F495333
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1686 | 535 | 3372 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_112762|Ga0500643_112762_199_663 |
| Length | 154 |
| Sequence | LETPFRRFSGASEQGMTARRSAACRNRSEVVARIAGVNIPTNKRVLIALQYIHGIGQKNAKDIMDKVHIPEDRRVSQLTDQEVLQIREVIDRDYMVEGDLRREVAVNIKRLMDLGCYRGLRHRKGLPVHGQRTHTNARTRKGPAKAIAGKKKTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 27 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 114 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 115 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 155 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 156 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 157 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 158 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 159 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 160 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 161 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 162 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 163 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 181 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 187 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 188 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 189 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 281 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 282 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 286 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 287 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 288 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 289 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 290 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 292 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 293 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 294 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 295 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 296 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 297 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 298 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 299 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 300 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 301 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 302 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 303 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 304 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 305 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 306 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 307 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 308 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 309 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 310 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 311 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 312 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 313 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 314 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 316 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 317 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 320 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 321 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 323 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 324 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 325 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 326 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 327 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 328 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 330 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 331 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 332 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 334 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 335 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 336 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 337 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 338 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 339 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 340 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 341 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 342 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 343 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 344 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 345 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 346 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 347 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 348 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 349 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 350 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 351 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 352 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 353 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 354 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 355 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 356 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 357 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 358 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 359 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 360 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 361 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 362 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 363 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 364 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 365 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 366 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 367 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 368 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 369 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 370 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 371 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 372 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 373 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 374 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 375 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 376 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 377 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 378 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 379 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 380 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 381 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 382 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 383 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 384 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 385 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 447 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 448 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 449 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 450 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 451 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 452 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 453 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 455 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 456 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 457 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 458 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 459 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 460 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 461 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 462 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 496 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 497 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 498 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 499 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 501 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 517 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 519 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 520 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 521 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 522 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 523 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 524 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 525 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 526 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 527 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 528 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 535 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0 |
| Rhizoplane | 6.29 |
| Rhizosphere | 89.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500643_112762 | 3300053087 | Bacteria | 734 |
| 2 | 2214828544 | 2209111006 | Bacteria | 9115 |
| 3 | ARSoilYngRDRAFT_c00061 | 3300000042 | Bacteria | 17682 |
| 4 | ARcpr5yngRDRAFT_c000075 | 3300000043 | Bacteria | 16570 |
| 5 | ARSoilOldRDRAFT_c000053 | 3300000044 | Bacteria | 23841 |
| 6 | ARCol0oldRDRAFT_c00087 | 3300000045 | Bacteria | 7959 |
| 7 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 8 | JGI24032J14994_100056 | 3300001430 | Bacteria | 4583 |
| 9 | JGI24741J21665_1021617 | 3300001915 | Bacteria | 1003 |
| 10 | JGI24746J21847_1002046 | 3300001977 | Bacteria | 3222 |
| 11 | JGI24747J21853_1011054 | 3300001978 | Bacteria | 910 |
| 12 | JGI24739J22299_10019550 | 3300001989 | Bacteria | 2423 |
| 13 | JGI24737J22298_10019784 | 3300001990 | Bacteria | 2152 |
| 14 | JGI24737J22298_10034285 | 3300001990 | Bacteria | 1574 |
| 15 | JGI24743J22301_10018255 | 3300001991 | Bacteria | 1324 |
| 16 | JGI24743J22301_10048881 | 3300001991 | Bacteria | 859 |
| 17 | JGI24735J21928_10183634 | 3300002067 | Bacteria | 606 |
| 18 | JGI24750J21931_1000316 | 3300002070 | Bacteria | 8271 |
| 19 | JGI24750J21931_1039382 | 3300002070 | Bacteria | 715 |
| 20 | JGI24745J21846_1000643 | 3300002073 | Bacteria | 3139 |
| 21 | JGI24748J21848_1006811 | 3300002074 | Bacteria | 1335 |
| 22 | JGI24748J21848_1016126 | 3300002074 | Bacteria | 892 |
| 23 | JGI24738J21930_10002068 | 3300002075 | Bacteria | 5382 |
| 24 | JGI24749J21850_1001860 | 3300002076 | Bacteria | 2985 |
| 25 | JGI24749J21850_1007303 | 3300002076 | Bacteria | 1540 |
| 26 | JGI24749J21850_1016726 | 3300002076 | Bacteria | 1031 |
| 27 | JGI24035J26624_1000222 | 3300002126 | Bacteria | 5221 |
| 28 | JGI24033J26618_1006577 | 3300002155 | Bacteria | 1308 |
| 29 | JGI24034J26672_10000885 | 3300002239 | Bacteria | 3903 |
| 30 | JGI24742J22300_10001777 | 3300002244 | Bacteria | 3440 |
| 31 | JGI25153J46596_10000830 | 3300003215 | Bacteria | 18874 |
| 32 | JGI25153J46596_10012702 | 3300003215 | Bacteria | 3610 |
| 33 | JGI25153J46596_10095157 | 3300003215 | Bacteria | 711 |
| 34 | JGI26129J50193_1004460 | 3300003349 | Bacteria | 991 |
| 35 | Ga0058862_12620432 | 3300004803 | Bacteria | 719 |
| 36 | Ga0058862_12749426 | 3300004803 | Bacteria | 864 |
| 37 | Ga0065716_1001548 | 3300005277 | Bacteria | 7149 |
| 38 | Ga0065704_10136765 | 3300005289 | Bacteria | 1555 |
| 39 | Ga0065712_10097334 | 3300005290 | Bacteria | 2154 |
| 40 | Ga0065712_10154053 | 3300005290 | Bacteria | 1348 |
| 41 | Ga0065712_10481422 | 3300005290 | Bacteria | 663 |
| 42 | Ga0065715_10002477 | 3300005293 | Bacteria | 7875 |
| 43 | Ga0065715_10137215 | 3300005293 | Bacteria | 1910 |
| 44 | Ga0065707_10221977 | 3300005295 | Bacteria | 1221 |
| 45 | Ga0070658_10032170 | 3300005327 | Bacteria | 4218 |
| 46 | Ga0070676_10002419 | 3300005328 | Bacteria | 9571 |
| 47 | Ga0070676_10069041 | 3300005328 | Bacteria | 2117 |
| 48 | Ga0070676_10426446 | 3300005328 | Bacteria | 928 |
| 49 | Ga0070683_100001083 | 3300005329 | Bacteria | 20468 |
| 50 | Ga0070683_100016861 | 3300005329 | Bacteria | 6444 |
| 51 | Ga0070683_100287619 | 3300005329 | Bacteria | 1563 |
| 52 | Ga0070690_100018877 | 3300005330 | Bacteria | 4175 |
| 53 | Ga0070690_100101714 | 3300005330 | Bacteria | 1906 |
| 54 | Ga0070690_100193783 | 3300005330 | Bacteria | 1410 |
| 55 | Ga0070670_100016356 | 3300005331 | Bacteria | 6370 |
| 56 | Ga0070670_100620526 | 3300005331 | Bacteria | 968 |
| 57 | Ga0070677_10000959 | 3300005333 | Bacteria | 9319 |
| 58 | Ga0068869_100000755 | 3300005334 | Bacteria | 18338 |
| 59 | Ga0068869_100772730 | 3300005334 | Bacteria | 824 |
| 60 | Ga0070666_10127070 | 3300005335 | Bacteria | 1770 |
| 61 | Ga0070680_100005733 | 3300005336 | Bacteria | 9421 |
| 62 | Ga0070680_100006856 | 3300005336 | Bacteria | 8685 |
| 63 | Ga0070680_100082555 | 3300005336 | Bacteria | 2653 |
| 64 | Ga0070680_100109472 | 3300005336 | Bacteria | 2299 |
| 65 | Ga0070680_100262774 | 3300005336 | Bacteria | 1460 |
| 66 | Ga0070680_100460180 | 3300005336 | Bacteria | 1087 |
| 67 | Ga0070680_101004180 | 3300005336 | Bacteria | 721 |
| 68 | Ga0070682_100001636 | 3300005337 | Bacteria | 12449 |
| 69 | Ga0070682_100038516 | 3300005337 | Bacteria | 2932 |
| 70 | Ga0070682_100057704 | 3300005337 | Bacteria | 2446 |
| 71 | Ga0070682_100721536 | 3300005337 | Bacteria | 801 |
| 72 | Ga0068868_100006260 | 3300005338 | Bacteria | 8418 |
| 73 | Ga0068868_100109693 | 3300005338 | Bacteria | 2241 |
| 74 | Ga0068868_100134916 | 3300005338 | Bacteria | 2022 |
| 75 | Ga0070660_100000245 | 3300005339 | Bacteria | 35915 |
| 76 | Ga0070660_100015793 | 3300005339 | Bacteria | 5462 |
| 77 | Ga0070660_100023815 | 3300005339 | Bacteria | 4538 |
| 78 | Ga0070660_100036932 | 3300005339 | Bacteria | 3702 |
| 79 | Ga0070660_100341261 | 3300005339 | Bacteria | 1232 |
| 80 | Ga0070689_100005690 | 3300005340 | Bacteria | 8547 |
| 81 | Ga0070689_100011434 | 3300005340 | Bacteria | 6358 |
| 82 | Ga0070689_100258407 | 3300005340 | Bacteria | 1439 |
| 83 | Ga0070691_10000386 | 3300005341 | Bacteria | 16019 |
| 84 | Ga0070691_10002710 | 3300005341 | Bacteria | 7884 |
| 85 | Ga0070691_10047921 | 3300005341 | Bacteria | 2032 |
| 86 | Ga0070691_10496796 | 3300005341 | Bacteria | 704 |
| 87 | Ga0070687_100000348 | 3300005343 | Bacteria | 15751 |
| 88 | Ga0070687_100104754 | 3300005343 | Bacteria | 1590 |
| 89 | Ga0070687_100928955 | 3300005343 | Bacteria | 626 |
| 90 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 91 | Ga0070661_100028862 | 3300005344 | Bacteria | 4003 |
| 92 | Ga0070661_100252395 | 3300005344 | Bacteria | 1361 |
| 93 | Ga0070661_100318049 | 3300005344 | Bacteria | 1215 |
| 94 | Ga0070661_100353327 | 3300005344 | Bacteria | 1153 |
| 95 | Ga0070661_101243042 | 3300005344 | Bacteria | 624 |
| 96 | Ga0070692_10000101 | 3300005345 | Bacteria | 19118 |
| 97 | Ga0070692_10618397 | 3300005345 | Bacteria | 719 |
| 98 | Ga0070668_100054011 | 3300005347 | Bacteria | 3098 |
| 99 | Ga0070668_100060030 | 3300005347 | Bacteria | 2944 |
| 100 | Ga0070668_100078969 | 3300005347 | Bacteria | 2575 |
| 101 | Ga0070669_100000314 | 3300005353 | Bacteria | 37924 |
| 102 | Ga0070669_100349101 | 3300005353 | Bacteria | 1200 |
| 103 | Ga0070675_100000161 | 3300005354 | Bacteria | 40950 |
| 104 | Ga0070675_100074637 | 3300005354 | Bacteria | 2818 |
| 105 | Ga0070675_100134504 | 3300005354 | Bacteria | 2109 |
| 106 | Ga0070675_100276441 | 3300005354 | Bacteria | 1475 |
| 107 | Ga0070671_100012885 | 3300005355 | Bacteria | 6741 |
| 108 | Ga0070671_100259246 | 3300005355 | Bacteria | 1477 |
| 109 | Ga0070674_100114332 | 3300005356 | Bacteria | 1987 |
| 110 | Ga0070674_100428072 | 3300005356 | Bacteria | 1087 |
| 111 | Ga0070673_100018429 | 3300005364 | Bacteria | 4985 |
| 112 | Ga0070673_100049760 | 3300005364 | Bacteria | 3273 |
| 113 | Ga0070673_100060499 | 3300005364 | Bacteria | 3001 |
| 114 | Ga0070673_100076967 | 3300005364 | Bacteria | 2695 |
| 115 | Ga0070673_100147687 | 3300005364 | Bacteria | 1989 |
| 116 | Ga0070673_100301046 | 3300005364 | Bacteria | 1412 |
| 117 | Ga0070688_100000991 | 3300005365 | Bacteria | 14237 |
| 118 | Ga0070688_100004219 | 3300005365 | Bacteria | 7469 |
| 119 | Ga0070688_100140355 | 3300005365 | Bacteria | 1640 |
| 120 | Ga0070688_100152668 | 3300005365 | Bacteria | 1580 |
| 121 | Ga0070659_100087845 | 3300005366 | Bacteria | 2489 |
| 122 | Ga0070659_100173698 | 3300005366 | Bacteria | 1766 |
| 123 | Ga0070659_100224119 | 3300005366 | Bacteria | 1553 |
| 124 | Ga0070659_100680564 | 3300005366 | Bacteria | 888 |
| 125 | Ga0070667_100006114 | 3300005367 | Bacteria | 10001 |
| 126 | Ga0070667_100026201 | 3300005367 | Bacteria | 4849 |
| 127 | Ga0070667_100085289 | 3300005367 | Bacteria | 2708 |
| 128 | Ga0070667_100239074 | 3300005367 | Bacteria | 1621 |
| 129 | Ga0070667_100281389 | 3300005367 | Bacteria | 1493 |
| 130 | Ga0070703_10033785 | 3300005406 | Bacteria | 1558 |
| 131 | Ga0070703_10339604 | 3300005406 | Bacteria | 638 |
| 132 | Ga0070709_10003934 | 3300005434 | Bacteria | 8011 |
| 133 | Ga0070709_10038757 | 3300005434 | Bacteria | 2920 |
| 134 | Ga0070709_10053838 | 3300005434 | Bacteria | 2535 |
| 135 | Ga0070709_10061805 | 3300005434 | Bacteria | 2386 |
| 136 | Ga0070709_10131938 | 3300005434 | Bacteria | 1707 |
| 137 | Ga0070709_10645083 | 3300005434 | Bacteria | 819 |
| 138 | Ga0070714_100020676 | 3300005435 | Bacteria | 5379 |
| 139 | Ga0070714_100222884 | 3300005435 | Bacteria | 1734 |
| 140 | Ga0070714_100488848 | 3300005435 | Bacteria | 1173 |
| 141 | Ga0070714_101006647 | 3300005435 | Bacteria | 811 |
| 142 | Ga0070713_100001694 | 3300005436 | Bacteria | 14164 |
| 143 | Ga0070713_100003041 | 3300005436 | Bacteria | 11020 |
| 144 | Ga0070713_100015926 | 3300005436 | Bacteria | 5639 |
| 145 | Ga0070713_100160468 | 3300005436 | Bacteria | 2006 |
| 146 | Ga0070713_100178759 | 3300005436 | Bacteria | 1905 |
| 147 | Ga0070713_100226838 | 3300005436 | Bacteria | 1696 |
| 148 | Ga0070713_100242746 | 3300005436 | Bacteria | 1641 |
| 149 | Ga0070713_100352058 | 3300005436 | Bacteria | 1367 |
| 150 | Ga0070710_10015917 | 3300005437 | Bacteria | 3815 |
| 151 | Ga0070710_10034381 | 3300005437 | Bacteria | 2757 |
| 152 | Ga0070710_10066577 | 3300005437 | Bacteria | 2066 |
| 153 | Ga0070710_10163657 | 3300005437 | Bacteria | 1381 |
| 154 | Ga0070710_10394949 | 3300005437 | Bacteria | 926 |
| 155 | Ga0070701_10000204 | 3300005438 | Bacteria | 18457 |
| 156 | Ga0070701_10012407 | 3300005438 | Bacteria | 3843 |
| 157 | Ga0070701_10466967 | 3300005438 | Bacteria | 813 |
| 158 | Ga0070711_100007210 | 3300005439 | Bacteria | 6753 |
| 159 | Ga0070711_100027936 | 3300005439 | Bacteria | 3708 |
| 160 | Ga0070711_100056777 | 3300005439 | Bacteria | 2709 |
| 161 | Ga0070711_100065901 | 3300005439 | Bacteria | 2535 |
| 162 | Ga0070711_100196758 | 3300005439 | Bacteria | 1553 |
| 163 | Ga0070711_100491404 | 3300005439 | Bacteria | 1010 |
| 164 | Ga0070705_100004847 | 3300005440 | Bacteria | 6546 |
| 165 | Ga0070705_100049688 | 3300005440 | Bacteria | 2436 |
| 166 | Ga0070705_100396479 | 3300005440 | Bacteria | 1021 |
| 167 | Ga0070700_100000856 | 3300005441 | Bacteria | 15021 |
| 168 | Ga0070700_100194781 | 3300005441 | Bacteria | 1419 |
| 169 | Ga0070700_100309989 | 3300005441 | Bacteria | 1155 |
| 170 | Ga0070694_100021165 | 3300005444 | Bacteria | 4152 |
| 171 | Ga0070694_100682990 | 3300005444 | Bacteria | 834 |
| 172 | Ga0070708_100050068 | 3300005445 | Bacteria | 3698 |
| 173 | Ga0070663_100000945 | 3300005455 | Bacteria | 15785 |
| 174 | Ga0070663_100017856 | 3300005455 | Bacteria | 4637 |
| 175 | Ga0070663_100048584 | 3300005455 | Bacteria | 3009 |
| 176 | Ga0070663_100185939 | 3300005455 | Bacteria | 1614 |
| 177 | Ga0070663_100775360 | 3300005455 | Bacteria | 820 |
| 178 | Ga0070663_101097129 | 3300005455 | Bacteria | 696 |
| 179 | Ga0070678_100007929 | 3300005456 | Bacteria | 6324 |
| 180 | Ga0070678_100028978 | 3300005456 | Bacteria | 3784 |
| 181 | Ga0070678_100132698 | 3300005456 | Bacteria | 1981 |
| 182 | Ga0070678_100495806 | 3300005456 | Bacteria | 1077 |
| 183 | Ga0070662_100026862 | 3300005457 | Bacteria | 3990 |
| 184 | Ga0070662_100042156 | 3300005457 | Bacteria | 3259 |
| 185 | Ga0070662_100506425 | 3300005457 | Bacteria | 1007 |
| 186 | Ga0070681_10004121 | 3300005458 | Bacteria | 13747 |
| 187 | Ga0070681_10005192 | 3300005458 | Bacteria | 12569 |
| 188 | Ga0070681_10019257 | 3300005458 | Bacteria | 6829 |
| 189 | Ga0070681_10045790 | 3300005458 | Bacteria | 4375 |
| 190 | Ga0070681_10141034 | 3300005458 | Bacteria | 2340 |
| 191 | Ga0070681_10210732 | 3300005458 | Bacteria | 1859 |
| 192 | Ga0070681_10308652 | 3300005458 | Bacteria | 1491 |
| 193 | Ga0070681_10676177 | 3300005458 | Bacteria | 947 |
| 194 | Ga0068867_100002227 | 3300005459 | Bacteria | 13620 |
| 195 | Ga0068867_100104555 | 3300005459 | Bacteria | 2167 |
| 196 | Ga0070685_10019677 | 3300005466 | Bacteria | 3646 |
| 197 | Ga0070685_10088882 | 3300005466 | Bacteria | 1867 |
| 198 | Ga0070685_10284367 | 3300005466 | Bacteria | 1108 |
| 199 | Ga0070685_10504412 | 3300005466 | Bacteria | 857 |
| 200 | Ga0070706_100252183 | 3300005467 | Bacteria | 1647 |
| 201 | Ga0070707_100343335 | 3300005468 | Bacteria | 1450 |
| 202 | Ga0070698_100892384 | 3300005471 | Bacteria | 834 |
| 203 | Ga0070698_101241090 | 3300005471 | Bacteria | 695 |
| 204 | Ga0070699_100260514 | 3300005518 | Bacteria | 1551 |
| 205 | Ga0070699_101395070 | 3300005518 | Bacteria | 643 |
| 206 | Ga0070699_101775677 | 3300005518 | Bacteria | 565 |
| 207 | Ga0070679_100008686 | 3300005530 | Bacteria | 9577 |
| 208 | Ga0070679_100059322 | 3300005530 | Bacteria | 3814 |
| 209 | Ga0070679_100075114 | 3300005530 | Bacteria | 3370 |
| 210 | Ga0070679_100104463 | 3300005530 | Bacteria | 2819 |
| 211 | Ga0070679_100142711 | 3300005530 | Bacteria | 2373 |
| 212 | Ga0070679_100358533 | 3300005530 | Bacteria | 1406 |
| 213 | Ga0070679_100517168 | 3300005530 | Bacteria | 1137 |
| 214 | Ga0070684_100000365 | 3300005535 | Bacteria | 31110 |
| 215 | Ga0070684_100113259 | 3300005535 | Bacteria | 2434 |
| 216 | Ga0070684_100150473 | 3300005535 | Bacteria | 2108 |
| 217 | Ga0070684_100220453 | 3300005535 | Bacteria | 1731 |
| 218 | Ga0070697_100654122 | 3300005536 | Bacteria | 926 |
| 219 | Ga0068853_100002095 | 3300005539 | Bacteria | 14797 |
| 220 | Ga0068853_100002660 | 3300005539 | Bacteria | 13466 |
| 221 | Ga0068853_100098304 | 3300005539 | Bacteria | 2584 |
| 222 | Ga0068853_100108708 | 3300005539 | Bacteria | 2460 |
| 223 | Ga0068853_100337036 | 3300005539 | Bacteria | 1401 |
| 224 | Ga0070672_100049173 | 3300005543 | Bacteria | 3279 |
| 225 | Ga0070672_100289492 | 3300005543 | Bacteria | 1386 |
| 226 | Ga0070672_100799995 | 3300005543 | Bacteria | 829 |
| 227 | Ga0070686_100002828 | 3300005544 | Bacteria | 9562 |
| 228 | Ga0070686_100078063 | 3300005544 | Bacteria | 2185 |
| 229 | Ga0070686_100426219 | 3300005544 | Bacteria | 1015 |
| 230 | Ga0070686_100445279 | 3300005544 | Bacteria | 994 |
| 231 | Ga0070686_100692544 | 3300005544 | Bacteria | 812 |
| 232 | Ga0070695_100009518 | 3300005545 | Bacteria | 5789 |
| 233 | Ga0070695_100012934 | 3300005545 | Bacteria | 5010 |
| 234 | Ga0070695_100048370 | 3300005545 | Bacteria | 2719 |
| 235 | Ga0070695_100090371 | 3300005545 | Bacteria | 2043 |
| 236 | Ga0070696_100023478 | 3300005546 | Bacteria | 4192 |
| 237 | Ga0070696_100152460 | 3300005546 | Bacteria | 1697 |
| 238 | Ga0070696_101281157 | 3300005546 | Bacteria | 622 |
| 239 | Ga0070696_101349775 | 3300005546 | Bacteria | 606 |
| 240 | Ga0070693_100000905 | 3300005547 | Bacteria | 13209 |
| 241 | Ga0070693_100025605 | 3300005547 | Bacteria | 3177 |
| 242 | Ga0070693_100072749 | 3300005547 | Bacteria | 2028 |
| 243 | Ga0070693_100119332 | 3300005547 | Bacteria | 1633 |
| 244 | Ga0070693_100236837 | 3300005547 | Bacteria | 1204 |
| 245 | Ga0070693_100319006 | 3300005547 | Bacteria | 1053 |
| 246 | Ga0070693_100454253 | 3300005547 | Bacteria | 900 |
| 247 | Ga0070693_100765753 | 3300005547 | Bacteria | 713 |
| 248 | Ga0070665_100165224 | 3300005548 | Bacteria | 2216 |
| 249 | Ga0070665_100391897 | 3300005548 | Bacteria | 1397 |
| 250 | Ga0070665_101154306 | 3300005548 | Bacteria | 786 |
| 251 | Ga0070665_101655400 | 3300005548 | Bacteria | 647 |
| 252 | Ga0070665_102072235 | 3300005548 | Bacteria | 574 |
| 253 | Ga0070704_100001366 | 3300005549 | Bacteria | 12945 |
| 254 | Ga0070704_100021937 | 3300005549 | Bacteria | 4148 |
| 255 | Ga0070704_100912527 | 3300005549 | Bacteria | 791 |
| 256 | Ga0070704_101391183 | 3300005549 | Bacteria | 643 |
| 257 | Ga0068855_100023189 | 3300005563 | Bacteria | 7435 |
| 258 | Ga0068855_100030257 | 3300005563 | Bacteria | 6476 |
| 259 | Ga0068855_100053934 | 3300005563 | Bacteria | 4729 |
| 260 | Ga0068855_100076351 | 3300005563 | Bacteria | 3889 |
| 261 | Ga0068855_100111493 | 3300005563 | Bacteria | 3140 |
| 262 | Ga0070664_100002074 | 3300005564 | Bacteria | 16005 |
| 263 | Ga0070664_100051635 | 3300005564 | Bacteria | 3481 |
| 264 | Ga0068857_100003594 | 3300005577 | Bacteria | 12976 |
| 265 | Ga0068857_100038829 | 3300005577 | Bacteria | 4216 |
| 266 | Ga0068857_100079337 | 3300005577 | Bacteria | 2930 |
| 267 | Ga0068857_100700986 | 3300005577 | Bacteria | 962 |
| 268 | Ga0068854_100000749 | 3300005578 | Bacteria | 19195 |
| 269 | Ga0068854_100149360 | 3300005578 | Bacteria | 1800 |
| 270 | Ga0068854_100280698 | 3300005578 | Bacteria | 1341 |
| 271 | Ga0068854_100530192 | 3300005578 | Bacteria | 996 |
| 272 | Ga0068854_100851709 | 3300005578 | Bacteria | 798 |
| 273 | Ga0068856_100000902 | 3300005614 | Bacteria | 31812 |
| 274 | Ga0068856_100002049 | 3300005614 | Bacteria | 20920 |
| 275 | Ga0068856_100109437 | 3300005614 | Bacteria | 2759 |
| 276 | Ga0068856_100264284 | 3300005614 | Bacteria | 1736 |
| 277 | Ga0068856_100307468 | 3300005614 | Bacteria | 1603 |
| 278 | Ga0068856_100426777 | 3300005614 | Bacteria | 1346 |
| 279 | Ga0068856_100826939 | 3300005614 | Bacteria | 945 |
| 280 | Ga0070702_100007363 | 3300005615 | Bacteria | 5266 |
| 281 | Ga0070702_100115751 | 3300005615 | Bacteria | 1670 |
| 282 | Ga0070702_100302148 | 3300005615 | Bacteria | 1108 |
| 283 | Ga0070702_101456277 | 3300005615 | Bacteria | 562 |
| 284 | Ga0068852_100004111 | 3300005616 | Bacteria | 10239 |
| 285 | Ga0068852_100278911 | 3300005616 | Bacteria | 1610 |
| 286 | Ga0068852_100336671 | 3300005616 | Bacteria | 1470 |
| 287 | Ga0068852_100817534 | 3300005616 | Bacteria | 947 |
| 288 | Ga0068859_100006839 | 3300005617 | Bacteria | 11585 |
| 289 | Ga0068859_100151443 | 3300005617 | Bacteria | 2395 |
| 290 | Ga0068859_100188199 | 3300005617 | Bacteria | 2148 |
| 291 | Ga0068859_100696719 | 3300005617 | Bacteria | 1106 |
| 292 | Ga0068864_100000595 | 3300005618 | Bacteria | 30701 |
| 293 | Ga0068864_100801079 | 3300005618 | Bacteria | 926 |
| 294 | Ga0068864_100888443 | 3300005618 | Bacteria | 879 |
| 295 | Ga0068864_100981964 | 3300005618 | Bacteria | 837 |
| 296 | Ga0068864_101062893 | 3300005618 | Bacteria | 804 |
| 297 | Ga0068864_101502968 | 3300005618 | Bacteria | 676 |
| 298 | Ga0068866_10000834 | 3300005718 | Bacteria | 13673 |
| 299 | Ga0068866_10673148 | 3300005718 | Bacteria | 707 |
| 300 | Ga0068861_100000825 | 3300005719 | Bacteria | 18722 |
| 301 | Ga0068861_100102398 | 3300005719 | Bacteria | 2279 |
| 302 | Ga0068861_100224439 | 3300005719 | Bacteria | 1590 |
| 303 | Ga0068851_10294186 | 3300005834 | Bacteria | 932 |
| 304 | Ga0068870_10000112 | 3300005840 | Bacteria | 27710 |
| 305 | Ga0068863_100012849 | 3300005841 | Bacteria | 8075 |
| 306 | Ga0068863_101669683 | 3300005841 | Bacteria | 646 |
| 307 | Ga0068858_100025610 | 3300005842 | Bacteria | 5489 |
| 308 | Ga0068858_100042730 | 3300005842 | Bacteria | 4202 |
| 309 | Ga0068858_100064539 | 3300005842 | Bacteria | 3389 |
| 310 | Ga0068858_100112861 | 3300005842 | Bacteria | 2538 |
| 311 | Ga0068858_100521962 | 3300005842 | Bacteria | 1148 |
| 312 | Ga0068858_100875977 | 3300005842 | Bacteria | 877 |
| 313 | Ga0068860_100070125 | 3300005843 | Bacteria | 3332 |
| 314 | Ga0068860_100103943 | 3300005843 | Bacteria | 2711 |
| 315 | Ga0068860_100121365 | 3300005843 | Bacteria | 2502 |
| 316 | Ga0068860_100121893 | 3300005843 | Bacteria | 2497 |
| 317 | Ga0068860_100539527 | 3300005843 | Bacteria | 1168 |
| 318 | Ga0068862_100004649 | 3300005844 | Bacteria | 11570 |
| 319 | Ga0068862_100030534 | 3300005844 | Bacteria | 4542 |
| 320 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 321 | Ga0081455_10002425 | 3300005937 | Bacteria | 22245 |
| 322 | Ga0081455_10079670 | 3300005937 | Bacteria | 2688 |
| 323 | Ga0081455_10094886 | 3300005937 | Bacteria | 2409 |
| 324 | Ga0081538_10165839 | 3300005981 | Bacteria | 973 |
| 325 | Ga0081540_1135422 | 3300005983 | Bacteria | 998 |
| 326 | Ga0081539_10054428 | 3300005985 | Bacteria | 2234 |
| 327 | Ga0070717_10007139 | 3300006028 | Bacteria | 8279 |
| 328 | Ga0070717_10044826 | 3300006028 | Bacteria | 3614 |
| 329 | Ga0070717_10123210 | 3300006028 | Bacteria | 2223 |
| 330 | Ga0070717_10193261 | 3300006028 | Bacteria | 1779 |
| 331 | Ga0070717_10203149 | 3300006028 | Bacteria | 1736 |
| 332 | Ga0070717_10369763 | 3300006028 | Bacteria | 1284 |
| 333 | Ga0070717_10554722 | 3300006028 | Bacteria | 1041 |
| 334 | Ga0075365_10187528 | 3300006038 | Bacteria | 1447 |
| 335 | Ga0075365_10303004 | 3300006038 | Bacteria | 1125 |
| 336 | Ga0075365_10541360 | 3300006038 | Bacteria | 823 |
| 337 | Ga0075365_10649278 | 3300006038 | Bacteria | 746 |
| 338 | Ga0075368_10162971 | 3300006042 | Bacteria | 935 |
| 339 | Ga0075364_10214500 | 3300006051 | Bacteria | 1305 |
| 340 | Ga0075432_10070274 | 3300006058 | Bacteria | 1257 |
| 341 | Ga0070715_10002476 | 3300006163 | Bacteria | 5677 |
| 342 | Ga0070715_10051947 | 3300006163 | Bacteria | 1766 |
| 343 | Ga0070716_100000346 | 3300006173 | Bacteria | 18854 |
| 344 | Ga0070712_100123232 | 3300006175 | Bacteria | 1954 |
| 345 | Ga0070712_100188090 | 3300006175 | Bacteria | 1614 |
| 346 | Ga0070712_100305744 | 3300006175 | Bacteria | 1288 |
| 347 | Ga0070712_100332996 | 3300006175 | Bacteria | 1237 |
| 348 | Ga0070712_100421841 | 3300006175 | Bacteria | 1106 |
| 349 | Ga0075362_10073846 | 3300006177 | Bacteria | 1562 |
| 350 | Ga0075362_10240335 | 3300006177 | Bacteria | 889 |
| 351 | Ga0075367_10061301 | 3300006178 | Bacteria | 2245 |
| 352 | Ga0075367_10156657 | 3300006178 | Bacteria | 1415 |
| 353 | Ga0075367_10260480 | 3300006178 | Bacteria | 1088 |
| 354 | Ga0075427_10003839 | 3300006194 | Bacteria | 2097 |
| 355 | Ga0075366_10038100 | 3300006195 | Bacteria | 2839 |
| 356 | Ga0075366_10069373 | 3300006195 | Bacteria | 2098 |
| 357 | Ga0075366_10731434 | 3300006195 | Bacteria | 615 |
| 358 | Ga0097621_100000600 | 3300006237 | Bacteria | 25393 |
| 359 | Ga0097621_100008260 | 3300006237 | Bacteria | 7491 |
| 360 | Ga0097621_100083524 | 3300006237 | Bacteria | 2661 |
| 361 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 362 | Ga0068871_100003511 | 3300006358 | Bacteria | 10792 |
| 363 | Ga0068871_100068572 | 3300006358 | Bacteria | 2912 |
| 364 | Ga0075428_100006364 | 3300006844 | Bacteria | 13140 |
| 365 | Ga0075428_100414073 | 3300006844 | Bacteria | 1444 |
| 366 | Ga0075430_100000196 | 3300006846 | Bacteria | 40930 |
| 367 | Ga0075431_100001183 | 3300006847 | Bacteria | 23547 |
| 368 | Ga0075431_100030686 | 3300006847 | Bacteria | 5537 |
| 369 | Ga0075433_10000991 | 3300006852 | Bacteria | 20176 |
| 370 | Ga0075433_10058749 | 3300006852 | Bacteria | 3364 |
| 371 | Ga0075433_10138919 | 3300006852 | Bacteria | 2160 |
| 372 | Ga0075434_100006955 | 3300006871 | Bacteria | 10427 |
| 373 | Ga0075434_100080382 | 3300006871 | Bacteria | 3256 |
| 374 | Ga0075434_100156845 | 3300006871 | Bacteria | 2295 |
| 375 | Ga0075434_100165496 | 3300006871 | Bacteria | 2231 |
| 376 | Ga0075434_100622169 | 3300006871 | Bacteria | 1098 |
| 377 | Ga0075434_100876859 | 3300006871 | Bacteria | 912 |
| 378 | Ga0075434_101523690 | 3300006871 | Bacteria | 678 |
| 379 | Ga0075429_100000573 | 3300006880 | Bacteria | 28269 |
| 380 | Ga0068865_100002402 | 3300006881 | Bacteria | 11045 |
| 381 | Ga0068865_100205807 | 3300006881 | Bacteria | 1530 |
| 382 | Ga0068865_100909877 | 3300006881 | Bacteria | 766 |
| 383 | Ga0075436_100050481 | 3300006914 | Bacteria | 2871 |
| 384 | Ga0075436_100067120 | 3300006914 | Bacteria | 2479 |
| 385 | Ga0075436_100248187 | 3300006914 | Bacteria | 1267 |
| 386 | Ga0075436_100746364 | 3300006914 | Bacteria | 727 |
| 387 | Ga0097620_100006838 | 3300006931 | Bacteria | 11585 |
| 388 | Ga0097620_100151443 | 3300006931 | Bacteria | 2395 |
| 389 | Ga0097620_100188203 | 3300006931 | Bacteria | 2148 |
| 390 | Ga0097620_100696733 | 3300006931 | Bacteria | 1106 |
| 391 | Ga0097620_101682728 | 3300006931 | Bacteria | 701 |
| 392 | Ga0075435_100026184 | 3300007076 | Bacteria | 4547 |
| 393 | Ga0075435_100065161 | 3300007076 | Bacteria | 2961 |
| 394 | Ga0075435_100133219 | 3300007076 | Bacteria | 2080 |
| 395 | Ga0075435_100136316 | 3300007076 | Bacteria | 2057 |
| 396 | Ga0075435_101349340 | 3300007076 | Bacteria | 625 |
| 397 | Ga0099794_10036846 | 3300007265 | Bacteria | 2314 |
| 398 | Ga0099795_10096832 | 3300007788 | Bacteria | 1152 |
| 399 | Ga0105251_10049977 | 3300009011 | Bacteria | 1999 |
| 400 | Ga0105240_10001231 | 3300009093 | Bacteria | 44471 |
| 401 | Ga0105240_10015848 | 3300009093 | Bacteria | 10226 |
| 402 | Ga0105240_10029762 | 3300009093 | Bacteria | 7106 |
| 403 | Ga0105240_10189209 | 3300009093 | Bacteria | 2421 |
| 404 | Ga0105240_10322237 | 3300009093 | Bacteria | 1761 |
| 405 | Ga0111539_10000683 | 3300009094 | Bacteria | 43914 |
| 406 | Ga0111539_10004804 | 3300009094 | Bacteria | 17625 |
| 407 | Ga0111539_10106813 | 3300009094 | Bacteria | 3284 |
| 408 | Ga0111539_10619937 | 3300009094 | Bacteria | 1260 |
| 409 | Ga0111539_11562896 | 3300009094 | Bacteria | 765 |
| 410 | Ga0111539_12069171 | 3300009094 | Bacteria | 660 |
| 411 | Ga0105245_10001982 | 3300009098 | Bacteria | 18594 |
| 412 | Ga0105245_10032623 | 3300009098 | Bacteria | 4610 |
| 413 | Ga0105245_10064026 | 3300009098 | Bacteria | 3323 |
| 414 | Ga0105245_10069436 | 3300009098 | Bacteria | 3195 |
| 415 | Ga0105245_10833457 | 3300009098 | Bacteria | 962 |
| 416 | Ga0105245_10880734 | 3300009098 | Bacteria | 936 |
| 417 | Ga0105247_10024545 | 3300009101 | Bacteria | 3634 |
| 418 | Ga0105247_10405179 | 3300009101 | Bacteria | 973 |
| 419 | Ga0105247_10672767 | 3300009101 | Bacteria | 776 |
| 420 | Ga0105247_11052898 | 3300009101 | Bacteria | 639 |
| 421 | Ga0114129_10008352 | 3300009147 | Bacteria | 14760 |
| 422 | Ga0114129_10056000 | 3300009147 | Bacteria | 5525 |
| 423 | Ga0114129_10365952 | 3300009147 | Bacteria | 1907 |
| 424 | Ga0114129_10519926 | 3300009147 | Bacteria | 1552 |
| 425 | Ga0114129_10912257 | 3300009147 | Bacteria | 1112 |
| 426 | Ga0114129_11186942 | 3300009147 | Bacteria | 951 |
| 427 | Ga0114129_11380762 | 3300009147 | Bacteria | 870 |
| 428 | Ga0105243_10002278 | 3300009148 | Bacteria | 16096 |
| 429 | Ga0105243_10107190 | 3300009148 | Bacteria | 2330 |
| 430 | Ga0105243_10116075 | 3300009148 | Bacteria | 2248 |
| 431 | Ga0105243_10244414 | 3300009148 | Bacteria | 1599 |
| 432 | Ga0105243_11548818 | 3300009148 | Bacteria | 688 |
| 433 | Ga0105243_11864334 | 3300009148 | Bacteria | 633 |
| 434 | Ga0105241_10015281 | 3300009174 | Bacteria | 5623 |
| 435 | Ga0105241_10019842 | 3300009174 | Bacteria | 4961 |
| 436 | Ga0105241_10060378 | 3300009174 | Bacteria | 2917 |
| 437 | Ga0105241_10116351 | 3300009174 | Bacteria | 2147 |
| 438 | Ga0105241_10619995 | 3300009174 | Bacteria | 979 |
| 439 | Ga0105242_10009023 | 3300009176 | Bacteria | 7661 |
| 440 | Ga0105242_10033184 | 3300009176 | Bacteria | 4132 |
| 441 | Ga0105242_10105043 | 3300009176 | Bacteria | 2398 |
| 442 | Ga0105242_10434627 | 3300009176 | Bacteria | 1233 |
| 443 | Ga0105248_10078593 | 3300009177 | Bacteria | 3708 |
| 444 | Ga0105248_10118525 | 3300009177 | Bacteria | 2986 |
| 445 | Ga0105248_10311914 | 3300009177 | Bacteria | 1772 |
| 446 | Ga0105248_10640192 | 3300009177 | Bacteria | 1200 |
| 447 | Ga0105248_10974446 | 3300009177 | Bacteria | 958 |
| 448 | Ga0105248_11046118 | 3300009177 | Bacteria | 922 |
| 449 | Ga0105248_12079175 | 3300009177 | Bacteria | 646 |
| 450 | Ga0105237_10003253 | 3300009545 | Bacteria | 19420 |
| 451 | Ga0105237_10199230 | 3300009545 | Bacteria | 2002 |
| 452 | Ga0105237_11107575 | 3300009545 | Bacteria | 799 |
| 453 | Ga0105238_10001939 | 3300009551 | Bacteria | 20807 |
| 454 | Ga0105238_10125323 | 3300009551 | Bacteria | 2548 |
| 455 | Ga0105238_10311988 | 3300009551 | Bacteria | 1558 |
| 456 | Ga0105238_10329696 | 3300009551 | Bacteria | 1513 |
| 457 | Ga0105238_10402467 | 3300009551 | Bacteria | 1362 |
| 458 | Ga0105238_11668683 | 3300009551 | Bacteria | 668 |
| 459 | Ga0105249_10001021 | 3300009553 | Bacteria | 24754 |
| 460 | Ga0105249_10097100 | 3300009553 | Bacteria | 2765 |
| 461 | Ga0105249_10399539 | 3300009553 | Bacteria | 1404 |
| 462 | Ga0105249_11874339 | 3300009553 | Bacteria | 672 |
| 463 | Ga0105035_124906 | 3300009988 | Bacteria | 576 |
| 464 | Ga0105239_10024925 | 3300010375 | Bacteria | 6588 |
| 465 | Ga0105239_10053067 | 3300010375 | Bacteria | 4447 |
| 466 | Ga0105239_10071533 | 3300010375 | Bacteria | 3810 |
| 467 | Ga0105239_10918552 | 3300010375 | Bacteria | 1005 |
| 468 | Ga0105239_11000590 | 3300010375 | Bacteria | 961 |
| 469 | Ga0105239_11100845 | 3300010375 | Bacteria | 914 |
| 470 | Ga0105239_11672828 | 3300010375 | Bacteria | 736 |
| 471 | Ga0105239_11676315 | 3300010375 | Bacteria | 736 |
| 472 | Ga0105239_12004665 | 3300010375 | Bacteria | 672 |
| 473 | Ga0105246_10007532 | 3300011119 | Bacteria | 6678 |
| 474 | Ga0105246_10034231 | 3300011119 | Bacteria | 3383 |
| 475 | Ga0105246_10133537 | 3300011119 | Bacteria | 1857 |
| 476 | Ga0105246_10199036 | 3300011119 | Bacteria | 1556 |
| 477 | Ga0105246_10533487 | 3300011119 | Bacteria | 1003 |
| 478 | Ga0105246_10963115 | 3300011119 | Bacteria | 770 |
| 479 | Ga0105246_11375884 | 3300011119 | Bacteria | 657 |
| 480 | Ga0157340_1002355 | 3300012473 | Bacteria | 957 |
| 481 | Ga0157340_1005064 | 3300012473 | Bacteria | 785 |
| 482 | Ga0157317_1006105 | 3300012475 | Bacteria | 832 |
| 483 | Ga0157337_1001743 | 3300012483 | Bacteria | 1161 |
| 484 | Ga0157335_1001290 | 3300012492 | Bacteria | 1348 |
| 485 | Ga0157319_1000744 | 3300012497 | Bacteria | 1525 |
| 486 | Ga0157314_1004810 | 3300012500 | Bacteria | 1005 |
| 487 | Ga0157347_1033880 | 3300012502 | Bacteria | 651 |
| 488 | Ga0157316_1009216 | 3300012510 | Bacteria | 881 |
| 489 | Ga0157326_1014555 | 3300012513 | Bacteria | 916 |
| 490 | Ga0157373_10000820 | 3300013100 | Bacteria | 24076 |
| 491 | Ga0157373_10038612 | 3300013100 | Bacteria | 3422 |
| 492 | Ga0157373_10087904 | 3300013100 | Bacteria | 2190 |
| 493 | Ga0157373_10230947 | 3300013100 | Bacteria | 1306 |
| 494 | Ga0157373_10290017 | 3300013100 | Bacteria | 1160 |
| 495 | Ga0157373_10779500 | 3300013100 | Bacteria | 704 |
| 496 | Ga0157373_11315958 | 3300013100 | Bacteria | 547 |
| 497 | Ga0157371_10056689 | 3300013102 | Bacteria | 2779 |
| 498 | Ga0157371_10107692 | 3300013102 | Bacteria | 1978 |
| 499 | Ga0157371_10363406 | 3300013102 | Bacteria | 1055 |
| 500 | Ga0157371_10567848 | 3300013102 | Bacteria | 842 |
| 501 | Ga0157370_10003448 | 3300013104 | Bacteria | 18559 |
| 502 | Ga0157370_10140736 | 3300013104 | Bacteria | 2248 |
| 503 | Ga0157370_10335875 | 3300013104 | Bacteria | 1393 |
| 504 | Ga0157370_10697307 | 3300013104 | Bacteria | 927 |
| 505 | Ga0157369_10001535 | 3300013105 | Bacteria | 28280 |
| 506 | Ga0157369_10202540 | 3300013105 | Bacteria | 2083 |
| 507 | Ga0157369_11317466 | 3300013105 | Bacteria | 736 |
| 508 | Ga0157369_12025311 | 3300013105 | Bacteria | 584 |
| 509 | Ga0157374_10066829 | 3300013296 | Bacteria | 3379 |
| 510 | Ga0157374_10125118 | 3300013296 | Bacteria | 2485 |
| 511 | Ga0157374_10140434 | 3300013296 | Bacteria | 2345 |
| 512 | Ga0157374_10188020 | 3300013296 | Bacteria | 2020 |
| 513 | Ga0157374_10232705 | 3300013296 | Bacteria | 1810 |
| 514 | Ga0157374_10845647 | 3300013296 | Bacteria | 932 |
| 515 | Ga0157374_11962262 | 3300013296 | Bacteria | 611 |
| 516 | Ga0157378_10057104 | 3300013297 | Bacteria | 3478 |
| 517 | Ga0157378_11067825 | 3300013297 | Bacteria | 844 |
| 518 | Ga0157378_11280230 | 3300013297 | Bacteria | 774 |
| 519 | Ga0157378_11375064 | 3300013297 | Bacteria | 748 |
| 520 | Ga0163162_10009279 | 3300013306 | Bacteria | 9569 |
| 521 | Ga0163162_10020735 | 3300013306 | Bacteria | 6461 |
| 522 | Ga0163162_10172801 | 3300013306 | Bacteria | 2285 |
| 523 | Ga0163162_10267056 | 3300013306 | Bacteria | 1842 |
| 524 | Ga0163162_10464185 | 3300013306 | Bacteria | 1398 |
| 525 | Ga0163162_11944940 | 3300013306 | Bacteria | 673 |
| 526 | Ga0157372_10008268 | 3300013307 | Bacteria | 11062 |
| 527 | Ga0157372_10210305 | 3300013307 | Bacteria | 2254 |
| 528 | Ga0157372_11971534 | 3300013307 | Bacteria | 671 |
| 529 | Ga0157375_10044270 | 3300013308 | Bacteria | 4323 |
| 530 | Ga0163163_10060628 | 3300014325 | Bacteria | 3747 |
| 531 | Ga0163163_10116861 | 3300014325 | Bacteria | 2699 |
| 532 | Ga0163163_10382703 | 3300014325 | Bacteria | 1465 |
| 533 | Ga0163163_10542471 | 3300014325 | Bacteria | 1225 |
| 534 | Ga0163163_11759736 | 3300014325 | Bacteria | 680 |
| 535 | Ga0163163_13027782 | 3300014325 | Bacteria | 524 |
| 536 | Ga0157380_10026178 | 3300014326 | Bacteria | 4428 |
| 537 | Ga0157380_10163009 | 3300014326 | Bacteria | 1940 |
| 538 | Ga0157380_10198955 | 3300014326 | Bacteria | 1776 |
| 539 | Ga0157380_10255117 | 3300014326 | Bacteria | 1590 |
| 540 | Ga0157380_10518613 | 3300014326 | Bacteria | 1162 |
| 541 | Ga0157380_10733136 | 3300014326 | Bacteria | 997 |
| 542 | Ga0157380_10972099 | 3300014326 | Bacteria | 880 |
| 543 | Ga0157380_11032515 | 3300014326 | Bacteria | 857 |
| 544 | Ga0157379_10007681 | 3300014968 | Bacteria | 9336 |
| 545 | Ga0157379_10074738 | 3300014968 | Bacteria | 3033 |
| 546 | Ga0157379_10094699 | 3300014968 | Bacteria | 2680 |
| 547 | Ga0157379_10169891 | 3300014968 | Bacteria | 1968 |
| 548 | Ga0157379_12084888 | 3300014968 | Bacteria | 562 |
| 549 | Ga0157376_10025272 | 3300014969 | Bacteria | 4676 |
| 550 | Ga0157376_10095317 | 3300014969 | Bacteria | 2588 |
| 551 | Ga0157376_10135960 | 3300014969 | Bacteria | 2200 |
| 552 | Ga0157376_10207521 | 3300014969 | Bacteria | 1807 |
| 553 | Ga0157376_12201688 | 3300014969 | Bacteria | 590 |
| 554 | Ga0182007_10293798 | 3300015262 | Bacteria | 595 |
| 555 | Ga0163161_10000415 | 3300017792 | Bacteria | 35797 |
| 556 | Ga0163161_11575846 | 3300017792 | Bacteria | 579 |
| 557 | Ga0197907_10403598 | 3300020069 | Bacteria | 910 |
| 558 | Ga0197907_10450514 | 3300020069 | Bacteria | 1247 |
| 559 | Ga0206356_10699909 | 3300020070 | Bacteria | 619 |
| 560 | Ga0206356_11260616 | 3300020070 | Bacteria | 1900 |
| 561 | Ga0206356_11379387 | 3300020070 | Bacteria | 562 |
| 562 | Ga0206355_1694710 | 3300020076 | Bacteria | 1165 |
| 563 | Ga0206352_10038065 | 3300020078 | Bacteria | 510 |
| 564 | Ga0206352_10652386 | 3300020078 | Bacteria | 698 |
| 565 | Ga0206352_10824787 | 3300020078 | Bacteria | 1151 |
| 566 | Ga0206352_11021523 | 3300020078 | Bacteria | 559 |
| 567 | Ga0206350_11469831 | 3300020080 | Bacteria | 655 |
| 568 | Ga0206354_10362155 | 3300020081 | Bacteria | 637 |
| 569 | Ga0206353_10245002 | 3300020082 | Bacteria | 798 |
| 570 | Ga0206353_10402798 | 3300020082 | Bacteria | 680 |
| 571 | Ga0154015_1621370 | 3300020610 | Bacteria | 1064 |
| 572 | Ga0213872_10049499 | 3300021361 | Bacteria | 1909 |
| 573 | Ga0213872_10110389 | 3300021361 | Bacteria | 1222 |
| 574 | Ga0213874_10101088 | 3300021377 | Bacteria | 958 |
| 575 | Ga0213876_10000421 | 3300021384 | Bacteria | 35344 |
| 576 | Ga0224712_10200510 | 3300022467 | Bacteria | 907 |
| 577 | Ga0207666_1000073 | 3300025271 | Bacteria | 16742 |
| 578 | Ga0207666_1011580 | 3300025271 | Bacteria | 1221 |
| 579 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 580 | Ga0209758_1000548 | 3300025297 | Bacteria | 59657 |
| 581 | Ga0209758_1052742 | 3300025297 | Bacteria | 1403 |
| 582 | Ga0207426_1024287 | 3300025302 | Bacteria | 2059 |
| 583 | Ga0207697_10024143 | 3300025315 | Bacteria | 2490 |
| 584 | Ga0207697_10024296 | 3300025315 | Bacteria | 2481 |
| 585 | Ga0207656_10051797 | 3300025321 | Bacteria | 1776 |
| 586 | Ga0207656_10503287 | 3300025321 | Bacteria | 615 |
| 587 | Ga0207713_1112270 | 3300025735 | Bacteria | 925 |
| 588 | Ga0207653_10002714 | 3300025885 | Bacteria | 5629 |
| 589 | Ga0207653_10052962 | 3300025885 | Bacteria | 1355 |
| 590 | Ga0207682_10000350 | 3300025893 | Bacteria | 21096 |
| 591 | Ga0207692_10009320 | 3300025898 | Bacteria | 4094 |
| 592 | Ga0207692_10047506 | 3300025898 | Bacteria | 2156 |
| 593 | Ga0207692_10679238 | 3300025898 | Bacteria | 667 |
| 594 | Ga0207642_10000638 | 3300025899 | Bacteria | 10749 |
| 595 | Ga0207642_10112122 | 3300025899 | Bacteria | 1391 |
| 596 | Ga0207642_10531658 | 3300025899 | Bacteria | 724 |
| 597 | Ga0207710_10127171 | 3300025900 | Bacteria | 1222 |
| 598 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 599 | Ga0207688_10073044 | 3300025901 | Bacteria | 1949 |
| 600 | Ga0207688_10230680 | 3300025901 | Bacteria | 1117 |
| 601 | Ga0207680_10026966 | 3300025903 | Bacteria | 3191 |
| 602 | Ga0207680_10075759 | 3300025903 | Bacteria | 2099 |
| 603 | Ga0207647_10002852 | 3300025904 | Bacteria | 13027 |
| 604 | Ga0207647_10065304 | 3300025904 | Bacteria | 2210 |
| 605 | Ga0207685_10049007 | 3300025905 | Bacteria | 1621 |
| 606 | Ga0207685_10170302 | 3300025905 | Bacteria | 1002 |
| 607 | Ga0207685_10191194 | 3300025905 | Bacteria | 956 |
| 608 | Ga0207685_10366055 | 3300025905 | Bacteria | 731 |
| 609 | Ga0207699_10002264 | 3300025906 | Bacteria | 9081 |
| 610 | Ga0207699_10048706 | 3300025906 | Bacteria | 2490 |
| 611 | Ga0207699_10125854 | 3300025906 | Bacteria | 1664 |
| 612 | Ga0207699_10285012 | 3300025906 | Bacteria | 1149 |
| 613 | Ga0207699_10442126 | 3300025906 | Bacteria | 931 |
| 614 | Ga0207699_10640397 | 3300025906 | Bacteria | 776 |
| 615 | Ga0207699_11106439 | 3300025906 | Bacteria | 586 |
| 616 | Ga0207645_10000222 | 3300025907 | Bacteria | 47139 |
| 617 | Ga0207645_10065550 | 3300025907 | Bacteria | 2321 |
| 618 | Ga0207645_10405126 | 3300025907 | Bacteria | 918 |
| 619 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 620 | Ga0207643_10732483 | 3300025908 | Bacteria | 640 |
| 621 | Ga0207705_10005544 | 3300025909 | Bacteria | 9436 |
| 622 | Ga0207654_10053603 | 3300025911 | Bacteria | 2329 |
| 623 | Ga0207654_10123061 | 3300025911 | Bacteria | 1632 |
| 624 | Ga0207654_10243534 | 3300025911 | Bacteria | 1203 |
| 625 | Ga0207707_10009792 | 3300025912 | Bacteria | 8311 |
| 626 | Ga0207707_10027971 | 3300025912 | Bacteria | 4930 |
| 627 | Ga0207707_10034403 | 3300025912 | Bacteria | 4433 |
| 628 | Ga0207707_10045417 | 3300025912 | Bacteria | 3828 |
| 629 | Ga0207707_10229371 | 3300025912 | Bacteria | 1616 |
| 630 | Ga0207707_10267476 | 3300025912 | Bacteria | 1482 |
| 631 | Ga0207707_11101696 | 3300025912 | Bacteria | 647 |
| 632 | Ga0207707_11109240 | 3300025912 | Bacteria | 644 |
| 633 | Ga0207695_10001037 | 3300025913 | Bacteria | 48830 |
| 634 | Ga0207695_10012684 | 3300025913 | Bacteria | 10093 |
| 635 | Ga0207695_10120619 | 3300025913 | Bacteria | 2591 |
| 636 | Ga0207695_10161789 | 3300025913 | Bacteria | 2169 |
| 637 | Ga0207695_10497021 | 3300025913 | Bacteria | 1102 |
| 638 | Ga0207671_10041568 | 3300025914 | Bacteria | 3403 |
| 639 | Ga0207671_10186930 | 3300025914 | Bacteria | 1614 |
| 640 | Ga0207693_10004694 | 3300025915 | Bacteria | 11503 |
| 641 | Ga0207693_10028016 | 3300025915 | Bacteria | 4452 |
| 642 | Ga0207693_10074737 | 3300025915 | Bacteria | 2654 |
| 643 | Ga0207693_10161048 | 3300025915 | Bacteria | 1765 |
| 644 | Ga0207693_10346813 | 3300025915 | Bacteria | 1162 |
| 645 | Ga0207693_10817221 | 3300025915 | Bacteria | 718 |
| 646 | Ga0207663_10017267 | 3300025916 | Bacteria | 4017 |
| 647 | Ga0207663_10121328 | 3300025916 | Bacteria | 1791 |
| 648 | Ga0207663_10123374 | 3300025916 | Bacteria | 1777 |
| 649 | Ga0207663_10157314 | 3300025916 | Bacteria | 1600 |
| 650 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 651 | Ga0207660_10016311 | 3300025917 | Bacteria | 4916 |
| 652 | Ga0207660_10019663 | 3300025917 | Bacteria | 4519 |
| 653 | Ga0207660_10023826 | 3300025917 | Bacteria | 4138 |
| 654 | Ga0207660_10352527 | 3300025917 | Bacteria | 1179 |
| 655 | Ga0207660_10669287 | 3300025917 | Bacteria | 846 |
| 656 | Ga0207660_11581187 | 3300025917 | Bacteria | 529 |
| 657 | Ga0207662_10028451 | 3300025918 | Bacteria | 3231 |
| 658 | Ga0207662_10154682 | 3300025918 | Bacteria | 1461 |
| 659 | Ga0207662_10740236 | 3300025918 | Bacteria | 691 |
| 660 | Ga0207657_10044442 | 3300025919 | Bacteria | 3905 |
| 661 | Ga0207657_10055996 | 3300025919 | Bacteria | 3404 |
| 662 | Ga0207657_10104175 | 3300025919 | Bacteria | 2351 |
| 663 | Ga0207657_10107088 | 3300025919 | Bacteria | 2313 |
| 664 | Ga0207657_10151486 | 3300025919 | Bacteria | 1889 |
| 665 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 666 | Ga0207649_10091718 | 3300025920 | Bacteria | 1990 |
| 667 | Ga0207649_10104851 | 3300025920 | Bacteria | 1878 |
| 668 | Ga0207649_10383648 | 3300025920 | Bacteria | 1048 |
| 669 | Ga0207652_10001438 | 3300025921 | Bacteria | 21098 |
| 670 | Ga0207652_10013408 | 3300025921 | Bacteria | 6634 |
| 671 | Ga0207652_10071805 | 3300025921 | Bacteria | 3008 |
| 672 | Ga0207652_10096158 | 3300025921 | Bacteria | 2609 |
| 673 | Ga0207652_10269135 | 3300025921 | Bacteria | 1537 |
| 674 | Ga0207652_10440775 | 3300025921 | Bacteria | 1174 |
| 675 | Ga0207652_11272228 | 3300025921 | Bacteria | 638 |
| 676 | Ga0207646_10045479 | 3300025922 | Bacteria | 3941 |
| 677 | Ga0207681_10002118 | 3300025923 | Bacteria | 12708 |
| 678 | Ga0207681_10126410 | 3300025923 | Bacteria | 1883 |
| 679 | Ga0207694_10085177 | 3300025924 | Bacteria | 2487 |
| 680 | Ga0207694_10151947 | 3300025924 | Bacteria | 1866 |
| 681 | Ga0207694_10227025 | 3300025924 | Bacteria | 1524 |
| 682 | Ga0207694_10969752 | 3300025924 | Bacteria | 719 |
| 683 | Ga0207650_10068752 | 3300025925 | Bacteria | 2660 |
| 684 | Ga0207650_10444364 | 3300025925 | Bacteria | 1078 |
| 685 | Ga0207650_10801544 | 3300025925 | Bacteria | 798 |
| 686 | Ga0207659_10000132 | 3300025926 | Bacteria | 43798 |
| 687 | Ga0207687_10000174 | 3300025927 | Bacteria | 42351 |
| 688 | Ga0207687_10104768 | 3300025927 | Bacteria | 2089 |
| 689 | Ga0207700_10029101 | 3300025928 | Bacteria | 3894 |
| 690 | Ga0207700_10071813 | 3300025928 | Bacteria | 2666 |
| 691 | Ga0207700_10114416 | 3300025928 | Bacteria | 2177 |
| 692 | Ga0207700_10229483 | 3300025928 | Bacteria | 1577 |
| 693 | Ga0207700_10256038 | 3300025928 | Bacteria | 1497 |
| 694 | Ga0207700_10476709 | 3300025928 | Bacteria | 1102 |
| 695 | Ga0207700_10694273 | 3300025928 | Bacteria | 908 |
| 696 | Ga0207700_11079816 | 3300025928 | Bacteria | 718 |
| 697 | Ga0207664_10000478 | 3300025929 | Bacteria | 28408 |
| 698 | Ga0207664_10006275 | 3300025929 | Bacteria | 8170 |
| 699 | Ga0207664_10072425 | 3300025929 | Bacteria | 2778 |
| 700 | Ga0207664_10197031 | 3300025929 | Bacteria | 1737 |
| 701 | Ga0207664_10208600 | 3300025929 | Bacteria | 1689 |
| 702 | Ga0207664_10286647 | 3300025929 | Bacteria | 1446 |
| 703 | Ga0207664_10456449 | 3300025929 | Bacteria | 1141 |
| 704 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 705 | Ga0207644_10451134 | 3300025931 | Bacteria | 1056 |
| 706 | Ga0207690_10001288 | 3300025932 | Bacteria | 15841 |
| 707 | Ga0207690_10302921 | 3300025932 | Bacteria | 1251 |
| 708 | Ga0207690_11858231 | 3300025932 | Bacteria | 503 |
| 709 | Ga0207706_10041870 | 3300025933 | Bacteria | 4059 |
| 710 | Ga0207706_10063219 | 3300025933 | Bacteria | 3259 |
| 711 | Ga0207706_10101430 | 3300025933 | Bacteria | 2532 |
| 712 | Ga0207706_10162826 | 3300025933 | Bacteria | 1961 |
| 713 | Ga0207706_11321384 | 3300025933 | Bacteria | 595 |
| 714 | Ga0207686_10001289 | 3300025934 | Bacteria | 14380 |
| 715 | Ga0207686_10147807 | 3300025934 | Bacteria | 1632 |
| 716 | Ga0207686_10423954 | 3300025934 | Bacteria | 1018 |
| 717 | Ga0207686_10595939 | 3300025934 | Bacteria | 869 |
| 718 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 719 | Ga0207709_10215518 | 3300025935 | Bacteria | 1381 |
| 720 | Ga0207670_10000523 | 3300025936 | Bacteria | 21171 |
| 721 | Ga0207670_10108831 | 3300025936 | Bacteria | 1993 |
| 722 | Ga0207670_10266778 | 3300025936 | Bacteria | 1329 |
| 723 | Ga0207669_10000235 | 3300025937 | Bacteria | 25138 |
| 724 | Ga0207669_10078273 | 3300025937 | Bacteria | 2106 |
| 725 | Ga0207669_11208647 | 3300025937 | Bacteria | 640 |
| 726 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 727 | Ga0207704_10204288 | 3300025938 | Bacteria | 1449 |
| 728 | Ga0207704_10335882 | 3300025938 | Bacteria | 1171 |
| 729 | Ga0207704_10453855 | 3300025938 | Bacteria | 1024 |
| 730 | Ga0207665_10000273 | 3300025939 | Bacteria | 35752 |
| 731 | Ga0207665_10052174 | 3300025939 | Bacteria | 2755 |
| 732 | Ga0207665_10065544 | 3300025939 | Bacteria | 2470 |
| 733 | Ga0207665_10196776 | 3300025939 | Bacteria | 1467 |
| 734 | Ga0207665_10276631 | 3300025939 | Bacteria | 1248 |
| 735 | Ga0207691_10000517 | 3300025940 | Bacteria | 38398 |
| 736 | Ga0207691_10057922 | 3300025940 | Bacteria | 3525 |
| 737 | Ga0207691_10619330 | 3300025940 | Bacteria | 916 |
| 738 | Ga0207711_10006368 | 3300025941 | Bacteria | 9949 |
| 739 | Ga0207711_10011248 | 3300025941 | Bacteria | 7435 |
| 740 | Ga0207711_10127471 | 3300025941 | Bacteria | 2278 |
| 741 | Ga0207711_10857677 | 3300025941 | Bacteria | 845 |
| 742 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 743 | Ga0207689_10388743 | 3300025942 | Bacteria | 1162 |
| 744 | Ga0207661_10001228 | 3300025944 | Bacteria | 17172 |
| 745 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 746 | Ga0207679_10192673 | 3300025945 | Bacteria | 1696 |
| 747 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 748 | Ga0207667_10012207 | 3300025949 | Bacteria | 9924 |
| 749 | Ga0207667_10039092 | 3300025949 | Bacteria | 5059 |
| 750 | Ga0207667_10062790 | 3300025949 | Bacteria | 3883 |
| 751 | Ga0207667_10255836 | 3300025949 | Bacteria | 1791 |
| 752 | Ga0207667_11524714 | 3300025949 | Bacteria | 639 |
| 753 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 754 | Ga0207651_10067548 | 3300025960 | Bacteria | 2516 |
| 755 | Ga0207651_10567714 | 3300025960 | Bacteria | 988 |
| 756 | Ga0207651_11168551 | 3300025960 | Bacteria | 690 |
| 757 | Ga0207712_10000738 | 3300025961 | Bacteria | 24767 |
| 758 | Ga0207712_10048716 | 3300025961 | Bacteria | 2949 |
| 759 | Ga0207712_10206744 | 3300025961 | Bacteria | 1560 |
| 760 | Ga0207668_10000664 | 3300025972 | Bacteria | 21087 |
| 761 | Ga0207668_10200896 | 3300025972 | Bacteria | 1587 |
| 762 | Ga0207668_10423622 | 3300025972 | Bacteria | 1130 |
| 763 | Ga0207640_10000343 | 3300025981 | Bacteria | 30767 |
| 764 | Ga0207640_10130022 | 3300025981 | Bacteria | 1819 |
| 765 | Ga0207640_10521555 | 3300025981 | Bacteria | 993 |
| 766 | Ga0207640_11040293 | 3300025981 | Bacteria | 722 |
| 767 | Ga0207658_10057127 | 3300025986 | Bacteria | 2898 |
| 768 | Ga0207658_10193076 | 3300025986 | Bacteria | 1694 |
| 769 | Ga0207658_10498259 | 3300025986 | Bacteria | 1084 |
| 770 | Ga0207677_10010253 | 3300026023 | Bacteria | 5297 |
| 771 | Ga0207677_10018951 | 3300026023 | Bacteria | 4144 |
| 772 | Ga0207677_11423901 | 3300026023 | Bacteria | 639 |
| 773 | Ga0207703_10002904 | 3300026035 | Bacteria | 14594 |
| 774 | Ga0207703_10028495 | 3300026035 | Bacteria | 4403 |
| 775 | Ga0207703_10036270 | 3300026035 | Bacteria | 3924 |
| 776 | Ga0207703_10266721 | 3300026035 | Bacteria | 1550 |
| 777 | Ga0207703_10420806 | 3300026035 | Bacteria | 1243 |
| 778 | Ga0207703_11572392 | 3300026035 | Bacteria | 633 |
| 779 | Ga0207639_10001257 | 3300026041 | Bacteria | 17164 |
| 780 | Ga0207639_10017714 | 3300026041 | Bacteria | 5051 |
| 781 | Ga0207639_10635906 | 3300026041 | Bacteria | 986 |
| 782 | Ga0207639_10913062 | 3300026041 | Bacteria | 821 |
| 783 | Ga0207678_10060468 | 3300026067 | Bacteria | 3259 |
| 784 | Ga0207678_10131444 | 3300026067 | Bacteria | 2136 |
| 785 | Ga0207678_10136346 | 3300026067 | Bacteria | 2094 |
| 786 | Ga0207678_10492824 | 3300026067 | Bacteria | 1068 |
| 787 | Ga0207678_10670144 | 3300026067 | Bacteria | 912 |
| 788 | Ga0207708_10048142 | 3300026075 | Bacteria | 3245 |
| 789 | Ga0207708_10065374 | 3300026075 | Bacteria | 2780 |
| 790 | Ga0207708_10093062 | 3300026075 | Bacteria | 2327 |
| 791 | Ga0207708_10481178 | 3300026075 | Bacteria | 1038 |
| 792 | Ga0207702_10003284 | 3300026078 | Bacteria | 14915 |
| 793 | Ga0207702_10011946 | 3300026078 | Bacteria | 7224 |
| 794 | Ga0207702_10088550 | 3300026078 | Bacteria | 2705 |
| 795 | Ga0207702_10333595 | 3300026078 | Bacteria | 1447 |
| 796 | Ga0207702_10518368 | 3300026078 | Bacteria | 1164 |
| 797 | Ga0207702_11557403 | 3300026078 | Bacteria | 654 |
| 798 | Ga0207641_10001831 | 3300026088 | Bacteria | 20447 |
| 799 | Ga0207641_10041398 | 3300026088 | Bacteria | 3860 |
| 800 | Ga0207641_11175904 | 3300026088 | Bacteria | 766 |
| 801 | Ga0207648_10000581 | 3300026089 | Bacteria | 41019 |
| 802 | Ga0207648_10097104 | 3300026089 | Bacteria | 2579 |
| 803 | Ga0207648_10205752 | 3300026089 | Bacteria | 1747 |
| 804 | Ga0207648_10206868 | 3300026089 | Bacteria | 1741 |
| 805 | Ga0207648_10370771 | 3300026089 | Bacteria | 1293 |
| 806 | Ga0207648_10505893 | 3300026089 | Bacteria | 1106 |
| 807 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 808 | Ga0207676_10048665 | 3300026095 | Bacteria | 3292 |
| 809 | Ga0207676_10420265 | 3300026095 | Bacteria | 1254 |
| 810 | Ga0207676_10486636 | 3300026095 | Bacteria | 1169 |
| 811 | Ga0207674_10001605 | 3300026116 | Bacteria | 29115 |
| 812 | Ga0207674_10128096 | 3300026116 | Bacteria | 2503 |
| 813 | Ga0207674_10201166 | 3300026116 | Bacteria | 1941 |
| 814 | Ga0207675_100000414 | 3300026118 | Bacteria | 41042 |
| 815 | Ga0207675_100065029 | 3300026118 | Bacteria | 3409 |
| 816 | Ga0207675_100141370 | 3300026118 | Bacteria | 2287 |
| 817 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 818 | Ga0207683_10012573 | 3300026121 | Bacteria | 7222 |
| 819 | Ga0207683_10086140 | 3300026121 | Bacteria | 2793 |
| 820 | Ga0207683_10970737 | 3300026121 | Bacteria | 789 |
| 821 | Ga0207698_10000951 | 3300026142 | Bacteria | 16837 |
| 822 | Ga0207698_10719028 | 3300026142 | Bacteria | 995 |
| 823 | Ga0207698_11025287 | 3300026142 | Bacteria | 836 |
| 824 | Ga0207698_11214340 | 3300026142 | Bacteria | 768 |
| 825 | Ga0207698_11290832 | 3300026142 | Bacteria | 745 |
| 826 | Ga0207698_11732545 | 3300026142 | Bacteria | 640 |
| 827 | Ga0207698_12697065 | 3300026142 | Bacteria | 506 |
| 828 | Ga0209973_1017621 | 3300027252 | Bacteria | 920 |
| 829 | Ga0209973_1024243 | 3300027252 | Bacteria | 825 |
| 830 | Ga0209969_1038746 | 3300027360 | Bacteria | 738 |
| 831 | Ga0209996_1011196 | 3300027395 | Bacteria | 1196 |
| 832 | Ga0209995_1021592 | 3300027471 | Bacteria | 1067 |
| 833 | Ga0209995_1036100 | 3300027471 | Bacteria | 831 |
| 834 | Ga0209179_1000116 | 3300027512 | Bacteria | 9269 |
| 835 | Ga0209982_1008297 | 3300027552 | Bacteria | 1522 |
| 836 | Ga0209970_1004927 | 3300027614 | Bacteria | 2208 |
| 837 | Ga0210002_1001458 | 3300027617 | Bacteria | 3340 |
| 838 | Ga0209983_1086438 | 3300027665 | Bacteria | 705 |
| 839 | Ga0209588_1021222 | 3300027671 | Bacteria | 2038 |
| 840 | Ga0209971_1039672 | 3300027682 | Bacteria | 1133 |
| 841 | Ga0209966_1000641 | 3300027695 | Bacteria | 7848 |
| 842 | Ga0209998_10011991 | 3300027717 | Bacteria | 1800 |
| 843 | Ga0209998_10029104 | 3300027717 | Bacteria | 1217 |
| 844 | Ga0209998_10057600 | 3300027717 | Bacteria | 910 |
| 845 | Ga0209813_10101548 | 3300027866 | Bacteria | 979 |
| 846 | Ga0209813_10170364 | 3300027866 | Bacteria | 791 |
| 847 | Ga0209974_10009862 | 3300027876 | Bacteria | 3231 |
| 848 | Ga0209974_10065145 | 3300027876 | Bacteria | 1237 |
| 849 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 850 | Ga0207428_10001773 | 3300027907 | Bacteria | 22109 |
| 851 | Ga0207428_10002442 | 3300027907 | Bacteria | 18563 |
| 852 | Ga0268266_10068513 | 3300028379 | Bacteria | 3072 |
| 853 | Ga0268266_10220254 | 3300028379 | Bacteria | 1744 |
| 854 | Ga0268266_10396400 | 3300028379 | Bacteria | 1304 |
| 855 | Ga0268265_10003320 | 3300028380 | Bacteria | 11642 |
| 856 | Ga0268265_10006176 | 3300028380 | Bacteria | 8113 |
| 857 | Ga0268265_10031542 | 3300028380 | Bacteria | 3827 |
| 858 | Ga0268265_12419870 | 3300028380 | Bacteria | 531 |
| 859 | Ga0268264_10002331 | 3300028381 | Bacteria | 16789 |
| 860 | Ga0268264_10029317 | 3300028381 | Bacteria | 4505 |
| 861 | Ga0268264_10119996 | 3300028381 | Bacteria | 2316 |
| 862 | Ga0268264_10411466 | 3300028381 | Bacteria | 1302 |
| 863 | Ga0268264_10437869 | 3300028381 | Bacteria | 1264 |
| 864 | Ga0265337_1000827 | 3300028556 | Bacteria | 16247 |
| 865 | Ga0265337_1198661 | 3300028556 | Bacteria | 544 |
| 866 | Ga0265334_10129897 | 3300028573 | Bacteria | 897 |
| 867 | Ga0265334_10145145 | 3300028573 | Bacteria | 839 |
| 868 | Ga0265334_10279855 | 3300028573 | Bacteria | 572 |
| 869 | Ga0265338_10043919 | 3300028800 | Bacteria | 4135 |
| 870 | Ga0265338_10462856 | 3300028800 | Bacteria | 897 |
| 871 | Ga0265330_10153761 | 3300031235 | Bacteria | 977 |
| 872 | Ga0265332_10121255 | 3300031238 | Bacteria | 1098 |
| 873 | Ga0265332_10254443 | 3300031238 | Bacteria | 726 |
| 874 | Ga0265328_10075839 | 3300031239 | Bacteria | 1237 |
| 875 | Ga0265328_10407279 | 3300031239 | Bacteria | 534 |
| 876 | Ga0265325_10001071 | 3300031241 | Bacteria | 19727 |
| 877 | Ga0265325_10009381 | 3300031241 | Bacteria | 5714 |
| 878 | Ga0265325_10069725 | 3300031241 | Bacteria | 1767 |
| 879 | Ga0265325_10096452 | 3300031241 | Bacteria | 1452 |
| 880 | Ga0265325_10104334 | 3300031241 | Bacteria | 1384 |
| 881 | Ga0265325_10243580 | 3300031241 | Bacteria | 816 |
| 882 | Ga0265329_10097503 | 3300031242 | Bacteria | 935 |
| 883 | Ga0265340_10000595 | 3300031247 | Bacteria | 20131 |
| 884 | Ga0265340_10010231 | 3300031247 | Bacteria | 5021 |
| 885 | Ga0265340_10020380 | 3300031247 | Bacteria | 3408 |
| 886 | Ga0265340_10023130 | 3300031247 | Bacteria | 3171 |
| 887 | Ga0265340_10023676 | 3300031247 | Bacteria | 3129 |
| 888 | Ga0265340_10071131 | 3300031247 | Bacteria | 1649 |
| 889 | Ga0265340_10154642 | 3300031247 | Bacteria | 1044 |
| 890 | Ga0265340_10268243 | 3300031247 | Bacteria | 759 |
| 891 | Ga0265339_10001408 | 3300031249 | Bacteria | 17842 |
| 892 | Ga0265339_10002105 | 3300031249 | Bacteria | 14517 |
| 893 | Ga0265339_10013957 | 3300031249 | Bacteria | 4859 |
| 894 | Ga0265339_10094870 | 3300031249 | Bacteria | 1559 |
| 895 | Ga0265339_10552650 | 3300031249 | Bacteria | 529 |
| 896 | Ga0265331_10014022 | 3300031250 | Bacteria | 4284 |
| 897 | Ga0265316_10005588 | 3300031344 | Bacteria | 12187 |
| 898 | Ga0265316_10079155 | 3300031344 | Bacteria | 2522 |
| 899 | Ga0265316_10170001 | 3300031344 | Bacteria | 1626 |
| 900 | Ga0307513_10475149 | 3300031456 | Bacteria | 971 |
| 901 | Ga0307408_100910917 | 3300031548 | Bacteria | 805 |
| 902 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 903 | Ga0265313_10003687 | 3300031595 | Bacteria | 12218 |
| 904 | Ga0265313_10003967 | 3300031595 | Bacteria | 11626 |
| 905 | Ga0265313_10004533 | 3300031595 | Bacteria | 10604 |
| 906 | Ga0265313_10005420 | 3300031595 | Bacteria | 9398 |
| 907 | Ga0265313_10022796 | 3300031595 | Bacteria | 3388 |
| 908 | Ga0265313_10036516 | 3300031595 | Bacteria | 2466 |
| 909 | Ga0265313_10050230 | 3300031595 | Bacteria | 2002 |
| 910 | Ga0265313_10063677 | 3300031595 | Bacteria | 1718 |
| 911 | Ga0265313_10140853 | 3300031595 | Bacteria | 1037 |
| 912 | Ga0265313_10183845 | 3300031595 | Bacteria | 877 |
| 913 | Ga0265313_10242318 | 3300031595 | Bacteria | 737 |
| 914 | Ga0265314_10004990 | 3300031711 | Bacteria | 12094 |
| 915 | Ga0265314_10006134 | 3300031711 | Bacteria | 10680 |
| 916 | Ga0265314_10116303 | 3300031711 | Bacteria | 1691 |
| 917 | Ga0265314_10166868 | 3300031711 | Bacteria | 1333 |
| 918 | Ga0265342_10002950 | 3300031712 | Bacteria | 14314 |
| 919 | Ga0265342_10009052 | 3300031712 | Bacteria | 7065 |
| 920 | Ga0265342_10017557 | 3300031712 | Bacteria | 4651 |
| 921 | Ga0265342_10080105 | 3300031712 | Bacteria | 1888 |
| 922 | Ga0265342_10112426 | 3300031712 | Bacteria | 1540 |
| 923 | Ga0265342_10166813 | 3300031712 | Bacteria | 1214 |
| 924 | Ga0265342_10230327 | 3300031712 | Bacteria | 995 |
| 925 | Ga0307405_10541041 | 3300031731 | Bacteria | 941 |
| 926 | Ga0307405_11571364 | 3300031731 | Bacteria | 580 |
| 927 | Ga0307413_10463563 | 3300031824 | Bacteria | 1009 |
| 928 | Ga0307410_10599571 | 3300031852 | Bacteria | 919 |
| 929 | Ga0307406_11517626 | 3300031901 | Bacteria | 590 |
| 930 | Ga0307406_11805906 | 3300031901 | Bacteria | 544 |
| 931 | Ga0307407_10216363 | 3300031903 | Bacteria | 1293 |
| 932 | Ga0307412_11650853 | 3300031911 | Bacteria | 586 |
| 933 | Ga0307409_100297855 | 3300031995 | Bacteria | 1499 |
| 934 | Ga0307409_101596973 | 3300031995 | Bacteria | 680 |
| 935 | Ga0307409_101818529 | 3300031995 | Bacteria | 638 |
| 936 | Ga0307416_100350392 | 3300032002 | Bacteria | 1494 |
| 937 | Ga0373930_0000352 | 3300034816 | Bacteria | 5995 |
| 938 | Ga0373930_0170420 | 3300034816 | Bacteria | 555 |
| 939 | Ga0373948_0000262 | 3300034817 | Bacteria | 6336 |
| 940 | Ga0373950_0000155 | 3300034818 | Bacteria | 10219 |
| 941 | Ga0373958_0000136 | 3300034819 | Bacteria | 8194 |
| 942 | Ga0373959_0000508 | 3300034820 | Bacteria | 7016 |
| 943 | Ga0373938_0000013 | 3300034957 | Bacteria | 24269 |
| 944 | Ga0373938_0010938 | 3300034957 | Bacteria | 1678 |
| 945 | Ga0373938_0145369 | 3300034957 | Bacteria | 628 |
| 946 | Ga0373926_0001371 | 3300035083 | Bacteria | 7372 |
| 947 | Ga0373926_0155249 | 3300035083 | Bacteria | 872 |
| 948 | Ga0373926_0261108 | 3300035083 | Bacteria | 672 |
| 949 | Ga0373928_0000255 | 3300035084 | Bacteria | 10564 |
| 950 | Ga0373928_0034036 | 3300035084 | Bacteria | 1142 |
| 951 | Ga0373929_0002106 | 3300035085 | Bacteria | 3696 |
| 952 | Ga0373929_0018776 | 3300035085 | Bacteria | 1377 |
| 953 | Ga0373934_0095854 | 3300035086 | Bacteria | 1198 |
| 954 | Ga0373940_0000097 | 3300035088 | Bacteria | 10516 |
| 955 | Ga0373940_0096900 | 3300035088 | Bacteria | 891 |
| 956 | Ga0373944_0007536 | 3300035089 | Bacteria | 2919 |
| 957 | Ga0373949_0002652 | 3300035090 | Bacteria | 4507 |
| 958 | Ga0373949_0027429 | 3300035090 | Bacteria | 1339 |
| 959 | Ga0373949_0043701 | 3300035090 | Bacteria | 1109 |
| 960 | Ga0373949_0146973 | 3300035090 | Bacteria | 679 |
| 961 | Ga0373951_0004343 | 3300035091 | Bacteria | 3372 |
| 962 | Ga0373952_0000182 | 3300035092 | Bacteria | 9790 |
| 963 | Ga0373952_0001880 | 3300035092 | Bacteria | 3814 |
| 964 | Ga0373923_0009752 | 3300035111 | Bacteria | 3472 |
| 965 | Ga0373923_0037057 | 3300035111 | Bacteria | 1994 |
| 966 | Ga0373923_0129868 | 3300035111 | Bacteria | 1131 |
| 967 | Ga0373923_0275670 | 3300035111 | Bacteria | 792 |
| 968 | Ga0373923_0381990 | 3300035111 | Bacteria | 676 |
| 969 | Ga0373932_0000252 | 3300035112 | Bacteria | 16339 |
| 970 | Ga0373932_0000830 | 3300035112 | Bacteria | 9130 |
| 971 | Ga0373932_0110613 | 3300035112 | Bacteria | 905 |
| 972 | Ga0373936_0007704 | 3300035113 | Bacteria | 4044 |
| 973 | Ga0373936_0015784 | 3300035113 | Bacteria | 2897 |
| 974 | Ga0373939_0001022 | 3300035114 | Bacteria | 6895 |
| 975 | Ga0373939_0004646 | 3300035114 | Bacteria | 3253 |
| 976 | Ga0373939_0011288 | 3300035114 | Bacteria | 2250 |
| 977 | Ga0373941_0000125 | 3300035115 | Bacteria | 13305 |
| 978 | Ga0373941_0091707 | 3300035115 | Bacteria | 1043 |
| 979 | Ga0373941_0100106 | 3300035115 | Bacteria | 1008 |
| 980 | Ga0373941_0295786 | 3300035115 | Bacteria | 645 |
| 981 | Ga0373945_0035220 | 3300035116 | Bacteria | 1788 |
| 982 | Ga0373945_0036416 | 3300035116 | Bacteria | 1763 |
| 983 | Ga0373945_0060204 | 3300035116 | Bacteria | 1415 |
| 984 | Ga0373953_0015314 | 3300035117 | Bacteria | 2776 |
| 985 | Ga0373953_0026316 | 3300035117 | Bacteria | 2228 |
| 986 | Ga0373953_0035794 | 3300035117 | Bacteria | 1952 |
| 987 | Ga0373954_0002715 | 3300035118 | Bacteria | 7451 |
| 988 | Ga0373954_0017164 | 3300035118 | Bacteria | 3246 |
| 989 | Ga0373954_0052172 | 3300035118 | Bacteria | 1921 |
| 990 | Ga0373954_0226256 | 3300035118 | Bacteria | 920 |
| 991 | Ga0373956_0002024 | 3300035119 | Bacteria | 8399 |
| 992 | Ga0373956_0008190 | 3300035119 | Bacteria | 4230 |
| 993 | Ga0373956_0012364 | 3300035119 | Bacteria | 3536 |
| 994 | Ga0373957_0017927 | 3300035120 | Bacteria | 2473 |
| 995 | Ga0373957_0019472 | 3300035120 | Bacteria | 2388 |
| 996 | Ga0373957_0057994 | 3300035120 | Bacteria | 1494 |
| 997 | Ga0373957_0303102 | 3300035120 | Bacteria | 678 |
| 998 | Ga0373960_0000068 | 3300035121 | Bacteria | 14664 |
| 999 | Ga0373960_0005186 | 3300035121 | Bacteria | 3010 |
| 1000 | Ga0373960_0049576 | 3300035121 | Bacteria | 1242 |
| 1001 | Ga0373943_0007567 | 3300035170 | Bacteria | 4879 |
| 1002 | Ga0373943_0013145 | 3300035170 | Bacteria | 3735 |
| 1003 | Ga0373943_0025295 | 3300035170 | Bacteria | 2774 |
| 1004 | Ga0373943_0047950 | 3300035170 | Bacteria | 2091 |
| 1005 | Ga0373946_0010959 | 3300035171 | Bacteria | 3370 |
| 1006 | Ga0373946_0021880 | 3300035171 | Bacteria | 2483 |
| 1007 | Ga0373946_0211283 | 3300035171 | Bacteria | 933 |
| 1008 | Ga0373946_0401209 | 3300035171 | Bacteria | 692 |
| 1009 | Ga0373955_0001002 | 3300035172 | Bacteria | 11996 |
| 1010 | Ga0373955_0003246 | 3300035172 | Bacteria | 7124 |
| 1011 | Ga0373955_0012262 | 3300035172 | Bacteria | 4116 |
| 1012 | Ga0373955_0041789 | 3300035172 | Bacteria | 2459 |
| 1013 | Ga0373942_0001496 | 3300035207 | Bacteria | 6007 |
| 1014 | Ga0373942_0017748 | 3300035207 | Bacteria | 1758 |
| 1015 | Ga0373961_0000638 | 3300035241 | Bacteria | 12665 |
| 1016 | Ga0373961_0008988 | 3300035241 | Bacteria | 2437 |
| 1017 | Ga0373961_0282338 | 3300035241 | Bacteria | 609 |
| 1018 | Ga0373962_0000112 | 3300035242 | Bacteria | 16939 |
| 1019 | Ga0373962_0003469 | 3300035242 | Bacteria | 3786 |
| 1020 | Ga0373962_0006987 | 3300035242 | Bacteria | 2751 |
| 1021 | Ga0373962_0087475 | 3300035242 | Bacteria | 955 |
| 1022 | Ga0373924_0045870 | 3300035410 | Bacteria | 1798 |
| 1023 | Ga0373924_0155771 | 3300035410 | Bacteria | 1000 |
| 1024 | Ga0373924_0166202 | 3300035410 | Bacteria | 968 |
| 1025 | Ga0373924_0255338 | 3300035410 | Bacteria | 776 |
| 1026 | Ga0373931_0000305 | 3300035691 | Bacteria | 20657 |
| 1027 | Ga0373931_0001634 | 3300035691 | Bacteria | 9691 |
| 1028 | Ga0373931_0103890 | 3300035691 | Bacteria | 1602 |
| 1029 | Ga0373931_0115030 | 3300035691 | Bacteria | 1531 |
| 1030 | Ga0373931_0119175 | 3300035691 | Bacteria | 1506 |
| 1031 | Ga0373931_0298677 | 3300035691 | Bacteria | 994 |
| 1032 | Ga0373931_0460339 | 3300035691 | Bacteria | 815 |
| 1033 | Ga0373931_0563181 | 3300035691 | Bacteria | 741 |
| 1034 | Ga0373935_0000768 | 3300035692 | Bacteria | 17055 |
| 1035 | Ga0373935_0033271 | 3300035692 | Bacteria | 3207 |
| 1036 | Ga0373935_0060054 | 3300035692 | Bacteria | 2432 |
| 1037 | Ga0373935_0069751 | 3300035692 | Bacteria | 2264 |
| 1038 | Ga0373935_0198900 | 3300035692 | Bacteria | 1384 |
| 1039 | Ga0373935_0729323 | 3300035692 | Bacteria | 729 |
| 1040 | Ga0373927_0017282 | 3300035695 | Bacteria | 4748 |
| 1041 | Ga0373927_0017738 | 3300035695 | Bacteria | 4683 |
| 1042 | Ga0373933_0002755 | 3300035724 | Bacteria | 9806 |
| 1043 | Ga0373933_0012124 | 3300035724 | Bacteria | 4760 |
| 1044 | Ga0373933_0032980 | 3300035724 | Bacteria | 3010 |
| 1045 | Ga0373933_0331363 | 3300035724 | Bacteria | 987 |
| 1046 | Ga0373933_0337578 | 3300035724 | Bacteria | 978 |
| 1047 | Ga0373947_0005394 | 3300035725 | Bacteria | 7462 |
| 1048 | Ga0373947_0058158 | 3300035725 | Bacteria | 2342 |
| 1049 | Ga0373947_0113971 | 3300035725 | Bacteria | 1711 |
| 1050 | Ga0373937_0000057 | 3300036401 | Bacteria | 99491 |
| 1051 | Ga0373937_0005145 | 3300036401 | Bacteria | 11151 |
| 1052 | Ga0373937_0021076 | 3300036401 | Bacteria | 5849 |
| 1053 | Ga0373937_0089618 | 3300036401 | Bacteria | 2848 |
| 1054 | Ga0373937_0147389 | 3300036401 | Bacteria | 2203 |
| 1055 | Ga0373937_0544377 | 3300036401 | Bacteria | 1102 |
| 1056 | Ga0316582_0188075 | 3300036647 | Bacteria | 1406 |
| 1057 | Ga0316584_0001009 | 3300036712 | Bacteria | 16241 |
| 1058 | Ga0373925_0000435 | 3300037068 | Bacteria | 42178 |
| 1059 | Ga0373925_0026064 | 3300037068 | Bacteria | 4275 |
| 1060 | Ga0373925_0034339 | 3300037068 | Bacteria | 3738 |
| 1061 | Ga0373925_0039839 | 3300037068 | Bacteria | 3477 |
| 1062 | Ga0395899_0027617 | 3300037312 | Bacteria | 4276 |
| 1063 | Ga0395899_0091027 | 3300037312 | Bacteria | 2211 |
| 1064 | Ga0395899_0108346 | 3300037312 | Bacteria | 1999 |
| 1065 | Ga0395899_0509727 | 3300037312 | Bacteria | 779 |
| 1066 | Ga0395899_0628217 | 3300037312 | Bacteria | 681 |
| 1067 | Ga0395899_0638165 | 3300037312 | Bacteria | 674 |
| 1068 | Ga0395900_0021199 | 3300037418 | Bacteria | 6643 |
| 1069 | Ga0395900_0079908 | 3300037418 | Bacteria | 3360 |
| 1070 | Ga0395900_0366054 | 3300037418 | Bacteria | 1412 |
| 1071 | Ga0395900_0810990 | 3300037418 | Bacteria | 863 |
| 1072 | Ga0395900_1372975 | 3300037418 | Bacteria | 620 |
| 1073 | Ga0395898_0012850 | 3300037466 | Bacteria | 8637 |
| 1074 | Ga0395898_0120982 | 3300037466 | Bacteria | 2508 |
| 1075 | Ga0395898_0216830 | 3300037466 | Bacteria | 1825 |
| 1076 | Ga0395905_1858586 | 3300037471 | Bacteria | 508 |
| 1077 | Ga0436364_0275541 | 3300037853 | Bacteria | 815 |
| 1078 | Ga0395901_0032023 | 3300038443 | Bacteria | 5424 |
| 1079 | Ga0395901_0132013 | 3300038443 | Bacteria | 2624 |
| 1080 | Ga0395901_0206033 | 3300038443 | Bacteria | 2060 |
| 1081 | Ga0395901_0214538 | 3300038443 | Bacteria | 2013 |
| 1082 | Ga0395901_0286280 | 3300038443 | Bacteria | 1711 |
| 1083 | Ga0242420_047701 | 3300038996 | Bacteria | 831 |
| 1084 | Ga0400483_057660 | 3300039062 | Bacteria | 5388 |
| 1085 | Ga0400483_114523 | 3300039062 | Bacteria | 3519 |
| 1086 | Ga0400483_151905 | 3300039062 | Bacteria | 1759 |
| 1087 | Ga0400483_217885 | 3300039062 | Bacteria | 12374 |
| 1088 | Ga0436365_0682766 | 3300039437 | Bacteria | 641 |
| 1089 | Ga0436365_0903794 | 3300039437 | Bacteria | 1392 |
| 1090 | Ga0436365_1078722 | 3300039437 | Bacteria | 827 |
| 1091 | Ga0436365_1131499 | 3300039437 | Bacteria | 661 |
| 1092 | Ga0436360_1129497 | 3300039438 | Bacteria | 623 |
| 1093 | Ga0436361_0097962 | 3300039447 | Bacteria | 2010 |
| 1094 | Ga0436361_0555071 | 3300039447 | Bacteria | 920 |
| 1095 | Ga0436361_0572950 | 3300039447 | Bacteria | 1151 |
| 1096 | Ga0436363_0063809 | 3300039450 | Bacteria | 2193 |
| 1097 | Ga0436363_1200183 | 3300039450 | Bacteria | 1001 |
| 1098 | Ga0436363_1679896 | 3300039450 | Bacteria | 528 |
| 1099 | Ga0436362_0103032 | 3300039453 | Bacteria | 1000 |
| 1100 | Ga0439465_0047897 | 3300041413 | Bacteria | 1394 |
| 1101 | Ga0439441_062304 | 3300042001 | Bacteria | 787 |
| 1102 | Ga0439441_105782 | 3300042001 | Bacteria | 635 |
| 1103 | Ga0439448_0152482 | 3300042005 | Bacteria | 802 |
| 1104 | Ga0439450_053610 | 3300042008 | Bacteria | 963 |
| 1105 | Ga0439455_0005610 | 3300042012 | Bacteria | 2558 |
| 1106 | Ga0439456_038656 | 3300042013 | Bacteria | 1032 |
| 1107 | Ga0450920_139308 | 3300042122 | Bacteria | 513 |
| 1108 | Ga0450923_004336 | 3300042125 | Bacteria | 2224 |
| 1109 | Ga0439459_0065286 | 3300042438 | Bacteria | 831 |
| 1110 | Ga0439464_0022068 | 3300042439 | Bacteria | 1751 |
| 1111 | Ga0451577_0102181 | 3300042876 | Bacteria | 2561 |
| 1112 | Ga0466972_0457002 | 3300044658 | Bacteria | 600 |
| 1113 | Ga0453683_0835583 | 3300044673 | Bacteria | 607 |
| 1114 | Ga0466966_0067594 | 3300044684 | Bacteria | 2244 |
| 1115 | Ga0466961_0407176 | 3300044693 | Bacteria | 825 |
| 1116 | Ga0466963_0052778 | 3300044694 | Bacteria | 2698 |
| 1117 | Ga0466963_0305327 | 3300044694 | Bacteria | 1119 |
| 1118 | Ga0466963_0461061 | 3300044694 | Bacteria | 897 |
| 1119 | Ga0453684_1338739 | 3300044712 | Bacteria | 745 |
| 1120 | Ga0466971_0121746 | 3300044719 | Bacteria | 1208 |
| 1121 | Ga0466968_0046854 | 3300044735 | Bacteria | 1837 |
| 1122 | Ga0466970_0605719 | 3300044765 | Bacteria | 636 |
| 1123 | Ga0466957_0042883 | 3300044842 | Bacteria | 2738 |
| 1124 | Ga0466957_0287238 | 3300044842 | Bacteria | 1102 |
| 1125 | Ga0466957_0528026 | 3300044842 | Bacteria | 821 |
| 1126 | Ga0466960_0068146 | 3300044901 | Bacteria | 1764 |
| 1127 | Ga0451576_0014613 | 3300045051 | Bacteria | 8726 |
| 1128 | Ga0466958_0087166 | 3300045836 | Bacteria | 1927 |
| 1129 | Ga0466958_0150677 | 3300045836 | Bacteria | 1467 |
| 1130 | Ga0466958_0587406 | 3300045836 | Bacteria | 724 |
| 1131 | Ga0466967_0150260 | 3300045976 | Bacteria | 2176 |
| 1132 | Ga0466967_1060224 | 3300045976 | Bacteria | 807 |
| 1133 | Ga0466967_1359010 | 3300045976 | Bacteria | 707 |
| 1134 | Ga0466967_1727867 | 3300045976 | Bacteria | 623 |
| 1135 | Ga0466967_1743619 | 3300045976 | Bacteria | 620 |
| 1136 | Ga0466967_1871610 | 3300045976 | Bacteria | 597 |
| 1137 | Ga0495592_0014401 | 3300046454 | Bacteria | 6005 |
| 1138 | Ga0495592_0064894 | 3300046454 | Bacteria | 2674 |
| 1139 | Ga0495592_0171347 | 3300046454 | Bacteria | 1486 |
| 1140 | Ga0495603_0018592 | 3300046455 | Bacteria | 4204 |
| 1141 | Ga0495590_0036240 | 3300046457 | Bacteria | 1721 |
| 1142 | Ga0495629_0003401 | 3300046459 | Bacteria | 12036 |
| 1143 | Ga0495629_0210900 | 3300046459 | Bacteria | 1341 |
| 1144 | Ga0495638_0091275 | 3300046460 | Bacteria | 1835 |
| 1145 | Ga0495638_0157555 | 3300046460 | Bacteria | 1312 |
| 1146 | Ga0495641_0018852 | 3300046461 | Bacteria | 3548 |
| 1147 | Ga0495651_0000205 | 3300046462 | Bacteria | 45135 |
| 1148 | Ga0495651_0001390 | 3300046462 | Bacteria | 18780 |
| 1149 | Ga0495651_0003040 | 3300046462 | Bacteria | 12936 |
| 1150 | Ga0495651_0251434 | 3300046462 | Bacteria | 1207 |
| 1151 | Ga0495651_0448229 | 3300046462 | Bacteria | 834 |
| 1152 | Ga0495653_0000120 | 3300046463 | Bacteria | 65274 |
| 1153 | Ga0495653_0003820 | 3300046463 | Bacteria | 12184 |
| 1154 | Ga0495653_0069439 | 3300046463 | Bacteria | 2640 |
| 1155 | Ga0495580_0209732 | 3300046472 | Bacteria | 1340 |
| 1156 | Ga0495580_0804085 | 3300046472 | Bacteria | 609 |
| 1157 | Ga0495582_0034706 | 3300046473 | Bacteria | 2772 |
| 1158 | Ga0495582_0063214 | 3300046473 | Bacteria | 2045 |
| 1159 | Ga0495582_0533630 | 3300046473 | Bacteria | 679 |
| 1160 | Ga0495639_0017560 | 3300046475 | Bacteria | 3109 |
| 1161 | Ga0495662_0001020 | 3300046476 | Bacteria | 13726 |
| 1162 | Ga0495662_0030489 | 3300046476 | Bacteria | 2603 |
| 1163 | Ga0495662_0118993 | 3300046476 | Bacteria | 1296 |
| 1164 | Ga0495664_0000023 | 3300046477 | Bacteria | 126807 |
| 1165 | Ga0495664_0003117 | 3300046477 | Bacteria | 9004 |
| 1166 | Ga0495664_0247869 | 3300046477 | Bacteria | 1077 |
| 1167 | Ga0495584_0031540 | 3300046491 | Bacteria | 2683 |
| 1168 | Ga0495584_0094008 | 3300046491 | Bacteria | 1513 |
| 1169 | Ga0495584_0362676 | 3300046491 | Bacteria | 736 |
| 1170 | Ga0495585_0124105 | 3300046492 | Bacteria | 1364 |
| 1171 | Ga0495585_0230885 | 3300046492 | Bacteria | 930 |
| 1172 | Ga0495594_0035688 | 3300046499 | Bacteria | 2709 |
| 1173 | Ga0495594_0239537 | 3300046499 | Bacteria | 1034 |
| 1174 | Ga0495608_0000030 | 3300046511 | Bacteria | 145828 |
| 1175 | Ga0495608_0004695 | 3300046511 | Bacteria | 9771 |
| 1176 | Ga0495608_0079829 | 3300046511 | Bacteria | 2127 |
| 1177 | Ga0495618_0000042 | 3300046514 | Bacteria | 96182 |
| 1178 | Ga0495618_0009048 | 3300046514 | Bacteria | 6010 |
| 1179 | Ga0495618_0044604 | 3300046514 | Bacteria | 2797 |
| 1180 | Ga0495618_0557384 | 3300046514 | Bacteria | 685 |
| 1181 | Ga0495628_0000027 | 3300046516 | Bacteria | 126537 |
| 1182 | Ga0495628_0002285 | 3300046516 | Bacteria | 17341 |
| 1183 | Ga0495628_0088235 | 3300046516 | Bacteria | 2404 |
| 1184 | Ga0495628_0293242 | 3300046516 | Bacteria | 1205 |
| 1185 | Ga0495630_0084001 | 3300046517 | Bacteria | 2404 |
| 1186 | Ga0495630_0261513 | 3300046517 | Bacteria | 1322 |
| 1187 | Ga0495630_0282749 | 3300046517 | Bacteria | 1267 |
| 1188 | Ga0495630_0707189 | 3300046517 | Bacteria | 771 |
| 1189 | Ga0495643_0311123 | 3300046522 | Bacteria | 715 |
| 1190 | Ga0495666_0022479 | 3300046526 | Bacteria | 3123 |
| 1191 | Ga0495642_0247247 | 3300046528 | Bacteria | 780 |
| 1192 | Ga0495652_0000041 | 3300046529 | Bacteria | 126519 |
| 1193 | Ga0495652_0005034 | 3300046529 | Bacteria | 12508 |
| 1194 | Ga0495652_0008048 | 3300046529 | Bacteria | 9659 |
| 1195 | Ga0495652_0104450 | 3300046529 | Bacteria | 2291 |
| 1196 | Ga0495652_0156303 | 3300046529 | Bacteria | 1775 |
| 1197 | Ga0495665_0024414 | 3300046531 | Bacteria | 3247 |
| 1198 | Ga0495665_0088078 | 3300046531 | Bacteria | 1632 |
| 1199 | Ga0495640_0000047 | 3300046533 | Bacteria | 64381 |
| 1200 | Ga0495640_0015836 | 3300046533 | Bacteria | 5659 |
| 1201 | Ga0495640_0061658 | 3300046533 | Bacteria | 2546 |
| 1202 | Ga0495640_0276973 | 3300046533 | Bacteria | 1045 |
| 1203 | Ga0495586_0082345 | 3300046535 | Bacteria | 1769 |
| 1204 | Ga0495587_0000025 | 3300046536 | Bacteria | 147974 |
| 1205 | Ga0495587_0001073 | 3300046536 | Bacteria | 17964 |
| 1206 | Ga0495587_0021132 | 3300046536 | Bacteria | 4014 |
| 1207 | Ga0495587_0039777 | 3300046536 | Bacteria | 2813 |
| 1208 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 1209 | Ga0495645_0002505 | 3300046543 | Bacteria | 12464 |
| 1210 | Ga0495645_0046486 | 3300046543 | Bacteria | 3163 |
| 1211 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 1212 | Ga0495667_0004699 | 3300046559 | Bacteria | 9233 |
| 1213 | Ga0495667_0013645 | 3300046559 | Bacteria | 5492 |
| 1214 | Ga0495667_0036143 | 3300046559 | Bacteria | 3298 |
| 1215 | Ga0495667_0060768 | 3300046559 | Bacteria | 2478 |
| 1216 | Ga0495656_0145593 | 3300046615 | Bacteria | 1140 |
| 1217 | Ga0495634_0002681 | 3300046642 | Bacteria | 14628 |
| 1218 | Ga0495634_0122759 | 3300046642 | Bacteria | 1662 |
| 1219 | Ga0495634_0248602 | 3300046642 | Bacteria | 1088 |
| 1220 | Ga0495635_0000061 | 3300046663 | Bacteria | 66702 |
| 1221 | Ga0495635_0013280 | 3300046663 | Bacteria | 5762 |
| 1222 | Ga0495635_0101199 | 3300046663 | Bacteria | 1969 |
| 1223 | Ga0495635_0157796 | 3300046663 | Bacteria | 1544 |
| 1224 | Ga0495659_0054918 | 3300046664 | Bacteria | 1458 |
| 1225 | Ga0495659_0496778 | 3300046664 | Bacteria | 534 |
| 1226 | Ga0495588_0057546 | 3300046674 | Bacteria | 2008 |
| 1227 | Ga0495657_0000204 | 3300046675 | Bacteria | 53010 |
| 1228 | Ga0495657_0005935 | 3300046675 | Bacteria | 9597 |
| 1229 | Ga0495657_0009621 | 3300046675 | Bacteria | 7320 |
| 1230 | Ga0495657_0051550 | 3300046675 | Bacteria | 2763 |
| 1231 | Ga0495657_0056504 | 3300046675 | Bacteria | 2613 |
| 1232 | Ga0495599_0000021 | 3300046678 | Bacteria | 127591 |
| 1233 | Ga0495599_0002367 | 3300046678 | Bacteria | 10955 |
| 1234 | Ga0495599_0006958 | 3300046678 | Bacteria | 6841 |
| 1235 | Ga0495599_0452307 | 3300046678 | Bacteria | 760 |
| 1236 | Ga0495623_0000858 | 3300046679 | Bacteria | 20593 |
| 1237 | Ga0495623_0001713 | 3300046679 | Bacteria | 14738 |
| 1238 | Ga0495623_0061441 | 3300046679 | Bacteria | 2356 |
| 1239 | Ga0495646_0000043 | 3300046680 | Bacteria | 65914 |
| 1240 | Ga0495646_0003394 | 3300046680 | Bacteria | 9902 |
| 1241 | Ga0495646_0193260 | 3300046680 | Bacteria | 1111 |
| 1242 | Ga0495646_0562693 | 3300046680 | Bacteria | 581 |
| 1243 | Ga0495647_0023189 | 3300046681 | Bacteria | 2249 |
| 1244 | Ga0495647_0031601 | 3300046681 | Bacteria | 1969 |
| 1245 | Ga0495658_0019075 | 3300046683 | Bacteria | 3575 |
| 1246 | Ga0495658_0060255 | 3300046683 | Bacteria | 2176 |
| 1247 | Ga0495669_0070805 | 3300046684 | Bacteria | 1589 |
| 1248 | Ga0495669_0161196 | 3300046684 | Bacteria | 1065 |
| 1249 | Ga0495613_0130268 | 3300046689 | Bacteria | 1801 |
| 1250 | Ga0495613_0152619 | 3300046689 | Bacteria | 1646 |
| 1251 | Ga0495613_0242912 | 3300046689 | Bacteria | 1258 |
| 1252 | Ga0495613_0433095 | 3300046689 | Bacteria | 893 |
| 1253 | Ga0495613_0792279 | 3300046689 | Bacteria | 619 |
| 1254 | Ga0495624_0027753 | 3300046690 | Bacteria | 3704 |
| 1255 | Ga0495624_0582130 | 3300046690 | Bacteria | 667 |
| 1256 | Ga0495671_0295934 | 3300046692 | Bacteria | 779 |
| 1257 | Ga0495589_0162433 | 3300046794 | Bacteria | 1064 |
| 1258 | Ga0495589_0268839 | 3300046794 | Bacteria | 794 |
| 1259 | Ga0495589_0291718 | 3300046794 | Bacteria | 757 |
| 1260 | Ga0495600_0000082 | 3300046809 | Bacteria | 52098 |
| 1261 | Ga0495600_0025274 | 3300046809 | Bacteria | 3827 |
| 1262 | Ga0495600_0071319 | 3300046809 | Bacteria | 2269 |
| 1263 | Ga0495600_0595037 | 3300046809 | Bacteria | 672 |
| 1264 | Ga0495581_0041004 | 3300047315 | Bacteria | 2679 |
| 1265 | Ga0495581_0093975 | 3300047315 | Bacteria | 1740 |
| 1266 | Ga0495581_0486163 | 3300047315 | Bacteria | 718 |
| 1267 | Ga0495604_0000036 | 3300047317 | Bacteria | 126707 |
| 1268 | Ga0495604_0003635 | 3300047317 | Bacteria | 12295 |
| 1269 | Ga0495604_0016633 | 3300047317 | Bacteria | 5881 |
| 1270 | Ga0495604_0149828 | 3300047317 | Bacteria | 1659 |
| 1271 | Ga0495674_0000085 | 3300047319 | Bacteria | 65389 |
| 1272 | Ga0495674_0064384 | 3300047319 | Bacteria | 3187 |
| 1273 | Ga0495674_0143635 | 3300047319 | Bacteria | 2004 |
| 1274 | Ga0495672_0000511 | 3300047320 | Bacteria | 44639 |
| 1275 | Ga0495676_0168077 | 3300047321 | Bacteria | 1545 |
| 1276 | Ga0495676_0338761 | 3300047321 | Bacteria | 1007 |
| 1277 | Ga0495680_0000201 | 3300047322 | Bacteria | 64686 |
| 1278 | Ga0495680_0012190 | 3300047322 | Bacteria | 7581 |
| 1279 | Ga0495680_0024378 | 3300047322 | Bacteria | 5018 |
| 1280 | Ga0495680_0132942 | 3300047322 | Bacteria | 1826 |
| 1281 | Ga0495680_0503811 | 3300047322 | Bacteria | 821 |
| 1282 | Ga0495680_0522910 | 3300047322 | Bacteria | 803 |
| 1283 | Ga0495675_0000203 | 3300047444 | Bacteria | 43496 |
| 1284 | Ga0495675_0004449 | 3300047444 | Bacteria | 8477 |
| 1285 | Ga0495675_0219460 | 3300047444 | Bacteria | 1151 |
| 1286 | Ga0495677_0315950 | 3300047445 | Bacteria | 615 |
| 1287 | Ga0495684_0000025 | 3300047471 | Bacteria | 127037 |
| 1288 | Ga0495684_0116578 | 3300047471 | Bacteria | 2013 |
| 1289 | Ga0495593_0005893 | 3300047673 | Bacteria | 7221 |
| 1290 | Ga0495593_0026153 | 3300047673 | Bacteria | 3225 |
| 1291 | Ga0495593_0095776 | 3300047673 | Bacteria | 1526 |
| 1292 | Ga0495593_0495358 | 3300047673 | Bacteria | 612 |
| 1293 | Ga0495602_0000097 | 3300048088 | Bacteria | 82301 |
| 1294 | Ga0495602_0005814 | 3300048088 | Bacteria | 12947 |
| 1295 | Ga0495602_0069117 | 3300048088 | Bacteria | 3029 |
| 1296 | Ga0495614_0210554 | 3300048089 | Bacteria | 881 |
| 1297 | Ga0496100_0000345 | 3300048903 | Bacteria | 22686 |
| 1298 | Ga0496100_0040182 | 3300048903 | Bacteria | 2974 |
| 1299 | Ga0496100_0196762 | 3300048903 | Bacteria | 1466 |
| 1300 | Ga0496100_0210950 | 3300048903 | Bacteria | 1420 |
| 1301 | Ga0496100_0381653 | 3300048903 | Bacteria | 1070 |
| 1302 | Ga0496100_0819396 | 3300048903 | Bacteria | 729 |
| 1303 | Ga0496101_0000866 | 3300048904 | Bacteria | 17903 |
| 1304 | Ga0496101_0002577 | 3300048904 | Bacteria | 11131 |
| 1305 | Ga0496101_0026764 | 3300048904 | Bacteria | 4010 |
| 1306 | Ga0496101_0031736 | 3300048904 | Bacteria | 3715 |
| 1307 | Ga0496101_0354354 | 3300048904 | Bacteria | 1153 |
| 1308 | Ga0496101_0754094 | 3300048904 | Bacteria | 768 |
| 1309 | Ga0496101_0879150 | 3300048904 | Bacteria | 706 |
| 1310 | Ga0496101_1581763 | 3300048904 | Bacteria | 509 |
| 1311 | Ga0496102_0001833 | 3300048905 | Bacteria | 18355 |
| 1312 | Ga0496102_0001868 | 3300048905 | Bacteria | 18139 |
| 1313 | Ga0496102_0035378 | 3300048905 | Bacteria | 4495 |
| 1314 | Ga0496102_0227674 | 3300048905 | Bacteria | 1758 |
| 1315 | Ga0496102_0713677 | 3300048905 | Bacteria | 925 |
| 1316 | Ga0496102_0954535 | 3300048905 | Bacteria | 778 |
| 1317 | Ga0496103_0001022 | 3300048906 | Bacteria | 19583 |
| 1318 | Ga0496103_0033382 | 3300048906 | Bacteria | 3144 |
| 1319 | Ga0496103_0039344 | 3300048906 | Bacteria | 2905 |
| 1320 | Ga0496103_0046372 | 3300048906 | Bacteria | 2683 |
| 1321 | Ga0496103_0159310 | 3300048906 | Bacteria | 1447 |
| 1322 | Ga0496103_0246031 | 3300048906 | Bacteria | 1151 |
| 1323 | Ga0496104_0000399 | 3300048907 | Bacteria | 38066 |
| 1324 | Ga0496104_0000877 | 3300048907 | Bacteria | 25894 |
| 1325 | Ga0496104_0041378 | 3300048907 | Bacteria | 4320 |
| 1326 | Ga0496104_0392679 | 3300048907 | Bacteria | 1300 |
| 1327 | Ga0496104_0395508 | 3300048907 | Bacteria | 1294 |
| 1328 | Ga0496104_1192407 | 3300048907 | Bacteria | 664 |
| 1329 | Ga0496105_0002417 | 3300048908 | Bacteria | 13529 |
| 1330 | Ga0496105_0077228 | 3300048908 | Bacteria | 2750 |
| 1331 | Ga0496105_0146792 | 3300048908 | Bacteria | 1939 |
| 1332 | Ga0496105_0148486 | 3300048908 | Bacteria | 1927 |
| 1333 | Ga0496105_0290849 | 3300048908 | Bacteria | 1315 |
| 1334 | Ga0496105_0325436 | 3300048908 | Bacteria | 1231 |
| 1335 | Ga0496106_0001110 | 3300048909 | Bacteria | 19925 |
| 1336 | Ga0496106_0002528 | 3300048909 | Bacteria | 13620 |
| 1337 | Ga0496106_0066180 | 3300048909 | Bacteria | 2752 |
| 1338 | Ga0496106_0076854 | 3300048909 | Bacteria | 2559 |
| 1339 | Ga0496106_0115700 | 3300048909 | Bacteria | 2091 |
| 1340 | Ga0496106_0267836 | 3300048909 | Bacteria | 1367 |
| 1341 | Ga0496106_0516860 | 3300048909 | Bacteria | 959 |
| 1342 | Ga0496107_0002539 | 3300048910 | Bacteria | 11894 |
| 1343 | Ga0496107_0017863 | 3300048910 | Bacteria | 4992 |
| 1344 | Ga0496107_0033041 | 3300048910 | Bacteria | 3700 |
| 1345 | Ga0496107_0794029 | 3300048910 | Bacteria | 693 |
| 1346 | Ga0496108_0003711 | 3300048911 | Bacteria | 12246 |
| 1347 | Ga0496108_0004403 | 3300048911 | Bacteria | 11337 |
| 1348 | Ga0496108_0009905 | 3300048911 | Bacteria | 7726 |
| 1349 | Ga0496108_0077559 | 3300048911 | Bacteria | 2810 |
| 1350 | Ga0496108_0081887 | 3300048911 | Bacteria | 2736 |
| 1351 | Ga0496108_0150271 | 3300048911 | Bacteria | 2009 |
| 1352 | Ga0496108_0418359 | 3300048911 | Bacteria | 1170 |
| 1353 | Ga0496108_0626557 | 3300048911 | Bacteria | 936 |
| 1354 | Ga0496109_0002269 | 3300048912 | Bacteria | 15980 |
| 1355 | Ga0496109_0005827 | 3300048912 | Bacteria | 10325 |
| 1356 | Ga0496109_0010610 | 3300048912 | Bacteria | 7880 |
| 1357 | Ga0496109_0072604 | 3300048912 | Bacteria | 3161 |
| 1358 | Ga0496109_0104703 | 3300048912 | Bacteria | 2627 |
| 1359 | Ga0496109_0107784 | 3300048912 | Bacteria | 2588 |
| 1360 | Ga0496109_0178790 | 3300048912 | Bacteria | 1992 |
| 1361 | Ga0496109_0742846 | 3300048912 | Bacteria | 919 |
| 1362 | Ga0496110_0004757 | 3300048913 | Bacteria | 10571 |
| 1363 | Ga0496110_0005009 | 3300048913 | Bacteria | 10350 |
| 1364 | Ga0496110_0062768 | 3300048913 | Bacteria | 3282 |
| 1365 | Ga0496110_0124293 | 3300048913 | Bacteria | 2327 |
| 1366 | Ga0496110_0239896 | 3300048913 | Bacteria | 1649 |
| 1367 | Ga0496110_0269768 | 3300048913 | Bacteria | 1549 |
| 1368 | Ga0496110_0275705 | 3300048913 | Bacteria | 1531 |
| 1369 | Ga0496110_0377198 | 3300048913 | Bacteria | 1292 |
| 1370 | Ga0496110_0850670 | 3300048913 | Bacteria | 817 |
| 1371 | Ga0496110_1800098 | 3300048913 | Bacteria | 522 |
| 1372 | Ga0496111_0008486 | 3300048914 | Bacteria | 6803 |
| 1373 | Ga0496111_0113696 | 3300048914 | Bacteria | 1995 |
| 1374 | Ga0496111_0166009 | 3300048914 | Bacteria | 1639 |
| 1375 | Ga0496111_0309448 | 3300048914 | Bacteria | 1171 |
| 1376 | Ga0496111_0508565 | 3300048914 | Bacteria | 886 |
| 1377 | Ga0496111_0686495 | 3300048914 | Bacteria | 745 |
| 1378 | Ga0496112_0003321 | 3300048915 | Bacteria | 13273 |
| 1379 | Ga0496112_0005896 | 3300048915 | Bacteria | 10679 |
| 1380 | Ga0496112_0107323 | 3300048915 | Bacteria | 2762 |
| 1381 | Ga0496112_0148666 | 3300048915 | Bacteria | 2310 |
| 1382 | Ga0496112_0306057 | 3300048915 | Bacteria | 1534 |
| 1383 | Ga0496112_1017178 | 3300048915 | Bacteria | 748 |
| 1384 | Ga0496113_0049264 | 3300048916 | Bacteria | 3136 |
| 1385 | Ga0496113_0160011 | 3300048916 | Bacteria | 1780 |
| 1386 | Ga0496113_0204176 | 3300048916 | Bacteria | 1571 |
| 1387 | Ga0496113_0214113 | 3300048916 | Bacteria | 1534 |
| 1388 | Ga0496113_0219441 | 3300048916 | Bacteria | 1515 |
| 1389 | Ga0496113_0331385 | 3300048916 | Bacteria | 1220 |
| 1390 | Ga0496113_0459870 | 3300048916 | Bacteria | 1022 |
| 1391 | Ga0496113_1037530 | 3300048916 | Bacteria | 645 |
| 1392 | Ga0496113_1606315 | 3300048916 | Bacteria | 500 |
| 1393 | Ga0496114_0007247 | 3300048917 | Bacteria | 8760 |
| 1394 | Ga0496114_0091339 | 3300048917 | Bacteria | 2586 |
| 1395 | Ga0496114_0279202 | 3300048917 | Bacteria | 1472 |
| 1396 | Ga0496114_0409099 | 3300048917 | Bacteria | 1201 |
| 1397 | Ga0496115_0007162 | 3300048918 | Bacteria | 8192 |
| 1398 | Ga0496115_0079825 | 3300048918 | Bacteria | 2663 |
| 1399 | Ga0496115_0096513 | 3300048918 | Bacteria | 2420 |
| 1400 | Ga0496115_0368084 | 3300048918 | Bacteria | 1170 |
| 1401 | Ga0496115_0507387 | 3300048918 | Bacteria | 968 |
| 1402 | Ga0496115_0736324 | 3300048918 | Bacteria | 772 |
| 1403 | Ga0496121_0001541 | 3300048924 | Bacteria | 38568 |
| 1404 | Ga0496121_0006108 | 3300048924 | Bacteria | 15150 |
| 1405 | Ga0496126_0031566 | 3300048929 | Bacteria | 5002 |
| 1406 | Ga0496126_0355209 | 3300048929 | Bacteria | 1198 |
| 1407 | Ga0501307_067962 | 3300049162 | Bacteria | 564 |
| 1408 | Ga0501031_0007081 | 3300049568 | Bacteria | 7316 |
| 1409 | Ga0501032_0000345 | 3300049569 | Bacteria | 38831 |
| 1410 | Ga0501032_0011528 | 3300049569 | Bacteria | 6349 |
| 1411 | Ga0501032_0404353 | 3300049569 | Bacteria | 877 |
| 1412 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 1413 | Ga0501033_0009628 | 3300049570 | Bacteria | 7434 |
| 1414 | Ga0501033_0311759 | 3300049570 | Bacteria | 1106 |
| 1415 | Ga0501033_0341811 | 3300049570 | Bacteria | 1049 |
| 1416 | Ga0501033_0720528 | 3300049570 | Bacteria | 678 |
| 1417 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 1418 | Ga0501034_0064668 | 3300049571 | Bacteria | 3671 |
| 1419 | Ga0501034_0181982 | 3300049571 | Bacteria | 2066 |
| 1420 | Ga0501034_0185763 | 3300049571 | Bacteria | 2042 |
| 1421 | Ga0501034_0313065 | 3300049571 | Bacteria | 1504 |
| 1422 | Ga0501034_0313235 | 3300049571 | Bacteria | 1503 |
| 1423 | Ga0501034_0371497 | 3300049571 | Bacteria | 1356 |
| 1424 | Ga0501034_0514381 | 3300049571 | Bacteria | 1109 |
| 1425 | Ga0501034_1172362 | 3300049571 | Bacteria | 647 |
| 1426 | Ga0501036_0001704 | 3300049572 | Bacteria | 17077 |
| 1427 | Ga0501036_0013016 | 3300049572 | Bacteria | 6907 |
| 1428 | Ga0501036_0296427 | 3300049572 | Bacteria | 1353 |
| 1429 | Ga0501036_0315601 | 3300049572 | Bacteria | 1306 |
| 1430 | Ga0501036_0627337 | 3300049572 | Bacteria | 891 |
| 1431 | Ga0501037_0000450 | 3300049573 | Bacteria | 33712 |
| 1432 | Ga0501037_0061670 | 3300049573 | Bacteria | 2735 |
| 1433 | Ga0501037_0081205 | 3300049573 | Bacteria | 2351 |
| 1434 | Ga0501037_0084716 | 3300049573 | Bacteria | 2295 |
| 1435 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 1436 | Ga0501038_0028787 | 3300049574 | Bacteria | 4932 |
| 1437 | Ga0501038_0066442 | 3300049574 | Bacteria | 3071 |
| 1438 | Ga0501038_0139780 | 3300049574 | Bacteria | 1982 |
| 1439 | Ga0501038_0479288 | 3300049574 | Bacteria | 954 |
| 1440 | Ga0501038_0759286 | 3300049574 | Bacteria | 723 |
| 1441 | Ga0501039_0000549 | 3300049575 | Bacteria | 27168 |
| 1442 | Ga0501039_0838026 | 3300049575 | Bacteria | 717 |
| 1443 | Ga0501039_0949539 | 3300049575 | Bacteria | 669 |
| 1444 | Ga0501040_0195912 | 3300049576 | Bacteria | 1434 |
| 1445 | Ga0501041_0197950 | 3300049577 | Bacteria | 1259 |
| 1446 | Ga0501042_0090134 | 3300049578 | Bacteria | 2201 |
| 1447 | Ga0501042_0119571 | 3300049578 | Bacteria | 1897 |
| 1448 | Ga0501042_0912375 | 3300049578 | Bacteria | 640 |
| 1449 | Ga0501043_0001704 | 3300049579 | Bacteria | 19033 |
| 1450 | Ga0501043_0054177 | 3300049579 | Bacteria | 3150 |
| 1451 | Ga0501043_0192378 | 3300049579 | Bacteria | 1586 |
| 1452 | Ga0501043_0292192 | 3300049579 | Bacteria | 1247 |
| 1453 | Ga0501043_0358593 | 3300049579 | Bacteria | 1107 |
| 1454 | Ga0501046_0002237 | 3300049580 | Bacteria | 18256 |
| 1455 | Ga0501046_0036672 | 3300049580 | Bacteria | 3945 |
| 1456 | Ga0501046_0179458 | 3300049580 | Bacteria | 1584 |
| 1457 | Ga0501046_0401674 | 3300049580 | Bacteria | 990 |
| 1458 | Ga0501046_0518728 | 3300049580 | Bacteria | 852 |
| 1459 | Ga0501046_0729312 | 3300049580 | Bacteria | 697 |
| 1460 | Ga0501047_0000440 | 3300049581 | Bacteria | 46007 |
| 1461 | Ga0501047_0016976 | 3300049581 | Bacteria | 6961 |
| 1462 | Ga0501047_0030355 | 3300049581 | Bacteria | 5211 |
| 1463 | Ga0501047_0063944 | 3300049581 | Bacteria | 3549 |
| 1464 | Ga0501047_0138620 | 3300049581 | Bacteria | 2311 |
| 1465 | Ga0501047_0427446 | 3300049581 | Bacteria | 1155 |
| 1466 | Ga0501047_0527954 | 3300049581 | Bacteria | 1006 |
| 1467 | Ga0501048_0001862 | 3300049582 | Bacteria | 16006 |
| 1468 | Ga0501048_0360186 | 3300049582 | Bacteria | 1038 |
| 1469 | Ga0501048_0365545 | 3300049582 | Bacteria | 1029 |
| 1470 | Ga0501067_0000076 | 3300049583 | Bacteria | 56529 |
| 1471 | Ga0501067_0008019 | 3300049583 | Bacteria | 5865 |
| 1472 | Ga0501067_0046517 | 3300049583 | Bacteria | 2408 |
| 1473 | Ga0501067_0167333 | 3300049583 | Bacteria | 1224 |
| 1474 | Ga0501067_0873642 | 3300049583 | Bacteria | 507 |
| 1475 | Ga0501068_0001049 | 3300049584 | Bacteria | 14641 |
| 1476 | Ga0501068_0115513 | 3300049584 | Bacteria | 1671 |
| 1477 | Ga0501068_0223426 | 3300049584 | Bacteria | 1197 |
| 1478 | Ga0501068_0387204 | 3300049584 | Bacteria | 901 |
| 1479 | Ga0501069_0018031 | 3300049585 | Bacteria | 3807 |
| 1480 | Ga0501069_0048488 | 3300049585 | Bacteria | 2358 |
| 1481 | Ga0501069_0145115 | 3300049585 | Bacteria | 1362 |
| 1482 | Ga0501069_0173426 | 3300049585 | Bacteria | 1245 |
| 1483 | Ga0501069_0228499 | 3300049585 | Bacteria | 1083 |
| 1484 | Ga0501070_0010753 | 3300049586 | Bacteria | 7733 |
| 1485 | Ga0501070_0054403 | 3300049586 | Bacteria | 3319 |
| 1486 | Ga0501070_0097895 | 3300049586 | Bacteria | 2426 |
| 1487 | Ga0501070_0120589 | 3300049586 | Bacteria | 2167 |
| 1488 | Ga0501070_0146838 | 3300049586 | Bacteria | 1946 |
| 1489 | Ga0501070_0148387 | 3300049586 | Bacteria | 1935 |
| 1490 | Ga0501070_0160366 | 3300049586 | Bacteria | 1854 |
| 1491 | Ga0501070_0833005 | 3300049586 | Bacteria | 723 |
| 1492 | Ga0501070_1238427 | 3300049586 | Bacteria | 571 |
| 1493 | Ga0501071_0127174 | 3300049587 | Bacteria | 1892 |
| 1494 | Ga0501071_0209635 | 3300049587 | Bacteria | 1465 |
| 1495 | Ga0501071_0315516 | 3300049587 | Bacteria | 1186 |
| 1496 | Ga0501072_0002634 | 3300049588 | Bacteria | 13457 |
| 1497 | Ga0501072_0235428 | 3300049588 | Bacteria | 1458 |
| 1498 | Ga0501072_0238200 | 3300049588 | Bacteria | 1449 |
| 1499 | Ga0501072_0239075 | 3300049588 | Bacteria | 1446 |
| 1500 | Ga0501072_0373095 | 3300049588 | Bacteria | 1132 |
| 1501 | Ga0501072_0693453 | 3300049588 | Bacteria | 800 |
| 1502 | Ga0501072_0917579 | 3300049588 | Bacteria | 684 |
| 1503 | Ga0501073_0000597 | 3300049589 | Bacteria | 25445 |
| 1504 | Ga0501073_0024093 | 3300049589 | Bacteria | 4370 |
| 1505 | Ga0501073_0037517 | 3300049589 | Bacteria | 3440 |
| 1506 | Ga0501073_0041475 | 3300049589 | Bacteria | 3252 |
| 1507 | Ga0501073_0044209 | 3300049589 | Bacteria | 3139 |
| 1508 | Ga0501073_0274520 | 3300049589 | Bacteria | 1163 |
| 1509 | Ga0501073_0275068 | 3300049589 | Bacteria | 1162 |
| 1510 | Ga0501073_0315066 | 3300049589 | Bacteria | 1079 |
| 1511 | Ga0501073_0464128 | 3300049589 | Bacteria | 875 |
| 1512 | Ga0501073_0546339 | 3300049589 | Bacteria | 800 |
| 1513 | Ga0501073_0911146 | 3300049589 | Bacteria | 605 |
| 1514 | Ga0501074_0000285 | 3300049590 | Bacteria | 29182 |
| 1515 | Ga0501074_0066499 | 3300049590 | Bacteria | 2593 |
| 1516 | Ga0501074_0068214 | 3300049590 | Bacteria | 2557 |
| 1517 | Ga0501074_0261439 | 3300049590 | Bacteria | 1230 |
| 1518 | Ga0501074_0299330 | 3300049590 | Bacteria | 1142 |
| 1519 | Ga0501074_0534590 | 3300049590 | Bacteria | 830 |
| 1520 | Ga0501074_0830985 | 3300049590 | Bacteria | 651 |
| 1521 | Ga0501075_0174523 | 3300049591 | Bacteria | 1640 |
| 1522 | Ga0501075_0297766 | 3300049591 | Bacteria | 1229 |
| 1523 | Ga0501075_0635401 | 3300049591 | Bacteria | 814 |
| 1524 | Ga0501075_0964004 | 3300049591 | Bacteria | 648 |
| 1525 | Ga0501075_1133616 | 3300049591 | Bacteria | 594 |
| 1526 | Ga0501076_1377480 | 3300049592 | Bacteria | 580 |
| 1527 | Ga0501077_0108309 | 3300049593 | Bacteria | 1760 |
| 1528 | Ga0501077_0230131 | 3300049593 | Bacteria | 1178 |
| 1529 | Ga0501077_0634198 | 3300049593 | Bacteria | 687 |
| 1530 | Ga0501079_0027965 | 3300049741 | Bacteria | 4325 |
| 1531 | Ga0501079_0086061 | 3300049741 | Bacteria | 2433 |
| 1532 | Ga0501079_0110781 | 3300049741 | Bacteria | 2133 |
| 1533 | Ga0501079_0193938 | 3300049741 | Bacteria | 1586 |
| 1534 | Ga0501079_0328970 | 3300049741 | Bacteria | 1197 |
| 1535 | Ga0501079_1331169 | 3300049741 | Bacteria | 565 |
| 1536 | Ga0501080_0001080 | 3300049742 | Bacteria | 22459 |
| 1537 | Ga0501080_0016495 | 3300049742 | Bacteria | 6823 |
| 1538 | Ga0501080_0067975 | 3300049742 | Bacteria | 3314 |
| 1539 | Ga0501080_0091018 | 3300049742 | Bacteria | 2833 |
| 1540 | Ga0501080_0109688 | 3300049742 | Bacteria | 2558 |
| 1541 | Ga0501080_0443378 | 3300049742 | Bacteria | 1164 |
| 1542 | Ga0501080_0696167 | 3300049742 | Bacteria | 896 |
| 1543 | Ga0501080_0709197 | 3300049742 | Bacteria | 887 |
| 1544 | Ga0501080_1338100 | 3300049742 | Bacteria | 612 |
| 1545 | Ga0501081_0018544 | 3300049743 | Bacteria | 4624 |
| 1546 | Ga0501081_0090060 | 3300049743 | Bacteria | 2156 |
| 1547 | Ga0501083_0000881 | 3300049744 | Bacteria | 19851 |
| 1548 | Ga0501083_0007860 | 3300049744 | Bacteria | 7555 |
| 1549 | Ga0501083_0024413 | 3300049744 | Bacteria | 4187 |
| 1550 | Ga0501083_0061997 | 3300049744 | Bacteria | 2496 |
| 1551 | Ga0501083_0086409 | 3300049744 | Bacteria | 2074 |
| 1552 | Ga0501083_0090565 | 3300049744 | Bacteria | 2020 |
| 1553 | Ga0501083_0455955 | 3300049744 | Bacteria | 832 |
| 1554 | Ga0501035_0000255 | 3300049822 | Bacteria | 63841 |
| 1555 | Ga0501035_0001116 | 3300049822 | Bacteria | 28096 |
| 1556 | Ga0501035_0007660 | 3300049822 | Bacteria | 10086 |
| 1557 | Ga0501035_0168444 | 3300049822 | Bacteria | 1893 |
| 1558 | Ga0501035_0347401 | 3300049822 | Bacteria | 1242 |
| 1559 | Ga0501035_0351623 | 3300049822 | Bacteria | 1233 |
| 1560 | Ga0501035_0390304 | 3300049822 | Bacteria | 1160 |
| 1561 | Ga0501035_0975551 | 3300049822 | Bacteria | 667 |
| 1562 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 1563 | Ga0501044_0060992 | 3300049823 | Bacteria | 3859 |
| 1564 | Ga0501044_0061315 | 3300049823 | Bacteria | 3848 |
| 1565 | Ga0501044_0074615 | 3300049823 | Bacteria | 3445 |
| 1566 | Ga0501044_0182883 | 3300049823 | Bacteria | 2062 |
| 1567 | Ga0501044_0272626 | 3300049823 | Bacteria | 1627 |
| 1568 | Ga0501044_0485944 | 3300049823 | Bacteria | 1137 |
| 1569 | Ga0501044_0685084 | 3300049823 | Bacteria | 911 |
| 1570 | Ga0501044_0809778 | 3300049823 | Bacteria | 815 |
| 1571 | nmdc:mga03683_175413_c1 | 3300050489 | Bacteria | 976 |
| 1572 | nmdc:mga03683_58457_c1 | 3300050489 | Bacteria | 1625 |
| 1573 | nmdc:mga00v17_384310_c1 | 3300050491 | Bacteria | 912 |
| 1574 | nmdc:mga00v17_424560_c1 | 3300050491 | Bacteria | 863 |
| 1575 | nmdc:mga00v17_82239_c1 | 3300050491 | Bacteria | 2012 |
| 1576 | nmdc:mga0yw44_5776_c1 | 3300050492 | Bacteria | 5896 |
| 1577 | nmdc:mga0k408_2835_c1 | 3300050493 | Bacteria | 9206 |
| 1578 | nmdc:mga0k408_449502_c1 | 3300050493 | Bacteria | 765 |
| 1579 | nmdc:mga0k408_7859_c1 | 3300050493 | Bacteria | 5706 |
| 1580 | nmdc:mga06z11_771695_c1 | 3300050494 | Bacteria | 586 |
| 1581 | nmdc:mga07m45_47271_c1 | 3300050496 | Bacteria | 2419 |
| 1582 | nmdc:mga07m45_561051_c1 | 3300050496 | Bacteria | 660 |
| 1583 | nmdc:mga05p37_14706_c1 | 3300050507 | Bacteria | 9402 |
| 1584 | nmdc:mga05p37_2437_c1 | 3300050507 | Bacteria | 21635 |
| 1585 | nmdc:mga05p37_265187_c1 | 3300050507 | Bacteria | 2054 |
| 1586 | nmdc:mga05p37_910783_c1 | 3300050507 | Bacteria | 947 |
| 1587 | nmdc:mga09592_1108952_c1 | 3300050508 | Bacteria | 657 |
| 1588 | nmdc:mga09592_1370_c1 | 3300050508 | Bacteria | 19524 |
| 1589 | nmdc:mga09592_266337_c1 | 3300050508 | Bacteria | 1486 |
| 1590 | nmdc:mga09592_285401_c1 | 3300050508 | Bacteria | 1431 |
| 1591 | nmdc:mga09592_8971_c1 | 3300050508 | Bacteria | 8131 |
| 1592 | nmdc:mga0qj67_108691_c1 | 3300050509 | Bacteria | 2238 |
| 1593 | nmdc:mga0qj67_969_c1 | 3300050509 | Bacteria | 19753 |
| 1594 | nmdc:mga06r32_156819_c1 | 3300050510 | Bacteria | 2258 |
| 1595 | nmdc:mga06r32_16932_c1 | 3300050510 | Bacteria | 5795 |
| 1596 | nmdc:mga06r32_638_c1 | 3300050510 | Bacteria | 30472 |
| 1597 | nmdc:mga06r32_87514_c1 | 3300050510 | Bacteria | 3040 |
| 1598 | nmdc:mga08y16_1574170_c1 | 3300050511 | Bacteria | 616 |
| 1599 | nmdc:mga08y16_3117_c1 | 3300050511 | Bacteria | 17166 |
| 1600 | nmdc:mga08y16_333_c1 | 3300050511 | Bacteria | 42807 |
| 1601 | nmdc:mga08y16_549_c1 | 3300050511 | Bacteria | 34756 |
| 1602 | nmdc:mga0n895_1174_c1 | 3300050512 | Bacteria | 19193 |
| 1603 | nmdc:mga0n895_124497_c1 | 3300050512 | Bacteria | 2601 |
| 1604 | nmdc:mga0n895_534292_c1 | 3300050512 | Bacteria | 1179 |
| 1605 | nmdc:mga0n895_857752_c1 | 3300050512 | Bacteria | 896 |
| 1606 | nmdc:mga0rr50_20520_c1 | 3300050513 | Bacteria | 4491 |
| 1607 | nmdc:mga0rr50_330858_c1 | 3300050513 | Bacteria | 1279 |
| 1608 | nmdc:mga0rr50_493176_c1 | 3300050513 | Bacteria | 1041 |
| 1609 | nmdc:mga0rr50_616040_c1 | 3300050513 | Bacteria | 926 |
| 1610 | nmdc:mga0rr50_6776_c1 | 3300050513 | Bacteria | 7016 |
| 1611 | nmdc:mga08x19_120860_c1 | 3300050514 | Bacteria | 1756 |
| 1612 | nmdc:mga08x19_432681_c1 | 3300050514 | Bacteria | 925 |
| 1613 | nmdc:mga08x19_683414_c1 | 3300050514 | Bacteria | 728 |
| 1614 | nmdc:mga08x19_702090_c1 | 3300050514 | Bacteria | 718 |
| 1615 | nmdc:mga08x19_82647_c1 | 3300050514 | Bacteria | 2110 |
| 1616 | nmdc:mga08x19_855881_c1 | 3300050514 | Bacteria | 646 |
| 1617 | nmdc:mga0a205_27812_c1 | 3300050515 | Bacteria | 5401 |
| 1618 | nmdc:mga0a205_6917_c1 | 3300050515 | Bacteria | 10255 |
| 1619 | nmdc:mga0a205_745_c1 | 3300050515 | Bacteria | 26246 |
| 1620 | nmdc:mga0a205_86774_c1 | 3300050515 | Bacteria | 3023 |
| 1621 | Ga0495601_0000025 | 3300053077 | Bacteria | 127736 |
| 1622 | Ga0495601_0000869 | 3300053077 | Bacteria | 16487 |
| 1623 | Ga0495601_0002429 | 3300053077 | Bacteria | 10574 |
| 1624 | Ga0495601_0009249 | 3300053077 | Bacteria | 5823 |
| 1625 | Ga0495601_0031396 | 3300053077 | Bacteria | 3301 |
| 1626 | Ga0495601_0044802 | 3300053077 | Bacteria | 2780 |
| 1627 | Ga0495601_1083712 | 3300053077 | Bacteria | 502 |
| 1628 | Ga0495612_0000570 | 3300053078 | Bacteria | 14844 |
| 1629 | Ga0495612_0018791 | 3300053078 | Bacteria | 2767 |
| 1630 | Ga0495612_0019618 | 3300053078 | Bacteria | 2708 |
| 1631 | Ga0495655_0069626 | 3300053083 | Bacteria | 980 |
| 1632 | Ga0495655_0108503 | 3300053083 | Bacteria | 831 |
| 1633 | Ga0495595_0000041 | 3300053084 | Bacteria | 67592 |
| 1634 | Ga0495595_0001114 | 3300053084 | Bacteria | 10394 |
| 1635 | Ga0495595_0001865 | 3300053084 | Bacteria | 8184 |
| 1636 | Ga0495595_0003026 | 3300053084 | Bacteria | 6649 |
| 1637 | Ga0495595_0131510 | 3300053084 | Bacteria | 1223 |
| 1638 | Ga0495595_0283763 | 3300053084 | Bacteria | 832 |
| 1639 | Ga0495595_0325298 | 3300053084 | Bacteria | 774 |
| 1640 | Ga0495619_0000035 | 3300053085 | Bacteria | 126262 |
| 1641 | Ga0495619_0000430 | 3300053085 | Bacteria | 28482 |
| 1642 | Ga0495619_0001481 | 3300053085 | Bacteria | 15481 |
| 1643 | Ga0495619_0038883 | 3300053085 | Bacteria | 3104 |
| 1644 | Ga0495619_0044333 | 3300053085 | Bacteria | 2919 |
| 1645 | Ga0495619_0364946 | 3300053085 | Bacteria | 998 |
| 1646 | Ga0495619_0573316 | 3300053085 | Bacteria | 773 |
| 1647 | Ga0500643_001596 | 3300053087 | Bacteria | 12817 |
| 1648 | Ga0500644_0007015 | 3300053088 | Bacteria | 2916 |
| 1649 | Ga0500651_0047561 | 3300053093 | Bacteria | 2696 |
| 1650 | Ga0500566_0086112 | 3300053094 | Bacteria | 1742 |
| 1651 | Ga0500650_0233840 | 3300053098 | Bacteria | 828 |
| 1652 | Ga0500556_0190192 | 3300053104 | Bacteria | 811 |
| 1653 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 1654 | Ga0500595_071208 | 3300053119 | Bacteria | 1031 |
| 1655 | Ga0500642_0043920 | 3300053130 | Bacteria | 1944 |
| 1656 | Ga0500652_132321 | 3300053131 | Bacteria | 1040 |
| 1657 | Ga0500652_240738 | 3300053131 | Bacteria | 720 |
| 1658 | Ga0500568_0212978 | 3300053139 | Bacteria | 706 |
| 1659 | Ga0500568_0290997 | 3300053139 | Bacteria | 593 |
| 1660 | Ga0500573_0139542 | 3300053140 | Bacteria | 1336 |
| 1661 | Ga0500573_0434933 | 3300053140 | Bacteria | 611 |
| 1662 | Ga0500577_0082986 | 3300053142 | Bacteria | 1282 |
| 1663 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1664 | Ga0500645_021076 | 3300053730 | Bacteria | 2013 |
| 1665 | Ga0501084_0290907 | 3300054114 | Bacteria | 1380 |
| 1666 | Ga0501084_0396959 | 3300054114 | Bacteria | 1165 |
| 1667 | Ga0501084_0636089 | 3300054114 | Bacteria | 901 |
| 1668 | Ga0501084_0673691 | 3300054114 | Bacteria | 873 |
| 1669 | Ga0501084_0835028 | 3300054114 | Bacteria | 775 |
| 1670 | Ga0501084_0867267 | 3300054114 | Bacteria | 759 |
| 1671 | Ga0587117_022658 | 3300059627 | Bacteria | 889 |
| 1672 | Ga0587068_153057 | 3300059641 | Bacteria | 523 |
| 1673 | Ga0587079_226678 | 3300059647 | Bacteria | 522 |
| 1674 | Ga0587071_045962 | 3300060344 | Bacteria | 889 |
| 1675 | Ga0501082_0024224 | 3300060353 | Bacteria | 5233 |
| 1676 | Ga0501082_0024485 | 3300060353 | Bacteria | 5203 |
| 1677 | Ga0501082_0395421 | 3300060353 | Bacteria | 1206 |
| 1678 | Ga0501082_0508045 | 3300060353 | Bacteria | 1053 |
| 1679 | Ga0501082_0807961 | 3300060353 | Bacteria | 820 |
| 1680 | Ga0501082_1219068 | 3300060353 | Bacteria | 657 |
| 1681 | Ga0501082_1244332 | 3300060353 | Bacteria | 650 |
| 1682 | Ga0501082_1664670 | 3300060353 | Bacteria | 557 |
| 1683 | Ga0466962_0127681 | 3300061719 | Bacteria | 1228 |
| 1684 | Ga0466962_0273108 | 3300061719 | Bacteria | 833 |
| 1685 | Ga0530510_0037913 | 3300061734 | Bacteria | 3477 |
| 1686 | Ga0530510_0060643 | 3300061734 | Bacteria | 2738 |
| 1687 | Ga0500643_112762 | |||
| 1688 | 2214828544 | |||
| 1689 | ARSoilYngRDRAFT_c00061 | |||
| 1690 | ARcpr5yngRDRAFT_c000075 | |||
| 1691 | ARSoilOldRDRAFT_c000053 | |||
| 1692 | ARCol0oldRDRAFT_c00087 | |||
| 1693 | ARCol0yngRDRAFT_1000025 | |||
| 1694 | JGI24032J14994_100056 | |||
| 1695 | JGI24741J21665_1021617 | |||
| 1696 | JGI24746J21847_1002046 | |||
| 1697 | JGI24747J21853_1011054 | |||
| 1698 | JGI24739J22299_10019550 | |||
| 1699 | JGI24737J22298_10019784 | |||
| 1700 | JGI24737J22298_10034285 | |||
| 1701 | JGI24743J22301_10018255 | |||
| 1702 | JGI24743J22301_10048881 | |||
| 1703 | JGI24735J21928_10183634 | |||
| 1704 | JGI24750J21931_1000316 | |||
| 1705 | JGI24750J21931_1039382 | |||
| 1706 | JGI24745J21846_1000643 | |||
| 1707 | JGI24748J21848_1006811 | |||
| 1708 | JGI24748J21848_1016126 | |||
| 1709 | JGI24738J21930_10002068 | |||
| 1710 | JGI24749J21850_1001860 | |||
| 1711 | JGI24749J21850_1007303 | |||
| 1712 | JGI24749J21850_1016726 | |||
| 1713 | JGI24035J26624_1000222 | |||
| 1714 | JGI24033J26618_1006577 | |||
| 1715 | JGI24034J26672_10000885 | |||
| 1716 | JGI24742J22300_10001777 | |||
| 1717 | JGI25153J46596_10000830 | |||
| 1718 | JGI25153J46596_10012702 | |||
| 1719 | JGI25153J46596_10095157 | |||
| 1720 | JGI26129J50193_1004460 | |||
| 1721 | Ga0058862_12620432 | |||
| 1722 | Ga0058862_12749426 | |||
| 1723 | Ga0065716_1001548 | |||
| 1724 | Ga0065704_10136765 | |||
| 1725 | Ga0065712_10097334 | |||
| 1726 | Ga0065712_10154053 | |||
| 1727 | Ga0065712_10481422 | |||
| 1728 | Ga0065715_10002477 | |||
| 1729 | Ga0065715_10137215 | |||
| 1730 | Ga0065707_10221977 | |||
| 1731 | Ga0070658_10032170 | |||
| 1732 | Ga0070676_10002419 | |||
| 1733 | Ga0070676_10069041 | |||
| 1734 | Ga0070676_10426446 | |||
| 1735 | Ga0070683_100001083 | |||
| 1736 | Ga0070683_100016861 | |||
| 1737 | Ga0070683_100287619 | |||
| 1738 | Ga0070690_100018877 | |||
| 1739 | Ga0070690_100101714 | |||
| 1740 | Ga0070690_100193783 | |||
| 1741 | Ga0070670_100016356 | |||
| 1742 | Ga0070670_100620526 | |||
| 1743 | Ga0070677_10000959 | |||
| 1744 | Ga0068869_100000755 | |||
| 1745 | Ga0068869_100772730 | |||
| 1746 | Ga0070666_10127070 | |||
| 1747 | Ga0070680_100005733 | |||
| 1748 | Ga0070680_100006856 | |||
| 1749 | Ga0070680_100082555 | |||
| 1750 | Ga0070680_100109472 | |||
| 1751 | Ga0070680_100262774 | |||
| 1752 | Ga0070680_100460180 | |||
| 1753 | Ga0070680_101004180 | |||
| 1754 | Ga0070682_100001636 | |||
| 1755 | Ga0070682_100038516 | |||
| 1756 | Ga0070682_100057704 | |||
| 1757 | Ga0070682_100721536 | |||
| 1758 | Ga0068868_100006260 | |||
| 1759 | Ga0068868_100109693 | |||
| 1760 | Ga0068868_100134916 | |||
| 1761 | Ga0070660_100000245 | |||
| 1762 | Ga0070660_100015793 | |||
| 1763 | Ga0070660_100023815 | |||
| 1764 | Ga0070660_100036932 | |||
| 1765 | Ga0070660_100341261 | |||
| 1766 | Ga0070689_100005690 | |||
| 1767 | Ga0070689_100011434 | |||
| 1768 | Ga0070689_100258407 | |||
| 1769 | Ga0070691_10000386 | |||
| 1770 | Ga0070691_10002710 | |||
| 1771 | Ga0070691_10047921 | |||
| 1772 | Ga0070691_10496796 | |||
| 1773 | Ga0070687_100000348 | |||
| 1774 | Ga0070687_100104754 | |||
| 1775 | Ga0070687_100928955 | |||
| 1776 | Ga0070661_100000017 | |||
| 1777 | Ga0070661_100028862 | |||
| 1778 | Ga0070661_100252395 | |||
| 1779 | Ga0070661_100318049 | |||
| 1780 | Ga0070661_100353327 | |||
| 1781 | Ga0070661_101243042 | |||
| 1782 | Ga0070692_10000101 | |||
| 1783 | Ga0070692_10618397 | |||
| 1784 | Ga0070668_100054011 | |||
| 1785 | Ga0070668_100060030 | |||
| 1786 | Ga0070668_100078969 | |||
| 1787 | Ga0070669_100000314 | |||
| 1788 | Ga0070669_100349101 | |||
| 1789 | Ga0070675_100000161 | |||
| 1790 | Ga0070675_100074637 | |||
| 1791 | Ga0070675_100134504 | |||
| 1792 | Ga0070675_100276441 | |||
| 1793 | Ga0070671_100012885 | |||
| 1794 | Ga0070671_100259246 | |||
| 1795 | Ga0070674_100114332 | |||
| 1796 | Ga0070674_100428072 | |||
| 1797 | Ga0070673_100018429 | |||
| 1798 | Ga0070673_100049760 | |||
| 1799 | Ga0070673_100060499 | |||
| 1800 | Ga0070673_100076967 | |||
| 1801 | Ga0070673_100147687 | |||
| 1802 | Ga0070673_100301046 | |||
| 1803 | Ga0070688_100000991 | |||
| 1804 | Ga0070688_100004219 | |||
| 1805 | Ga0070688_100140355 | |||
| 1806 | Ga0070688_100152668 | |||
| 1807 | Ga0070659_100087845 | |||
| 1808 | Ga0070659_100173698 | |||
| 1809 | Ga0070659_100224119 | |||
| 1810 | Ga0070659_100680564 | |||
| 1811 | Ga0070667_100006114 | |||
| 1812 | Ga0070667_100026201 | |||
| 1813 | Ga0070667_100085289 | |||
| 1814 | Ga0070667_100239074 | |||
| 1815 | Ga0070667_100281389 | |||
| 1816 | Ga0070703_10033785 | |||
| 1817 | Ga0070703_10339604 | |||
| 1818 | Ga0070709_10003934 | |||
| 1819 | Ga0070709_10038757 | |||
| 1820 | Ga0070709_10053838 | |||
| 1821 | Ga0070709_10061805 | |||
| 1822 | Ga0070709_10131938 | |||
| 1823 | Ga0070709_10645083 | |||
| 1824 | Ga0070714_100020676 | |||
| 1825 | Ga0070714_100222884 | |||
| 1826 | Ga0070714_100488848 | |||
| 1827 | Ga0070714_101006647 | |||
| 1828 | Ga0070713_100001694 | |||
| 1829 | Ga0070713_100003041 | |||
| 1830 | Ga0070713_100015926 | |||
| 1831 | Ga0070713_100160468 | |||
| 1832 | Ga0070713_100178759 | |||
| 1833 | Ga0070713_100226838 | |||
| 1834 | Ga0070713_100242746 | |||
| 1835 | Ga0070713_100352058 | |||
| 1836 | Ga0070710_10015917 | |||
| 1837 | Ga0070710_10034381 | |||
| 1838 | Ga0070710_10066577 | |||
| 1839 | Ga0070710_10163657 | |||
| 1840 | Ga0070710_10394949 | |||
| 1841 | Ga0070701_10000204 | |||
| 1842 | Ga0070701_10012407 | |||
| 1843 | Ga0070701_10466967 | |||
| 1844 | Ga0070711_100007210 | |||
| 1845 | Ga0070711_100027936 | |||
| 1846 | Ga0070711_100056777 | |||
| 1847 | Ga0070711_100065901 | |||
| 1848 | Ga0070711_100196758 | |||
| 1849 | Ga0070711_100491404 | |||
| 1850 | Ga0070705_100004847 | |||
| 1851 | Ga0070705_100049688 | |||
| 1852 | Ga0070705_100396479 | |||
| 1853 | Ga0070700_100000856 | |||
| 1854 | Ga0070700_100194781 | |||
| 1855 | Ga0070700_100309989 | |||
| 1856 | Ga0070694_100021165 | |||
| 1857 | Ga0070694_100682990 | |||
| 1858 | Ga0070708_100050068 | |||
| 1859 | Ga0070663_100000945 | |||
| 1860 | Ga0070663_100017856 | |||
| 1861 | Ga0070663_100048584 | |||
| 1862 | Ga0070663_100185939 | |||
| 1863 | Ga0070663_100775360 | |||
| 1864 | Ga0070663_101097129 | |||
| 1865 | Ga0070678_100007929 | |||
| 1866 | Ga0070678_100028978 | |||
| 1867 | Ga0070678_100132698 | |||
| 1868 | Ga0070678_100495806 | |||
| 1869 | Ga0070662_100026862 | |||
| 1870 | Ga0070662_100042156 | |||
| 1871 | Ga0070662_100506425 | |||
| 1872 | Ga0070681_10004121 | |||
| 1873 | Ga0070681_10005192 | |||
| 1874 | Ga0070681_10019257 | |||
| 1875 | Ga0070681_10045790 | |||
| 1876 | Ga0070681_10141034 | |||
| 1877 | Ga0070681_10210732 | |||
| 1878 | Ga0070681_10308652 | |||
| 1879 | Ga0070681_10676177 | |||
| 1880 | Ga0068867_100002227 | |||
| 1881 | Ga0068867_100104555 | |||
| 1882 | Ga0070685_10019677 | |||
| 1883 | Ga0070685_10088882 | |||
| 1884 | Ga0070685_10284367 | |||
| 1885 | Ga0070685_10504412 | |||
| 1886 | Ga0070706_100252183 | |||
| 1887 | Ga0070707_100343335 | |||
| 1888 | Ga0070698_100892384 | |||
| 1889 | Ga0070698_101241090 | |||
| 1890 | Ga0070699_100260514 | |||
| 1891 | Ga0070699_101395070 | |||
| 1892 | Ga0070699_101775677 | |||
| 1893 | Ga0070679_100008686 | |||
| 1894 | Ga0070679_100059322 | |||
| 1895 | Ga0070679_100075114 | |||
| 1896 | Ga0070679_100104463 | |||
| 1897 | Ga0070679_100142711 | |||
| 1898 | Ga0070679_100358533 | |||
| 1899 | Ga0070679_100517168 | |||
| 1900 | Ga0070684_100000365 | |||
| 1901 | Ga0070684_100113259 | |||
| 1902 | Ga0070684_100150473 | |||
| 1903 | Ga0070684_100220453 | |||
| 1904 | Ga0070697_100654122 | |||
| 1905 | Ga0068853_100002095 | |||
| 1906 | Ga0068853_100002660 | |||
| 1907 | Ga0068853_100098304 | |||
| 1908 | Ga0068853_100108708 | |||
| 1909 | Ga0068853_100337036 | |||
| 1910 | Ga0070672_100049173 | |||
| 1911 | Ga0070672_100289492 | |||
| 1912 | Ga0070672_100799995 | |||
| 1913 | Ga0070686_100002828 | |||
| 1914 | Ga0070686_100078063 | |||
| 1915 | Ga0070686_100426219 | |||
| 1916 | Ga0070686_100445279 | |||
| 1917 | Ga0070686_100692544 | |||
| 1918 | Ga0070695_100009518 | |||
| 1919 | Ga0070695_100012934 | |||
| 1920 | Ga0070695_100048370 | |||
| 1921 | Ga0070695_100090371 | |||
| 1922 | Ga0070696_100023478 | |||
| 1923 | Ga0070696_100152460 | |||
| 1924 | Ga0070696_101281157 | |||
| 1925 | Ga0070696_101349775 | |||
| 1926 | Ga0070693_100000905 | |||
| 1927 | Ga0070693_100025605 | |||
| 1928 | Ga0070693_100072749 | |||
| 1929 | Ga0070693_100119332 | |||
| 1930 | Ga0070693_100236837 | |||
| 1931 | Ga0070693_100319006 | |||
| 1932 | Ga0070693_100454253 | |||
| 1933 | Ga0070693_100765753 | |||
| 1934 | Ga0070665_100165224 | |||
| 1935 | Ga0070665_100391897 | |||
| 1936 | Ga0070665_101154306 | |||
| 1937 | Ga0070665_101655400 | |||
| 1938 | Ga0070665_102072235 | |||
| 1939 | Ga0070704_100001366 | |||
| 1940 | Ga0070704_100021937 | |||
| 1941 | Ga0070704_100912527 | |||
| 1942 | Ga0070704_101391183 | |||
| 1943 | Ga0068855_100023189 | |||
| 1944 | Ga0068855_100030257 | |||
| 1945 | Ga0068855_100053934 | |||
| 1946 | Ga0068855_100076351 | |||
| 1947 | Ga0068855_100111493 | |||
| 1948 | Ga0070664_100002074 | |||
| 1949 | Ga0070664_100051635 | |||
| 1950 | Ga0068857_100003594 | |||
| 1951 | Ga0068857_100038829 | |||
| 1952 | Ga0068857_100079337 | |||
| 1953 | Ga0068857_100700986 | |||
| 1954 | Ga0068854_100000749 | |||
| 1955 | Ga0068854_100149360 | |||
| 1956 | Ga0068854_100280698 | |||
| 1957 | Ga0068854_100530192 | |||
| 1958 | Ga0068854_100851709 | |||
| 1959 | Ga0068856_100000902 | |||
| 1960 | Ga0068856_100002049 | |||
| 1961 | Ga0068856_100109437 | |||
| 1962 | Ga0068856_100264284 | |||
| 1963 | Ga0068856_100307468 | |||
| 1964 | Ga0068856_100426777 | |||
| 1965 | Ga0068856_100826939 | |||
| 1966 | Ga0070702_100007363 | |||
| 1967 | Ga0070702_100115751 | |||
| 1968 | Ga0070702_100302148 | |||
| 1969 | Ga0070702_101456277 | |||
| 1970 | Ga0068852_100004111 | |||
| 1971 | Ga0068852_100278911 | |||
| 1972 | Ga0068852_100336671 | |||
| 1973 | Ga0068852_100817534 | |||
| 1974 | Ga0068859_100006839 | |||
| 1975 | Ga0068859_100151443 | |||
| 1976 | Ga0068859_100188199 | |||
| 1977 | Ga0068859_100696719 | |||
| 1978 | Ga0068864_100000595 | |||
| 1979 | Ga0068864_100801079 | |||
| 1980 | Ga0068864_100888443 | |||
| 1981 | Ga0068864_100981964 | |||
| 1982 | Ga0068864_101062893 | |||
| 1983 | Ga0068864_101502968 | |||
| 1984 | Ga0068866_10000834 | |||
| 1985 | Ga0068866_10673148 | |||
| 1986 | Ga0068861_100000825 | |||
| 1987 | Ga0068861_100102398 | |||
| 1988 | Ga0068861_100224439 | |||
| 1989 | Ga0068851_10294186 | |||
| 1990 | Ga0068870_10000112 | |||
| 1991 | Ga0068863_100012849 | |||
| 1992 | Ga0068863_101669683 | |||
| 1993 | Ga0068858_100025610 | |||
| 1994 | Ga0068858_100042730 | |||
| 1995 | Ga0068858_100064539 | |||
| 1996 | Ga0068858_100112861 | |||
| 1997 | Ga0068858_100521962 | |||
| 1998 | Ga0068858_100875977 | |||
| 1999 | Ga0068860_100070125 | |||
| 2000 | Ga0068860_100103943 | |||
| 2001 | Ga0068860_100121365 | |||
| 2002 | Ga0068860_100121893 | |||
| 2003 | Ga0068860_100539527 | |||
| 2004 | Ga0068862_100004649 | |||
| 2005 | Ga0068862_100030534 | |||
| 2006 | Ga0081455_10000048 | |||
| 2007 | Ga0081455_10002425 | |||
| 2008 | Ga0081455_10079670 | |||
| 2009 | Ga0081455_10094886 | |||
| 2010 | Ga0081538_10165839 | |||
| 2011 | Ga0081540_1135422 | |||
| 2012 | Ga0081539_10054428 | |||
| 2013 | Ga0070717_10007139 | |||
| 2014 | Ga0070717_10044826 | |||
| 2015 | Ga0070717_10123210 | |||
| 2016 | Ga0070717_10193261 | |||
| 2017 | Ga0070717_10203149 | |||
| 2018 | Ga0070717_10369763 | |||
| 2019 | Ga0070717_10554722 | |||
| 2020 | Ga0075365_10187528 | |||
| 2021 | Ga0075365_10303004 | |||
| 2022 | Ga0075365_10541360 | |||
| 2023 | Ga0075365_10649278 | |||
| 2024 | Ga0075368_10162971 | |||
| 2025 | Ga0075364_10214500 | |||
| 2026 | Ga0075432_10070274 | |||
| 2027 | Ga0070715_10002476 | |||
| 2028 | Ga0070715_10051947 | |||
| 2029 | Ga0070716_100000346 | |||
| 2030 | Ga0070712_100123232 | |||
| 2031 | Ga0070712_100188090 | |||
| 2032 | Ga0070712_100305744 | |||
| 2033 | Ga0070712_100332996 | |||
| 2034 | Ga0070712_100421841 | |||
| 2035 | Ga0075362_10073846 | |||
| 2036 | Ga0075362_10240335 | |||
| 2037 | Ga0075367_10061301 | |||
| 2038 | Ga0075367_10156657 | |||
| 2039 | Ga0075367_10260480 | |||
| 2040 | Ga0075427_10003839 | |||
| 2041 | Ga0075366_10038100 | |||
| 2042 | Ga0075366_10069373 | |||
| 2043 | Ga0075366_10731434 | |||
| 2044 | Ga0097621_100000600 | |||
| 2045 | Ga0097621_100008260 | |||
| 2046 | Ga0097621_100083524 | |||
| 2047 | Ga0068871_100000118 | |||
| 2048 | Ga0068871_100003511 | |||
| 2049 | Ga0068871_100068572 | |||
| 2050 | Ga0075428_100006364 | |||
| 2051 | Ga0075428_100414073 | |||
| 2052 | Ga0075430_100000196 | |||
| 2053 | Ga0075431_100001183 | |||
| 2054 | Ga0075431_100030686 | |||
| 2055 | Ga0075433_10000991 | |||
| 2056 | Ga0075433_10058749 | |||
| 2057 | Ga0075433_10138919 | |||
| 2058 | Ga0075434_100006955 | |||
| 2059 | Ga0075434_100080382 | |||
| 2060 | Ga0075434_100156845 | |||
| 2061 | Ga0075434_100165496 | |||
| 2062 | Ga0075434_100622169 | |||
| 2063 | Ga0075434_100876859 | |||
| 2064 | Ga0075434_101523690 | |||
| 2065 | Ga0075429_100000573 | |||
| 2066 | Ga0068865_100002402 | |||
| 2067 | Ga0068865_100205807 | |||
| 2068 | Ga0068865_100909877 | |||
| 2069 | Ga0075436_100050481 | |||
| 2070 | Ga0075436_100067120 | |||
| 2071 | Ga0075436_100248187 | |||
| 2072 | Ga0075436_100746364 | |||
| 2073 | Ga0097620_100006838 | |||
| 2074 | Ga0097620_100151443 | |||
| 2075 | Ga0097620_100188203 | |||
| 2076 | Ga0097620_100696733 | |||
| 2077 | Ga0097620_101682728 | |||
| 2078 | Ga0075435_100026184 | |||
| 2079 | Ga0075435_100065161 | |||
| 2080 | Ga0075435_100133219 | |||
| 2081 | Ga0075435_100136316 | |||
| 2082 | Ga0075435_101349340 | |||
| 2083 | Ga0099794_10036846 | |||
| 2084 | Ga0099795_10096832 | |||
| 2085 | Ga0105251_10049977 | |||
| 2086 | Ga0105240_10001231 | |||
| 2087 | Ga0105240_10015848 | |||
| 2088 | Ga0105240_10029762 | |||
| 2089 | Ga0105240_10189209 | |||
| 2090 | Ga0105240_10322237 | |||
| 2091 | Ga0111539_10000683 | |||
| 2092 | Ga0111539_10004804 | |||
| 2093 | Ga0111539_10106813 | |||
| 2094 | Ga0111539_10619937 | |||
| 2095 | Ga0111539_11562896 | |||
| 2096 | Ga0111539_12069171 | |||
| 2097 | Ga0105245_10001982 | |||
| 2098 | Ga0105245_10032623 | |||
| 2099 | Ga0105245_10064026 | |||
| 2100 | Ga0105245_10069436 | |||
| 2101 | Ga0105245_10833457 | |||
| 2102 | Ga0105245_10880734 | |||
| 2103 | Ga0105247_10024545 | |||
| 2104 | Ga0105247_10405179 | |||
| 2105 | Ga0105247_10672767 | |||
| 2106 | Ga0105247_11052898 | |||
| 2107 | Ga0114129_10008352 | |||
| 2108 | Ga0114129_10056000 | |||
| 2109 | Ga0114129_10365952 | |||
| 2110 | Ga0114129_10519926 | |||
| 2111 | Ga0114129_10912257 | |||
| 2112 | Ga0114129_11186942 | |||
| 2113 | Ga0114129_11380762 | |||
| 2114 | Ga0105243_10002278 | |||
| 2115 | Ga0105243_10107190 | |||
| 2116 | Ga0105243_10116075 | |||
| 2117 | Ga0105243_10244414 | |||
| 2118 | Ga0105243_11548818 | |||
| 2119 | Ga0105243_11864334 | |||
| 2120 | Ga0105241_10015281 | |||
| 2121 | Ga0105241_10019842 | |||
| 2122 | Ga0105241_10060378 | |||
| 2123 | Ga0105241_10116351 | |||
| 2124 | Ga0105241_10619995 | |||
| 2125 | Ga0105242_10009023 | |||
| 2126 | Ga0105242_10033184 | |||
| 2127 | Ga0105242_10105043 | |||
| 2128 | Ga0105242_10434627 | |||
| 2129 | Ga0105248_10078593 | |||
| 2130 | Ga0105248_10118525 | |||
| 2131 | Ga0105248_10311914 | |||
| 2132 | Ga0105248_10640192 | |||
| 2133 | Ga0105248_10974446 | |||
| 2134 | Ga0105248_11046118 | |||
| 2135 | Ga0105248_12079175 | |||
| 2136 | Ga0105237_10003253 | |||
| 2137 | Ga0105237_10199230 | |||
| 2138 | Ga0105237_11107575 | |||
| 2139 | Ga0105238_10001939 | |||
| 2140 | Ga0105238_10125323 | |||
| 2141 | Ga0105238_10311988 | |||
| 2142 | Ga0105238_10329696 | |||
| 2143 | Ga0105238_10402467 | |||
| 2144 | Ga0105238_11668683 | |||
| 2145 | Ga0105249_10001021 | |||
| 2146 | Ga0105249_10097100 | |||
| 2147 | Ga0105249_10399539 | |||
| 2148 | Ga0105249_11874339 | |||
| 2149 | Ga0105035_124906 | |||
| 2150 | Ga0105239_10024925 | |||
| 2151 | Ga0105239_10053067 | |||
| 2152 | Ga0105239_10071533 | |||
| 2153 | Ga0105239_10918552 | |||
| 2154 | Ga0105239_11000590 | |||
| 2155 | Ga0105239_11100845 | |||
| 2156 | Ga0105239_11672828 | |||
| 2157 | Ga0105239_11676315 | |||
| 2158 | Ga0105239_12004665 | |||
| 2159 | Ga0105246_10007532 | |||
| 2160 | Ga0105246_10034231 | |||
| 2161 | Ga0105246_10133537 | |||
| 2162 | Ga0105246_10199036 | |||
| 2163 | Ga0105246_10533487 | |||
| 2164 | Ga0105246_10963115 | |||
| 2165 | Ga0105246_11375884 | |||
| 2166 | Ga0157340_1002355 | |||
| 2167 | Ga0157340_1005064 | |||
| 2168 | Ga0157317_1006105 | |||
| 2169 | Ga0157337_1001743 | |||
| 2170 | Ga0157335_1001290 | |||
| 2171 | Ga0157319_1000744 | |||
| 2172 | Ga0157314_1004810 | |||
| 2173 | Ga0157347_1033880 | |||
| 2174 | Ga0157316_1009216 | |||
| 2175 | Ga0157326_1014555 | |||
| 2176 | Ga0157373_10000820 | |||
| 2177 | Ga0157373_10038612 | |||
| 2178 | Ga0157373_10087904 | |||
| 2179 | Ga0157373_10230947 | |||
| 2180 | Ga0157373_10290017 | |||
| 2181 | Ga0157373_10779500 | |||
| 2182 | Ga0157373_11315958 | |||
| 2183 | Ga0157371_10056689 | |||
| 2184 | Ga0157371_10107692 | |||
| 2185 | Ga0157371_10363406 | |||
| 2186 | Ga0157371_10567848 | |||
| 2187 | Ga0157370_10003448 | |||
| 2188 | Ga0157370_10140736 | |||
| 2189 | Ga0157370_10335875 | |||
| 2190 | Ga0157370_10697307 | |||
| 2191 | Ga0157369_10001535 | |||
| 2192 | Ga0157369_10202540 | |||
| 2193 | Ga0157369_11317466 | |||
| 2194 | Ga0157369_12025311 | |||
| 2195 | Ga0157374_10066829 | |||
| 2196 | Ga0157374_10125118 | |||
| 2197 | Ga0157374_10140434 | |||
| 2198 | Ga0157374_10188020 | |||
| 2199 | Ga0157374_10232705 | |||
| 2200 | Ga0157374_10845647 | |||
| 2201 | Ga0157374_11962262 | |||
| 2202 | Ga0157378_10057104 | |||
| 2203 | Ga0157378_11067825 | |||
| 2204 | Ga0157378_11280230 | |||
| 2205 | Ga0157378_11375064 | |||
| 2206 | Ga0163162_10009279 | |||
| 2207 | Ga0163162_10020735 | |||
| 2208 | Ga0163162_10172801 | |||
| 2209 | Ga0163162_10267056 | |||
| 2210 | Ga0163162_10464185 | |||
| 2211 | Ga0163162_11944940 | |||
| 2212 | Ga0157372_10008268 | |||
| 2213 | Ga0157372_10210305 | |||
| 2214 | Ga0157372_11971534 | |||
| 2215 | Ga0157375_10044270 | |||
| 2216 | Ga0163163_10060628 | |||
| 2217 | Ga0163163_10116861 | |||
| 2218 | Ga0163163_10382703 | |||
| 2219 | Ga0163163_10542471 | |||
| 2220 | Ga0163163_11759736 | |||
| 2221 | Ga0163163_13027782 | |||
| 2222 | Ga0157380_10026178 | |||
| 2223 | Ga0157380_10163009 | |||
| 2224 | Ga0157380_10198955 | |||
| 2225 | Ga0157380_10255117 | |||
| 2226 | Ga0157380_10518613 | |||
| 2227 | Ga0157380_10733136 | |||
| 2228 | Ga0157380_10972099 | |||
| 2229 | Ga0157380_11032515 | |||
| 2230 | Ga0157379_10007681 | |||
| 2231 | Ga0157379_10074738 | |||
| 2232 | Ga0157379_10094699 | |||
| 2233 | Ga0157379_10169891 | |||
| 2234 | Ga0157379_12084888 | |||
| 2235 | Ga0157376_10025272 | |||
| 2236 | Ga0157376_10095317 | |||
| 2237 | Ga0157376_10135960 | |||
| 2238 | Ga0157376_10207521 | |||
| 2239 | Ga0157376_12201688 | |||
| 2240 | Ga0182007_10293798 | |||
| 2241 | Ga0163161_10000415 | |||
| 2242 | Ga0163161_11575846 | |||
| 2243 | Ga0197907_10403598 | |||
| 2244 | Ga0197907_10450514 | |||
| 2245 | Ga0206356_10699909 | |||
| 2246 | Ga0206356_11260616 | |||
| 2247 | Ga0206356_11379387 | |||
| 2248 | Ga0206355_1694710 | |||
| 2249 | Ga0206352_10038065 | |||
| 2250 | Ga0206352_10652386 | |||
| 2251 | Ga0206352_10824787 | |||
| 2252 | Ga0206352_11021523 | |||
| 2253 | Ga0206350_11469831 | |||
| 2254 | Ga0206354_10362155 | |||
| 2255 | Ga0206353_10245002 | |||
| 2256 | Ga0206353_10402798 | |||
| 2257 | Ga0154015_1621370 | |||
| 2258 | Ga0213872_10049499 | |||
| 2259 | Ga0213872_10110389 | |||
| 2260 | Ga0213874_10101088 | |||
| 2261 | Ga0213876_10000421 | |||
| 2262 | Ga0224712_10200510 | |||
| 2263 | Ga0207666_1000073 | |||
| 2264 | Ga0207666_1011580 | |||
| 2265 | Ga0209758_1000013 | |||
| 2266 | Ga0209758_1000548 | |||
| 2267 | Ga0209758_1052742 | |||
| 2268 | Ga0207426_1024287 | |||
| 2269 | Ga0207697_10024143 | |||
| 2270 | Ga0207697_10024296 | |||
| 2271 | Ga0207656_10051797 | |||
| 2272 | Ga0207656_10503287 | |||
| 2273 | Ga0207713_1112270 | |||
| 2274 | Ga0207653_10002714 | |||
| 2275 | Ga0207653_10052962 | |||
| 2276 | Ga0207682_10000350 | |||
| 2277 | Ga0207692_10009320 | |||
| 2278 | Ga0207692_10047506 | |||
| 2279 | Ga0207692_10679238 | |||
| 2280 | Ga0207642_10000638 | |||
| 2281 | Ga0207642_10112122 | |||
| 2282 | Ga0207642_10531658 | |||
| 2283 | Ga0207710_10127171 | |||
| 2284 | Ga0207688_10000001 | |||
| 2285 | Ga0207688_10073044 | |||
| 2286 | Ga0207688_10230680 | |||
| 2287 | Ga0207680_10026966 | |||
| 2288 | Ga0207680_10075759 | |||
| 2289 | Ga0207647_10002852 | |||
| 2290 | Ga0207647_10065304 | |||
| 2291 | Ga0207685_10049007 | |||
| 2292 | Ga0207685_10170302 | |||
| 2293 | Ga0207685_10191194 | |||
| 2294 | Ga0207685_10366055 | |||
| 2295 | Ga0207699_10002264 | |||
| 2296 | Ga0207699_10048706 | |||
| 2297 | Ga0207699_10125854 | |||
| 2298 | Ga0207699_10285012 | |||
| 2299 | Ga0207699_10442126 | |||
| 2300 | Ga0207699_10640397 | |||
| 2301 | Ga0207699_11106439 | |||
| 2302 | Ga0207645_10000222 | |||
| 2303 | Ga0207645_10065550 | |||
| 2304 | Ga0207645_10405126 | |||
| 2305 | Ga0207643_10000009 | |||
| 2306 | Ga0207643_10732483 | |||
| 2307 | Ga0207705_10005544 | |||
| 2308 | Ga0207654_10053603 | |||
| 2309 | Ga0207654_10123061 | |||
| 2310 | Ga0207654_10243534 | |||
| 2311 | Ga0207707_10009792 | |||
| 2312 | Ga0207707_10027971 | |||
| 2313 | Ga0207707_10034403 | |||
| 2314 | Ga0207707_10045417 | |||
| 2315 | Ga0207707_10229371 | |||
| 2316 | Ga0207707_10267476 | |||
| 2317 | Ga0207707_11101696 | |||
| 2318 | Ga0207707_11109240 | |||
| 2319 | Ga0207695_10001037 | |||
| 2320 | Ga0207695_10012684 | |||
| 2321 | Ga0207695_10120619 | |||
| 2322 | Ga0207695_10161789 | |||
| 2323 | Ga0207695_10497021 | |||
| 2324 | Ga0207671_10041568 | |||
| 2325 | Ga0207671_10186930 | |||
| 2326 | Ga0207693_10004694 | |||
| 2327 | Ga0207693_10028016 | |||
| 2328 | Ga0207693_10074737 | |||
| 2329 | Ga0207693_10161048 | |||
| 2330 | Ga0207693_10346813 | |||
| 2331 | Ga0207693_10817221 | |||
| 2332 | Ga0207663_10017267 | |||
| 2333 | Ga0207663_10121328 | |||
| 2334 | Ga0207663_10123374 | |||
| 2335 | Ga0207663_10157314 | |||
| 2336 | Ga0207660_10000197 | |||
| 2337 | Ga0207660_10016311 | |||
| 2338 | Ga0207660_10019663 | |||
| 2339 | Ga0207660_10023826 | |||
| 2340 | Ga0207660_10352527 | |||
| 2341 | Ga0207660_10669287 | |||
| 2342 | Ga0207660_11581187 | |||
| 2343 | Ga0207662_10028451 | |||
| 2344 | Ga0207662_10154682 | |||
| 2345 | Ga0207662_10740236 | |||
| 2346 | Ga0207657_10044442 | |||
| 2347 | Ga0207657_10055996 | |||
| 2348 | Ga0207657_10104175 | |||
| 2349 | Ga0207657_10107088 | |||
| 2350 | Ga0207657_10151486 | |||
| 2351 | Ga0207649_10000052 | |||
| 2352 | Ga0207649_10091718 | |||
| 2353 | Ga0207649_10104851 | |||
| 2354 | Ga0207649_10383648 | |||
| 2355 | Ga0207652_10001438 | |||
| 2356 | Ga0207652_10013408 | |||
| 2357 | Ga0207652_10071805 | |||
| 2358 | Ga0207652_10096158 | |||
| 2359 | Ga0207652_10269135 | |||
| 2360 | Ga0207652_10440775 | |||
| 2361 | Ga0207652_11272228 | |||
| 2362 | Ga0207646_10045479 | |||
| 2363 | Ga0207681_10002118 | |||
| 2364 | Ga0207681_10126410 | |||
| 2365 | Ga0207694_10085177 | |||
| 2366 | Ga0207694_10151947 | |||
| 2367 | Ga0207694_10227025 | |||
| 2368 | Ga0207694_10969752 | |||
| 2369 | Ga0207650_10068752 | |||
| 2370 | Ga0207650_10444364 | |||
| 2371 | Ga0207650_10801544 | |||
| 2372 | Ga0207659_10000132 | |||
| 2373 | Ga0207687_10000174 | |||
| 2374 | Ga0207687_10104768 | |||
| 2375 | Ga0207700_10029101 | |||
| 2376 | Ga0207700_10071813 | |||
| 2377 | Ga0207700_10114416 | |||
| 2378 | Ga0207700_10229483 | |||
| 2379 | Ga0207700_10256038 | |||
| 2380 | Ga0207700_10476709 | |||
| 2381 | Ga0207700_10694273 | |||
| 2382 | Ga0207700_11079816 | |||
| 2383 | Ga0207664_10000478 | |||
| 2384 | Ga0207664_10006275 | |||
| 2385 | Ga0207664_10072425 | |||
| 2386 | Ga0207664_10197031 | |||
| 2387 | Ga0207664_10208600 | |||
| 2388 | Ga0207664_10286647 | |||
| 2389 | Ga0207664_10456449 | |||
| 2390 | Ga0207644_10000212 | |||
| 2391 | Ga0207644_10451134 | |||
| 2392 | Ga0207690_10001288 | |||
| 2393 | Ga0207690_10302921 | |||
| 2394 | Ga0207690_11858231 | |||
| 2395 | Ga0207706_10041870 | |||
| 2396 | Ga0207706_10063219 | |||
| 2397 | Ga0207706_10101430 | |||
| 2398 | Ga0207706_10162826 | |||
| 2399 | Ga0207706_11321384 | |||
| 2400 | Ga0207686_10001289 | |||
| 2401 | Ga0207686_10147807 | |||
| 2402 | Ga0207686_10423954 | |||
| 2403 | Ga0207686_10595939 | |||
| 2404 | Ga0207709_10000530 | |||
| 2405 | Ga0207709_10215518 | |||
| 2406 | Ga0207670_10000523 | |||
| 2407 | Ga0207670_10108831 | |||
| 2408 | Ga0207670_10266778 | |||
| 2409 | Ga0207669_10000235 | |||
| 2410 | Ga0207669_10078273 | |||
| 2411 | Ga0207669_11208647 | |||
| 2412 | Ga0207704_10000198 | |||
| 2413 | Ga0207704_10204288 | |||
| 2414 | Ga0207704_10335882 | |||
| 2415 | Ga0207704_10453855 | |||
| 2416 | Ga0207665_10000273 | |||
| 2417 | Ga0207665_10052174 | |||
| 2418 | Ga0207665_10065544 | |||
| 2419 | Ga0207665_10196776 | |||
| 2420 | Ga0207665_10276631 | |||
| 2421 | Ga0207691_10000517 | |||
| 2422 | Ga0207691_10057922 | |||
| 2423 | Ga0207691_10619330 | |||
| 2424 | Ga0207711_10006368 | |||
| 2425 | Ga0207711_10011248 | |||
| 2426 | Ga0207711_10127471 | |||
| 2427 | Ga0207711_10857677 | |||
| 2428 | Ga0207689_10000031 | |||
| 2429 | Ga0207689_10388743 | |||
| 2430 | Ga0207661_10001228 | |||
| 2431 | Ga0207679_10000183 | |||
| 2432 | Ga0207679_10192673 | |||
| 2433 | Ga0207667_10004001 | |||
| 2434 | Ga0207667_10012207 | |||
| 2435 | Ga0207667_10039092 | |||
| 2436 | Ga0207667_10062790 | |||
| 2437 | Ga0207667_10255836 | |||
| 2438 | Ga0207667_11524714 | |||
| 2439 | Ga0207651_10000051 | |||
| 2440 | Ga0207651_10067548 | |||
| 2441 | Ga0207651_10567714 | |||
| 2442 | Ga0207651_11168551 | |||
| 2443 | Ga0207712_10000738 | |||
| 2444 | Ga0207712_10048716 | |||
| 2445 | Ga0207712_10206744 | |||
| 2446 | Ga0207668_10000664 | |||
| 2447 | Ga0207668_10200896 | |||
| 2448 | Ga0207668_10423622 | |||
| 2449 | Ga0207640_10000343 | |||
| 2450 | Ga0207640_10130022 | |||
| 2451 | Ga0207640_10521555 | |||
| 2452 | Ga0207640_11040293 | |||
| 2453 | Ga0207658_10057127 | |||
| 2454 | Ga0207658_10193076 | |||
| 2455 | Ga0207658_10498259 | |||
| 2456 | Ga0207677_10010253 | |||
| 2457 | Ga0207677_10018951 | |||
| 2458 | Ga0207677_11423901 | |||
| 2459 | Ga0207703_10002904 | |||
| 2460 | Ga0207703_10028495 | |||
| 2461 | Ga0207703_10036270 | |||
| 2462 | Ga0207703_10266721 | |||
| 2463 | Ga0207703_10420806 | |||
| 2464 | Ga0207703_11572392 | |||
| 2465 | Ga0207639_10001257 | |||
| 2466 | Ga0207639_10017714 | |||
| 2467 | Ga0207639_10635906 | |||
| 2468 | Ga0207639_10913062 | |||
| 2469 | Ga0207678_10060468 | |||
| 2470 | Ga0207678_10131444 | |||
| 2471 | Ga0207678_10136346 | |||
| 2472 | Ga0207678_10492824 | |||
| 2473 | Ga0207678_10670144 | |||
| 2474 | Ga0207708_10048142 | |||
| 2475 | Ga0207708_10065374 | |||
| 2476 | Ga0207708_10093062 | |||
| 2477 | Ga0207708_10481178 | |||
| 2478 | Ga0207702_10003284 | |||
| 2479 | Ga0207702_10011946 | |||
| 2480 | Ga0207702_10088550 | |||
| 2481 | Ga0207702_10333595 | |||
| 2482 | Ga0207702_10518368 | |||
| 2483 | Ga0207702_11557403 | |||
| 2484 | Ga0207641_10001831 | |||
| 2485 | Ga0207641_10041398 | |||
| 2486 | Ga0207641_11175904 | |||
| 2487 | Ga0207648_10000581 | |||
| 2488 | Ga0207648_10097104 | |||
| 2489 | Ga0207648_10205752 | |||
| 2490 | Ga0207648_10206868 | |||
| 2491 | Ga0207648_10370771 | |||
| 2492 | Ga0207648_10505893 | |||
| 2493 | Ga0207676_10000124 | |||
| 2494 | Ga0207676_10048665 | |||
| 2495 | Ga0207676_10420265 | |||
| 2496 | Ga0207676_10486636 | |||
| 2497 | Ga0207674_10001605 | |||
| 2498 | Ga0207674_10128096 | |||
| 2499 | Ga0207674_10201166 | |||
| 2500 | Ga0207675_100000414 | |||
| 2501 | Ga0207675_100065029 | |||
| 2502 | Ga0207675_100141370 | |||
| 2503 | Ga0207683_10000242 | |||
| 2504 | Ga0207683_10012573 | |||
| 2505 | Ga0207683_10086140 | |||
| 2506 | Ga0207683_10970737 | |||
| 2507 | Ga0207698_10000951 | |||
| 2508 | Ga0207698_10719028 | |||
| 2509 | Ga0207698_11025287 | |||
| 2510 | Ga0207698_11214340 | |||
| 2511 | Ga0207698_11290832 | |||
| 2512 | Ga0207698_11732545 | |||
| 2513 | Ga0207698_12697065 | |||
| 2514 | Ga0209973_1017621 | |||
| 2515 | Ga0209973_1024243 | |||
| 2516 | Ga0209969_1038746 | |||
| 2517 | Ga0209996_1011196 | |||
| 2518 | Ga0209995_1021592 | |||
| 2519 | Ga0209995_1036100 | |||
| 2520 | Ga0209179_1000116 | |||
| 2521 | Ga0209982_1008297 | |||
| 2522 | Ga0209970_1004927 | |||
| 2523 | Ga0210002_1001458 | |||
| 2524 | Ga0209983_1086438 | |||
| 2525 | Ga0209588_1021222 | |||
| 2526 | Ga0209971_1039672 | |||
| 2527 | Ga0209966_1000641 | |||
| 2528 | Ga0209998_10011991 | |||
| 2529 | Ga0209998_10029104 | |||
| 2530 | Ga0209998_10057600 | |||
| 2531 | Ga0209813_10101548 | |||
| 2532 | Ga0209813_10170364 | |||
| 2533 | Ga0209974_10009862 | |||
| 2534 | Ga0209974_10065145 | |||
| 2535 | Ga0207428_10000037 | |||
| 2536 | Ga0207428_10001773 | |||
| 2537 | Ga0207428_10002442 | |||
| 2538 | Ga0268266_10068513 | |||
| 2539 | Ga0268266_10220254 | |||
| 2540 | Ga0268266_10396400 | |||
| 2541 | Ga0268265_10003320 | |||
| 2542 | Ga0268265_10006176 | |||
| 2543 | Ga0268265_10031542 | |||
| 2544 | Ga0268265_12419870 | |||
| 2545 | Ga0268264_10002331 | |||
| 2546 | Ga0268264_10029317 | |||
| 2547 | Ga0268264_10119996 | |||
| 2548 | Ga0268264_10411466 | |||
| 2549 | Ga0268264_10437869 | |||
| 2550 | Ga0265337_1000827 | |||
| 2551 | Ga0265337_1198661 | |||
| 2552 | Ga0265334_10129897 | |||
| 2553 | Ga0265334_10145145 | |||
| 2554 | Ga0265334_10279855 | |||
| 2555 | Ga0265338_10043919 | |||
| 2556 | Ga0265338_10462856 | |||
| 2557 | Ga0265330_10153761 | |||
| 2558 | Ga0265332_10121255 | |||
| 2559 | Ga0265332_10254443 | |||
| 2560 | Ga0265328_10075839 | |||
| 2561 | Ga0265328_10407279 | |||
| 2562 | Ga0265325_10001071 | |||
| 2563 | Ga0265325_10009381 | |||
| 2564 | Ga0265325_10069725 | |||
| 2565 | Ga0265325_10096452 | |||
| 2566 | Ga0265325_10104334 | |||
| 2567 | Ga0265325_10243580 | |||
| 2568 | Ga0265329_10097503 | |||
| 2569 | Ga0265340_10000595 | |||
| 2570 | Ga0265340_10010231 | |||
| 2571 | Ga0265340_10020380 | |||
| 2572 | Ga0265340_10023130 | |||
| 2573 | Ga0265340_10023676 | |||
| 2574 | Ga0265340_10071131 | |||
| 2575 | Ga0265340_10154642 | |||
| 2576 | Ga0265340_10268243 | |||
| 2577 | Ga0265339_10001408 | |||
| 2578 | Ga0265339_10002105 | |||
| 2579 | Ga0265339_10013957 | |||
| 2580 | Ga0265339_10094870 | |||
| 2581 | Ga0265339_10552650 | |||
| 2582 | Ga0265331_10014022 | |||
| 2583 | Ga0265316_10005588 | |||
| 2584 | Ga0265316_10079155 | |||
| 2585 | Ga0265316_10170001 | |||
| 2586 | Ga0307513_10475149 | |||
| 2587 | Ga0307408_100910917 | |||
| 2588 | Ga0265313_10000031 | |||
| 2589 | Ga0265313_10003687 | |||
| 2590 | Ga0265313_10003967 | |||
| 2591 | Ga0265313_10004533 | |||
| 2592 | Ga0265313_10005420 | |||
| 2593 | Ga0265313_10022796 | |||
| 2594 | Ga0265313_10036516 | |||
| 2595 | Ga0265313_10050230 | |||
| 2596 | Ga0265313_10063677 | |||
| 2597 | Ga0265313_10140853 | |||
| 2598 | Ga0265313_10183845 | |||
| 2599 | Ga0265313_10242318 | |||
| 2600 | Ga0265314_10004990 | |||
| 2601 | Ga0265314_10006134 | |||
| 2602 | Ga0265314_10116303 | |||
| 2603 | Ga0265314_10166868 | |||
| 2604 | Ga0265342_10002950 | |||
| 2605 | Ga0265342_10009052 | |||
| 2606 | Ga0265342_10017557 | |||
| 2607 | Ga0265342_10080105 | |||
| 2608 | Ga0265342_10112426 | |||
| 2609 | Ga0265342_10166813 | |||
| 2610 | Ga0265342_10230327 | |||
| 2611 | Ga0307405_10541041 | |||
| 2612 | Ga0307405_11571364 | |||
| 2613 | Ga0307413_10463563 | |||
| 2614 | Ga0307410_10599571 | |||
| 2615 | Ga0307406_11517626 | |||
| 2616 | Ga0307406_11805906 | |||
| 2617 | Ga0307407_10216363 | |||
| 2618 | Ga0307412_11650853 | |||
| 2619 | Ga0307409_100297855 | |||
| 2620 | Ga0307409_101596973 | |||
| 2621 | Ga0307409_101818529 | |||
| 2622 | Ga0307416_100350392 | |||
| 2623 | Ga0373930_0000352 | |||
| 2624 | Ga0373930_0170420 | |||
| 2625 | Ga0373948_0000262 | |||
| 2626 | Ga0373950_0000155 | |||
| 2627 | Ga0373958_0000136 | |||
| 2628 | Ga0373959_0000508 | |||
| 2629 | Ga0373938_0000013 | |||
| 2630 | Ga0373938_0010938 | |||
| 2631 | Ga0373938_0145369 | |||
| 2632 | Ga0373926_0001371 | |||
| 2633 | Ga0373926_0155249 | |||
| 2634 | Ga0373926_0261108 | |||
| 2635 | Ga0373928_0000255 | |||
| 2636 | Ga0373928_0034036 | |||
| 2637 | Ga0373929_0002106 | |||
| 2638 | Ga0373929_0018776 | |||
| 2639 | Ga0373934_0095854 | |||
| 2640 | Ga0373940_0000097 | |||
| 2641 | Ga0373940_0096900 | |||
| 2642 | Ga0373944_0007536 | |||
| 2643 | Ga0373949_0002652 | |||
| 2644 | Ga0373949_0027429 | |||
| 2645 | Ga0373949_0043701 | |||
| 2646 | Ga0373949_0146973 | |||
| 2647 | Ga0373951_0004343 | |||
| 2648 | Ga0373952_0000182 | |||
| 2649 | Ga0373952_0001880 | |||
| 2650 | Ga0373923_0009752 | |||
| 2651 | Ga0373923_0037057 | |||
| 2652 | Ga0373923_0129868 | |||
| 2653 | Ga0373923_0275670 | |||
| 2654 | Ga0373923_0381990 | |||
| 2655 | Ga0373932_0000252 | |||
| 2656 | Ga0373932_0000830 | |||
| 2657 | Ga0373932_0110613 | |||
| 2658 | Ga0373936_0007704 | |||
| 2659 | Ga0373936_0015784 | |||
| 2660 | Ga0373939_0001022 | |||
| 2661 | Ga0373939_0004646 | |||
| 2662 | Ga0373939_0011288 | |||
| 2663 | Ga0373941_0000125 | |||
| 2664 | Ga0373941_0091707 | |||
| 2665 | Ga0373941_0100106 | |||
| 2666 | Ga0373941_0295786 | |||
| 2667 | Ga0373945_0035220 | |||
| 2668 | Ga0373945_0036416 | |||
| 2669 | Ga0373945_0060204 | |||
| 2670 | Ga0373953_0015314 | |||
| 2671 | Ga0373953_0026316 | |||
| 2672 | Ga0373953_0035794 | |||
| 2673 | Ga0373954_0002715 | |||
| 2674 | Ga0373954_0017164 | |||
| 2675 | Ga0373954_0052172 | |||
| 2676 | Ga0373954_0226256 | |||
| 2677 | Ga0373956_0002024 | |||
| 2678 | Ga0373956_0008190 | |||
| 2679 | Ga0373956_0012364 | |||
| 2680 | Ga0373957_0017927 | |||
| 2681 | Ga0373957_0019472 | |||
| 2682 | Ga0373957_0057994 | |||
| 2683 | Ga0373957_0303102 | |||
| 2684 | Ga0373960_0000068 | |||
| 2685 | Ga0373960_0005186 | |||
| 2686 | Ga0373960_0049576 | |||
| 2687 | Ga0373943_0007567 | |||
| 2688 | Ga0373943_0013145 | |||
| 2689 | Ga0373943_0025295 | |||
| 2690 | Ga0373943_0047950 | |||
| 2691 | Ga0373946_0010959 | |||
| 2692 | Ga0373946_0021880 | |||
| 2693 | Ga0373946_0211283 | |||
| 2694 | Ga0373946_0401209 | |||
| 2695 | Ga0373955_0001002 | |||
| 2696 | Ga0373955_0003246 | |||
| 2697 | Ga0373955_0012262 | |||
| 2698 | Ga0373955_0041789 | |||
| 2699 | Ga0373942_0001496 | |||
| 2700 | Ga0373942_0017748 | |||
| 2701 | Ga0373961_0000638 | |||
| 2702 | Ga0373961_0008988 | |||
| 2703 | Ga0373961_0282338 | |||
| 2704 | Ga0373962_0000112 | |||
| 2705 | Ga0373962_0003469 | |||
| 2706 | Ga0373962_0006987 | |||
| 2707 | Ga0373962_0087475 | |||
| 2708 | Ga0373924_0045870 | |||
| 2709 | Ga0373924_0155771 | |||
| 2710 | Ga0373924_0166202 | |||
| 2711 | Ga0373924_0255338 | |||
| 2712 | Ga0373931_0000305 | |||
| 2713 | Ga0373931_0001634 | |||
| 2714 | Ga0373931_0103890 | |||
| 2715 | Ga0373931_0115030 | |||
| 2716 | Ga0373931_0119175 | |||
| 2717 | Ga0373931_0298677 | |||
| 2718 | Ga0373931_0460339 | |||
| 2719 | Ga0373931_0563181 | |||
| 2720 | Ga0373935_0000768 | |||
| 2721 | Ga0373935_0033271 | |||
| 2722 | Ga0373935_0060054 | |||
| 2723 | Ga0373935_0069751 | |||
| 2724 | Ga0373935_0198900 | |||
| 2725 | Ga0373935_0729323 | |||
| 2726 | Ga0373927_0017282 | |||
| 2727 | Ga0373927_0017738 | |||
| 2728 | Ga0373933_0002755 | |||
| 2729 | Ga0373933_0012124 | |||
| 2730 | Ga0373933_0032980 | |||
| 2731 | Ga0373933_0331363 | |||
| 2732 | Ga0373933_0337578 | |||
| 2733 | Ga0373947_0005394 | |||
| 2734 | Ga0373947_0058158 | |||
| 2735 | Ga0373947_0113971 | |||
| 2736 | Ga0373937_0000057 | |||
| 2737 | Ga0373937_0005145 | |||
| 2738 | Ga0373937_0021076 | |||
| 2739 | Ga0373937_0089618 | |||
| 2740 | Ga0373937_0147389 | |||
| 2741 | Ga0373937_0544377 | |||
| 2742 | Ga0316582_0188075 | |||
| 2743 | Ga0316584_0001009 | |||
| 2744 | Ga0373925_0000435 | |||
| 2745 | Ga0373925_0026064 | |||
| 2746 | Ga0373925_0034339 | |||
| 2747 | Ga0373925_0039839 | |||
| 2748 | Ga0395899_0027617 | |||
| 2749 | Ga0395899_0091027 | |||
| 2750 | Ga0395899_0108346 | |||
| 2751 | Ga0395899_0509727 | |||
| 2752 | Ga0395899_0628217 | |||
| 2753 | Ga0395899_0638165 | |||
| 2754 | Ga0395900_0021199 | |||
| 2755 | Ga0395900_0079908 | |||
| 2756 | Ga0395900_0366054 | |||
| 2757 | Ga0395900_0810990 | |||
| 2758 | Ga0395900_1372975 | |||
| 2759 | Ga0395898_0012850 | |||
| 2760 | Ga0395898_0120982 | |||
| 2761 | Ga0395898_0216830 | |||
| 2762 | Ga0395905_1858586 | |||
| 2763 | Ga0436364_0275541 | |||
| 2764 | Ga0395901_0032023 | |||
| 2765 | Ga0395901_0132013 | |||
| 2766 | Ga0395901_0206033 | |||
| 2767 | Ga0395901_0214538 | |||
| 2768 | Ga0395901_0286280 | |||
| 2769 | Ga0242420_047701 | |||
| 2770 | Ga0400483_057660 | |||
| 2771 | Ga0400483_114523 | |||
| 2772 | Ga0400483_151905 | |||
| 2773 | Ga0400483_217885 | |||
| 2774 | Ga0436365_0682766 | |||
| 2775 | Ga0436365_0903794 | |||
| 2776 | Ga0436365_1078722 | |||
| 2777 | Ga0436365_1131499 | |||
| 2778 | Ga0436360_1129497 | |||
| 2779 | Ga0436361_0097962 | |||
| 2780 | Ga0436361_0555071 | |||
| 2781 | Ga0436361_0572950 | |||
| 2782 | Ga0436363_0063809 | |||
| 2783 | Ga0436363_1200183 | |||
| 2784 | Ga0436363_1679896 | |||
| 2785 | Ga0436362_0103032 | |||
| 2786 | Ga0439465_0047897 | |||
| 2787 | Ga0439441_062304 | |||
| 2788 | Ga0439441_105782 | |||
| 2789 | Ga0439448_0152482 | |||
| 2790 | Ga0439450_053610 | |||
| 2791 | Ga0439455_0005610 | |||
| 2792 | Ga0439456_038656 | |||
| 2793 | Ga0450920_139308 | |||
| 2794 | Ga0450923_004336 | |||
| 2795 | Ga0439459_0065286 | |||
| 2796 | Ga0439464_0022068 | |||
| 2797 | Ga0451577_0102181 | |||
| 2798 | Ga0466972_0457002 | |||
| 2799 | Ga0453683_0835583 | |||
| 2800 | Ga0466966_0067594 | |||
| 2801 | Ga0466961_0407176 | |||
| 2802 | Ga0466963_0052778 | |||
| 2803 | Ga0466963_0305327 | |||
| 2804 | Ga0466963_0461061 | |||
| 2805 | Ga0453684_1338739 | |||
| 2806 | Ga0466971_0121746 | |||
| 2807 | Ga0466968_0046854 | |||
| 2808 | Ga0466970_0605719 | |||
| 2809 | Ga0466957_0042883 | |||
| 2810 | Ga0466957_0287238 | |||
| 2811 | Ga0466957_0528026 | |||
| 2812 | Ga0466960_0068146 | |||
| 2813 | Ga0451576_0014613 | |||
| 2814 | Ga0466958_0087166 | |||
| 2815 | Ga0466958_0150677 | |||
| 2816 | Ga0466958_0587406 | |||
| 2817 | Ga0466967_0150260 | |||
| 2818 | Ga0466967_1060224 | |||
| 2819 | Ga0466967_1359010 | |||
| 2820 | Ga0466967_1727867 | |||
| 2821 | Ga0466967_1743619 | |||
| 2822 | Ga0466967_1871610 | |||
| 2823 | Ga0495592_0014401 | |||
| 2824 | Ga0495592_0064894 | |||
| 2825 | Ga0495592_0171347 | |||
| 2826 | Ga0495603_0018592 | |||
| 2827 | Ga0495590_0036240 | |||
| 2828 | Ga0495629_0003401 | |||
| 2829 | Ga0495629_0210900 | |||
| 2830 | Ga0495638_0091275 | |||
| 2831 | Ga0495638_0157555 | |||
| 2832 | Ga0495641_0018852 | |||
| 2833 | Ga0495651_0000205 | |||
| 2834 | Ga0495651_0001390 | |||
| 2835 | Ga0495651_0003040 | |||
| 2836 | Ga0495651_0251434 | |||
| 2837 | Ga0495651_0448229 | |||
| 2838 | Ga0495653_0000120 | |||
| 2839 | Ga0495653_0003820 | |||
| 2840 | Ga0495653_0069439 | |||
| 2841 | Ga0495580_0209732 | |||
| 2842 | Ga0495580_0804085 | |||
| 2843 | Ga0495582_0034706 | |||
| 2844 | Ga0495582_0063214 | |||
| 2845 | Ga0495582_0533630 | |||
| 2846 | Ga0495639_0017560 | |||
| 2847 | Ga0495662_0001020 | |||
| 2848 | Ga0495662_0030489 | |||
| 2849 | Ga0495662_0118993 | |||
| 2850 | Ga0495664_0000023 | |||
| 2851 | Ga0495664_0003117 | |||
| 2852 | Ga0495664_0247869 | |||
| 2853 | Ga0495584_0031540 | |||
| 2854 | Ga0495584_0094008 | |||
| 2855 | Ga0495584_0362676 | |||
| 2856 | Ga0495585_0124105 | |||
| 2857 | Ga0495585_0230885 | |||
| 2858 | Ga0495594_0035688 | |||
| 2859 | Ga0495594_0239537 | |||
| 2860 | Ga0495608_0000030 | |||
| 2861 | Ga0495608_0004695 | |||
| 2862 | Ga0495608_0079829 | |||
| 2863 | Ga0495618_0000042 | |||
| 2864 | Ga0495618_0009048 | |||
| 2865 | Ga0495618_0044604 | |||
| 2866 | Ga0495618_0557384 | |||
| 2867 | Ga0495628_0000027 | |||
| 2868 | Ga0495628_0002285 | |||
| 2869 | Ga0495628_0088235 | |||
| 2870 | Ga0495628_0293242 | |||
| 2871 | Ga0495630_0084001 | |||
| 2872 | Ga0495630_0261513 | |||
| 2873 | Ga0495630_0282749 | |||
| 2874 | Ga0495630_0707189 | |||
| 2875 | Ga0495643_0311123 | |||
| 2876 | Ga0495666_0022479 | |||
| 2877 | Ga0495642_0247247 | |||
| 2878 | Ga0495652_0000041 | |||
| 2879 | Ga0495652_0005034 | |||
| 2880 | Ga0495652_0008048 | |||
| 2881 | Ga0495652_0104450 | |||
| 2882 | Ga0495652_0156303 | |||
| 2883 | Ga0495665_0024414 | |||
| 2884 | Ga0495665_0088078 | |||
| 2885 | Ga0495640_0000047 | |||
| 2886 | Ga0495640_0015836 | |||
| 2887 | Ga0495640_0061658 | |||
| 2888 | Ga0495640_0276973 | |||
| 2889 | Ga0495586_0082345 | |||
| 2890 | Ga0495587_0000025 | |||
| 2891 | Ga0495587_0001073 | |||
| 2892 | Ga0495587_0021132 | |||
| 2893 | Ga0495587_0039777 | |||
| 2894 | Ga0495645_0000001 | |||
| 2895 | Ga0495645_0002505 | |||
| 2896 | Ga0495645_0046486 | |||
| 2897 | Ga0495667_0000001 | |||
| 2898 | Ga0495667_0004699 | |||
| 2899 | Ga0495667_0013645 | |||
| 2900 | Ga0495667_0036143 | |||
| 2901 | Ga0495667_0060768 | |||
| 2902 | Ga0495656_0145593 | |||
| 2903 | Ga0495634_0002681 | |||
| 2904 | Ga0495634_0122759 | |||
| 2905 | Ga0495634_0248602 | |||
| 2906 | Ga0495635_0000061 | |||
| 2907 | Ga0495635_0013280 | |||
| 2908 | Ga0495635_0101199 | |||
| 2909 | Ga0495635_0157796 | |||
| 2910 | Ga0495659_0054918 | |||
| 2911 | Ga0495659_0496778 | |||
| 2912 | Ga0495588_0057546 | |||
| 2913 | Ga0495657_0000204 | |||
| 2914 | Ga0495657_0005935 | |||
| 2915 | Ga0495657_0009621 | |||
| 2916 | Ga0495657_0051550 | |||
| 2917 | Ga0495657_0056504 | |||
| 2918 | Ga0495599_0000021 | |||
| 2919 | Ga0495599_0002367 | |||
| 2920 | Ga0495599_0006958 | |||
| 2921 | Ga0495599_0452307 | |||
| 2922 | Ga0495623_0000858 | |||
| 2923 | Ga0495623_0001713 | |||
| 2924 | Ga0495623_0061441 | |||
| 2925 | Ga0495646_0000043 | |||
| 2926 | Ga0495646_0003394 | |||
| 2927 | Ga0495646_0193260 | |||
| 2928 | Ga0495646_0562693 | |||
| 2929 | Ga0495647_0023189 | |||
| 2930 | Ga0495647_0031601 | |||
| 2931 | Ga0495658_0019075 | |||
| 2932 | Ga0495658_0060255 | |||
| 2933 | Ga0495669_0070805 | |||
| 2934 | Ga0495669_0161196 | |||
| 2935 | Ga0495613_0130268 | |||
| 2936 | Ga0495613_0152619 | |||
| 2937 | Ga0495613_0242912 | |||
| 2938 | Ga0495613_0433095 | |||
| 2939 | Ga0495613_0792279 | |||
| 2940 | Ga0495624_0027753 | |||
| 2941 | Ga0495624_0582130 | |||
| 2942 | Ga0495671_0295934 | |||
| 2943 | Ga0495589_0162433 | |||
| 2944 | Ga0495589_0268839 | |||
| 2945 | Ga0495589_0291718 | |||
| 2946 | Ga0495600_0000082 | |||
| 2947 | Ga0495600_0025274 | |||
| 2948 | Ga0495600_0071319 | |||
| 2949 | Ga0495600_0595037 | |||
| 2950 | Ga0495581_0041004 | |||
| 2951 | Ga0495581_0093975 | |||
| 2952 | Ga0495581_0486163 | |||
| 2953 | Ga0495604_0000036 | |||
| 2954 | Ga0495604_0003635 | |||
| 2955 | Ga0495604_0016633 | |||
| 2956 | Ga0495604_0149828 | |||
| 2957 | Ga0495674_0000085 | |||
| 2958 | Ga0495674_0064384 | |||
| 2959 | Ga0495674_0143635 | |||
| 2960 | Ga0495672_0000511 | |||
| 2961 | Ga0495676_0168077 | |||
| 2962 | Ga0495676_0338761 | |||
| 2963 | Ga0495680_0000201 | |||
| 2964 | Ga0495680_0012190 | |||
| 2965 | Ga0495680_0024378 | |||
| 2966 | Ga0495680_0132942 | |||
| 2967 | Ga0495680_0503811 | |||
| 2968 | Ga0495680_0522910 | |||
| 2969 | Ga0495675_0000203 | |||
| 2970 | Ga0495675_0004449 | |||
| 2971 | Ga0495675_0219460 | |||
| 2972 | Ga0495677_0315950 | |||
| 2973 | Ga0495684_0000025 | |||
| 2974 | Ga0495684_0116578 | |||
| 2975 | Ga0495593_0005893 | |||
| 2976 | Ga0495593_0026153 | |||
| 2977 | Ga0495593_0095776 | |||
| 2978 | Ga0495593_0495358 | |||
| 2979 | Ga0495602_0000097 | |||
| 2980 | Ga0495602_0005814 | |||
| 2981 | Ga0495602_0069117 | |||
| 2982 | Ga0495614_0210554 | |||
| 2983 | Ga0496100_0000345 | |||
| 2984 | Ga0496100_0040182 | |||
| 2985 | Ga0496100_0196762 | |||
| 2986 | Ga0496100_0210950 | |||
| 2987 | Ga0496100_0381653 | |||
| 2988 | Ga0496100_0819396 | |||
| 2989 | Ga0496101_0000866 | |||
| 2990 | Ga0496101_0002577 | |||
| 2991 | Ga0496101_0026764 | |||
| 2992 | Ga0496101_0031736 | |||
| 2993 | Ga0496101_0354354 | |||
| 2994 | Ga0496101_0754094 | |||
| 2995 | Ga0496101_0879150 | |||
| 2996 | Ga0496101_1581763 | |||
| 2997 | Ga0496102_0001833 | |||
| 2998 | Ga0496102_0001868 | |||
| 2999 | Ga0496102_0035378 | |||
| 3000 | Ga0496102_0227674 | |||
| 3001 | Ga0496102_0713677 | |||
| 3002 | Ga0496102_0954535 | |||
| 3003 | Ga0496103_0001022 | |||
| 3004 | Ga0496103_0033382 | |||
| 3005 | Ga0496103_0039344 | |||
| 3006 | Ga0496103_0046372 | |||
| 3007 | Ga0496103_0159310 | |||
| 3008 | Ga0496103_0246031 | |||
| 3009 | Ga0496104_0000399 | |||
| 3010 | Ga0496104_0000877 | |||
| 3011 | Ga0496104_0041378 | |||
| 3012 | Ga0496104_0392679 | |||
| 3013 | Ga0496104_0395508 | |||
| 3014 | Ga0496104_1192407 | |||
| 3015 | Ga0496105_0002417 | |||
| 3016 | Ga0496105_0077228 | |||
| 3017 | Ga0496105_0146792 | |||
| 3018 | Ga0496105_0148486 | |||
| 3019 | Ga0496105_0290849 | |||
| 3020 | Ga0496105_0325436 | |||
| 3021 | Ga0496106_0001110 | |||
| 3022 | Ga0496106_0002528 | |||
| 3023 | Ga0496106_0066180 | |||
| 3024 | Ga0496106_0076854 | |||
| 3025 | Ga0496106_0115700 | |||
| 3026 | Ga0496106_0267836 | |||
| 3027 | Ga0496106_0516860 | |||
| 3028 | Ga0496107_0002539 | |||
| 3029 | Ga0496107_0017863 | |||
| 3030 | Ga0496107_0033041 | |||
| 3031 | Ga0496107_0794029 | |||
| 3032 | Ga0496108_0003711 | |||
| 3033 | Ga0496108_0004403 | |||
| 3034 | Ga0496108_0009905 | |||
| 3035 | Ga0496108_0077559 | |||
| 3036 | Ga0496108_0081887 | |||
| 3037 | Ga0496108_0150271 | |||
| 3038 | Ga0496108_0418359 | |||
| 3039 | Ga0496108_0626557 | |||
| 3040 | Ga0496109_0002269 | |||
| 3041 | Ga0496109_0005827 | |||
| 3042 | Ga0496109_0010610 | |||
| 3043 | Ga0496109_0072604 | |||
| 3044 | Ga0496109_0104703 | |||
| 3045 | Ga0496109_0107784 | |||
| 3046 | Ga0496109_0178790 | |||
| 3047 | Ga0496109_0742846 | |||
| 3048 | Ga0496110_0004757 | |||
| 3049 | Ga0496110_0005009 | |||
| 3050 | Ga0496110_0062768 | |||
| 3051 | Ga0496110_0124293 | |||
| 3052 | Ga0496110_0239896 | |||
| 3053 | Ga0496110_0269768 | |||
| 3054 | Ga0496110_0275705 | |||
| 3055 | Ga0496110_0377198 | |||
| 3056 | Ga0496110_0850670 | |||
| 3057 | Ga0496110_1800098 | |||
| 3058 | Ga0496111_0008486 | |||
| 3059 | Ga0496111_0113696 | |||
| 3060 | Ga0496111_0166009 | |||
| 3061 | Ga0496111_0309448 | |||
| 3062 | Ga0496111_0508565 | |||
| 3063 | Ga0496111_0686495 | |||
| 3064 | Ga0496112_0003321 | |||
| 3065 | Ga0496112_0005896 | |||
| 3066 | Ga0496112_0107323 | |||
| 3067 | Ga0496112_0148666 | |||
| 3068 | Ga0496112_0306057 | |||
| 3069 | Ga0496112_1017178 | |||
| 3070 | Ga0496113_0049264 | |||
| 3071 | Ga0496113_0160011 | |||
| 3072 | Ga0496113_0204176 | |||
| 3073 | Ga0496113_0214113 | |||
| 3074 | Ga0496113_0219441 | |||
| 3075 | Ga0496113_0331385 | |||
| 3076 | Ga0496113_0459870 | |||
| 3077 | Ga0496113_1037530 | |||
| 3078 | Ga0496113_1606315 | |||
| 3079 | Ga0496114_0007247 | |||
| 3080 | Ga0496114_0091339 | |||
| 3081 | Ga0496114_0279202 | |||
| 3082 | Ga0496114_0409099 | |||
| 3083 | Ga0496115_0007162 | |||
| 3084 | Ga0496115_0079825 | |||
| 3085 | Ga0496115_0096513 | |||
| 3086 | Ga0496115_0368084 | |||
| 3087 | Ga0496115_0507387 | |||
| 3088 | Ga0496115_0736324 | |||
| 3089 | Ga0496121_0001541 | |||
| 3090 | Ga0496121_0006108 | |||
| 3091 | Ga0496126_0031566 | |||
| 3092 | Ga0496126_0355209 | |||
| 3093 | Ga0501307_067962 | |||
| 3094 | Ga0501031_0007081 | |||
| 3095 | Ga0501032_0000345 | |||
| 3096 | Ga0501032_0011528 | |||
| 3097 | Ga0501032_0404353 | |||
| 3098 | Ga0501033_0000094 | |||
| 3099 | Ga0501033_0009628 | |||
| 3100 | Ga0501033_0311759 | |||
| 3101 | Ga0501033_0341811 | |||
| 3102 | Ga0501033_0720528 | |||
| 3103 | Ga0501034_0000021 | |||
| 3104 | Ga0501034_0064668 | |||
| 3105 | Ga0501034_0181982 | |||
| 3106 | Ga0501034_0185763 | |||
| 3107 | Ga0501034_0313065 | |||
| 3108 | Ga0501034_0313235 | |||
| 3109 | Ga0501034_0371497 | |||
| 3110 | Ga0501034_0514381 | |||
| 3111 | Ga0501034_1172362 | |||
| 3112 | Ga0501036_0001704 | |||
| 3113 | Ga0501036_0013016 | |||
| 3114 | Ga0501036_0296427 | |||
| 3115 | Ga0501036_0315601 | |||
| 3116 | Ga0501036_0627337 | |||
| 3117 | Ga0501037_0000450 | |||
| 3118 | Ga0501037_0061670 | |||
| 3119 | Ga0501037_0081205 | |||
| 3120 | Ga0501037_0084716 | |||
| 3121 | Ga0501038_0000052 | |||
| 3122 | Ga0501038_0028787 | |||
| 3123 | Ga0501038_0066442 | |||
| 3124 | Ga0501038_0139780 | |||
| 3125 | Ga0501038_0479288 | |||
| 3126 | Ga0501038_0759286 | |||
| 3127 | Ga0501039_0000549 | |||
| 3128 | Ga0501039_0838026 | |||
| 3129 | Ga0501039_0949539 | |||
| 3130 | Ga0501040_0195912 | |||
| 3131 | Ga0501041_0197950 | |||
| 3132 | Ga0501042_0090134 | |||
| 3133 | Ga0501042_0119571 | |||
| 3134 | Ga0501042_0912375 | |||
| 3135 | Ga0501043_0001704 | |||
| 3136 | Ga0501043_0054177 | |||
| 3137 | Ga0501043_0192378 | |||
| 3138 | Ga0501043_0292192 | |||
| 3139 | Ga0501043_0358593 | |||
| 3140 | Ga0501046_0002237 | |||
| 3141 | Ga0501046_0036672 | |||
| 3142 | Ga0501046_0179458 | |||
| 3143 | Ga0501046_0401674 | |||
| 3144 | Ga0501046_0518728 | |||
| 3145 | Ga0501046_0729312 | |||
| 3146 | Ga0501047_0000440 | |||
| 3147 | Ga0501047_0016976 | |||
| 3148 | Ga0501047_0030355 | |||
| 3149 | Ga0501047_0063944 | |||
| 3150 | Ga0501047_0138620 | |||
| 3151 | Ga0501047_0427446 | |||
| 3152 | Ga0501047_0527954 | |||
| 3153 | Ga0501048_0001862 | |||
| 3154 | Ga0501048_0360186 | |||
| 3155 | Ga0501048_0365545 | |||
| 3156 | Ga0501067_0000076 | |||
| 3157 | Ga0501067_0008019 | |||
| 3158 | Ga0501067_0046517 | |||
| 3159 | Ga0501067_0167333 | |||
| 3160 | Ga0501067_0873642 | |||
| 3161 | Ga0501068_0001049 | |||
| 3162 | Ga0501068_0115513 | |||
| 3163 | Ga0501068_0223426 | |||
| 3164 | Ga0501068_0387204 | |||
| 3165 | Ga0501069_0018031 | |||
| 3166 | Ga0501069_0048488 | |||
| 3167 | Ga0501069_0145115 | |||
| 3168 | Ga0501069_0173426 | |||
| 3169 | Ga0501069_0228499 | |||
| 3170 | Ga0501070_0010753 | |||
| 3171 | Ga0501070_0054403 | |||
| 3172 | Ga0501070_0097895 | |||
| 3173 | Ga0501070_0120589 | |||
| 3174 | Ga0501070_0146838 | |||
| 3175 | Ga0501070_0148387 | |||
| 3176 | Ga0501070_0160366 | |||
| 3177 | Ga0501070_0833005 | |||
| 3178 | Ga0501070_1238427 | |||
| 3179 | Ga0501071_0127174 | |||
| 3180 | Ga0501071_0209635 | |||
| 3181 | Ga0501071_0315516 | |||
| 3182 | Ga0501072_0002634 | |||
| 3183 | Ga0501072_0235428 | |||
| 3184 | Ga0501072_0238200 | |||
| 3185 | Ga0501072_0239075 | |||
| 3186 | Ga0501072_0373095 | |||
| 3187 | Ga0501072_0693453 | |||
| 3188 | Ga0501072_0917579 | |||
| 3189 | Ga0501073_0000597 | |||
| 3190 | Ga0501073_0024093 | |||
| 3191 | Ga0501073_0037517 | |||
| 3192 | Ga0501073_0041475 | |||
| 3193 | Ga0501073_0044209 | |||
| 3194 | Ga0501073_0274520 | |||
| 3195 | Ga0501073_0275068 | |||
| 3196 | Ga0501073_0315066 | |||
| 3197 | Ga0501073_0464128 | |||
| 3198 | Ga0501073_0546339 | |||
| 3199 | Ga0501073_0911146 | |||
| 3200 | Ga0501074_0000285 | |||
| 3201 | Ga0501074_0066499 | |||
| 3202 | Ga0501074_0068214 | |||
| 3203 | Ga0501074_0261439 | |||
| 3204 | Ga0501074_0299330 | |||
| 3205 | Ga0501074_0534590 | |||
| 3206 | Ga0501074_0830985 | |||
| 3207 | Ga0501075_0174523 | |||
| 3208 | Ga0501075_0297766 | |||
| 3209 | Ga0501075_0635401 | |||
| 3210 | Ga0501075_0964004 | |||
| 3211 | Ga0501075_1133616 | |||
| 3212 | Ga0501076_1377480 | |||
| 3213 | Ga0501077_0108309 | |||
| 3214 | Ga0501077_0230131 | |||
| 3215 | Ga0501077_0634198 | |||
| 3216 | Ga0501079_0027965 | |||
| 3217 | Ga0501079_0086061 | |||
| 3218 | Ga0501079_0110781 | |||
| 3219 | Ga0501079_0193938 | |||
| 3220 | Ga0501079_0328970 | |||
| 3221 | Ga0501079_1331169 | |||
| 3222 | Ga0501080_0001080 | |||
| 3223 | Ga0501080_0016495 | |||
| 3224 | Ga0501080_0067975 | |||
| 3225 | Ga0501080_0091018 | |||
| 3226 | Ga0501080_0109688 | |||
| 3227 | Ga0501080_0443378 | |||
| 3228 | Ga0501080_0696167 | |||
| 3229 | Ga0501080_0709197 | |||
| 3230 | Ga0501080_1338100 | |||
| 3231 | Ga0501081_0018544 | |||
| 3232 | Ga0501081_0090060 | |||
| 3233 | Ga0501083_0000881 | |||
| 3234 | Ga0501083_0007860 | |||
| 3235 | Ga0501083_0024413 | |||
| 3236 | Ga0501083_0061997 | |||
| 3237 | Ga0501083_0086409 | |||
| 3238 | Ga0501083_0090565 | |||
| 3239 | Ga0501083_0455955 | |||
| 3240 | Ga0501035_0000255 | |||
| 3241 | Ga0501035_0001116 | |||
| 3242 | Ga0501035_0007660 | |||
| 3243 | Ga0501035_0168444 | |||
| 3244 | Ga0501035_0347401 | |||
| 3245 | Ga0501035_0351623 | |||
| 3246 | Ga0501035_0390304 | |||
| 3247 | Ga0501035_0975551 | |||
| 3248 | Ga0501044_0000141 | |||
| 3249 | Ga0501044_0060992 | |||
| 3250 | Ga0501044_0061315 | |||
| 3251 | Ga0501044_0074615 | |||
| 3252 | Ga0501044_0182883 | |||
| 3253 | Ga0501044_0272626 | |||
| 3254 | Ga0501044_0485944 | |||
| 3255 | Ga0501044_0685084 | |||
| 3256 | Ga0501044_0809778 | |||
| 3257 | nmdc:mga03683_175413_c1 | |||
| 3258 | nmdc:mga03683_58457_c1 | |||
| 3259 | nmdc:mga00v17_384310_c1 | |||
| 3260 | nmdc:mga00v17_424560_c1 | |||
| 3261 | nmdc:mga00v17_82239_c1 | |||
| 3262 | nmdc:mga0yw44_5776_c1 | |||
| 3263 | nmdc:mga0k408_2835_c1 | |||
| 3264 | nmdc:mga0k408_449502_c1 | |||
| 3265 | nmdc:mga0k408_7859_c1 | |||
| 3266 | nmdc:mga06z11_771695_c1 | |||
| 3267 | nmdc:mga07m45_47271_c1 | |||
| 3268 | nmdc:mga07m45_561051_c1 | |||
| 3269 | nmdc:mga05p37_14706_c1 | |||
| 3270 | nmdc:mga05p37_2437_c1 | |||
| 3271 | nmdc:mga05p37_265187_c1 | |||
| 3272 | nmdc:mga05p37_910783_c1 | |||
| 3273 | nmdc:mga09592_1108952_c1 | |||
| 3274 | nmdc:mga09592_1370_c1 | |||
| 3275 | nmdc:mga09592_266337_c1 | |||
| 3276 | nmdc:mga09592_285401_c1 | |||
| 3277 | nmdc:mga09592_8971_c1 | |||
| 3278 | nmdc:mga0qj67_108691_c1 | |||
| 3279 | nmdc:mga0qj67_969_c1 | |||
| 3280 | nmdc:mga06r32_156819_c1 | |||
| 3281 | nmdc:mga06r32_16932_c1 | |||
| 3282 | nmdc:mga06r32_638_c1 | |||
| 3283 | nmdc:mga06r32_87514_c1 | |||
| 3284 | nmdc:mga08y16_1574170_c1 | |||
| 3285 | nmdc:mga08y16_3117_c1 | |||
| 3286 | nmdc:mga08y16_333_c1 | |||
| 3287 | nmdc:mga08y16_549_c1 | |||
| 3288 | nmdc:mga0n895_1174_c1 | |||
| 3289 | nmdc:mga0n895_124497_c1 | |||
| 3290 | nmdc:mga0n895_534292_c1 | |||
| 3291 | nmdc:mga0n895_857752_c1 | |||
| 3292 | nmdc:mga0rr50_20520_c1 | |||
| 3293 | nmdc:mga0rr50_330858_c1 | |||
| 3294 | nmdc:mga0rr50_493176_c1 | |||
| 3295 | nmdc:mga0rr50_616040_c1 | |||
| 3296 | nmdc:mga0rr50_6776_c1 | |||
| 3297 | nmdc:mga08x19_120860_c1 | |||
| 3298 | nmdc:mga08x19_432681_c1 | |||
| 3299 | nmdc:mga08x19_683414_c1 | |||
| 3300 | nmdc:mga08x19_702090_c1 | |||
| 3301 | nmdc:mga08x19_82647_c1 | |||
| 3302 | nmdc:mga08x19_855881_c1 | |||
| 3303 | nmdc:mga0a205_27812_c1 | |||
| 3304 | nmdc:mga0a205_6917_c1 | |||
| 3305 | nmdc:mga0a205_745_c1 | |||
| 3306 | nmdc:mga0a205_86774_c1 | |||
| 3307 | Ga0495601_0000025 | |||
| 3308 | Ga0495601_0000869 | |||
| 3309 | Ga0495601_0002429 | |||
| 3310 | Ga0495601_0009249 | |||
| 3311 | Ga0495601_0031396 | |||
| 3312 | Ga0495601_0044802 | |||
| 3313 | Ga0495601_1083712 | |||
| 3314 | Ga0495612_0000570 | |||
| 3315 | Ga0495612_0018791 | |||
| 3316 | Ga0495612_0019618 | |||
| 3317 | Ga0495655_0069626 | |||
| 3318 | Ga0495655_0108503 | |||
| 3319 | Ga0495595_0000041 | |||
| 3320 | Ga0495595_0001114 | |||
| 3321 | Ga0495595_0001865 | |||
| 3322 | Ga0495595_0003026 | |||
| 3323 | Ga0495595_0131510 | |||
| 3324 | Ga0495595_0283763 | |||
| 3325 | Ga0495595_0325298 | |||
| 3326 | Ga0495619_0000035 | |||
| 3327 | Ga0495619_0000430 | |||
| 3328 | Ga0495619_0001481 | |||
| 3329 | Ga0495619_0038883 | |||
| 3330 | Ga0495619_0044333 | |||
| 3331 | Ga0495619_0364946 | |||
| 3332 | Ga0495619_0573316 | |||
| 3333 | Ga0500643_001596 | |||
| 3334 | Ga0500644_0007015 | |||
| 3335 | Ga0500651_0047561 | |||
| 3336 | Ga0500566_0086112 | |||
| 3337 | Ga0500650_0233840 | |||
| 3338 | Ga0500556_0190192 | |||
| 3339 | Ga0500595_000016 | |||
| 3340 | Ga0500595_071208 | |||
| 3341 | Ga0500642_0043920 | |||
| 3342 | Ga0500652_132321 | |||
| 3343 | Ga0500652_240738 | |||
| 3344 | Ga0500568_0212978 | |||
| 3345 | Ga0500568_0290997 | |||
| 3346 | Ga0500573_0139542 | |||
| 3347 | Ga0500573_0434933 | |||
| 3348 | Ga0500577_0082986 | |||
| 3349 | Ga0500616_0000006 | |||
| 3350 | Ga0500645_021076 | |||
| 3351 | Ga0501084_0290907 | |||
| 3352 | Ga0501084_0396959 | |||
| 3353 | Ga0501084_0636089 | |||
| 3354 | Ga0501084_0673691 | |||
| 3355 | Ga0501084_0835028 | |||
| 3356 | Ga0501084_0867267 | |||
| 3357 | Ga0587117_022658 | |||
| 3358 | Ga0587068_153057 | |||
| 3359 | Ga0587079_226678 | |||
| 3360 | Ga0587071_045962 | |||
| 3361 | Ga0501082_0024224 | |||
| 3362 | Ga0501082_0024485 | |||
| 3363 | Ga0501082_0395421 | |||
| 3364 | Ga0501082_0508045 | |||
| 3365 | Ga0501082_0807961 | |||
| 3366 | Ga0501082_1219068 | |||
| 3367 | Ga0501082_1244332 | |||
| 3368 | Ga0501082_1664670 | |||
| 3369 | Ga0466962_0127681 | |||
| 3370 | Ga0466962_0273108 | |||
| 3371 | Ga0530510_0037913 | |||
| 3372 | Ga0530510_0060643 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zqf-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) | 0.965 | 3 | 61 |
| 6zqg-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-c | 0.9397 | 3 | 61 |
| 6rbd-assembly1.cif.gz_S | state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles | 0.93 | 3 | 61 |
| 1r2z-assembly1.cif.gz_A | mutm (fpg) bound to 5,6-dihydrouracil (dhu) containing dna | 0.921 | 11 | 58 |
| 6erq-assembly2.cif.gz_J | structure of the human mitochondrial transcription initiation complex at the hsp promoter | 0.9206 | 11 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8HCP0_1_71_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9884 | 4 | 66 | 1.10.8.50 |
| af_P54019_1_77_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9814 | 3 | 61 | 1.10.8.50 |
| af_A0A1D8PQQ5_1_82_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9684 | 3 | 61 | 1.10.8.50 |
| af_P9WH61_1_72_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9603 | 1 | 71 | 1.10.8.50 |
| 1i94M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.954 | 14 | 64 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4MPL7-F1-model_v4 | 30S ribosomal protein S13 | 0.9977 | 1 | 66 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A533J219-F1-model_v4 | deleted | 0.9899 | 1 | 58 |
|
| AF-A0A436DSH1-F1-model_v4 | 30S ribosomal protein S13 | 0.9889 | 1 | 68 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A7C1JM66-F1-model_v4 | 30S ribosomal protein S13 | 0.9878 | 1 | 60 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C2W8B0-F1-model_v4 | 30S ribosomal protein S13 | 0.9844 | 1 | 63 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |