947 3300005563 Ga0068855_100482974 Ga0068855_1004829742 251
948 3300005577 Ga0068857_100024325 Ga0068857_1000243253 251
949 3300005577 Ga0068857_100071597 Ga0068857_1000715973 251
950 3300005577 Ga0068857_100192669 Ga0068857_1001926692 251
951 3300005577 Ga0068857_100400913 Ga0068857_1004009132 251
952 3300005578 Ga0068854_100015803 Ga0068854_1000158034 251
953 3300005614 Ga0068856_100224895 Ga0068856_1002248952 251
954 3300005614 Ga0068856_100549921 Ga0068856_1005499212 251
955 3300005616 Ga0068852_100063265 Ga0068852_1000632653 251
956 3300005617 Ga0068859_100058087 Ga0068859_1000580873 251
957 3300005618 Ga0068864_100050145 Ga0068864_1000501451 251
958 3300005718 Ga0068866_10186540 Ga0068866_101865402 251
959 3300005718 Ga0068866_10304992 Ga0068866_103049921 251
960 3300005719 Ga0068861_100180027 Ga0068861_1001800272 251
961 3300005834 Ga0068851_10006063 Ga0068851_100060633 251
962 3300005842 Ga0068858_100047295 Ga0068858_1000472951 251
963 3300005844 Ga0068862_100245860 Ga0068862_1002458602 251
964 3300005937 Ga0081455_10001069 Ga0081455_100010696 251
965 3300005981 Ga0081538_10004388 Ga0081538_100043884 251
966 3300005983 Ga0081540_1003961 Ga0081540_10039613 251
967 3300005983 Ga0081540_1034946 Ga0081540_10349463 251
968 3300005985 Ga0081539_10000379 Ga0081539_1000037921 251
969 3300006028 Ga0070717_10000224 Ga0070717_100002246 251
970 3300006028 Ga0070717_10002876 Ga0070717_100028765 251
971 3300006028 Ga0070717_10057087 Ga0070717_100570871 251
972 3300006028 Ga0070717_10106427 Ga0070717_101064271 251
973 3300006038 Ga0075365_10001527 Ga0075365_100015271 251
974 3300006038 Ga0075365_10031975 Ga0075365_100319751 251
975 3300006038 Ga0075365_10066502 Ga0075365_100665022 251
976 3300006038 Ga0075365_10073284 Ga0075365_100732843 251
977 3300006038 Ga0075365_10118132 Ga0075365_101181323 251
978 3300006038 Ga0075365_10126379 Ga0075365_101263792 251
979 3300006038 Ga0075365_10258049 Ga0075365_102580491 251
980 3300006042 Ga0075368_10005831 Ga0075368_100058313 251
981 3300006042 Ga0075368_10080844 Ga0075368_100808442 251
982 3300006051 Ga0075364_10050143 Ga0075364_100501432 251
983 3300006051 Ga0075364_10060728 Ga0075364_100607282 251
984 3300006163 Ga0070715_10001633 Ga0070715_100016336 251
985 3300006173 Ga0070716_100010255 Ga0070716_1000102553 251
986 3300006173 Ga0070716_100013159 Ga0070716_1000131592 251
987 3300006173 Ga0070716_100108952 Ga0070716_1001089522 251
988 3300006173 Ga0070716_100277977 Ga0070716_1002779772 251
989 3300006175 Ga0070712_100009415 Ga0070712_1000094155 251
990 3300006175 Ga0070712_100108299 Ga0070712_1001082992 251
991 3300006178 Ga0075367_10240836 Ga0075367_102408361 251
992 3300006178 Ga0075367_10241596 Ga0075367_102415962 251
993 3300006195 Ga0075366_10068704 Ga0075366_100687042 251
994 3300006237 Ga0097621_100028885 Ga0097621_1000288853 251
995 3300006353 Ga0075370_10052522 Ga0075370_100525224 251
996 3300006353 Ga0075370_10089873 Ga0075370_100898732 251
997 3300006358 Ga0068871_100042230 Ga0068871_1000422303 251
998 3300006844 Ga0075428_100897466 Ga0075428_1008974661 251
999 3300006846 Ga0075430_100024425 Ga0075430_1000244253 251
1000 3300006871 Ga0075434_100330546 Ga0075434_1003305462 251
1001 3300006871 Ga0075434_100460050 Ga0075434_1004600501 251
1002 3300006871 Ga0075434_100613723 Ga0075434_1006137231 251
1003 3300006881 Ga0068865_100367686 Ga0068865_1003676862 251
1004 3300006914 Ga0075436_100345800 Ga0075436_1003458001 251
1005 3300006931 Ga0097620_100058087 Ga0097620_1000580873 251
1006 3300006944 Ga0099823_1024679 Ga0099823_10246794 251
1007 3300007265 Ga0099794_10098671 Ga0099794_100986711 251
1008 3300007788 Ga0099795_10028013 Ga0099795_100280134 251
1009 3300009036 Ga0105244_10074608 Ga0105244_100746082 251
1010 3300009093 Ga0105240_10012909 Ga0105240_100129097 251
1011 3300009093 Ga0105240_10071555 Ga0105240_100715552 251
1012 3300009093 Ga0105240_10094483 Ga0105240_100944835 251
1013 3300009094 Ga0111539_10288746 Ga0111539_102887462 251
1014 3300009094 Ga0111539_10656131 Ga0111539_106561311 251
1015 3300009098 Ga0105245_10898606 Ga0105245_108986061 251
1016 3300009101 Ga0105247_10033948 Ga0105247_100339482 251
1017 3300009101 Ga0105247_10107324 Ga0105247_101073242 251
1018 3300009101 Ga0105247_10310290 Ga0105247_103102902 251
1019 3300009148 Ga0105243_10042136 Ga0105243_100421362 251
1020 3300009174 Ga0105241_10375461 Ga0105241_103754612 251
1021 3300009174 Ga0105241_10509816 Ga0105241_105098161 251
1022 3300009176 Ga0105242_10278478 Ga0105242_102784782 251
1023 3300009176 Ga0105242_10434735 Ga0105242_104347352 251
1024 3300009177 Ga0105248_10032228 Ga0105248_100322282 251
1025 3300009177 Ga0105248_10088266 Ga0105248_100882662 251
1026 3300009177 Ga0105248_10272994 Ga0105248_102729941 251
1027 3300009177 Ga0105248_10299459 Ga0105248_102994592 251
1028 3300009545 Ga0105237_10217788 Ga0105237_102177883 251
1029 3300009545 Ga0105237_10247229 Ga0105237_102472291 251
1030 3300009551 Ga0105238_10017873 Ga0105238_100178736 251
1031 3300009551 Ga0105238_10039830 Ga0105238_100398302 251
1032 3300009551 Ga0105238_10126156 Ga0105238_101261562 251
1033 3300009553 Ga0105249_10088853 Ga0105249_100888532 251
1034 3300010375 Ga0105239_10041053 Ga0105239_100410533 251
1035 3300010375 Ga0105239_10047108 Ga0105239_100471083 251
1036 3300011119 Ga0105246_10265888 Ga0105246_102658882 251
1037 3300011119 Ga0105246_10319180 Ga0105246_103191802 251
1038 3300012505 Ga0157339_1001999 Ga0157339_10019992 251
1039 3300013100 Ga0157373_10080298 Ga0157373_100802983 251
1040 3300013105 Ga0157369_10047236 Ga0157369_100472364 251
1041 3300013105 Ga0157369_10217338 Ga0157369_102173382 251
1042 3300013296 Ga0157374_10038013 Ga0157374_100380132 251
1043 3300013296 Ga0157374_10190078 Ga0157374_101900783 251
1044 3300013297 Ga0157378_10109936 Ga0157378_101099361 251
1045 3300013297 Ga0157378_10438037 Ga0157378_104380372 251
1046 3300013306 Ga0163162_10117935 Ga0163162_101179352 251
1047 3300013306 Ga0163162_10236196 Ga0163162_102361962 251
1048 3300013307 Ga0157372_10212623 Ga0157372_102126233 251
1049 3300013307 Ga0157372_10462919 Ga0157372_104629191 251
1050 3300013308 Ga0157375_10195603 Ga0157375_101956031 251
1051 3300013308 Ga0157375_10296391 Ga0157375_102963912 251
1052 3300013308 Ga0157375_10514473 Ga0157375_105144732 251
1053 3300014325 Ga0163163_10009676 Ga0163163_100096766 251
1054 3300014325 Ga0163163_10036866 Ga0163163_100368663 251
1055 3300014325 Ga0163163_10288375 Ga0163163_102883752 251
1056 3300014325 Ga0163163_10288660 Ga0163163_102886603 251
1057 3300014326 Ga0157380_10146325 Ga0157380_101463252 251
1058 3300014745 Ga0157377_10189865 Ga0157377_101898651 251
1059 3300014745 Ga0157377_10270908 Ga0157377_102709082 251
1060 3300014968 Ga0157379_10249068 Ga0157379_102490682 251
1061 3300014968 Ga0157379_10351511 Ga0157379_103515111 251
1062 3300014969 Ga0157376_10059767 Ga0157376_100597672 251
1063 3300014969 Ga0157376_10116336 Ga0157376_101163362 251
1064 3300014969 Ga0157376_10175130 Ga0157376_101751302 251
1065 3300017792 Ga0163161_10222549 Ga0163161_102225492 251
1066 3300017792 Ga0163161_10239596 Ga0163161_102395962 251
1067 3300020069 Ga0197907_11209949 Ga0197907_112099492 251
1068 3300025230 Ga0209563_104891 Ga0209563_1048911 251
1069 3300025295 Ga0209564_1001796 Ga0209564_10017968 251
1070 3300025295 Ga0209564_1003203 Ga0209564_100320310 251
1071 3300025295 Ga0209564_1047021 Ga0209564_10470211 251
1072 3300025297 Ga0209758_1000371 Ga0209758_100037131 251
1073 3300025297 Ga0209758_1001291 Ga0209758_100129126 251
1074 3300025297 Ga0209758_1001559 Ga0209758_100155923 251
1075 3300025297 Ga0209758_1014744 Ga0209758_10147442 251
1076 3300025297 Ga0209758_1085607 Ga0209758_10856071 251
1077 3300025302 Ga0207426_1000352 Ga0207426_100035254 251
1078 3300025302 Ga0207426_1005546 Ga0207426_10055463 251
1079 3300025315 Ga0207697_10014505 Ga0207697_100145053 251
1080 3300025321 Ga0207656_10007348 Ga0207656_100073482 251
1081 3300025898 Ga0207692_10010688 Ga0207692_100106882 251
1082 3300025898 Ga0207692_10253297 Ga0207692_102532971 251
1083 3300025900 Ga0207710_10005547 Ga0207710_100055473 251
1084 3300025900 Ga0207710_10235481 Ga0207710_102354812 251
1085 3300025901 Ga0207688_10062052 Ga0207688_100620522 251
1086 3300025901 Ga0207688_10077716 Ga0207688_100777162 251
1087 3300025903 Ga0207680_10052069 Ga0207680_100520692 251
1088 3300025903 Ga0207680_10124672 Ga0207680_101246722 251
1089 3300025904 Ga0207647_10004508 Ga0207647_100045086 251
1090 3300025904 Ga0207647_10015943 Ga0207647_100159433 251
1091 3300025904 Ga0207647_10166333 Ga0207647_101663331 251
1092 3300025905 Ga0207685_10000490 Ga0207685_100004902 251
1093 3300025906 Ga0207699_10002390 Ga0207699_100023905 251
1094 3300025906 Ga0207699_10094410 Ga0207699_100944102 251
1095 3300025909 Ga0207705_10100992 Ga0207705_101009921 251
1096 3300025909 Ga0207705_10243255 Ga0207705_102432552 251
1097 3300025910 Ga0207684_10545295 Ga0207684_105452951 251
1098 3300025911 Ga0207654_10080204 Ga0207654_100802042 251
1099 3300025912 Ga0207707_10038828 Ga0207707_100388286 251
1100 3300025913 Ga0207695_10026603 Ga0207695_100266036 251
1101 3300025913 Ga0207695_10037699 Ga0207695_100376996 251
1102 3300025914 Ga0207671_10053672 Ga0207671_100536722 251
1103 3300025915 Ga0207693_10003086 Ga0207693_100030867 251
1104 3300025915 Ga0207693_10018422 Ga0207693_100184223 251
1105 3300025915 Ga0207693_10051463 Ga0207693_100514633 251
1106 3300025915 Ga0207693_10346168 Ga0207693_103461681 251
1107 3300025916 Ga0207663_10001974 Ga0207663_100019746 251
1108 3300025916 Ga0207663_10025028 Ga0207663_100250283 251
1109 3300025916 Ga0207663_10057238 Ga0207663_100572382 251
1110 3300025917 Ga0207660_10002465 Ga0207660_100024659 251
1111 3300025917 Ga0207660_10022470 Ga0207660_100224703 251
1112 3300025919 Ga0207657_10019503 Ga0207657_100195033 251
1113 3300025919 Ga0207657_10027909 Ga0207657_100279093 251
1114 3300025919 Ga0207657_10258441 Ga0207657_102584412 251
1115 3300025921 Ga0207652_10002286 Ga0207652_100022866 251
1116 3300025921 Ga0207652_10533685 Ga0207652_105336852 251
1117 3300025924 Ga0207694_10028380 Ga0207694_100283803 251
1118 3300025924 Ga0207694_10040730 Ga0207694_100407302 251
1119 3300025924 Ga0207694_10054256 Ga0207694_100542562 251
1120 3300025925 Ga0207650_10054104 Ga0207650_100541043 251
1121 3300025925 Ga0207650_10227353 Ga0207650_102273532 251
1122 3300025927 Ga0207687_10077091 Ga0207687_100770912 251
1123 3300025927 Ga0207687_10298241 Ga0207687_102982411 251
1124 3300025927 Ga0207687_10411048 Ga0207687_104110481 251
1125 3300025928 Ga0207700_10004634 Ga0207700_100046345 251
1126 3300025928 Ga0207700_10017235 Ga0207700_100172355 251
1127 3300025928 Ga0207700_10060010 Ga0207700_100600102 251
1128 3300025928 Ga0207700_10092425 Ga0207700_100924252 251
1129 3300025928 Ga0207700_10392555 Ga0207700_103925552 251
1130 3300025929 Ga0207664_10005861 Ga0207664_100058615 251
1131 3300025929 Ga0207664_10060623 Ga0207664_100606232 251
1132 3300025929 Ga0207664_10081041 Ga0207664_100810413 251
1133 3300025931 Ga0207644_10010381 Ga0207644_100103813 251
1134 3300025931 Ga0207644_10024814 Ga0207644_100248142 251
1135 3300025931 Ga0207644_10455504 Ga0207644_104555042 251
1136 3300025932 Ga0207690_10080890 Ga0207690_100808902 251
1137 3300025932 Ga0207690_10173761 Ga0207690_101737612 251
1138 3300025934 Ga0207686_10012373 Ga0207686_100123733 251
1139 3300025935 Ga0207709_10052202 Ga0207709_100522023 251
1140 3300025936 Ga0207670_10030422 Ga0207670_100304223 251
1141 3300025937 Ga0207669_10351262 Ga0207669_103512621 251
1142 3300025938 Ga0207704_10005807 Ga0207704_100058075 251
1143 3300025938 Ga0207704_10673730 Ga0207704_106737301 251
1144 3300025939 Ga0207665_10000455 Ga0207665_100004557 251
1145 3300025939 Ga0207665_10011323 Ga0207665_100113232 251
1146 3300025939 Ga0207665_10088607 Ga0207665_100886072 251
1147 3300025941 Ga0207711_10022195 Ga0207711_100221953 251
1148 3300025941 Ga0207711_10095450 Ga0207711_100954503 251
1149 3300025944 Ga0207661_10043715 Ga0207661_100437152 251
1150 3300025944 Ga0207661_10353844 Ga0207661_103538441 251
1151 3300025945 Ga0207679_10140943 Ga0207679_101409432 251
1152 3300025949 Ga0207667_10037625 Ga0207667_100376252 251
1153 3300025949 Ga0207667_10042452 Ga0207667_100424523 251
1154 3300025949 Ga0207667_10069488 Ga0207667_100694883 251
1155 3300025949 Ga0207667_10129097 Ga0207667_101290973 251
1156 3300025949 Ga0207667_10258659 Ga0207667_102586592 251
1157 3300025960 Ga0207651_10139634 Ga0207651_101396342 251
1158 3300025972 Ga0207668_10173452 Ga0207668_101734522 251
1159 3300025981 Ga0207640_10018371 Ga0207640_100183714 251
1160 3300025986 Ga0207658_10015698 Ga0207658_100156983 251
1161 3300025986 Ga0207658_10018042 Ga0207658_100180423 251
1162 3300025986 Ga0207658_10437314 Ga0207658_104373142 251
1163 3300026023 Ga0207677_10009719 Ga0207677_100097192 251
1164 3300026023 Ga0207677_10385440 Ga0207677_103854401 251
1165 3300026035 Ga0207703_10228165 Ga0207703_102281652 251
1166 3300026041 Ga0207639_10049151 Ga0207639_100491512 251
1167 3300026041 Ga0207639_10276048 Ga0207639_102760482 251
1168 3300026041 Ga0207639_10290452 Ga0207639_102904521 251
1169 3300026067 Ga0207678_10144884 Ga0207678_101448841 251
1170 3300026067 Ga0207678_10152456 Ga0207678_101524562 251
1171 3300026067 Ga0207678_10165636 Ga0207678_101656361 251
1172 3300026067 Ga0207678_10255834 Ga0207678_102558342 251
1173 3300026067 Ga0207678_10515968 Ga0207678_105159681 251
1174 3300026075 Ga0207708_10347917 Ga0207708_103479172 251
1175 3300026078 Ga0207702_10000075 Ga0207702_1000007570 251
1176 3300026078 Ga0207702_10008399 Ga0207702_100083998 251
1177 3300026078 Ga0207702_10159644 Ga0207702_101596441 251
1178 3300026078 Ga0207702_10197843 Ga0207702_101978432 251
1179 3300026078 Ga0207702_10614955 Ga0207702_106149551 251
1180 3300026088 Ga0207641_10069289 Ga0207641_100692892 251
1181 3300026095 Ga0207676_10008170 Ga0207676_100081704 251
1182 3300026116 Ga0207674_10128285 Ga0207674_101282853 251
1183 3300026116 Ga0207674_10176530 Ga0207674_101765303 251
1184 3300026116 Ga0207674_10379881 Ga0207674_103798812 251
1185 3300026118 Ga0207675_100148916 Ga0207675_1001489162 251
1186 3300026118 Ga0207675_100151263 Ga0207675_1001512632 251
1187 3300026121 Ga0207683_10013509 Ga0207683_100135095 251
1188 3300026121 Ga0207683_10020817 Ga0207683_100208174 251
1189 3300026121 Ga0207683_10033981 Ga0207683_100339813 251
1190 3300026121 Ga0207683_10073168 Ga0207683_100731682 251
1191 3300027296 Ga0209389_1000132 Ga0209389_100013245 251
1192 3300027361 Ga0209489_103912 Ga0209489_10391216 251
1193 3300027363 Ga0209700_100281 Ga0209700_10028144 251
1194 3300027671 Ga0209588_1004688 Ga0209588_10046881 251
1195 3300027866 Ga0209813_10004019 Ga0209813_100040192 251
1196 3300027866 Ga0209813_10097669 Ga0209813_100976691 251
1197 3300027907 Ga0207428_10149772 Ga0207428_101497722 251
1198 3300028379 Ga0268266_10010224 Ga0268266_100102248 251
1199 3300028379 Ga0268266_10016552 Ga0268266_100165523 251
1200 3300028380 Ga0268265_10547078 Ga0268265_105470781 251
1201 3300028381 Ga0268264_10149643 Ga0268264_101496432 251
1202 3300028573 Ga0265334_10035881 Ga0265334_100358812 251
1203 3300031235 Ga0265330_10015875 Ga0265330_100158753 251
1204 3300031235 Ga0265330_10028009 Ga0265330_100280092 251
1205 3300031238 Ga0265332_10005648 Ga0265332_100056483 251
1206 3300031238 Ga0265332_10061076 Ga0265332_100610762 251
1207 3300031241 Ga0265325_10000006 Ga0265325_10000006195 251
1208 3300031241 Ga0265325_10005078 Ga0265325_100050786 251
1209 3300031247 Ga0265340_10001029 Ga0265340_100010296 251
1210 3300031344 Ga0265316_10069202 Ga0265316_100692022 251
1211 3300031344 Ga0265316_10428241 Ga0265316_104282411 251
1212 3300031595 Ga0265313_10004211 Ga0265313_100042118 251
1213 3300031595 Ga0265313_10038758 Ga0265313_100387582 251
1214 3300031711 Ga0265314_10007699 Ga0265314_100076997 251
1215 3300031711 Ga0265314_10053368 Ga0265314_100533681 251
1216 3300031712 Ga0265342_10062563 Ga0265342_100625632 251
1217 3300031712 Ga0265342_10143952 Ga0265342_101439521 251
1218 3300032126 Ga0307415_100301385 Ga0307415_1003013851 251
1219 3300033180 Ga0307510_10214854 Ga0307510_102148542 251
1220 3300034816 Ga0373930_0009477 Ga0373930_0009477_824_1582 251
1221 3300034819 Ga0373958_0050421 Ga0373958_0050421_49_807 251
1222 3300034820 Ga0373959_0004888 Ga0373959_0004888_253_1011 251
1223 3300034957 Ga0373938_0014855 Ga0373938_0014855_453_1211 251
1224 3300035085 Ga0373929_0004081 Ga0373929_0004081_1001_1759 251
1225 3300035086 Ga0373934_0002524 Ga0373934_0002524_4915_5673 251
1226 3300035088 Ga0373940_0005371 Ga0373940_0005371_359_1117 251
1227 3300035092 Ga0373952_0000703 Ga0373952_0000703_3546_4304 251
1228 3300035112 Ga0373932_0004218 Ga0373932_0004218_748_1506 251
1229 3300035113 Ga0373936_0005474 Ga0373936_0005474_1904_2662 251
1230 3300035113 Ga0373936_0054933 Ga0373936_0054933_52_810 251
1231 3300035115 Ga0373941_0009331 Ga0373941_0009331_1396_2154 251
1232 3300035115 Ga0373941_0032545 Ga0373941_0032545_308_1066 251
1233 3300035116 Ga0373945_0012567 Ga0373945_0012567_406_1164 251
1234 3300035116 Ga0373945_0024502 Ga0373945_0024502_563_1321 251
1235 3300035116 Ga0373945_0103450 Ga0373945_0103450_146_904 251
1236 3300035117 Ga0373953_0006545 Ga0373953_0006545_737_1495 251
1237 3300035117 Ga0373953_0130758 Ga0373953_0130758_23_781 251
1238 3300035118 Ga0373954_0001369 Ga0373954_0001369_902_1660 251
1239 3300035119 Ga0373956_0028711 Ga0373956_0028711_1040_1798 251
1240 3300035119 Ga0373956_0079479 Ga0373956_0079479_563_1321 251
1241 3300035120 Ga0373957_0040888 Ga0373957_0040888_322_1080 251
1242 3300035121 Ga0373960_0009007 Ga0373960_0009007_1220_1978 251
1243 3300035170 Ga0373943_0007816 Ga0373943_0007816_717_1475 251
1244 3300035170 Ga0373943_0023765 Ga0373943_0023765_860_1618 251
1245 3300035170 Ga0373943_0039720 Ga0373943_0039720_778_1536 251
1246 3300035171 Ga0373946_0014662 Ga0373946_0014662_360_1118 251
1247 3300035171 Ga0373946_0038028 Ga0373946_0038028_255_1013 251
1248 3300035172 Ga0373955_0001864 Ga0373955_0001864_7409_8167 251
1249 3300035242 Ga0373962_0005970 Ga0373962_0005970_1811_2569 251
1250 3300035410 Ga0373924_0031770 Ga0373924_0031770_902_1660 251
1251 3300035691 Ga0373931_0003730 Ga0373931_0003730_481_1239 251
1252 3300035691 Ga0373931_0013950 Ga0373931_0013950_1488_2243 251
1253 3300035691 Ga0373931_0014396 Ga0373931_0014396_93_851 251
1254 3300035692 Ga0373935_0000110 Ga0373935_0000110_30868_31626 251
1255 3300035692 Ga0373935_0028868 Ga0373935_0028868_1843_2601 251
1256 3300035692 Ga0373935_0203993 Ga0373935_0203993_263_1021 251
1257 3300035695 Ga0373927_0002008 Ga0373927_0002008_4382_5140 251
1258 3300035695 Ga0373927_0005256 Ga0373927_0005256_4754_5512 251
1259 3300035724 Ga0373933_0000117 Ga0373933_0000117_42142_42912 251
1260 3300035724 Ga0373933_0000863 Ga0373933_0000863_12891_13649 251
1261 3300035724 Ga0373933_0154366 Ga0373933_0154366_661_1419 251
1262 3300035724 Ga0373933_0205792 Ga0373933_0205792_398_1156 251
1263 3300035725 Ga0373947_0001449 Ga0373947_0001449_5797_6555 251
1264 3300035725 Ga0373947_0012614 Ga0373947_0012614_1897_2655 251
1265 3300035725 Ga0373947_0096855 Ga0373947_0096855_479_1237 251
1266 3300035725 Ga0373947_0277508 Ga0373947_0277508_263_1021 251
1267 3300036401 Ga0373937_0007186 Ga0373937_0007186_1465_2223 251
1268 3300036401 Ga0373937_0080469 Ga0373937_0080469_644_1402 251
1269 3300036401 Ga0373937_0208724 Ga0373937_0208724_863_1621 251
1270 3300036401 Ga0373937_0373974 Ga0373937_0373974_422_1180 251
1271 3300037068 Ga0373925_0000748 Ga0373925_0000748_26034_26792 251
1272 3300037068 Ga0373925_0004770 Ga0373925_0004770_5526_6284 251
1273 3300037068 Ga0373925_0021180 Ga0373925_0021180_1620_2378 251
1274 3300037068 Ga0373925_0087242 Ga0373925_0087242_1264_2022 251
1275 3300037068 Ga0373925_0567824 Ga0373925_0567824_49_843 251
1276 3300037466 Ga0395898_0122535 Ga0395898_0122535_1658_2416 251
1277 3300037466 Ga0395898_0395500 Ga0395898_0395500_79_837 251
1278 3300037471 Ga0395905_0002799 Ga0395905_0002799_17984_18754 251
1279 3300039437 Ga0436365_1023002 Ga0436365_1023002_441_1199 251
1280 3300039447 Ga0436361_0862295 Ga0436361_0862295_74_832 251
1281 3300039450 Ga0436363_0062258 Ga0436363_0062258_156_914 251
1282 3300044656 Ga0466969_0163530 Ga0466969_0163530_175_930 251
1283 3300044658 Ga0466972_0000125 Ga0466972_0000125_44979_45734 251
1284 3300044683 Ga0466965_0313425 Ga0466965_0313425_28_783 251
1285 3300044684 Ga0466966_0161906 Ga0466966_0161906_45_803 251
1286 3300044694 Ga0466963_0105572 Ga0466963_0105572_761_1519 251
1287 3300044901 Ga0466960_0159631 Ga0466960_0159631_441_1196 251
1288 3300045049 Ga0466959_0360311 Ga0466959_0360311_222_980 251
1289 3300045976 Ga0466967_0042275 Ga0466967_0042275_2627_3385 251
1290 3300045976 Ga0466967_0468639 Ga0466967_0468639_82_840 251
1291 3300046454 Ga0495592_0003752 Ga0495592_0003752_8937_9695 251
1292 3300046454 Ga0495592_0030096 Ga0495592_0030096_2205_2963 251
1293 3300046454 Ga0495592_0210847 Ga0495592_0210847_517_1275 251
1294 3300046455 Ga0495603_0000011 Ga0495603_0000011_42463_43221 251
1295 3300046455 Ga0495603_0018500 Ga0495603_0018500_1228_1986 251
1296 3300046455 Ga0495603_0029271 Ga0495603_0029271_2054_2812 251
1297 3300046455 Ga0495603_0126687 Ga0495603_0126687_302_1057 251
1298 3300046459 Ga0495629_0000251 Ga0495629_0000251_27316_28074 251
1299 3300046459 Ga0495629_0000253 Ga0495629_0000253_9071_9829 251
1300 3300046459 Ga0495629_0002122 Ga0495629_0002122_10029_10787 251
1301 3300046460 Ga0495638_0009386 Ga0495638_0009386_3069_3833 251
1302 3300046460 Ga0495638_0022362 Ga0495638_0022362_1948_2703 251
1303 3300046460 Ga0495638_0036500 Ga0495638_0036500_1707_2480 251
1304 3300046461 Ga0495641_0014674 Ga0495641_0014674_3251_4009 251
1305 3300046461 Ga0495641_0039165 Ga0495641_0039165_1037_1795 251
1306 3300046462 Ga0495651_0015572 Ga0495651_0015572_2399_3157 251
1307 3300046462 Ga0495651_0085167 Ga0495651_0085167_1106_1864 251
1308 3300046462 Ga0495651_0120048 Ga0495651_0120048_1060_1815 251
1309 3300046463 Ga0495653_0000473 Ga0495653_0000473_17517_18275 251
1310 3300046463 Ga0495653_0113012 Ga0495653_0113012_188_946 251
1311 3300046472 Ga0495580_0015052 Ga0495580_0015052_1267_2025 251
1312 3300046472 Ga0495580_0018909 Ga0495580_0018909_3500_4258 251
1313 3300046473 Ga0495582_0000974 Ga0495582_0000974_9855_10613 251
1314 3300046473 Ga0495582_0027990 Ga0495582_0027990_554_1318 251
1315 3300046475 Ga0495639_0000017 Ga0495639_0000017_44806_45564 251
1316 3300046475 Ga0495639_0060223 Ga0495639_0060223_285_1049 251
1317 3300046476 Ga0495662_0000179 Ga0495662_0000179_6363_7121 251
1318 3300046476 Ga0495662_0233079 Ga0495662_0233079_25_783 251
1319 3300046477 Ga0495664_0089776 Ga0495664_0089776_1014_1772 251
1320 3300046492 Ga0495585_0004643 Ga0495585_0004643_1688_2446 251
1321 3300046499 Ga0495594_0000094 Ga0495594_0000094_24306_25064 251
1322 3300046499 Ga0495594_0007078 Ga0495594_0007078_2025_2783 251
1323 3300046499 Ga0495594_0098064 Ga0495594_0098064_736_1494 251
1324 3300046507 Ga0495606_0002138 Ga0495606_0002138_886_1659 251
1325 3300046507 Ga0495606_0102853 Ga0495606_0102853_20_790 251
1326 3300046511 Ga0495608_0007400 Ga0495608_0007400_1675_2433 251
1327 3300046511 Ga0495608_0060453 Ga0495608_0060453_604_1359 251
1328 3300046512 Ga0495610_0075749 Ga0495610_0075749_665_1435 251
1329 3300046513 Ga0495616_0043510 Ga0495616_0043510_1470_2228 251
1330 3300046514 Ga0495618_0084293 Ga0495618_0084293_688_1443 251
1331 3300046514 Ga0495618_0095271 Ga0495618_0095271_360_1118 251
1332 3300046515 Ga0495620_0024967 Ga0495620_0024967_39_812 251
1333 3300046516 Ga0495628_0027034 Ga0495628_0027034_3634_4389 251
1334 3300046516 Ga0495628_0064067 Ga0495628_0064067_466_1224 251
1335 3300046516 Ga0495628_0180064 Ga0495628_0180064_802_1560 251
1336 3300046516 Ga0495628_0244898 Ga0495628_0244898_391_1149 251
1337 3300046517 Ga0495630_0008181 Ga0495630_0008181_4683_5441 251
1338 3300046517 Ga0495630_0036331 Ga0495630_0036331_2461_3219 251
1339 3300046523 Ga0495644_0003084 Ga0495644_0003084_783_1541 251
1340 3300046524 Ga0495648_0000494 Ga0495648_0000494_12655_13413 251
1341 3300046524 Ga0495648_0060116 Ga0495648_0060116_312_1085 251
1342 3300046526 Ga0495666_0149246 Ga0495666_0149246_42_800 251
1343 3300046528 Ga0495642_0129722 Ga0495642_0129722_37_807 251
1344 3300046529 Ga0495652_0006106 Ga0495652_0006106_5186_5944 251
1345 3300046529 Ga0495652_0013728 Ga0495652_0013728_4733_5488 251
1346 3300046529 Ga0495652_0091230 Ga0495652_0091230_86_844 251
1347 3300046529 Ga0495652_0119722 Ga0495652_0119722_812_1570 251
1348 3300046530 Ga0495654_0032938 Ga0495654_0032938_915_1688 251
1349 3300046530 Ga0495654_0165740 Ga0495654_0165740_35_790 251
1350 3300046531 Ga0495665_0000032 Ga0495665_0000032_41149_41907 251
1351 3300046531 Ga0495665_0023158 Ga0495665_0023158_1686_2444 251
1352 3300046533 Ga0495640_0001724 Ga0495640_0001724_4214_4972 251
1353 3300046533 Ga0495640_0196234 Ga0495640_0196234_483_1253 251
1354 3300046535 Ga0495586_0311371 Ga0495586_0311371_11_769 251
1355 3300046536 Ga0495587_0010454 Ga0495587_0010454_4423_5181 251
1356 3300046536 Ga0495587_0037939 Ga0495587_0037939_293_1051 251
1357 3300046537 Ga0495598_0006263 Ga0495598_0006263_53_811 251
1358 3300046538 Ga0495609_0142147 Ga0495609_0142147_194_952 251
1359 3300046542 Ga0495597_0046757 Ga0495597_0046757_347_1117 251
1360 3300046543 Ga0495645_0137633 Ga0495645_0137633_78_872 251
1361 3300046543 Ga0495645_0263284 Ga0495645_0263284_117_872 251
1362 3300046557 Ga0495622_0010235 Ga0495622_0010235_2197_2955 251
1363 3300046557 Ga0495622_0038223 Ga0495622_0038223_106_879 251
1364 3300046558 Ga0495633_0003607 Ga0495633_0003607_1699_2457 251
1365 3300046559 Ga0495667_0000962 Ga0495667_0000962_5320_6078 251
1366 3300046559 Ga0495667_0165382 Ga0495667_0165382_221_979 251
1367 3300046615 Ga0495656_0001421 Ga0495656_0001421_2161_2919 251
1368 3300046616 Ga0495668_0216984 Ga0495668_0216984_132_902 251
1369 3300046642 Ga0495634_0003268 Ga0495634_0003268_11211_11969 251
1370 3300046642 Ga0495634_0078652 Ga0495634_0078652_336_1094 251
1371 3300046642 Ga0495634_0212154 Ga0495634_0212154_66_821 251
1372 3300046642 Ga0495634_0229210 Ga0495634_0229210_26_784 251
1373 3300046648 Ga0495611_0030565 Ga0495611_0030565_1115_1873 251
1374 3300046663 Ga0495635_0000084 Ga0495635_0000084_965_1723 251
1375 3300046663 Ga0495635_0003234 Ga0495635_0003234_8357_9115 251
1376 3300046663 Ga0495635_0164809 Ga0495635_0164809_274_1029 251
1377 3300046665 Ga0495661_0019379 Ga0495661_0019379_1982_2740 251
1378 3300046665 Ga0495661_0063366 Ga0495661_0063366_1242_2015 251
1379 3300046674 Ga0495588_0034752 Ga0495588_0034752_22_780 251
1380 3300046674 Ga0495588_0037169 Ga0495588_0037169_1421_2179 251
1381 3300046674 Ga0495588_0108846 Ga0495588_0108846_251_1024 251
1382 3300046675 Ga0495657_0005107 Ga0495657_0005107_725_1483 251
1383 3300046675 Ga0495657_0008437 Ga0495657_0008437_3137_3892 251
1384 3300046675 Ga0495657_0190027 Ga0495657_0190027_338_1096 251
1385 3300046675 Ga0495657_0224104 Ga0495657_0224104_34_792 251
1386 3300046678 Ga0495599_0000457 Ga0495599_0000457_16708_17466 251
1387 3300046678 Ga0495599_0038768 Ga0495599_0038768_1685_2443 251
1388 3300046679 Ga0495623_0008556 Ga0495623_0008556_5104_5862 251
1389 3300046679 Ga0495623_0107716 Ga0495623_0107716_255_1040 251
1390 3300046680 Ga0495646_0042090 Ga0495646_0042090_1607_2365 251
1391 3300046680 Ga0495646_0064091 Ga0495646_0064091_1187_1945 251
1392 3300046680 Ga0495646_0153260 Ga0495646_0153260_335_1090 251
1393 3300046681 Ga0495647_0000248 Ga0495647_0000248_2298_3056 251
1394 3300046681 Ga0495647_0017500 Ga0495647_0017500_1497_2255 251
1395 3300046683 Ga0495658_0001805 Ga0495658_0001805_6753_7511 251
1396 3300046683 Ga0495658_0007984 Ga0495658_0007984_1988_2746 251
1397 3300046683 Ga0495658_0106447 Ga0495658_0106447_491_1249 251
1398 3300046689 Ga0495613_0001580 Ga0495613_0001580_9546_10304 251
1399 3300046689 Ga0495613_0004954 Ga0495613_0004954_6494_7252 251
1400 3300046689 Ga0495613_0071751 Ga0495613_0071751_58_816 251
1401 3300046689 Ga0495613_0121915 Ga0495613_0121915_157_948 251
1402 3300046690 Ga0495624_0004094 Ga0495624_0004094_3418_4176 251
1403 3300046691 Ga0495670_0000787 Ga0495670_0000787_7784_8542 251
1404 3300046691 Ga0495670_0010416 Ga0495670_0010416_3178_3951 251
1405 3300046692 Ga0495671_0243761 Ga0495671_0243761_58_816 251
1406 3300046694 Ga0495649_0094750 Ga0495649_0094750_124_894 251
1407 3300046809 Ga0495600_0003042 Ga0495600_0003042_8924_9682 251
1408 3300046809 Ga0495600_0004866 Ga0495600_0004866_1990_2748 251
1409 3300047315 Ga0495581_0000076 Ga0495581_0000076_9855_10613 251
1410 3300047315 Ga0495581_0043435 Ga0495581_0043435_624_1388 251
1411 3300047315 Ga0495581_0114836 Ga0495581_0114836_242_1000 251
1412 3300047315 Ga0495581_0139969 Ga0495581_0139969_293_1051 251
1413 3300047315 Ga0495581_0203298 Ga0495581_0203298_225_995 251
1414 3300047317 Ga0495604_0010464 Ga0495604_0010464_1295_2053 251
1415 3300047317 Ga0495604_0102023 Ga0495604_0102023_624_1382 251
1416 3300047317 Ga0495604_0133812 Ga0495604_0133812_817_1575 251
1417 3300047319 Ga0495674_0001109 Ga0495674_0001109_18451_19209 251
1418 3300047319 Ga0495674_0070677 Ga0495674_0070677_1224_1982 251
1419 3300047319 Ga0495674_0072742 Ga0495674_0072742_2145_2903 251
1420 3300047320 Ga0495672_0028513 Ga0495672_0028513_925_1680 251
1421 3300047320 Ga0495672_0242945 Ga0495672_0242945_36_791 251
1422 3300047321 Ga0495676_0036452 Ga0495676_0036452_2328_3086 251
1423 3300047321 Ga0495676_0227178 Ga0495676_0227178_166_924 251
1424 3300047321 Ga0495676_0283049 Ga0495676_0283049_323_1081 251
1425 3300047322 Ga0495680_0007126 Ga0495680_0007126_8061_8819 251
1426 3300047322 Ga0495680_0010925 Ga0495680_0010925_1990_2748 251
1427 3300047322 Ga0495680_0021814 Ga0495680_0021814_2424_3179 251
1428 3300047322 Ga0495680_0270302 Ga0495680_0270302_191_949 251
1429 3300047323 Ga0495683_0166942 Ga0495683_0166942_31_801 251
1430 3300047443 Ga0495687_010366 Ga0495687_010366_2949_3719 251
1431 3300047444 Ga0495675_0001533 Ga0495675_0001533_9270_10028 251
1432 3300047469 Ga0495673_0117193 Ga0495673_0117193_28_786 251
1433 3300047471 Ga0495684_0001330 Ga0495684_0001330_9252_10010 251
1434 3300047471 Ga0495684_0001937 Ga0495684_0001937_2600_3358 251
1435 3300047472 Ga0495686_0076759 Ga0495686_0076759_732_1490 251
1436 3300047472 Ga0495686_0169194 Ga0495686_0169194_449_1207 251
1437 3300047472 Ga0495686_0275060 Ga0495686_0275060_91_864 251
1438 3300047673 Ga0495593_0002160 Ga0495593_0002160_4050_4808 251
1439 3300047673 Ga0495593_0002185 Ga0495593_0002185_10214_10972 251
1440 3300047673 Ga0495593_0004247 Ga0495593_0004247_3059_3817 251
1441 3300048088 Ga0495602_0084727 Ga0495602_0084727_1396_2154 251
1442 3300048089 Ga0495614_0035738 Ga0495614_0035738_1106_1864 251
1443 3300048089 Ga0495614_0045811 Ga0495614_0045811_420_1178 251
1444 3300048089 Ga0495614_0199292 Ga0495614_0199292_124_882 251
1445 3300048903 Ga0496100_0009708 Ga0496100_0009708_4513_5271 251
1446 3300048903 Ga0496100_0032941 Ga0496100_0032941_2151_2909 251
1447 3300048903 Ga0496100_0133547 Ga0496100_0133547_440_1279 251
1448 3300048903 Ga0496100_0186477 Ga0496100_0186477_215_985 251
1449 3300048904 Ga0496101_0062075 Ga0496101_0062075_1683_2453 251
1450 3300048904 Ga0496101_0106071 Ga0496101_0106071_283_1041 251
1451 3300048904 Ga0496101_0124410 Ga0496101_0124410_162_920 251
1452 3300048904 Ga0496101_0234968 Ga0496101_0234968_35_790 251
1453 3300048904 Ga0496101_0306525 Ga0496101_0306525_175_930 251
1454 3300048905 Ga0496102_0004998 Ga0496102_0004998_2982_3752 251
1455 3300048905 Ga0496102_0017053 Ga0496102_0017053_3988_4743 251
1456 3300048905 Ga0496102_0029309 Ga0496102_0029309_4107_4862 251
1457 3300048905 Ga0496102_0123553 Ga0496102_0123553_738_1496 251
1458 3300048905 Ga0496102_0253023 Ga0496102_0253023_571_1326 251
1459 3300048906 Ga0496103_0003807 Ga0496103_0003807_6151_6921 251
1460 3300048906 Ga0496103_0024359 Ga0496103_0024359_2151_2909 251
1461 3300048906 Ga0496103_0067753 Ga0496103_0067753_1239_1994 251
1462 3300048907 Ga0496104_0023465 Ga0496104_0023465_2294_3052 251
1463 3300048907 Ga0496104_0026932 Ga0496104_0026932_1371_2129 251
1464 3300048907 Ga0496104_0118811 Ga0496104_0118811_550_1308 251
1465 3300048907 Ga0496104_0131351 Ga0496104_0131351_136_891 251
1466 3300048908 Ga0496105_0027756 Ga0496105_0027756_2151_2909 251
1467 3300048908 Ga0496105_0047246 Ga0496105_0047246_1374_2132 251
1468 3300048908 Ga0496105_0104294 Ga0496105_0104294_863_1621 251
1469 3300048908 Ga0496105_0129992 Ga0496105_0129992_37_807 251
1470 3300048908 Ga0496105_0193884 Ga0496105_0193884_807_1562 251
1471 3300048909 Ga0496106_0001453 Ga0496106_0001453_14257_15015 251
1472 3300048909 Ga0496106_0007579 Ga0496106_0007579_2002_2760 251
1473 3300048909 Ga0496106_0155397 Ga0496106_0155397_925_1680 251
1474 3300048910 Ga0496107_0012401 Ga0496107_0012401_502_1260 251
1475 3300048910 Ga0496107_0057233 Ga0496107_0057233_972_1727 251
1476 3300048910 Ga0496107_0080430 Ga0496107_0080430_1239_1994 251
1477 3300048910 Ga0496107_0131581 Ga0496107_0131581_856_1614 251
1478 3300048910 Ga0496107_0139865 Ga0496107_0139865_948_1706 251
1479 3300048910 Ga0496107_0140109 Ga0496107_0140109_720_1478 251
1480 3300048911 Ga0496108_0007772 Ga0496108_0007772_7586_8344 251
1481 3300048911 Ga0496108_0015489 Ga0496108_0015489_5323_6078 251
1482 3300048911 Ga0496108_0081128 Ga0496108_0081128_1708_2466 251
1483 3300048911 Ga0496108_0132976 Ga0496108_0132976_1050_1820 251
1484 3300048911 Ga0496108_0389286 Ga0496108_0389286_436_1191 251
1485 3300048911 Ga0496108_0435246 Ga0496108_0435246_332_1090 251
1486 3300048912 Ga0496109_0002542 Ga0496109_0002542_5529_6287 251
1487 3300048912 Ga0496109_0253461 Ga0496109_0253461_597_1367 251
1488 3300048913 Ga0496110_0006911 Ga0496110_0006911_8118_8873 251
1489 3300048913 Ga0496110_0024579 Ga0496110_0024579_319_1077 251
1490 3300048913 Ga0496110_0108630 Ga0496110_0108630_1409_2167 251
1491 3300048913 Ga0496110_0234218 Ga0496110_0234218_168_926 251
1492 3300048913 Ga0496110_0401456 Ga0496110_0401456_245_1000 251
1493 3300048913 Ga0496110_0700215 Ga0496110_0700215_47_817 251
1494 3300048914 Ga0496111_0004178 Ga0496111_0004178_132_887 251
1495 3300048914 Ga0496111_0040057 Ga0496111_0040057_1179_1937 251
1496 3300048914 Ga0496111_0049479 Ga0496111_0049479_517_1275 251
1497 3300048914 Ga0496111_0094980 Ga0496111_0094980_1352_2110 251
1498 3300048914 Ga0496111_0271124 Ga0496111_0271124_418_1176 251
1499 3300048915 Ga0496112_0010890 Ga0496112_0010890_4458_5216 251
1500 3300048915 Ga0496112_0024803 Ga0496112_0024803_4850_5608 251
1501 3300048915 Ga0496112_0041801 Ga0496112_0041801_149_907 251
1502 3300048915 Ga0496112_0189675 Ga0496112_0189675_382_1140 251
1503 3300048915 Ga0496112_0216117 Ga0496112_0216117_354_1109 251
1504 3300048915 Ga0496112_0251390 Ga0496112_0251390_667_1437 251
1505 3300048916 Ga0496113_0004601 Ga0496113_0004601_2151_2909 251
1506 3300048916 Ga0496113_0008091 Ga0496113_0008091_563_1321 251
1507 3300048916 Ga0496113_0114467 Ga0496113_0114467_388_1143 251
1508 3300048916 Ga0496113_0215699 Ga0496113_0215699_527_1297 251
1509 3300048916 Ga0496113_0555583 Ga0496113_0555583_143_901 251
1510 3300048917 Ga0496114_0005585 Ga0496114_0005585_8193_8948 251
1511 3300048917 Ga0496114_0015990 Ga0496114_0015990_2151_2909 251
1512 3300048917 Ga0496114_0065889 Ga0496114_0065889_1740_2510 251
1513 3300048917 Ga0496114_0114066 Ga0496114_0114066_929_1684 251
1514 3300048917 Ga0496114_0121398 Ga0496114_0121398_466_1224 251
1515 3300048918 Ga0496115_0019563 Ga0496115_0019563_838_1596 251
1516 3300048918 Ga0496115_0040397 Ga0496115_0040397_795_1553 251
1517 3300048918 Ga0496115_0041198 Ga0496115_0041198_2151_2909 251
1518 3300048918 Ga0496115_0089958 Ga0496115_0089958_1237_1992 251
1519 3300048918 Ga0496115_0467285 Ga0496115_0467285_231_989 251
1520 3300048919 Ga0496116_0002810 Ga0496116_0002810_12514_13287 251
1521 3300048919 Ga0496116_0181951 Ga0496116_0181951_294_1064 251
1522 3300048919 Ga0496116_0254201 Ga0496116_0254201_45_815 251
1523 3300048920 Ga0496117_0064775 Ga0496117_0064775_844_1614 251
1524 3300048920 Ga0496117_0066143 Ga0496117_0066143_1480_2253 251
1525 3300048921 Ga0496118_0017101 Ga0496118_0017101_3419_4174 251
1526 3300048921 Ga0496118_0075568 Ga0496118_0075568_1225_1998 251
1527 3300048921 Ga0496118_0201703 Ga0496118_0201703_113_886 251
1528 3300048922 Ga0496119_0091345 Ga0496119_0091345_682_1452 251
1529 3300048922 Ga0496119_0094144 Ga0496119_0094144_786_1550 251
1530 3300048922 Ga0496119_0149169 Ga0496119_0149169_341_1099 251
1531 3300048922 Ga0496119_0195140 Ga0496119_0195140_240_1013 251
1532 3300048924 Ga0496121_0005592 Ga0496121_0005592_4869_5633 251
1533 3300048924 Ga0496121_0005961 Ga0496121_0005961_11347_12105 251
1534 3300048924 Ga0496121_0031537 Ga0496121_0031537_1425_2198 251
1535 3300048924 Ga0496121_0102204 Ga0496121_0102204_1193_1966 251
1536 3300048924 Ga0496121_0114227 Ga0496121_0114227_245_1000 251
1537 3300048924 Ga0496121_0258853 Ga0496121_0258853_388_1158 251
1538 3300048924 Ga0496121_0260947 Ga0496121_0260947_58_813 251
1539 3300048925 Ga0496122_0024253 Ga0496122_0024253_4488_5261 251
1540 3300048925 Ga0496122_0214035 Ga0496122_0214035_158_931 251
1541 3300048926 Ga0496123_0153571 Ga0496123_0153571_39_812 251
1542 3300048927 Ga0496124_0170336 Ga0496124_0170336_161_931 251
1543 3300048927 Ga0496124_0176486 Ga0496124_0176486_91_864 251
1544 3300048928 Ga0496125_0000850 Ga0496125_0000850_6478_7233 251
1545 3300048928 Ga0496125_0006132 Ga0496125_0006132_4522_5295 251
1546 3300048928 Ga0496125_0006453 Ga0496125_0006453_6070_6843 251
1547 3300048928 Ga0496125_0059762 Ga0496125_0059762_86_856 251
1548 3300048929 Ga0496126_0004886 Ga0496126_0004886_2367_3122 251
1549 3300048929 Ga0496126_0018879 Ga0496126_0018879_1401_2156 251
1550 3300048929 Ga0496126_0066646 Ga0496126_0066646_2208_2978 251
1551 3300048929 Ga0496126_0138295 Ga0496126_0138295_639_1394 251
1552 3300048929 Ga0496126_0149822 Ga0496126_0149822_155_913 251
1553 3300048929 Ga0496126_0159831 Ga0496126_0159831_602_1372 251
1554 3300048929 Ga0496126_0170358 Ga0496126_0170358_153_926 251
1555 3300048929 Ga0496126_0207351 Ga0496126_0207351_467_1225 251
1556 3300048929 Ga0496126_0233659 Ga0496126_0233659_640_1413 251
1557 3300048929 Ga0496126_0251436 Ga0496126_0251436_63_827 251
1558 3300049570 Ga0501033_0055981 Ga0501033_0055981_1857_2612 251
1559 3300049571 Ga0501034_0078646 Ga0501034_0078646_438_1193 251
1560 3300049572 Ga0501036_0281622 Ga0501036_0281622_76_831 251
1561 3300049574 Ga0501038_0144616 Ga0501038_0144616_77_832 251
1562 3300049576 Ga0501040_0527577 Ga0501040_0527577_47_808 251
1563 3300049580 Ga0501046_0032084 Ga0501046_0032084_2365_3120 251
1564 3300049581 Ga0501047_0087080 Ga0501047_0087080_62_817 251
1565 3300049581 Ga0501047_0546852 Ga0501047_0546852_74_829 251
1566 3300049583 Ga0501067_0051104 Ga0501067_0051104_947_1702 251
1567 3300049585 Ga0501069_0093592 Ga0501069_0093592_650_1414 251
1568 3300049586 Ga0501070_0068644 Ga0501070_0068644_571_1335 251
1569 3300049586 Ga0501070_0171049 Ga0501070_0171049_143_901 251
1570 3300049589 Ga0501073_0117597 Ga0501073_0117597_64_819 251
1571 3300049591 Ga0501075_0337399 Ga0501075_0337399_65_841 251
1572 3300049742 Ga0501080_0548637 Ga0501080_0548637_15_776 251
1573 3300049822 Ga0501035_0001058 Ga0501035_0001058_11851_12618 251
1574 3300049822 Ga0501035_0268517 Ga0501035_0268517_606_1364 251
1575 3300049823 Ga0501044_0247374 Ga0501044_0247374_146_904 251
1576 3300049824 Ga0501045_0109171 Ga0501045_0109171_1100_1855 251
1577 3300050490 nmdc:mga03n38_166170_c1 nmdc:mga03n38_166170_c1_215_988 251
1578 3300050490 nmdc:mga03n38_88814_c1 nmdc:mga03n38_88814_c1_479_1237 251
1579 3300050491 nmdc:mga00v17_126620_c1 nmdc:mga00v17_126620_c1_138_908 251
1580 3300050492 nmdc:mga0yw44_140144_c1 nmdc:mga0yw44_140144_c1_242_1006 251
1581 3300050492 nmdc:mga0yw44_20149_c1 nmdc:mga0yw44_20149_c1_2695_3468 251
1582 3300050492 nmdc:mga0yw44_215952_c1 nmdc:mga0yw44_215952_c1_359_1114 251
1583 3300050492 nmdc:mga0yw44_28351_c1 nmdc:mga0yw44_28351_c1_319_1089 251
1584 3300050492 nmdc:mga0yw44_29821_c1 nmdc:mga0yw44_29821_c1_887_1657 251
1585 3300050492 nmdc:mga0yw44_32622_c1 nmdc:mga0yw44_32622_c1_1084_1842 251
1586 3300050492 nmdc:mga0yw44_49130_c1 nmdc:mga0yw44_49130_c1_877_1641 251
1587 3300050493 nmdc:mga0k408_9852_c1 nmdc:mga0k408_9852_c1_328_1098 251
1588 3300050494 nmdc:mga06z11_195578_c1 nmdc:mga06z11_195578_c1_117_890 251
1589 3300050495 nmdc:mga04h51_68922_c1 nmdc:mga04h51_68922_c1_175_933 251
1590 3300050496 nmdc:mga07m45_102179_c1 nmdc:mga07m45_102179_c1_641_1414 251
1591 3300050496 nmdc:mga07m45_3911_c1 nmdc:mga07m45_3911_c1_4722_5492 251
1592 3300050509 nmdc:mga0qj67_214647_c1 nmdc:mga0qj67_214647_c1_234_995 251
1593 3300050510 nmdc:mga06r32_231017_c1 nmdc:mga06r32_231017_c1_505_1266 251
1594 3300050511 nmdc:mga08y16_511091_c1 nmdc:mga08y16_511091_c1_264_1022 251
1595 3300050512 nmdc:mga0n895_537959_c1 nmdc:mga0n895_537959_c1_78_836 251
1596 3300050512 nmdc:mga0n895_556268_c1 nmdc:mga0n895_556268_c1_362_1120 251
1597 3300050512 nmdc:mga0n895_72053_c1 nmdc:mga0n895_72053_c1_504_1262 251
1598 3300050514 nmdc:mga08x19_258482_c1 nmdc:mga08x19_258482_c1_202_960 251
1599 3300050514 nmdc:mga08x19_32130_c1 nmdc:mga08x19_32130_c1_2178_2936 251
1600 3300050516 nmdc:mga0sz30_86912_c1 nmdc:mga0sz30_86912_c1_228_998 251
1601 3300050516 nmdc:mga0sz30_94549_c1 nmdc:mga0sz30_94549_c1_206_976 251
1602 3300053077 Ga0495601_0056249 Ga0495601_0056249_300_1064 251
1603 3300053077 Ga0495601_0099669 Ga0495601_0099669_1047_1805 251
1604 3300053077 Ga0495601_0121479 Ga0495601_0121479_904_1662 251
1605 3300053077 Ga0495601_0167874 Ga0495601_0167874_351_1106 251
1606 3300053077 Ga0495601_0207292 Ga0495601_0207292_263_1057 251
1607 3300053078 Ga0495612_0005170 Ga0495612_0005170_1518_2276 251
1608 3300053078 Ga0495612_0022238 Ga0495612_0022238_755_1513 251
1609 3300053080 Ga0500635_0014749 Ga0500635_0014749_519_1274 251
1610 3300053084 Ga0495595_0000267 Ga0495595_0000267_17517_18275 251
1611 3300053084 Ga0495595_0001389 Ga0495595_0001389_708_1466 251
1612 3300053085 Ga0495619_0000434 Ga0495619_0000434_26658_27416 251
1613 3300053085 Ga0495619_0000491 Ga0495619_0000491_14595_15353 251
1614 3300053085 Ga0495619_0055342 Ga0495619_0055342_1013_1768 251
1615 3300053087 Ga0500643_000156 Ga0500643_000156_49799_50554 251
1616 3300053087 Ga0500643_011270 Ga0500643_011270_692_1465 251
1617 3300053089 Ga0500581_083803 Ga0500581_083803_570_1343 251
1618 3300053090 Ga0500646_0008643 Ga0500646_0008643_133_906 251
1619 3300053091 Ga0500647_0067702 Ga0500647_0067702_585_1358 251
1620 3300053093 Ga0500651_0061060 Ga0500651_0061060_805_1578 251
1621 3300053093 Ga0500651_0152455 Ga0500651_0152455_388_1167 251
1622 3300053093 Ga0500651_0189508 Ga0500651_0189508_67_825 251
1623 3300053094 Ga0500566_0000091 Ga0500566_0000091_20159_20929 251
1624 3300053094 Ga0500566_0000990 Ga0500566_0000990_13727_14500 251
1625 3300053094 Ga0500566_0095435 Ga0500566_0095435_729_1496 251
1626 3300053094 Ga0500566_0183280 Ga0500566_0183280_213_983 251
1627 3300053095 Ga0500640_139350 Ga0500640_139350_109_876 251
1628 3300053096 Ga0500641_0068022 Ga0500641_0068022_105_860 251
1629 3300053098 Ga0500650_0001832 Ga0500650_0001832_4676_5449 251
1630 3300053098 Ga0500650_0172716 Ga0500650_0172716_38_793 251
1631 3300053103 Ga0500555_000933 Ga0500555_000933_6822_7577 251
1632 3300053104 Ga0500556_0000002 Ga0500556_0000002_635269_636042 251
1633 3300053104 Ga0500556_0004481 Ga0500556_0004481_1450_2205 251
1634 3300053104 Ga0500556_0122004 Ga0500556_0122004_126_884 251
1635 3300053105 Ga0500557_000024 Ga0500557_000024_48875_49633 251
1636 3300053108 Ga0500562_012516 Ga0500562_012516_599_1372 251
1637 3300053108 Ga0500562_063985 Ga0500562_063985_183_956 251
1638 3300053119 Ga0500595_002243 Ga0500595_002243_1703_2461 251
1639 3300053121 Ga0500607_030662 Ga0500607_030662_1481_2254 251
1640 3300053121 Ga0500607_118822 Ga0500607_118822_369_1136 251
1641 3300053122 Ga0500608_000584 Ga0500608_000584_6155_6928 251
1642 3300053123 Ga0500614_012060 Ga0500614_012060_965_1732 251
1643 3300053130 Ga0500642_0000093 Ga0500642_0000093_29623_30396 251
1644 3300053130 Ga0500642_0000107 Ga0500642_0000107_17243_18016 251
1645 3300053131 Ga0500652_000219 Ga0500652_000219_14970_15743 251
1646 3300053133 Ga0500655_003619 Ga0500655_003619_1672_2427 251
1647 3300053133 Ga0500655_008426 Ga0500655_008426_308_1063 251
1648 3300053134 Ga0500658_0038875 Ga0500658_0038875_573_1346 251
1649 3300053134 Ga0500658_0152483 Ga0500658_0152483_143_898 251
1650 3300053136 Ga0500559_0001261 Ga0500559_0001261_4386_5159 251
1651 3300053139 Ga0500568_0000835 Ga0500568_0000835_12983_13756 251
1652 3300053139 Ga0500568_0001045 Ga0500568_0001045_5782_6546 251
1653 3300053139 Ga0500568_0005007 Ga0500568_0005007_803_1558 251
1654 3300053139 Ga0500568_0020371 Ga0500568_0020371_1976_2734 251
1655 3300053139 Ga0500568_0047844 Ga0500568_0047844_169_939 251
1656 3300053142 Ga0500577_0000212 Ga0500577_0000212_9695_10468 251
1657 3300053145 Ga0500586_096995 Ga0500586_096995_43_816 251
1658 3300053148 Ga0500590_171896 Ga0500590_171896_16_786 251
1659 3300053151 Ga0500604_0007304 Ga0500604_0007304_1497_2270 251
1660 3300053153 Ga0500616_0000045 Ga0500616_0000045_86208_86963 251
1661 3300053153 Ga0500616_0000069 Ga0500616_0000069_117011_117784 251
1662 3300053153 Ga0500616_0051836 Ga0500616_0051836_709_1464 251
1663 3300053156 Ga0500622_0001388 Ga0500622_0001388_5782_6555 251
1664 3300053156 Ga0500622_0015344 Ga0500622_0015344_1997_2752 251
1665 3300053158 Ga0500627_0007562 Ga0500627_0007562_1840_2595 251
1666 3300053158 Ga0500627_0055077 Ga0500627_0055077_374_1138 251
1667 3300053161 Ga0500634_0013070 Ga0500634_0013070_108_881 251
1668 3300053161 Ga0500634_0102260 Ga0500634_0102260_150_905 251
1669 3300053161 Ga0500634_0108303 Ga0500634_0108303_85_864 251
1670 3300053162 Ga0500638_197403 Ga0500638_197403_35_808 251
1671 3300053177 Ga0500636_0003270 Ga0500636_0003270_7850_8623 251
1672 3300053178 Ga0500637_0006416 Ga0500637_0006416_920_1675 251
1673 3300053178 Ga0500637_0175014 Ga0500637_0175014_150_905 251
1674 3300053727 Ga0500611_005568 Ga0500611_005568_636_1409 251
1675 3300053730 Ga0500645_077583 Ga0500645_077583_176_931 251
1676 3300053736 Ga0500599_000719 Ga0500599_000719_471_1226 251
1677 3300053737 Ga0500601_000724 Ga0500601_000724_1677_2432 251
1678 3300054114 Ga0501084_0151219 Ga0501084_0151219_212_988 251
1679 3300060353 Ga0501082_0000084 Ga0501082_0000084_58317_59075 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

7

246

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kxq-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9819 5 249
4nvt-assembly2.cif.gz_B crystal structure of triosephosphate isomerase from brucella melitensis 0.9816 5 249
3kxq-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9795 5 249
4nvt-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from brucella melitensis 0.9781 5 249
4nvt-assembly2.cif.gz_B crystal structure of triosephosphate isomerase from brucella melitensis 0.966 5 249
ID Description Score Start End Superfamily
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9805 5 249 3.20.20.70
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9611 5 249 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9494 4 251 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9484 6 249 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9458 4 251 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1X3GA60-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9953 1 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2M6UJ64-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9943 1 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-K0VYF7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9916 63 249 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A1X3GA60-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9914 1 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A435EAS4-F1-model_v4 deleted 0.9887 46 249

Feature Viewer

pLDDT pTM Quality
94.31 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map