F495334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1686 | 1161 | 3372 | 263 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2937848649|2937852746 |
| Length | 293 |
| Sequence | WNCLTCDLSDLRLVGLFGDPKMNFWHKPMKNGPRIITVANQKGGVGKTTTAINLATALAAIGEKVLIVDLDPQGNASTGLGIDRKDRTVSSYDVLTGELELEAAAIPTAVPGLSIVPSTLDLLGIEMEIASAPDRVLRLRNALRAASARSAGFGYVLIDCPPSLNLLTLNSMAAADSVLVPLQCEFFALEGLSQLLETVEQVRRSINPDLTIQGIVLTMYDGRNNLANQVVQDVRQHMGDKVYETIIPRNVRVSEAPSYGKPAILYDLKCSGSQAYLQLASEVIRRERKLRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 57 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 58 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 70 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 85 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 86 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 87 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 88 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 147 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 157 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 163 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 164 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 165 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 166 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 167 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 168 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 169 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 170 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 171 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 172 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 173 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 174 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 175 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 176 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 177 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 178 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 264 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 265 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 266 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 268 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 273 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 274 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 275 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 276 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 277 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 278 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 279 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 280 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 281 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 282 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 283 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 284 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 286 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 287 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 290 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 293 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 294 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 297 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 298 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 300 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 303 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 307 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 308 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 309 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 310 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 311 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 312 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 313 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 314 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 315 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 316 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 317 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 318 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 319 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 320 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 321 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 322 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 323 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 324 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 325 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 326 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 327 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 328 | 2512875024 | |||
| 329 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 330 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 331 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 332 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 333 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 334 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 335 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 336 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 337 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 338 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 339 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 340 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 341 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 342 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 343 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 344 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 345 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 346 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 347 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 348 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 349 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 350 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 351 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 352 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 353 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 354 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 355 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 356 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 357 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 358 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 359 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 360 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 361 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 362 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 363 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 364 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 365 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 366 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 367 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 368 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 369 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 370 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 371 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 372 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 373 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 374 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 375 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 376 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 377 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 378 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 379 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 380 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 381 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 382 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 383 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 384 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 385 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 386 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 387 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 388 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 389 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 390 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 391 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 392 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 393 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 394 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 395 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 396 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 397 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 398 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 399 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 400 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 401 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 402 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 403 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 404 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 405 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 406 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 407 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 408 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 409 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 410 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 411 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 412 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 413 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 414 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 415 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 416 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 417 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 418 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 419 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 420 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 421 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 422 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 423 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 424 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 425 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 426 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 427 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 428 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 429 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 430 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 431 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 432 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 433 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 434 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 435 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 436 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 437 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 438 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 439 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 440 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 441 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 442 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 443 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 444 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 445 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 446 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 447 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 448 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 449 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 450 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 451 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 452 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 453 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 454 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 455 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 456 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 457 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 458 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 459 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 460 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 461 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 462 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 463 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 464 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 465 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 466 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 467 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 468 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 469 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 470 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 471 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 472 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 473 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 474 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 475 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 476 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 477 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 478 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 479 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 480 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 481 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 482 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 483 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 484 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 485 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 486 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 487 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 488 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 489 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 490 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 491 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 492 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 493 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 494 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 495 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 496 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 497 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 498 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 499 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 500 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 501 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 502 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 503 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 504 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 505 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 506 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 507 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 508 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 509 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 510 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 511 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 512 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 513 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 514 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 515 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 516 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 517 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 518 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 519 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 520 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 521 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 522 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 523 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 524 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 525 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 526 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 527 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 528 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 529 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 530 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 531 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 532 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 533 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 534 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 535 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 536 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 537 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 538 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 539 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 540 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 541 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 542 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 543 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 544 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 545 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 546 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 547 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 548 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 549 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 550 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 551 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 552 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 553 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 554 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 555 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 556 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 557 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 558 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 559 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 560 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 561 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 562 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 563 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 564 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 565 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 566 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 567 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 568 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 569 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 570 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 571 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 572 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 573 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 574 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 575 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 576 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 577 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 578 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 579 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 580 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 581 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 582 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 583 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 584 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 585 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 586 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 587 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 588 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 589 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 590 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 591 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 592 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 593 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 594 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 595 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 596 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 597 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 598 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 599 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 600 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 601 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 602 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 603 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 604 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 605 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 606 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 607 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 608 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 609 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 610 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 611 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 612 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 613 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 614 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 615 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 616 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 617 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 618 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 619 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 620 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 621 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 622 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 623 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 624 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 625 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 626 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 627 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 628 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 629 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 630 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 631 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 632 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 633 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 634 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 635 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 636 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 637 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 638 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 639 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 640 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 641 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 642 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 643 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 644 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 645 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 646 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 647 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 648 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 649 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 650 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 651 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 652 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 653 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 654 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 655 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 656 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 657 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 658 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 659 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 660 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 661 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 662 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 663 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 664 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 665 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 666 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 667 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 668 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 669 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 670 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 671 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 672 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 673 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 674 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 675 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 676 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 677 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 678 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 679 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 680 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 681 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 682 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 683 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 684 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 685 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 686 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 687 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 688 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 689 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 690 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 691 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 692 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 693 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 694 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 695 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 696 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 697 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 698 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 699 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 700 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 701 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 702 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 703 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 704 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 705 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 706 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 707 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 708 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 709 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 710 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 711 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 712 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 713 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 714 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 715 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 716 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 717 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 718 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 719 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 720 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 721 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 722 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 723 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 724 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 725 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 726 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 727 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 728 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 729 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 730 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 731 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 732 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 733 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 734 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 735 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 736 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 737 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 738 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 739 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 740 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 741 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 742 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 743 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 744 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 745 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 746 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 747 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 748 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 749 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 750 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 751 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 752 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 753 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 754 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 755 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 756 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 757 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 758 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 759 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 760 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 761 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 762 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 763 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 764 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 765 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 766 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 767 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 768 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 769 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 770 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 771 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 772 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 773 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 774 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 775 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 776 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 777 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 778 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 779 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 780 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 781 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 782 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 783 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 784 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 785 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 786 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 787 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 788 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 789 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 790 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 791 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 792 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 793 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 794 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 795 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 796 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 797 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 798 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 799 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 800 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 801 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 802 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 803 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 804 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 805 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 806 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 807 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 808 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 809 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 810 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 811 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 812 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 813 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 814 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 815 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 816 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 817 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 818 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 819 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 820 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 821 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 822 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 823 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 824 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 825 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 826 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 827 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 828 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 829 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 830 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 831 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 832 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 833 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 834 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 835 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 836 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 837 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 838 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 839 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 840 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 841 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 842 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 843 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 844 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 845 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 846 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 847 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 848 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 849 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 850 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 851 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 852 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 853 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 854 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 855 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 856 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 857 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 858 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 859 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 860 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 861 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 862 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 863 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 864 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 865 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 866 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 867 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 868 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 869 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 870 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 871 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 872 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 873 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 874 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 875 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 876 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 877 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 878 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 879 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 880 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 881 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 882 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 883 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 884 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 885 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 886 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 887 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 888 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 889 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 890 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 891 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 892 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 893 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 894 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 895 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 896 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 897 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 898 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 899 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 900 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 901 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 902 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 903 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 904 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 905 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 906 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 907 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 908 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 909 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 910 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 911 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 912 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 913 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 914 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 915 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 916 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 917 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 918 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 919 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 920 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 921 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 922 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 923 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 924 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 925 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 926 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 927 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 928 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 929 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 930 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 931 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 932 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 933 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 934 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 935 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 936 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 937 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 938 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 939 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 940 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 941 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 942 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 943 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 944 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 945 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 946 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 947 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 948 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 949 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 950 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 951 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 952 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 953 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 954 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 955 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 956 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 957 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 958 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 959 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 960 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 961 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 962 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 963 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 964 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 965 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 966 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 967 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 968 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 969 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 970 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 971 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 972 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 973 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 974 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 975 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 976 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 977 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 978 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 979 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 980 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 981 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 982 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 983 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 984 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 985 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 986 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 987 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 988 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 989 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 990 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 991 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 992 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 993 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 994 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 995 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 996 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 997 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 998 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 999 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 1000 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 1001 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 1002 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 1003 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 1004 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 1005 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 1006 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 1007 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 1008 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 1009 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 1010 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 1011 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 1012 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 1013 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 1014 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 1015 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 1016 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 1017 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 1018 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 1019 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 1020 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 1021 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 1022 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 1023 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 1024 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 1025 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 1026 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 1027 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 1028 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 1029 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 1030 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 1031 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 1032 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 1033 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 1034 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 1035 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 1036 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 1037 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 1038 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 1039 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 1040 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 1041 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 1042 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 1043 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 1044 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 1045 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 1046 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 1047 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 1048 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 1049 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 1050 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 1051 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 1052 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 1053 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 1054 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 1055 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 1056 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 1057 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 1058 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 1059 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 1060 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 1061 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 1062 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 1063 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 1064 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 1065 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 1066 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 1067 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 1068 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 1069 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 1070 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 1071 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 1072 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 1073 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 1074 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 1075 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 1076 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 1077 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 1078 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 1079 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 1080 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 1081 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 1082 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 1083 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 1084 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 1085 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 1086 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 1087 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 1088 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 1089 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 1090 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 1091 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 1092 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1093 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1094 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1095 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1096 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1097 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1098 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1099 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1100 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1101 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1102 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1103 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1104 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1105 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1106 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1107 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1108 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1109 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1110 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1111 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1112 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1113 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1114 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1115 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1116 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1117 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1118 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1119 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1120 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1121 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1122 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1123 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1124 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1125 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1126 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1127 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1128 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1129 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1130 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1131 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1132 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1133 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1134 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1135 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1136 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1137 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1138 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1139 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1140 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1141 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1142 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1143 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1144 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1145 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1146 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1147 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1148 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1149 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1150 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1151 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1152 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1153 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1154 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1155 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1156 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1157 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1158 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1159 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1160 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1161 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 48.52 |
| Metatranscriptomes | 0.47 |
| Isolates | 51.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 18.8 |
| Nodule | 39.44 |
| Rhizoplane | 1.9 |
| Rhizosphere | 23.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008046 | 3300001979 | Bacteria | 4236 |
| 2 | JGI24739J22299_10026028 | 3300001989 | Bacteria | 2055 |
| 3 | JGI24735J21928_10010743 | 3300002067 | Bacteria | 2911 |
| 4 | JGI25155J39150_1000018 | 3300002704 | Bacteria | 157606 |
| 5 | JGI25156J39149_1000055 | 3300002705 | Bacteria | 87733 |
| 6 | JGI25156J39149_1005781 | 3300002705 | Bacteria | 3503 |
| 7 | JGI25162J39368_1000524 | 3300002737 | Bacteria | 28601 |
| 8 | JGI25162J39368_1001321 | 3300002737 | Bacteria | 13874 |
| 9 | JGI25154J39366_1000069 | 3300002738 | Bacteria | 96438 |
| 10 | JGI25158J39367_1000191 | 3300002739 | Bacteria | 14579 |
| 11 | JGI25157J39369_1000076 | 3300002741 | Bacteria | 87678 |
| 12 | JGI25157J39369_1002158 | 3300002741 | Bacteria | 5464 |
| 13 | JGI25152J39213_1000169 | 3300002773 | Bacteria | 44325 |
| 14 | JGI25152J39213_1001739 | 3300002773 | Bacteria | 8902 |
| 15 | JGI25152J39213_1002279 | 3300002773 | Bacteria | 7402 |
| 16 | JGI25152J39213_1006926 | 3300002773 | Bacteria | 2997 |
| 17 | JGI25152J39213_1014945 | 3300002773 | Bacteria | 1552 |
| 18 | JGI25150J39212_1000018 | 3300002774 | Bacteria | 146535 |
| 19 | JGI25150J39212_1001891 | 3300002774 | Bacteria | 5502 |
| 20 | JGI25150J39212_1011092 | 3300002774 | Bacteria | 1647 |
| 21 | JGI25159J45721_1000022 | 3300002987 | Bacteria | 119463 |
| 22 | JGI25159J45721_1000486 | 3300002987 | Bacteria | 18238 |
| 23 | JGI25159J45721_1003195 | 3300002987 | Bacteria | 5876 |
| 24 | JGI25151J46595_10000034 | 3300003187 | Bacteria | 192271 |
| 25 | JGI25151J46595_10000879 | 3300003187 | Bacteria | 23723 |
| 26 | JGI25151J46595_10003252 | 3300003187 | Bacteria | 9039 |
| 27 | JGI25151J46595_10007778 | 3300003187 | Bacteria | 5215 |
| 28 | JGI25151J46595_10049730 | 3300003187 | Bacteria | 1435 |
| 29 | JGI25406J46586_10065927 | 3300003203 | Bacteria | 1152 |
| 30 | JGI25165J46597_1000052 | 3300003214 | Bacteria | 236064 |
| 31 | JGI25165J46597_1000723 | 3300003214 | Bacteria | 25872 |
| 32 | JGI25165J46597_1001341 | 3300003214 | Bacteria | 13817 |
| 33 | JGI25165J46597_1001646 | 3300003214 | Bacteria | 10374 |
| 34 | JGI25165J46597_1002217 | 3300003214 | Bacteria | 6809 |
| 35 | JGI25153J46596_10000759 | 3300003215 | Bacteria | 19719 |
| 36 | JGI25153J46596_10004655 | 3300003215 | Bacteria | 7336 |
| 37 | JGI25153J46596_10004904 | 3300003215 | Bacteria | 7112 |
| 38 | JGI25153J46596_10005257 | 3300003215 | Bacteria | 6806 |
| 39 | JGI25153J46596_10016210 | 3300003215 | Bacteria | 2997 |
| 40 | JGI25153J46596_10016213 | 3300003215 | Bacteria | 2997 |
| 41 | JGI25153J46596_10041591 | 3300003215 | Bacteria | 1411 |
| 42 | JGI25160J50197_1000051 | 3300003354 | Bacteria | 132923 |
| 43 | JGI25160J50197_1000056 | 3300003354 | Bacteria | 119463 |
| 44 | JGI25160J50197_1000317 | 3300003354 | Bacteria | 33502 |
| 45 | JGI25160J50197_1024851 | 3300003354 | Bacteria | 1690 |
| 46 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 47 | JGI25161J50226_1000214 | 3300003374 | Bacteria | 36702 |
| 48 | JGI25161J50226_1000451 | 3300003374 | Bacteria | 19047 |
| 49 | JGI25161J50226_1002111 | 3300003374 | Bacteria | 5362 |
| 50 | Ga0006562J51391_1044604 | 3300003578 | Bacteria | 2988 |
| 51 | Ga0055539_1003028 | 3300003752 | Bacteria | 2418 |
| 52 | Ga0055542_1000284 | 3300003762 | Bacteria | 56677 |
| 53 | Ga0055529_1007878 | 3300003763 | Bacteria | 1431 |
| 54 | Ga0055526_1001496 | 3300003771 | Bacteria | 16543 |
| 55 | Ga0055526_1001864 | 3300003771 | Bacteria | 14599 |
| 56 | Ga0055526_1003195 | 3300003771 | Bacteria | 10600 |
| 57 | Ga0055524_1000962 | 3300003775 | Bacteria | 18149 |
| 58 | Ga0055524_1001781 | 3300003775 | Bacteria | 11832 |
| 59 | Ga0055524_1002678 | 3300003775 | Bacteria | 9022 |
| 60 | Ga0055524_1003666 | 3300003775 | Bacteria | 7363 |
| 61 | Ga0055524_1004018 | 3300003775 | Bacteria | 6937 |
| 62 | Ga0055524_1006695 | 3300003775 | Bacteria | 4975 |
| 63 | Ga0055524_1011005 | 3300003775 | Bacteria | 3562 |
| 64 | Ga0055524_1014485 | 3300003775 | Bacteria | 2920 |
| 65 | Ga0055536_1004102 | 3300003781 | Bacteria | 7571 |
| 66 | Ga0055536_1017871 | 3300003781 | Bacteria | 2300 |
| 67 | Ga0055528_1000452 | 3300003790 | Bacteria | 32857 |
| 68 | Ga0055528_1001257 | 3300003790 | Bacteria | 16081 |
| 69 | Ga0055528_1002057 | 3300003790 | Bacteria | 11232 |
| 70 | Ga0055528_1004002 | 3300003790 | Bacteria | 7209 |
| 71 | Ga0055528_1012948 | 3300003790 | Bacteria | 3200 |
| 72 | Ga0055528_1016826 | 3300003790 | Bacteria | 2564 |
| 73 | Ga0055540_1000597 | 3300003792 | Bacteria | 26126 |
| 74 | Ga0055540_1004729 | 3300003792 | Bacteria | 6012 |
| 75 | Ga0055540_1007895 | 3300003792 | Bacteria | 3925 |
| 76 | Ga0055540_1016975 | 3300003792 | Bacteria | 2048 |
| 77 | Ga0055540_1017617 | 3300003792 | Bacteria | 1987 |
| 78 | Ga0055531_10018670 | 3300003794 | Bacteria | 2849 |
| 79 | Ga0058692_1002316 | 3300003856 | Bacteria | 6438 |
| 80 | Ga0055543_1000041 | 3300004625 | Bacteria | 118501 |
| 81 | Ga0055543_1000330 | 3300004625 | Bacteria | 32518 |
| 82 | Ga0055543_1000682 | 3300004625 | Bacteria | 17718 |
| 83 | Ga0055543_1001229 | 3300004625 | Bacteria | 10697 |
| 84 | Ga0065165_1000155 | 3300005262 | Bacteria | 119501 |
| 85 | Ga0065165_1000303 | 3300005262 | Bacteria | 82513 |
| 86 | Ga0065165_1002015 | 3300005262 | Bacteria | 18962 |
| 87 | Ga0065165_1012660 | 3300005262 | Bacteria | 3417 |
| 88 | Ga0065704_10145387 | 3300005289 | Bacteria | 1477 |
| 89 | Ga0070670_100000711 | 3300005331 | Bacteria | 25830 |
| 90 | Ga0070666_10163594 | 3300005335 | Bacteria | 1556 |
| 91 | Ga0070682_100046169 | 3300005337 | Bacteria | 2702 |
| 92 | Ga0070669_100052021 | 3300005353 | Bacteria | 2995 |
| 93 | Ga0070663_100233991 | 3300005455 | Bacteria | 1448 |
| 94 | Ga0068867_100041403 | 3300005459 | Bacteria | 3367 |
| 95 | Ga0068853_100312445 | 3300005539 | Bacteria | 1455 |
| 96 | Ga0070665_100001728 | 3300005548 | Bacteria | 24967 |
| 97 | Ga0070665_100024473 | 3300005548 | Bacteria | 6081 |
| 98 | Ga0070665_100027905 | 3300005548 | Bacteria | 5684 |
| 99 | Ga0070665_100046994 | 3300005548 | Bacteria | 4332 |
| 100 | Ga0070665_100065392 | 3300005548 | Bacteria | 3648 |
| 101 | Ga0070665_100081432 | 3300005548 | Bacteria | 3243 |
| 102 | Ga0068855_100209256 | 3300005563 | Bacteria | 2193 |
| 103 | Ga0068854_100043122 | 3300005578 | Bacteria | 3196 |
| 104 | Ga0068856_100009588 | 3300005614 | Bacteria | 9405 |
| 105 | Ga0068856_100107833 | 3300005614 | Bacteria | 2781 |
| 106 | Ga0068856_100109572 | 3300005614 | Bacteria | 2758 |
| 107 | Ga0068851_10023620 | 3300005834 | Bacteria | 3007 |
| 108 | Ga0068860_100214379 | 3300005843 | Bacteria | 1868 |
| 109 | Ga0081540_1088199 | 3300005983 | Bacteria | 1372 |
| 110 | Ga0081539_10000690 | 3300005985 | Bacteria | 67656 |
| 111 | Ga0075365_10008818 | 3300006038 | Bacteria | 5751 |
| 112 | Ga0075365_10011801 | 3300006038 | Bacteria | 5157 |
| 113 | Ga0075365_10015484 | 3300006038 | Bacteria | 4616 |
| 114 | Ga0075365_10035579 | 3300006038 | Bacteria | 3223 |
| 115 | Ga0075365_10065362 | 3300006038 | Bacteria | 2438 |
| 116 | Ga0075365_10128777 | 3300006038 | Bacteria | 1750 |
| 117 | Ga0075365_10169525 | 3300006038 | Bacteria | 1523 |
| 118 | Ga0075365_10247244 | 3300006038 | Bacteria | 1253 |
| 119 | Ga0075365_10250840 | 3300006038 | Bacteria | 1244 |
| 120 | Ga0075368_10000331 | 3300006042 | Bacteria | 13823 |
| 121 | Ga0075368_10013009 | 3300006042 | Bacteria | 3052 |
| 122 | Ga0075364_10000055 | 3300006051 | Bacteria | 41950 |
| 123 | Ga0075364_10002563 | 3300006051 | Bacteria | 10184 |
| 124 | Ga0075364_10111164 | 3300006051 | Bacteria | 1828 |
| 125 | Ga0075364_10113188 | 3300006051 | Bacteria | 1812 |
| 126 | Ga0075364_10207119 | 3300006051 | Bacteria | 1330 |
| 127 | Ga0075364_10376193 | 3300006051 | Bacteria | 969 |
| 128 | Ga0075362_10003009 | 3300006177 | Bacteria | 5796 |
| 129 | Ga0075367_10001276 | 3300006178 | Bacteria | 10645 |
| 130 | Ga0075367_10008172 | 3300006178 | Bacteria | 5407 |
| 131 | Ga0075367_10012825 | 3300006178 | Bacteria | 4487 |
| 132 | Ga0075369_10000313 | 3300006186 | Bacteria | 14403 |
| 133 | Ga0075369_10000392 | 3300006186 | Bacteria | 13230 |
| 134 | Ga0075369_10000984 | 3300006186 | Bacteria | 9500 |
| 135 | Ga0075369_10059281 | 3300006186 | Bacteria | 1667 |
| 136 | Ga0075366_10010073 | 3300006195 | Bacteria | 5298 |
| 137 | Ga0075366_10018892 | 3300006195 | Bacteria | 3984 |
| 138 | Ga0075366_10059537 | 3300006195 | Bacteria | 2268 |
| 139 | Ga0075366_10169644 | 3300006195 | Bacteria | 1324 |
| 140 | Ga0075370_10003473 | 3300006353 | Bacteria | 7510 |
| 141 | Ga0075370_10030140 | 3300006353 | Bacteria | 3026 |
| 142 | Ga0079104_1000310 | 3300006946 | Bacteria | 61815 |
| 143 | Ga0079104_1002619 | 3300006946 | Bacteria | 9415 |
| 144 | Ga0099826_10000813 | 3300006948 | Bacteria | 16761 |
| 145 | Ga0105251_10005877 | 3300009011 | Bacteria | 7935 |
| 146 | Ga0105244_10061279 | 3300009036 | Bacteria | 1894 |
| 147 | Ga0105244_10148610 | 3300009036 | Bacteria | 1123 |
| 148 | Ga0105244_10151217 | 3300009036 | Bacteria | 1112 |
| 149 | Ga0105250_10005594 | 3300009092 | Bacteria | 5620 |
| 150 | Ga0105240_10000142 | 3300009093 | Bacteria | 146932 |
| 151 | Ga0105240_10117420 | 3300009093 | Bacteria | 3207 |
| 152 | Ga0105247_10027296 | 3300009101 | Bacteria | 3453 |
| 153 | Ga0105243_10013389 | 3300009148 | Bacteria | 6202 |
| 154 | Ga0105243_10065194 | 3300009148 | Bacteria | 2925 |
| 155 | Ga0105241_10094484 | 3300009174 | Bacteria | 2365 |
| 156 | Ga0105248_10015451 | 3300009177 | Bacteria | 8413 |
| 157 | Ga0105237_10073189 | 3300009545 | Bacteria | 3419 |
| 158 | Ga0105238_10241903 | 3300009551 | Bacteria | 1782 |
| 159 | Ga0105238_10399002 | 3300009551 | Bacteria | 1368 |
| 160 | Ga0105249_10027699 | 3300009553 | Bacteria | 5114 |
| 161 | Ga0105249_10076570 | 3300009553 | Bacteria | 3101 |
| 162 | Ga0105249_10164867 | 3300009553 | Bacteria | 2144 |
| 163 | Ga0123341_1011001 | 3300009765 | Bacteria | 8249 |
| 164 | Ga0123342_1006148 | 3300009766 | Bacteria | 16842 |
| 165 | Ga0105239_10040928 | 3300010375 | Bacteria | 5078 |
| 166 | Ga0105239_10098844 | 3300010375 | Bacteria | 3226 |
| 167 | Ga0105239_10145918 | 3300010375 | Bacteria | 2639 |
| 168 | Ga0105239_10222728 | 3300010375 | Bacteria | 2116 |
| 169 | Ga0105246_10125589 | 3300011119 | Bacteria | 1908 |
| 170 | Ga0157373_10017981 | 3300013100 | Bacteria | 5148 |
| 171 | Ga0157373_10052766 | 3300013100 | Bacteria | 2892 |
| 172 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 173 | Ga0157371_10016970 | 3300013102 | Bacteria | 5421 |
| 174 | Ga0157371_10208933 | 3300013102 | Bacteria | 1400 |
| 175 | Ga0157370_10000079 | 3300013104 | Bacteria | 107305 |
| 176 | Ga0157370_10250954 | 3300013104 | Bacteria | 1637 |
| 177 | Ga0157369_10058030 | 3300013105 | Bacteria | 4175 |
| 178 | Ga0157369_10155592 | 3300013105 | Bacteria | 2415 |
| 179 | Ga0157369_10301116 | 3300013105 | Bacteria | 1668 |
| 180 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 181 | Ga0157374_10515719 | 3300013296 | Bacteria | 1201 |
| 182 | Ga0163162_10240203 | 3300013306 | Bacteria | 1942 |
| 183 | Ga0163162_10264290 | 3300013306 | Bacteria | 1852 |
| 184 | Ga0163162_10407197 | 3300013306 | Bacteria | 1493 |
| 185 | Ga0163163_10667340 | 3300014325 | Bacteria | 1103 |
| 186 | Ga0182006_1045002 | 3300015261 | Bacteria | 1719 |
| 187 | Ga0182007_10009040 | 3300015262 | Bacteria | 4052 |
| 188 | Ga0182005_1011399 | 3300015265 | Bacteria | 2535 |
| 189 | Ga0183363_1129 | 3300015690 | Bacteria | 19181 |
| 190 | Ga0214542_1000064 | 3300021321 | Bacteria | 127681 |
| 191 | Ga0214542_1012059 | 3300021321 | Bacteria | 11445 |
| 192 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 193 | Ga0214543_1000063 | 3300021327 | Bacteria | 127694 |
| 194 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 195 | Ga0209435_100031 | 3300025206 | Bacteria | 164115 |
| 196 | Ga0209436_100013 | 3300025208 | Bacteria | 131492 |
| 197 | Ga0209436_100428 | 3300025208 | Bacteria | 18888 |
| 198 | Ga0209436_106719 | 3300025208 | Bacteria | 2485 |
| 199 | Ga0207427_108179 | 3300025231 | Bacteria | 1180 |
| 200 | Ga0209437_100179 | 3300025233 | Bacteria | 134210 |
| 201 | Ga0209437_100181 | 3300025233 | Bacteria | 132953 |
| 202 | Ga0207425_1000035 | 3300025245 | Bacteria | 225942 |
| 203 | Ga0207425_1000818 | 3300025245 | Bacteria | 15570 |
| 204 | Ga0207425_1003762 | 3300025245 | Bacteria | 4742 |
| 205 | Ga0207425_1006981 | 3300025245 | Bacteria | 3034 |
| 206 | Ga0207425_1016727 | 3300025245 | Bacteria | 1624 |
| 207 | Ga0207425_1017715 | 3300025245 | Bacteria | 1559 |
| 208 | Ga0209646_1000102 | 3300025246 | Bacteria | 164115 |
| 209 | Ga0209026_1000096 | 3300025250 | Bacteria | 164115 |
| 210 | Ga0209026_1000141 | 3300025250 | Bacteria | 114545 |
| 211 | Ga0209677_100353 | 3300025253 | Bacteria | 28643 |
| 212 | Ga0209148_1000111 | 3300025254 | Bacteria | 198095 |
| 213 | Ga0209148_1006902 | 3300025254 | Bacteria | 2411 |
| 214 | Ga0209759_1000090 | 3300025256 | Bacteria | 164115 |
| 215 | Ga0209759_1000354 | 3300025256 | Bacteria | 59742 |
| 216 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 217 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 218 | Ga0209129_1000826 | 3300025258 | Bacteria | 19503 |
| 219 | Ga0209129_1002308 | 3300025258 | Bacteria | 9478 |
| 220 | Ga0209129_1003458 | 3300025258 | Bacteria | 6852 |
| 221 | Ga0209129_1003466 | 3300025258 | Bacteria | 6840 |
| 222 | Ga0209233_1000118 | 3300025261 | Bacteria | 236172 |
| 223 | Ga0209233_1000185 | 3300025261 | Bacteria | 133788 |
| 224 | Ga0209233_1000212 | 3300025261 | Bacteria | 110364 |
| 225 | Ga0209233_1000263 | 3300025261 | Bacteria | 79293 |
| 226 | Ga0209233_1002000 | 3300025261 | Bacteria | 7717 |
| 227 | Ga0209455_1000206 | 3300025272 | Bacteria | 84430 |
| 228 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 229 | Ga0209673_1000050 | 3300025273 | Bacteria | 285287 |
| 230 | Ga0209673_1000370 | 3300025273 | Bacteria | 81047 |
| 231 | Ga0209673_1001845 | 3300025273 | Bacteria | 17300 |
| 232 | Ga0209673_1002753 | 3300025273 | Bacteria | 11510 |
| 233 | Ga0209673_1004411 | 3300025273 | Bacteria | 7553 |
| 234 | Ga0209673_1009772 | 3300025273 | Bacteria | 4115 |
| 235 | Ga0209673_1012920 | 3300025273 | Bacteria | 3328 |
| 236 | Ga0209673_1017809 | 3300025273 | Bacteria | 2607 |
| 237 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 238 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 239 | Ga0209130_1000133 | 3300025284 | Bacteria | 119561 |
| 240 | Ga0209130_1003685 | 3300025284 | Bacteria | 6322 |
| 241 | Ga0209130_1009201 | 3300025284 | Bacteria | 2840 |
| 242 | Ga0209676_1003603 | 3300025292 | Bacteria | 9324 |
| 243 | Ga0209676_1017298 | 3300025292 | Bacteria | 2559 |
| 244 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 245 | Ga0209025_1000132 | 3300025294 | Bacteria | 197432 |
| 246 | Ga0209025_1000453 | 3300025294 | Bacteria | 80110 |
| 247 | Ga0209025_1000536 | 3300025294 | Bacteria | 71932 |
| 248 | Ga0209025_1000815 | 3300025294 | Bacteria | 50019 |
| 249 | Ga0209025_1003984 | 3300025294 | Bacteria | 13258 |
| 250 | Ga0209025_1008993 | 3300025294 | Bacteria | 7056 |
| 251 | Ga0209025_1009137 | 3300025294 | Bacteria | 6969 |
| 252 | Ga0209025_1023470 | 3300025294 | Bacteria | 3221 |
| 253 | Ga0209025_1044776 | 3300025294 | Bacteria | 1844 |
| 254 | Ga0209025_1082425 | 3300025294 | Bacteria | 1086 |
| 255 | Ga0209564_1000193 | 3300025295 | Bacteria | 141731 |
| 256 | Ga0209564_1000227 | 3300025295 | Bacteria | 125497 |
| 257 | Ga0209564_1000284 | 3300025295 | Bacteria | 102684 |
| 258 | Ga0209564_1002592 | 3300025295 | Bacteria | 13868 |
| 259 | Ga0209564_1007808 | 3300025295 | Bacteria | 5431 |
| 260 | Ga0209564_1010209 | 3300025295 | Bacteria | 4357 |
| 261 | Ga0209564_1010789 | 3300025295 | Bacteria | 4164 |
| 262 | Ga0209564_1021755 | 3300025295 | Bacteria | 2293 |
| 263 | Ga0209758_1000299 | 3300025297 | Bacteria | 97367 |
| 264 | Ga0209758_1000406 | 3300025297 | Bacteria | 73962 |
| 265 | Ga0209758_1000864 | 3300025297 | Bacteria | 41937 |
| 266 | Ga0209758_1001412 | 3300025297 | Bacteria | 28454 |
| 267 | Ga0209758_1001462 | 3300025297 | Bacteria | 27731 |
| 268 | Ga0209758_1003168 | 3300025297 | Bacteria | 15434 |
| 269 | Ga0209758_1003902 | 3300025297 | Bacteria | 13025 |
| 270 | Ga0209758_1005846 | 3300025297 | Bacteria | 9189 |
| 271 | Ga0209758_1007065 | 3300025297 | Bacteria | 7785 |
| 272 | Ga0209758_1022438 | 3300025297 | Bacteria | 2894 |
| 273 | Ga0209758_1028206 | 3300025297 | Bacteria | 2380 |
| 274 | Ga0209050_1002699 | 3300025298 | Bacteria | 14431 |
| 275 | Ga0209050_1004678 | 3300025298 | Bacteria | 9092 |
| 276 | Ga0209050_1004888 | 3300025298 | Bacteria | 8778 |
| 277 | Ga0209256_1000286 | 3300025299 | Bacteria | 88880 |
| 278 | Ga0209256_1001479 | 3300025299 | Bacteria | 24043 |
| 279 | Ga0209256_1001610 | 3300025299 | Bacteria | 22074 |
| 280 | Ga0209256_1001820 | 3300025299 | Bacteria | 19999 |
| 281 | Ga0209256_1002679 | 3300025299 | Bacteria | 13959 |
| 282 | Ga0209256_1003742 | 3300025299 | Bacteria | 10288 |
| 283 | Ga0209256_1005463 | 3300025299 | Bacteria | 7300 |
| 284 | Ga0209256_1013906 | 3300025299 | Bacteria | 2947 |
| 285 | Ga0209256_1015132 | 3300025299 | Bacteria | 2720 |
| 286 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 287 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 288 | Ga0207426_1000214 | 3300025302 | Bacteria | 137296 |
| 289 | Ga0207426_1000248 | 3300025302 | Bacteria | 119561 |
| 290 | Ga0207426_1000682 | 3300025302 | Bacteria | 40955 |
| 291 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 292 | Ga0209051_1000822 | 3300025303 | Bacteria | 32088 |
| 293 | Ga0209051_1001039 | 3300025303 | Bacteria | 26259 |
| 294 | Ga0209051_1011245 | 3300025303 | Bacteria | 4438 |
| 295 | Ga0209051_1012570 | 3300025303 | Bacteria | 4089 |
| 296 | Ga0209257_1003194 | 3300025304 | Bacteria | 14537 |
| 297 | Ga0209257_1003966 | 3300025304 | Bacteria | 11990 |
| 298 | Ga0209257_1008273 | 3300025304 | Bacteria | 5971 |
| 299 | Ga0209257_1021432 | 3300025304 | Bacteria | 2347 |
| 300 | Ga0209257_1031374 | 3300025304 | Bacteria | 1700 |
| 301 | Ga0209257_1032740 | 3300025304 | Bacteria | 1644 |
| 302 | Ga0207713_1039001 | 3300025735 | Bacteria | 2009 |
| 303 | Ga0207680_10460929 | 3300025903 | Bacteria | 903 |
| 304 | Ga0207647_10005393 | 3300025904 | Bacteria | 9389 |
| 305 | Ga0207647_10029967 | 3300025904 | Bacteria | 3515 |
| 306 | Ga0207647_10232840 | 3300025904 | Bacteria | 1059 |
| 307 | Ga0207695_10000234 | 3300025913 | Bacteria | 146987 |
| 308 | Ga0207671_10000234 | 3300025914 | Bacteria | 83448 |
| 309 | Ga0207681_10044364 | 3300025923 | Bacteria | 2979 |
| 310 | Ga0207650_10001757 | 3300025925 | Bacteria | 15368 |
| 311 | Ga0207709_10041550 | 3300025935 | Bacteria | 2760 |
| 312 | Ga0207709_10130227 | 3300025935 | Bacteria | 1713 |
| 313 | Ga0207711_10015450 | 3300025941 | Bacteria | 6335 |
| 314 | Ga0207667_10228498 | 3300025949 | Bacteria | 1906 |
| 315 | Ga0207712_10015100 | 3300025961 | Bacteria | 4976 |
| 316 | Ga0207640_10099697 | 3300025981 | Bacteria | 2033 |
| 317 | Ga0207639_10264026 | 3300026041 | Bacteria | 1507 |
| 318 | Ga0207678_10040358 | 3300026067 | Bacteria | 4048 |
| 319 | Ga0207702_10028158 | 3300026078 | Bacteria | 4669 |
| 320 | Ga0207702_10347382 | 3300026078 | Bacteria | 1418 |
| 321 | Ga0207648_10017029 | 3300026089 | Bacteria | 6623 |
| 322 | Ga0207683_10204603 | 3300026121 | Bacteria | 1795 |
| 323 | Ga0207698_10158850 | 3300026142 | Bacteria | 1974 |
| 324 | Ga0207698_10347438 | 3300026142 | Bacteria | 1400 |
| 325 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 326 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 327 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 328 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 329 | Ga0209371_1001411 | 3300027312 | Bacteria | 16466 |
| 330 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 331 | Ga0209282_1000695 | 3300027666 | Bacteria | 16757 |
| 332 | Ga0209813_10000656 | 3300027866 | Bacteria | 7932 |
| 333 | Ga0209813_10005578 | 3300027866 | Bacteria | 3063 |
| 334 | Ga0268266_10009948 | 3300028379 | Bacteria | 8347 |
| 335 | Ga0268266_10020595 | 3300028379 | Bacteria | 5619 |
| 336 | Ga0268266_10022456 | 3300028379 | Bacteria | 5376 |
| 337 | Ga0268266_10024962 | 3300028379 | Bacteria | 5086 |
| 338 | Ga0268266_10036055 | 3300028379 | Bacteria | 4208 |
| 339 | Ga0268266_10048156 | 3300028379 | Bacteria | 3653 |
| 340 | Ga0268266_10084479 | 3300028379 | Bacteria | 2772 |
| 341 | Ga0268266_10107988 | 3300028379 | Bacteria | 2462 |
| 342 | Ga0307515_10001049 | 3300028794 | Bacteria | 63286 |
| 343 | Ga0307515_10001099 | 3300028794 | Bacteria | 61933 |
| 344 | Ga0307515_10003215 | 3300028794 | Bacteria | 34578 |
| 345 | Ga0307515_10012908 | 3300028794 | Bacteria | 15667 |
| 346 | Ga0307515_10166092 | 3300028794 | Bacteria | 2224 |
| 347 | Ga0307515_10405949 | 3300028794 | Bacteria | 986 |
| 348 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 349 | Ga0268256_1001490 | 3300030500 | Bacteria | 13902 |
| 350 | Ga0307513_10001726 | 3300031456 | Bacteria | 31179 |
| 351 | Ga0307513_10293864 | 3300031456 | Bacteria | 1395 |
| 352 | Ga0307513_10322135 | 3300031456 | Bacteria | 1303 |
| 353 | Ga0307408_100174389 | 3300031548 | Bacteria | 1719 |
| 354 | Ga0307408_100214882 | 3300031548 | Bacteria | 1565 |
| 355 | Ga0307405_10000700 | 3300031731 | Bacteria | 13004 |
| 356 | Ga0307405_10105294 | 3300031731 | Bacteria | 1900 |
| 357 | Ga0307405_10107309 | 3300031731 | Bacteria | 1885 |
| 358 | Ga0307406_10025694 | 3300031901 | Bacteria | 3528 |
| 359 | Ga0307412_10000412 | 3300031911 | Bacteria | 26116 |
| 360 | Ga0307412_10180321 | 3300031911 | Bacteria | 1588 |
| 361 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 362 | Ga0307409_100057973 | 3300031995 | Bacteria | 3005 |
| 363 | Ga0307416_100117991 | 3300032002 | Bacteria | 2357 |
| 364 | Ga0307414_10281880 | 3300032004 | Bacteria | 1397 |
| 365 | Ga0315913_1000022 | 3300033430 | Bacteria | 94546 |
| 366 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 367 | Ga0373943_0022408 | 3300035170 | Bacteria | 2927 |
| 368 | Ga0373927_0000068 | 3300035695 | Bacteria | 75823 |
| 369 | Ga0373925_0009713 | 3300037068 | Bacteria | 6995 |
| 370 | Ga0395899_0000114 | 3300037312 | Bacteria | 134621 |
| 371 | Ga0395900_0000154 | 3300037418 | Bacteria | 113757 |
| 372 | Ga0395898_0000308 | 3300037466 | Bacteria | 113757 |
| 373 | Ga0395905_0000145 | 3300037471 | Bacteria | 116795 |
| 374 | Ga0395905_0000153 | 3300037471 | Bacteria | 113757 |
| 375 | Ga0395905_0002522 | 3300037471 | Bacteria | 20214 |
| 376 | Ga0395905_0003283 | 3300037471 | Bacteria | 17375 |
| 377 | Ga0395905_0006080 | 3300037471 | Bacteria | 12205 |
| 378 | Ga0395905_0109772 | 3300037471 | Bacteria | 2590 |
| 379 | Ga0395905_0140183 | 3300037471 | Bacteria | 2275 |
| 380 | Ga0395905_0203194 | 3300037471 | Bacteria | 1857 |
| 381 | Ga0395901_0000107 | 3300038443 | Bacteria | 113757 |
| 382 | Ga0395901_0128293 | 3300038443 | Bacteria | 2666 |
| 383 | Ga0439436_0020168 | 3300041404 | Bacteria | 1986 |
| 384 | Ga0439438_022143 | 3300041405 | Bacteria | 1766 |
| 385 | Ga0439465_0002941 | 3300041413 | Bacteria | 5579 |
| 386 | Ga0439465_0008560 | 3300041413 | Bacteria | 3228 |
| 387 | Ga0439465_0087910 | 3300041413 | Bacteria | 1060 |
| 388 | Ga0439465_0109789 | 3300041413 | Bacteria | 959 |
| 389 | Ga0439465_0109951 | 3300041413 | Bacteria | 958 |
| 390 | Ga0451787_786302 | 3300041441 | Bacteria | 3281 |
| 391 | Ga0451791_1084156 | 3300041451 | Bacteria | 2283 |
| 392 | Ga0451795_0936408 | 3300041456 | Bacteria | 1710 |
| 393 | Ga0451835_0541352 | 3300041492 | Bacteria | 1606 |
| 394 | Ga0451837_1266342 | 3300041494 | Bacteria | 2873 |
| 395 | Ga0451839_0960768 | 3300041496 | Bacteria | 948 |
| 396 | Ga0451839_1362450 | 3300041496 | Bacteria | 900 |
| 397 | Ga0451845_0818217 | 3300041501 | Bacteria | 1202 |
| 398 | Ga0451846_16062 | 3300041502 | Bacteria | 4334 |
| 399 | Ga0451847_0888644 | 3300041503 | Bacteria | 1230 |
| 400 | Ga0451848_00496 | 3300041504 | Bacteria | 1003 |
| 401 | Ga0451849_0622848 | 3300041505 | Bacteria | 1609 |
| 402 | Ga0451849_1184580 | 3300041505 | Bacteria | 888 |
| 403 | Ga0451850_52452 | 3300041506 | Bacteria | 1113 |
| 404 | Ga0451851_0296208 | 3300041507 | Bacteria | 1866 |
| 405 | Ga0451851_1301903 | 3300041507 | Bacteria | 1545 |
| 406 | Ga0451843_0006262 | 3300041509 | Bacteria | 2798 |
| 407 | Ga0451843_0102315 | 3300041509 | Bacteria | 4344 |
| 408 | Ga0451854_25229 | 3300041510 | Bacteria | 1677 |
| 409 | Ga0451855_1956298 | 3300041511 | Bacteria | 1229 |
| 410 | Ga0452271_63898 | 3300041916 | Bacteria | 1163 |
| 411 | Ga0439449_0016640 | 3300042007 | Bacteria | 2763 |
| 412 | Ga0439449_0082256 | 3300042007 | Bacteria | 1187 |
| 413 | Ga0439462_0050030 | 3300042015 | Bacteria | 1122 |
| 414 | Ga0450918_001271 | 3300042531 | Bacteria | 5116 |
| 415 | Ga0466965_0038749 | 3300044683 | Bacteria | 2342 |
| 416 | Ga0466968_0085444 | 3300044735 | Bacteria | 1392 |
| 417 | Ga0466970_0057028 | 3300044765 | Bacteria | 2088 |
| 418 | Ga0466960_0058815 | 3300044901 | Bacteria | 1878 |
| 419 | Ga0466967_0122754 | 3300045976 | Bacteria | 2403 |
| 420 | Ga0495590_0096483 | 3300046457 | Bacteria | 1048 |
| 421 | Ga0495629_0228937 | 3300046459 | Bacteria | 1281 |
| 422 | Ga0495638_0000110 | 3300046460 | Bacteria | 131410 |
| 423 | Ga0495638_0009542 | 3300046460 | Bacteria | 6800 |
| 424 | Ga0495638_0023446 | 3300046460 | Bacteria | 4035 |
| 425 | Ga0495638_0072445 | 3300046460 | Bacteria | 2105 |
| 426 | Ga0495605_0018627 | 3300046474 | Bacteria | 3718 |
| 427 | Ga0495605_0018645 | 3300046474 | Bacteria | 3715 |
| 428 | Ga0495585_0025166 | 3300046492 | Bacteria | 3412 |
| 429 | Ga0495585_0273670 | 3300046492 | Bacteria | 836 |
| 430 | Ga0495607_0009290 | 3300046501 | Bacteria | 6668 |
| 431 | Ga0495583_0002526 | 3300046506 | Bacteria | 15489 |
| 432 | Ga0495583_0030411 | 3300046506 | Bacteria | 2630 |
| 433 | Ga0495583_0036690 | 3300046506 | Bacteria | 2329 |
| 434 | Ga0495583_0038784 | 3300046506 | Bacteria | 2249 |
| 435 | Ga0495606_0008486 | 3300046507 | Bacteria | 8914 |
| 436 | Ga0495610_0000363 | 3300046512 | Bacteria | 47378 |
| 437 | Ga0495610_0114438 | 3300046512 | Bacteria | 1191 |
| 438 | Ga0495620_0026048 | 3300046515 | Bacteria | 2755 |
| 439 | Ga0495620_0032808 | 3300046515 | Bacteria | 2362 |
| 440 | Ga0495620_0124812 | 3300046515 | Bacteria | 1013 |
| 441 | Ga0495631_0009141 | 3300046518 | Bacteria | 4963 |
| 442 | Ga0495631_0062843 | 3300046518 | Bacteria | 1608 |
| 443 | Ga0495632_0002260 | 3300046519 | Bacteria | 14836 |
| 444 | Ga0495632_0004424 | 3300046519 | Bacteria | 9551 |
| 445 | Ga0495632_0031879 | 3300046519 | Bacteria | 2720 |
| 446 | Ga0495632_0043756 | 3300046519 | Bacteria | 2237 |
| 447 | Ga0495643_0014831 | 3300046522 | Bacteria | 4627 |
| 448 | Ga0495643_0083550 | 3300046522 | Bacteria | 1657 |
| 449 | Ga0495648_0023661 | 3300046524 | Bacteria | 4200 |
| 450 | Ga0495648_0033988 | 3300046524 | Bacteria | 3325 |
| 451 | Ga0495654_0000143 | 3300046530 | Bacteria | 74495 |
| 452 | Ga0495654_0029808 | 3300046530 | Bacteria | 2781 |
| 453 | Ga0495654_0102439 | 3300046530 | Bacteria | 1316 |
| 454 | Ga0495640_0124115 | 3300046533 | Bacteria | 1676 |
| 455 | Ga0495609_0047715 | 3300046538 | Bacteria | 1916 |
| 456 | Ga0495597_0003665 | 3300046542 | Bacteria | 8821 |
| 457 | Ga0495622_0003807 | 3300046557 | Bacteria | 7049 |
| 458 | Ga0495633_0017760 | 3300046558 | Bacteria | 3627 |
| 459 | Ga0495668_0013032 | 3300046616 | Bacteria | 4920 |
| 460 | Ga0495668_0028753 | 3300046616 | Bacteria | 3143 |
| 461 | Ga0495668_0044115 | 3300046616 | Bacteria | 2478 |
| 462 | Ga0495668_0078372 | 3300046616 | Bacteria | 1814 |
| 463 | Ga0495668_0166161 | 3300046616 | Bacteria | 1209 |
| 464 | Ga0495611_0066298 | 3300046648 | Bacteria | 1646 |
| 465 | Ga0495625_0018152 | 3300046660 | Bacteria | 5499 |
| 466 | Ga0495625_0025839 | 3300046660 | Bacteria | 4445 |
| 467 | Ga0495625_0032212 | 3300046660 | Bacteria | 3891 |
| 468 | Ga0495625_0032944 | 3300046660 | Bacteria | 3836 |
| 469 | Ga0495625_0036901 | 3300046660 | Bacteria | 3588 |
| 470 | Ga0495625_0060171 | 3300046660 | Bacteria | 2692 |
| 471 | Ga0495625_0087218 | 3300046660 | Bacteria | 2164 |
| 472 | Ga0495625_0114829 | 3300046660 | Bacteria | 1838 |
| 473 | Ga0495625_0153453 | 3300046660 | Bacteria | 1547 |
| 474 | Ga0495625_0350247 | 3300046660 | Bacteria | 934 |
| 475 | Ga0495670_0124213 | 3300046691 | Bacteria | 1342 |
| 476 | Ga0495649_0028221 | 3300046694 | Bacteria | 3111 |
| 477 | Ga0495604_0040845 | 3300047317 | Bacteria | 3640 |
| 478 | Ga0495672_0037794 | 3300047320 | Bacteria | 2951 |
| 479 | Ga0495681_0006015 | 3300047470 | Bacteria | 8035 |
| 480 | Ga0495681_0016034 | 3300047470 | Bacteria | 4222 |
| 481 | Ga0495686_0002138 | 3300047472 | Bacteria | 19314 |
| 482 | Ga0495686_0029027 | 3300047472 | Bacteria | 3600 |
| 483 | Ga0495686_0034137 | 3300047472 | Bacteria | 3278 |
| 484 | Ga0496100_0041778 | 3300048903 | Bacteria | 2925 |
| 485 | Ga0496102_0027633 | 3300048905 | Bacteria | 5066 |
| 486 | Ga0496102_0095857 | 3300048905 | Bacteria | 2750 |
| 487 | Ga0496102_0231085 | 3300048905 | Bacteria | 1744 |
| 488 | Ga0496102_0664044 | 3300048905 | Bacteria | 965 |
| 489 | Ga0496103_0035386 | 3300048906 | Bacteria | 3057 |
| 490 | Ga0496104_0019186 | 3300048907 | Bacteria | 6252 |
| 491 | Ga0496104_0572581 | 3300048907 | Bacteria | 1040 |
| 492 | Ga0496105_0106434 | 3300048908 | Bacteria | 2315 |
| 493 | Ga0496106_0000209 | 3300048909 | Bacteria | 40829 |
| 494 | Ga0496110_0034043 | 3300048913 | Bacteria | 4410 |
| 495 | Ga0496110_0037462 | 3300048913 | Bacteria | 4215 |
| 496 | Ga0496111_0000529 | 3300048914 | Bacteria | 19781 |
| 497 | Ga0496112_0059923 | 3300048915 | Bacteria | 3751 |
| 498 | Ga0496113_0125184 | 3300048916 | Bacteria | 2012 |
| 499 | Ga0496113_0182693 | 3300048916 | Bacteria | 1663 |
| 500 | Ga0496115_0559841 | 3300048918 | Bacteria | 913 |
| 501 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 502 | Ga0496116_0002951 | 3300048919 | Bacteria | 17324 |
| 503 | Ga0496116_0004307 | 3300048919 | Bacteria | 13619 |
| 504 | Ga0496116_0007377 | 3300048919 | Bacteria | 9769 |
| 505 | Ga0496116_0012871 | 3300048919 | Bacteria | 6795 |
| 506 | Ga0496116_0013281 | 3300048919 | Bacteria | 6657 |
| 507 | Ga0496116_0027111 | 3300048919 | Bacteria | 4175 |
| 508 | Ga0496116_0049893 | 3300048919 | Bacteria | 2793 |
| 509 | Ga0496116_0089513 | 3300048919 | Bacteria | 1877 |
| 510 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 511 | Ga0496117_0004374 | 3300048920 | Bacteria | 15663 |
| 512 | Ga0496117_0005859 | 3300048920 | Bacteria | 12714 |
| 513 | Ga0496117_0008418 | 3300048920 | Bacteria | 9802 |
| 514 | Ga0496117_0008839 | 3300048920 | Bacteria | 9505 |
| 515 | Ga0496117_0025271 | 3300048920 | Bacteria | 4673 |
| 516 | Ga0496117_0057733 | 3300048920 | Bacteria | 2693 |
| 517 | Ga0496117_0062376 | 3300048920 | Bacteria | 2555 |
| 518 | Ga0496118_0000208 | 3300048921 | Bacteria | 102645 |
| 519 | Ga0496118_0008309 | 3300048921 | Bacteria | 10754 |
| 520 | Ga0496118_0009542 | 3300048921 | Bacteria | 9773 |
| 521 | Ga0496118_0010424 | 3300048921 | Bacteria | 9207 |
| 522 | Ga0496118_0018069 | 3300048921 | Bacteria | 6382 |
| 523 | Ga0496118_0026041 | 3300048921 | Bacteria | 4996 |
| 524 | Ga0496118_0117856 | 3300048921 | Bacteria | 1741 |
| 525 | Ga0496119_0010018 | 3300048922 | Bacteria | 8021 |
| 526 | Ga0496119_0027187 | 3300048922 | Bacteria | 3941 |
| 527 | Ga0496119_0028420 | 3300048922 | Bacteria | 3815 |
| 528 | Ga0496119_0057969 | 3300048922 | Bacteria | 2337 |
| 529 | Ga0496119_0058422 | 3300048922 | Bacteria | 2324 |
| 530 | Ga0496119_0059282 | 3300048922 | Bacteria | 2300 |
| 531 | Ga0496119_0098164 | 3300048922 | Bacteria | 1649 |
| 532 | Ga0496119_0173109 | 3300048922 | Bacteria | 1138 |
| 533 | Ga0496120_0000387 | 3300048923 | Bacteria | 71224 |
| 534 | Ga0496120_0003353 | 3300048923 | Bacteria | 14696 |
| 535 | Ga0496120_0009286 | 3300048923 | Bacteria | 6995 |
| 536 | Ga0496120_0031754 | 3300048923 | Bacteria | 3193 |
| 537 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 538 | Ga0496121_0000888 | 3300048924 | Bacteria | 53958 |
| 539 | Ga0496121_0003956 | 3300048924 | Bacteria | 20474 |
| 540 | Ga0496121_0006665 | 3300048924 | Bacteria | 14205 |
| 541 | Ga0496121_0011216 | 3300048924 | Bacteria | 9985 |
| 542 | Ga0496121_0017687 | 3300048924 | Bacteria | 7256 |
| 543 | Ga0496121_0021103 | 3300048924 | Bacteria | 6399 |
| 544 | Ga0496121_0026581 | 3300048924 | Bacteria | 5446 |
| 545 | Ga0496121_0062440 | 3300048924 | Bacteria | 3051 |
| 546 | Ga0496121_0099186 | 3300048924 | Bacteria | 2252 |
| 547 | Ga0496121_0368692 | 3300048924 | Bacteria | 951 |
| 548 | Ga0496121_0423096 | 3300048924 | Bacteria | 866 |
| 549 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 550 | Ga0496122_0000082 | 3300048925 | Bacteria | 209159 |
| 551 | Ga0496122_0000308 | 3300048925 | Bacteria | 107960 |
| 552 | Ga0496122_0001941 | 3300048925 | Bacteria | 31047 |
| 553 | Ga0496122_0009040 | 3300048925 | Bacteria | 10577 |
| 554 | Ga0496122_0009440 | 3300048925 | Bacteria | 10278 |
| 555 | Ga0496122_0016216 | 3300048925 | Bacteria | 7071 |
| 556 | Ga0496122_0024313 | 3300048925 | Bacteria | 5303 |
| 557 | Ga0496122_0046997 | 3300048925 | Bacteria | 3336 |
| 558 | Ga0496122_0056321 | 3300048925 | Bacteria | 2931 |
| 559 | Ga0496122_0069421 | 3300048925 | Bacteria | 2523 |
| 560 | Ga0496122_0099299 | 3300048925 | Bacteria | 1952 |
| 561 | Ga0496122_0179827 | 3300048925 | Bacteria | 1263 |
| 562 | Ga0496122_0188034 | 3300048925 | Bacteria | 1222 |
| 563 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 564 | Ga0496123_0000066 | 3300048926 | Bacteria | 210327 |
| 565 | Ga0496123_0000067 | 3300048926 | Bacteria | 209159 |
| 566 | Ga0496123_0004280 | 3300048926 | Bacteria | 15189 |
| 567 | Ga0496123_0005944 | 3300048926 | Bacteria | 12020 |
| 568 | Ga0496123_0007760 | 3300048926 | Bacteria | 10011 |
| 569 | Ga0496123_0014489 | 3300048926 | Bacteria | 6531 |
| 570 | Ga0496123_0014788 | 3300048926 | Bacteria | 6443 |
| 571 | Ga0496123_0017159 | 3300048926 | Bacteria | 5840 |
| 572 | Ga0496123_0032615 | 3300048926 | Bacteria | 3766 |
| 573 | Ga0496123_0091795 | 3300048926 | Bacteria | 1799 |
| 574 | Ga0496123_0143543 | 3300048926 | Bacteria | 1300 |
| 575 | Ga0496123_0147973 | 3300048926 | Bacteria | 1272 |
| 576 | Ga0496124_0000294 | 3300048927 | Bacteria | 93153 |
| 577 | Ga0496124_0001215 | 3300048927 | Bacteria | 39879 |
| 578 | Ga0496124_0003574 | 3300048927 | Bacteria | 18903 |
| 579 | Ga0496124_0004183 | 3300048927 | Bacteria | 17010 |
| 580 | Ga0496124_0008477 | 3300048927 | Bacteria | 10743 |
| 581 | Ga0496124_0021552 | 3300048927 | Bacteria | 5936 |
| 582 | Ga0496124_0041507 | 3300048927 | Bacteria | 3969 |
| 583 | Ga0496124_0066054 | 3300048927 | Bacteria | 3014 |
| 584 | Ga0496124_0071829 | 3300048927 | Bacteria | 2867 |
| 585 | Ga0496124_0132601 | 3300048927 | Bacteria | 1977 |
| 586 | Ga0496124_0138206 | 3300048927 | Bacteria | 1926 |
| 587 | Ga0496124_0196553 | 3300048927 | Bacteria | 1538 |
| 588 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 589 | Ga0496125_0000288 | 3300048928 | Bacteria | 99681 |
| 590 | Ga0496125_0004702 | 3300048928 | Bacteria | 15559 |
| 591 | Ga0496125_0005090 | 3300048928 | Bacteria | 14802 |
| 592 | Ga0496125_0006385 | 3300048928 | Bacteria | 12774 |
| 593 | Ga0496125_0010417 | 3300048928 | Bacteria | 9407 |
| 594 | Ga0496125_0051919 | 3300048928 | Bacteria | 3377 |
| 595 | Ga0496125_0122995 | 3300048928 | Bacteria | 1845 |
| 596 | Ga0496125_0124822 | 3300048928 | Bacteria | 1827 |
| 597 | Ga0496125_0225126 | 3300048928 | Bacteria | 1204 |
| 598 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 599 | Ga0496126_0000258 | 3300048929 | Bacteria | 113843 |
| 600 | Ga0496126_0061541 | 3300048929 | Bacteria | 3372 |
| 601 | Ga0496126_0125055 | 3300048929 | Bacteria | 2227 |
| 602 | Ga0496126_0266582 | 3300048929 | Bacteria | 1422 |
| 603 | Ga0496126_0281803 | 3300048929 | Bacteria | 1376 |
| 604 | Ga0496126_0447962 | 3300048929 | Bacteria | 1039 |
| 605 | Ga0496126_0519990 | 3300048929 | Bacteria | 948 |
| 606 | Ga0495678_051307 | 3300049459 | Bacteria | 1595 |
| 607 | Ga0501300_002486 | 3300049523 | Bacteria | 2755 |
| 608 | Ga0501031_0000009 | 3300049568 | Bacteria | 155116 |
| 609 | Ga0501031_0038311 | 3300049568 | Bacteria | 3129 |
| 610 | Ga0501031_0081844 | 3300049568 | Bacteria | 2105 |
| 611 | Ga0501031_0109836 | 3300049568 | Bacteria | 1801 |
| 612 | Ga0501031_0153985 | 3300049568 | Bacteria | 1502 |
| 613 | Ga0501031_0160215 | 3300049568 | Bacteria | 1471 |
| 614 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 615 | Ga0501032_0000017 | 3300049569 | Bacteria | 158303 |
| 616 | Ga0501032_0004117 | 3300049569 | Bacteria | 11017 |
| 617 | Ga0501032_0161419 | 3300049569 | Bacteria | 1472 |
| 618 | Ga0501032_0164065 | 3300049569 | Bacteria | 1458 |
| 619 | Ga0501032_0188048 | 3300049569 | Bacteria | 1350 |
| 620 | Ga0501032_0209990 | 3300049569 | Bacteria | 1269 |
| 621 | Ga0501033_0000029 | 3300049570 | Bacteria | 158294 |
| 622 | Ga0501033_0000741 | 3300049570 | Bacteria | 29982 |
| 623 | Ga0501033_0000898 | 3300049570 | Bacteria | 27225 |
| 624 | Ga0501033_0001913 | 3300049570 | Bacteria | 18117 |
| 625 | Ga0501033_0015463 | 3300049570 | Bacteria | 5788 |
| 626 | Ga0501033_0020825 | 3300049570 | Bacteria | 4951 |
| 627 | Ga0501033_0041445 | 3300049570 | Bacteria | 3435 |
| 628 | Ga0501033_0048357 | 3300049570 | Bacteria | 3159 |
| 629 | Ga0501033_0142767 | 3300049570 | Bacteria | 1731 |
| 630 | Ga0501033_0340796 | 3300049570 | Bacteria | 1051 |
| 631 | Ga0501034_0000102 | 3300049571 | Bacteria | 158302 |
| 632 | Ga0501034_0006657 | 3300049571 | Bacteria | 12393 |
| 633 | Ga0501034_0008076 | 3300049571 | Bacteria | 11161 |
| 634 | Ga0501034_0008287 | 3300049571 | Bacteria | 11001 |
| 635 | Ga0501034_0048481 | 3300049571 | Bacteria | 4287 |
| 636 | Ga0501034_0101447 | 3300049571 | Bacteria | 2871 |
| 637 | Ga0501034_0116412 | 3300049571 | Bacteria | 2661 |
| 638 | Ga0501034_0154163 | 3300049571 | Bacteria | 2272 |
| 639 | Ga0501034_0379969 | 3300049571 | Bacteria | 1337 |
| 640 | Ga0501036_0000011 | 3300049572 | Bacteria | 158302 |
| 641 | Ga0501036_0000804 | 3300049572 | Bacteria | 23330 |
| 642 | Ga0501036_0297214 | 3300049572 | Bacteria | 1351 |
| 643 | Ga0501037_0000015 | 3300049573 | Bacteria | 161311 |
| 644 | Ga0501037_0000089 | 3300049573 | Bacteria | 85102 |
| 645 | Ga0501037_0000091 | 3300049573 | Bacteria | 84811 |
| 646 | Ga0501037_0060985 | 3300049573 | Bacteria | 2751 |
| 647 | Ga0501037_0125928 | 3300049573 | Bacteria | 1839 |
| 648 | Ga0501038_0000016 | 3300049574 | Bacteria | 159150 |
| 649 | Ga0501038_0000402 | 3300049574 | Bacteria | 37516 |
| 650 | Ga0501038_0229756 | 3300049574 | Bacteria | 1477 |
| 651 | Ga0501039_0000022 | 3300049575 | Bacteria | 160858 |
| 652 | Ga0501039_0000023 | 3300049575 | Bacteria | 158026 |
| 653 | Ga0501039_0045660 | 3300049575 | Bacteria | 3385 |
| 654 | Ga0501040_0029026 | 3300049576 | Bacteria | 3732 |
| 655 | Ga0501040_0494081 | 3300049576 | Bacteria | 882 |
| 656 | Ga0501042_0026781 | 3300049578 | Bacteria | 4051 |
| 657 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 658 | Ga0501043_0000093 | 3300049579 | Bacteria | 80521 |
| 659 | Ga0501043_0000372 | 3300049579 | Bacteria | 40661 |
| 660 | Ga0501043_0064351 | 3300049579 | Bacteria | 2879 |
| 661 | Ga0501043_0092471 | 3300049579 | Bacteria | 2378 |
| 662 | Ga0501046_0012425 | 3300049580 | Bacteria | 7249 |
| 663 | Ga0501046_0087767 | 3300049580 | Bacteria | 2396 |
| 664 | Ga0501046_0148875 | 3300049580 | Bacteria | 1767 |
| 665 | Ga0501047_0001169 | 3300049581 | Bacteria | 26022 |
| 666 | Ga0501047_0092127 | 3300049581 | Bacteria | 2909 |
| 667 | Ga0501047_0214148 | 3300049581 | Bacteria | 1784 |
| 668 | Ga0501048_0146250 | 3300049582 | Bacteria | 1671 |
| 669 | Ga0501048_0460991 | 3300049582 | Bacteria | 910 |
| 670 | Ga0501067_0152752 | 3300049583 | Bacteria | 1286 |
| 671 | Ga0501068_0006869 | 3300049584 | Bacteria | 6291 |
| 672 | Ga0501068_0114354 | 3300049584 | Bacteria | 1680 |
| 673 | Ga0501068_0211120 | 3300049584 | Bacteria | 1233 |
| 674 | Ga0501069_0000001 | 3300049585 | Bacteria | 289100 |
| 675 | Ga0501069_0038095 | 3300049585 | Bacteria | 2654 |
| 676 | Ga0501069_0095787 | 3300049585 | Bacteria | 1681 |
| 677 | Ga0501070_0000071 | 3300049586 | Bacteria | 86669 |
| 678 | Ga0501070_0000771 | 3300049586 | Bacteria | 29156 |
| 679 | Ga0501070_0001656 | 3300049586 | Bacteria | 19742 |
| 680 | Ga0501070_0017382 | 3300049586 | Bacteria | 6037 |
| 681 | Ga0501070_0055100 | 3300049586 | Bacteria | 3296 |
| 682 | Ga0501070_0089623 | 3300049586 | Bacteria | 2545 |
| 683 | Ga0501070_0144438 | 3300049586 | Bacteria | 1964 |
| 684 | Ga0501070_0183253 | 3300049586 | Bacteria | 1723 |
| 685 | Ga0501070_0409529 | 3300049586 | Bacteria | 1096 |
| 686 | Ga0501071_0004826 | 3300049587 | Bacteria | 8591 |
| 687 | Ga0501073_0003390 | 3300049589 | Bacteria | 11984 |
| 688 | Ga0501074_0000003 | 3300049590 | Bacteria | 116101 |
| 689 | Ga0501074_0092052 | 3300049590 | Bacteria | 2171 |
| 690 | Ga0501074_0120102 | 3300049590 | Bacteria | 1879 |
| 691 | Ga0501080_0000090 | 3300049742 | Bacteria | 61585 |
| 692 | Ga0501080_0037802 | 3300049742 | Bacteria | 4507 |
| 693 | Ga0501080_0243365 | 3300049742 | Bacteria | 1641 |
| 694 | Ga0501083_0000012 | 3300049744 | Bacteria | 178668 |
| 695 | Ga0501035_0000037 | 3300049822 | Bacteria | 160921 |
| 696 | Ga0501035_0000038 | 3300049822 | Bacteria | 158818 |
| 697 | Ga0501035_0000336 | 3300049822 | Bacteria | 54776 |
| 698 | Ga0501035_0000646 | 3300049822 | Bacteria | 38403 |
| 699 | Ga0501035_0002118 | 3300049822 | Bacteria | 19744 |
| 700 | Ga0501035_0003768 | 3300049822 | Bacteria | 14446 |
| 701 | Ga0501035_0056753 | 3300049822 | Bacteria | 3492 |
| 702 | Ga0501035_0106057 | 3300049822 | Bacteria | 2464 |
| 703 | Ga0501035_0144586 | 3300049822 | Bacteria | 2066 |
| 704 | Ga0501035_0473060 | 3300049822 | Bacteria | 1034 |
| 705 | Ga0501044_0000018 | 3300049823 | Bacteria | 225885 |
| 706 | Ga0501044_0000046 | 3300049823 | Bacteria | 146812 |
| 707 | Ga0501044_0004660 | 3300049823 | Bacteria | 15346 |
| 708 | Ga0501044_0070887 | 3300049823 | Bacteria | 3544 |
| 709 | Ga0501044_0080832 | 3300049823 | Bacteria | 3291 |
| 710 | Ga0501044_0116263 | 3300049823 | Bacteria | 2680 |
| 711 | Ga0501044_0155940 | 3300049823 | Bacteria | 2263 |
| 712 | Ga0501044_0375518 | 3300049823 | Bacteria | 1337 |
| 713 | Ga0501044_0557299 | 3300049823 | Bacteria | 1043 |
| 714 | Ga0501044_0642147 | 3300049823 | Bacteria | 951 |
| 715 | Ga0501045_0073807 | 3300049824 | Bacteria | 2512 |
| 716 | nmdc:mga03683_2458_c1 | 3300050489 | Bacteria | 5759 |
| 717 | nmdc:mga03n38_17445_c1 | 3300050490 | Bacteria | 2812 |
| 718 | nmdc:mga03n38_71079_c1 | 3300050490 | Bacteria | 1611 |
| 719 | nmdc:mga00v17_125199_c1 | 3300050491 | Bacteria | 1639 |
| 720 | nmdc:mga00v17_134185_c1 | 3300050491 | Bacteria | 1584 |
| 721 | nmdc:mga00v17_15_c1 | 3300050491 | Bacteria | 126234 |
| 722 | nmdc:mga00v17_324172_c1 | 3300050491 | Bacteria | 1001 |
| 723 | nmdc:mga00v17_431_c1 | 3300050491 | Bacteria | 23635 |
| 724 | nmdc:mga00v17_75770_c1 | 3300050491 | Bacteria | 2092 |
| 725 | nmdc:mga00v17_81892_c1 | 3300050491 | Bacteria | 2017 |
| 726 | nmdc:mga0yw44_119249_c1 | 3300050492 | Bacteria | 1698 |
| 727 | nmdc:mga0yw44_1587_c2 | 3300050492 | Bacteria | 8177 |
| 728 | nmdc:mga0yw44_1628_c1 | 3300050492 | Bacteria | 9032 |
| 729 | nmdc:mga0yw44_164075_c1 | 3300050492 | Bacteria | 1456 |
| 730 | nmdc:mga0yw44_180042_c1 | 3300050492 | Bacteria | 1391 |
| 731 | nmdc:mga0yw44_240508_c1 | 3300050492 | Bacteria | 1203 |
| 732 | nmdc:mga0yw44_25626_c2 | 3300050492 | Bacteria | 2964 |
| 733 | nmdc:mga0yw44_29246_c1 | 3300050492 | Bacteria | 3180 |
| 734 | nmdc:mga0yw44_86646_c1 | 3300050492 | Bacteria | 1973 |
| 735 | nmdc:mga0k408_157793_c1 | 3300050493 | Bacteria | 1351 |
| 736 | nmdc:mga0k408_3676_c1 | 3300050493 | Bacteria | 8116 |
| 737 | nmdc:mga06z11_104916_c1 | 3300050494 | Bacteria | 1556 |
| 738 | nmdc:mga06z11_114220_c1 | 3300050494 | Bacteria | 1499 |
| 739 | nmdc:mga06z11_2118_c1 | 3300050494 | Bacteria | 7526 |
| 740 | nmdc:mga06z11_28056_c1 | 3300050494 | Bacteria | 2697 |
| 741 | nmdc:mga06z11_332165_c1 | 3300050494 | Bacteria | 908 |
| 742 | nmdc:mga06z11_5062_c1 | 3300050494 | Bacteria | 5247 |
| 743 | nmdc:mga04h51_39041_c1 | 3300050495 | Bacteria | 1541 |
| 744 | nmdc:mga04h51_6294_c1 | 3300050495 | Bacteria | 3070 |
| 745 | nmdc:mga07m45_10477_c1 | 3300050496 | Bacteria | 4845 |
| 746 | nmdc:mga07m45_374873_c1 | 3300050496 | Bacteria | 826 |
| 747 | nmdc:mga0sz30_13711_c1 | 3300050516 | Bacteria | 3179 |
| 748 | nmdc:mga0sz30_2924_c1 | 3300050516 | Bacteria | 6124 |
| 749 | nmdc:mga0sz30_55500_c1 | 3300050516 | Bacteria | 1686 |
| 750 | Ga0500610_0011546 | 3300053079 | Bacteria | 4029 |
| 751 | Ga0500578_0019247 | 3300053086 | Bacteria | 4382 |
| 752 | Ga0500578_0050156 | 3300053086 | Bacteria | 2677 |
| 753 | Ga0500643_000411 | 3300053087 | Bacteria | 32710 |
| 754 | Ga0500643_004409 | 3300053087 | Bacteria | 6379 |
| 755 | Ga0500643_004901 | 3300053087 | Bacteria | 5893 |
| 756 | Ga0500643_012816 | 3300053087 | Bacteria | 2989 |
| 757 | Ga0500643_023987 | 3300053087 | Bacteria | 1942 |
| 758 | Ga0500646_0006695 | 3300053090 | Bacteria | 2931 |
| 759 | Ga0500646_0046538 | 3300053090 | Bacteria | 1238 |
| 760 | Ga0500651_0011997 | 3300053093 | Bacteria | 5242 |
| 761 | Ga0500555_005686 | 3300053103 | Bacteria | 3536 |
| 762 | Ga0500555_008223 | 3300053103 | Bacteria | 2972 |
| 763 | Ga0500556_0009403 | 3300053104 | Bacteria | 2840 |
| 764 | Ga0500556_0014812 | 3300053104 | Bacteria | 2390 |
| 765 | Ga0500556_0100341 | 3300053104 | Bacteria | 1114 |
| 766 | Ga0500557_000398 | 3300053105 | Bacteria | 5691 |
| 767 | Ga0500560_001605 | 3300053107 | Bacteria | 4001 |
| 768 | Ga0500560_018919 | 3300053107 | Bacteria | 1929 |
| 769 | Ga0500562_000876 | 3300053108 | Bacteria | 7313 |
| 770 | Ga0500562_048507 | 3300053108 | Bacteria | 1134 |
| 771 | Ga0500569_011445 | 3300053109 | Bacteria | 2119 |
| 772 | Ga0500594_0003502 | 3300053118 | Bacteria | 3454 |
| 773 | Ga0500618_000513 | 3300053125 | Bacteria | 24523 |
| 774 | Ga0500618_001619 | 3300053125 | Bacteria | 9745 |
| 775 | Ga0500618_002829 | 3300053125 | Bacteria | 6253 |
| 776 | Ga0500618_008883 | 3300053125 | Bacteria | 2771 |
| 777 | Ga0500618_023169 | 3300053125 | Bacteria | 1505 |
| 778 | Ga0500621_007448 | 3300053126 | Bacteria | 3577 |
| 779 | Ga0500621_081022 | 3300053126 | Bacteria | 1301 |
| 780 | Ga0500652_117154 | 3300053131 | Bacteria | 1113 |
| 781 | Ga0500655_000376 | 3300053133 | Bacteria | 9603 |
| 782 | Ga0500655_001263 | 3300053133 | Bacteria | 4805 |
| 783 | Ga0500655_024401 | 3300053133 | Bacteria | 1145 |
| 784 | Ga0500658_0001925 | 3300053134 | Bacteria | 8127 |
| 785 | Ga0500559_0074872 | 3300053136 | Bacteria | 1530 |
| 786 | Ga0500561_0000122 | 3300053137 | Bacteria | 14939 |
| 787 | Ga0500568_0000010 | 3300053139 | Bacteria | 249043 |
| 788 | Ga0500568_0000247 | 3300053139 | Bacteria | 45994 |
| 789 | Ga0500568_0001724 | 3300053139 | Bacteria | 13585 |
| 790 | Ga0500568_0017640 | 3300053139 | Bacteria | 3147 |
| 791 | Ga0500568_0022137 | 3300053139 | Bacteria | 2725 |
| 792 | Ga0500568_0096891 | 3300053139 | Bacteria | 1109 |
| 793 | Ga0500573_0002132 | 3300053140 | Bacteria | 9757 |
| 794 | Ga0500573_0002450 | 3300053140 | Bacteria | 9282 |
| 795 | Ga0500590_000271 | 3300053148 | Bacteria | 16202 |
| 796 | Ga0500604_0002160 | 3300053151 | Bacteria | 5410 |
| 797 | Ga0500604_0003631 | 3300053151 | Bacteria | 4152 |
| 798 | Ga0500604_0068900 | 3300053151 | Bacteria | 1124 |
| 799 | Ga0500616_0000448 | 3300053153 | Bacteria | 53998 |
| 800 | Ga0500616_0001820 | 3300053153 | Bacteria | 19372 |
| 801 | Ga0500616_0007147 | 3300053153 | Bacteria | 7144 |
| 802 | Ga0500616_0010751 | 3300053153 | Bacteria | 5459 |
| 803 | Ga0500616_0172516 | 3300053153 | Bacteria | 981 |
| 804 | Ga0500620_000306 | 3300053155 | Bacteria | 9390 |
| 805 | Ga0500622_0000169 | 3300053156 | Bacteria | 70224 |
| 806 | Ga0500622_0000441 | 3300053156 | Bacteria | 39445 |
| 807 | Ga0500622_0003398 | 3300053156 | Bacteria | 10704 |
| 808 | Ga0500627_0001834 | 3300053158 | Bacteria | 6063 |
| 809 | Ga0500627_0002598 | 3300053158 | Bacteria | 5399 |
| 810 | Ga0500627_0018943 | 3300053158 | Bacteria | 2734 |
| 811 | Ga0500627_0128084 | 3300053158 | Bacteria | 1146 |
| 812 | Ga0500627_0163919 | 3300053158 | Bacteria | 1002 |
| 813 | Ga0500633_0000081 | 3300053160 | Bacteria | 14125 |
| 814 | Ga0500633_0099159 | 3300053160 | Bacteria | 1071 |
| 815 | Ga0500634_0000956 | 3300053161 | Bacteria | 10406 |
| 816 | Ga0500634_0001545 | 3300053161 | Bacteria | 9045 |
| 817 | Ga0500636_0000030 | 3300053177 | Bacteria | 77501 |
| 818 | Ga0500636_0002620 | 3300053177 | Bacteria | 9993 |
| 819 | Ga0500645_003289 | 3300053730 | Bacteria | 6651 |
| 820 | Ga0500645_004116 | 3300053730 | Bacteria | 5682 |
| 821 | Ga0500645_004791 | 3300053730 | Bacteria | 5118 |
| 822 | Ga0500645_017926 | 3300053730 | Bacteria | 2216 |
| 823 | Ga0500645_018238 | 3300053730 | Bacteria | 2193 |
| 824 | Ga0587067_014834 | 3300059640 | Bacteria | 1254 |
| 825 | Ga0587072_005168 | 3300059643 | Bacteria | 1938 |
| 826 | Ga0501082_0270955 | 3300060353 | Bacteria | 1477 |
| 827 | 2937852746 | 2937848649 | Bacteria | 6983481 |
| 828 | 2503198912 | 2503198000 | Bacteria | 6884444 |
| 829 | 2509117935 | 2508501123 | Bacteria | 6283661 |
| 830 | 2509143087 | 2508501127 | Bacteria | 7037543 |
| 831 | 2509371521 | 2509276018 | Bacteria | 6910194 |
| 832 | 2509377991 | 2509276019 | Bacteria | 6802256 |
| 833 | 2509389234 | 2509276021 | Bacteria | 7634384 |
| 834 | 2509393785 | 2509276022 | Bacteria | 6200534 |
| 835 | 2509444797 | 2509276033 | Bacteria | 7180565 |
| 836 | 2510135421 | 2510065019 | Bacteria | 6903379 |
| 837 | 2510305822 | 2510065057 | Bacteria | 6649661 |
| 838 | 2510318462 | 2510065059 | Bacteria | 6847884 |
| 839 | 2510839189 | 2510461069 | Bacteria | 5505000 |
| 840 | 2510896880 | 2510461076 | Bacteria | 8618824 |
| 841 | 2511135845 | 2510917022 | Bacteria | 6504556 |
| 842 | 2511168427 | 2510917026 | Bacteria | 7046020 |
| 843 | 2511185227 | 2510917028 | Bacteria | 6185411 |
| 844 | 2511199354 | 2510917030 | Bacteria | 7460662 |
| 845 | 2511391875 | 2511231027 | Bacteria | 5013807 |
| 846 | 2511498588 | 2511231052 | Bacteria | 6974333 |
| 847 | 2512534737 | 2512047086 | Bacteria | 6850303 |
| 848 | 2512933695 | 2512875016 | Bacteria | 6529530 |
| 849 | 2512961846 | 2512875024 | Bacteria | 7195110 |
| 850 | 2512973451 | 2512875026 | Bacteria | 6861065 |
| 851 | 2513572880 | 2513237084 | Bacteria | 7231967 |
| 852 | 2513580413 | 2513237085 | Bacteria | 7695351 |
| 853 | 2513586364 | 2513237086 | Bacteria | 7265287 |
| 854 | 2513597848 | 2513237088 | Bacteria | 6927906 |
| 855 | 2513602032 | 2513237089 | Bacteria | 6553624 |
| 856 | 2513613811 | 2513237090 | Bacteria | 7096802 |
| 857 | 2513615821 | 2513237091 | Bacteria | 6900273 |
| 858 | 2513634915 | 2513237093 | Bacteria | 7545552 |
| 859 | 2513711524 | 2513237103 | Bacteria | 7647401 |
| 860 | 2513865127 | 2513237138 | Bacteria | 7368160 |
| 861 | 2513885387 | 2513237140 | Bacteria | 7076289 |
| 862 | 2513904656 | 2513237143 | Bacteria | 6664116 |
| 863 | 2513912903 | 2513237144 | Bacteria | 7530820 |
| 864 | 2513929496 | 2513237146 | Bacteria | 7166346 |
| 865 | 2513983486 | 2513237156 | Bacteria | 6402557 |
| 866 | 2514001719 | 2513237159 | Bacteria | 6810126 |
| 867 | 2514003369 | 2513237160 | Bacteria | 6650282 |
| 868 | 2514023182 | 2513237162 | Bacteria | 7468464 |
| 869 | 2514035473 | 2513237164 | Bacteria | 7563725 |
| 870 | 2514421928 | 2513237305 | Bacteria | 7293571 |
| 871 | 2514586563 | 2513237351 | Bacteria | 6968952 |
| 872 | 2515114593 | 2515075009 | Bacteria | 7288508 |
| 873 | 2515612432 | 2515154107 | Bacteria | 6795637 |
| 874 | 2515634987 | 2515154113 | Bacteria | 7807172 |
| 875 | 2515644449 | 2515154114 | Bacteria | 7848616 |
| 876 | 2515660974 | 2515154116 | Bacteria | 7552979 |
| 877 | 2515741776 | 2515154134 | Bacteria | 7220242 |
| 878 | 2516205696 | 2516143018 | Bacteria | 6951533 |
| 879 | 2516894865 | 2516653046 | Bacteria | 6989037 |
| 880 | 2517038236 | 2516653077 | Bacteria | 7555578 |
| 881 | 2517078514 | 2516653085 | Bacteria | 7346596 |
| 882 | 2517097253 | 2517093000 | Bacteria | 7412387 |
| 883 | 2517408358 | 2517287029 | Bacteria | 6905599 |
| 884 | 2517571546 | 2517487022 | Bacteria | 7227575 |
| 885 | 2520379796 | 2519899620 | Bacteria | 6499161 |
| 886 | 2524450318 | 2524023207 | Bacteria | 6813453 |
| 887 | 2524461185 | 2524023209 | Bacteria | 6679728 |
| 888 | 2530647181 | 2529292951 | Bacteria | 6916614 |
| 889 | 2535485501 | 2534681786 | Bacteria | 3308809 |
| 890 | 2537874460 | 2537561587 | Bacteria | 5425293 |
| 891 | 2551678469 | 2551306084 | Bacteria | 8942552 |
| 892 | 2551685174 | 2551306085 | Bacteria | 7347181 |
| 893 | 2551694002 | 2551306086 | Bacteria | 6843938 |
| 894 | 2551704510 | 2551306087 | Bacteria | 7351905 |
| 895 | 2551710798 | 2551306089 | Bacteria | 7162724 |
| 896 | 2551717206 | 2551306090 | Bacteria | 7953713 |
| 897 | 2551718204 | 2551306090 | Bacteria | 7953713 |
| 898 | 2551720985 | 2551306090 | Bacteria | 7953713 |
| 899 | 2551724596 | 2551306091 | Bacteria | 7086830 |
| 900 | 2551734490 | 2551306092 | Bacteria | 6992595 |
| 901 | 2551740723 | 2551306093 | Bacteria | 7064773 |
| 902 | 2554248990 | 2554235003 | Bacteria | 5877155 |
| 903 | 2558867507 | 2558860100 | Bacteria | 8458965 |
| 904 | 2559296078 | 2558860242 | Bacteria | 5568029 |
| 905 | 2561468551 | 2558860983 | Bacteria | 4133860 |
| 906 | 2585166504 | 2582581283 | Bacteria | 6030556 |
| 907 | 2585201550 | 2582581294 | Bacteria | 6626667 |
| 908 | 2585224109 | 2582581298 | Bacteria | 7315509 |
| 909 | 2585231871 | 2582581299 | Bacteria | 6518058 |
| 910 | 2585257173 | 2582581304 | Bacteria | 5831370 |
| 911 | 2585267175 | 2582581306 | Bacteria | 6450535 |
| 912 | 2585272065 | 2582581307 | Bacteria | 6597605 |
| 913 | 2585279630 | 2582581308 | Bacteria | 7413247 |
| 914 | 2585327467 | 2582581315 | Bacteria | 7318924 |
| 915 | 2585333994 | 2582581316 | Bacteria | 7774528 |
| 916 | 2585388226 | 2582581865 | Bacteria | 6644329 |
| 917 | 2585399941 | 2582581867 | Bacteria | 7184437 |
| 918 | 2585529187 | 2585427526 | Bacteria | 7258840 |
| 919 | 2585535709 | 2585427527 | Bacteria | 7273426 |
| 920 | 2585543004 | 2585427528 | Bacteria | 6842387 |
| 921 | 2585549809 | 2585427529 | Bacteria | 7395659 |
| 922 | 2585551087 | 2585427530 | Bacteria | 7383882 |
| 923 | 2585563390 | 2585427531 | Bacteria | 6992870 |
| 924 | 2585821030 | 2585427590 | Bacteria | 6824633 |
| 925 | 2585839227 | 2585427593 | Bacteria | 7141551 |
| 926 | 2585845063 | 2585427594 | Bacteria | 6180594 |
| 927 | 2585897189 | 2585427608 | Bacteria | 6544331 |
| 928 | 2585909103 | 2585427609 | Bacteria | 6667127 |
| 929 | 2585998077 | 2585427633 | Bacteria | 6413184 |
| 930 | 2586002656 | 2585427634 | Bacteria | 6455027 |
| 931 | 2587984517 | 2585428125 | Bacteria | 6662905 |
| 932 | 2588519776 | 2588253730 | Bacteria | 6881675 |
| 933 | 2597810842 | 2597489875 | Bacteria | 7010078 |
| 934 | 2599335749 | 2599185156 | Bacteria | 5403036 |
| 935 | 2599419962 | 2599185170 | Bacteria | 7295545 |
| 936 | 2599603129 | 2599185210 | Bacteria | 5624189 |
| 937 | 2599722638 | 2599185236 | Bacteria | 6875203 |
| 938 | 2599938835 | 2599185301 | Bacteria | 6161860 |
| 939 | 2600193975 | 2599185352 | Bacteria | 7228948 |
| 940 | 2600377442 | 2600254933 | Bacteria | 4750527 |
| 941 | 2601610966 | 2600255279 | Bacteria | 5605316 |
| 942 | 2601747740 | 2600255308 | Bacteria | 5611129 |
| 943 | 2616297547 | 2615840624 | Bacteria | 6557588 |
| 944 | 2616306417 | 2615840626 | Bacteria | 7921970 |
| 945 | 2616551095 | 2615840698 | Bacteria | 7319877 |
| 946 | 2617382326 | 2617270742 | Bacteria | 6808054 |
| 947 | 2643771707 | 2643221550 | Bacteria | 4619371 |
| 948 | 2643777315 | 2643221551 | Bacteria | 3750538 |
| 949 | 2643795763 | 2643221555 | Bacteria | 3749717 |
| 950 | 2643807939 | 2643221557 | Bacteria | 7184309 |
| 951 | 2643814887 | 2643221558 | Bacteria | 5460675 |
| 952 | 2643838023 | 2643221564 | Bacteria | 4193379 |
| 953 | 2643854822 | 2643221568 | Bacteria | 5187270 |
| 954 | 2643921602 | 2643221582 | Bacteria | 5804683 |
| 955 | 2643985964 | 2643221595 | Bacteria | 6565519 |
| 956 | 2644002645 | 2643221599 | Bacteria | 6292121 |
| 957 | 2644052442 | 2643221607 | Bacteria | 6314006 |
| 958 | 2644068870 | 2643221610 | Bacteria | 7480339 |
| 959 | 2644133943 | 2643221623 | Bacteria | 5239945 |
| 960 | 2644146355 | 2643221626 | Bacteria | 8069654 |
| 961 | 2644154451 | 2643221627 | Bacteria | 6761570 |
| 962 | 2644194648 | 2643221634 | Bacteria | 6705461 |
| 963 | 2644201175 | 2643221636 | Bacteria | 6583769 |
| 964 | 2644209666 | 2643221637 | Bacteria | 5345260 |
| 965 | 2644240313 | 2643221643 | Bacteria | 5749658 |
| 966 | 2644299688 | 2643221653 | Bacteria | 4569637 |
| 967 | 2644310374 | 2643221655 | Bacteria | 7722067 |
| 968 | 2644334841 | 2643221659 | Bacteria | 7890716 |
| 969 | 2644378404 | 2643221668 | Bacteria | 7306521 |
| 970 | 2644419941 | 2643221675 | Bacteria | 7473456 |
| 971 | 2644453297 | 2643221680 | Bacteria | 7473610 |
| 972 | 2644484720 | 2643221686 | Bacteria | 6310811 |
| 973 | 2644492557 | 2643221688 | Bacteria | 5260751 |
| 974 | 2644501240 | 2643221689 | Bacteria | 6042950 |
| 975 | 2644521656 | 2643221693 | Bacteria | 5513853 |
| 976 | 2644544965 | 2643221698 | Bacteria | 7756764 |
| 977 | 2644615385 | 2643221712 | Bacteria | 7729434 |
| 978 | 2644653194 | 2643221718 | Bacteria | 5345506 |
| 979 | 2644657916 | 2643221719 | Bacteria | 4568197 |
| 980 | 2644675096 | 2643221723 | Bacteria | 7095460 |
| 981 | 2644688676 | 2643221726 | Bacteria | 7455827 |
| 982 | 2657682310 | 2657244999 | Bacteria | 5946535 |
| 983 | 2671116026 | 2667528174 | Bacteria | 6435400 |
| 984 | 2688596186 | 2687453392 | Bacteria | 6880454 |
| 985 | 2692319837 | 2690316117 | Bacteria | 6800650 |
| 986 | 2694627682 | 2693429783 | Bacteria | 7019804 |
| 987 | 2694636793 | 2693429784 | Bacteria | 7241525 |
| 988 | 2719183132 | 2718217882 | Bacteria | 6556348 |
| 989 | 2719387852 | 2718217927 | Bacteria | 6972593 |
| 990 | 2719667472 | 2718217997 | Bacteria | 6740740 |
| 991 | 2719733849 | 2718218009 | Bacteria | 6478651 |
| 992 | 2720493892 | 2718218199 | Bacteria | 6740745 |
| 993 | 2720615353 | 2718218232 | Bacteria | 6720332 |
| 994 | 2720622141 | 2718218233 | Bacteria | 6662049 |
| 995 | 2720633495 | 2718218235 | Bacteria | 6630699 |
| 996 | 2720777193 | 2718218269 | Bacteria | 6906114 |
| 997 | 2721149244 | 2718218363 | Bacteria | 6524337 |
| 998 | 2721160646 | 2718218365 | Bacteria | 6274507 |
| 999 | 2721166057 | 2718218366 | Bacteria | 6425255 |
| 1000 | 2721401485 | 2718218423 | Bacteria | 6438183 |
| 1001 | 2722842227 | 2721755514 | Bacteria | 6424414 |
| 1002 | 2723028791 | 2721755556 | Bacteria | 6745503 |
| 1003 | 2723562404 | 2721755684 | Bacteria | 6859907 |
| 1004 | 2723569100 | 2721755685 | Bacteria | 6704835 |
| 1005 | 2723573322 | 2721755686 | Bacteria | 7343952 |
| 1006 | 2724040299 | 2721755809 | Bacteria | 6438790 |
| 1007 | 2724046605 | 2721755810 | Bacteria | 6479005 |
| 1008 | 2724091800 | 2721755819 | Bacteria | 6906405 |
| 1009 | 2724106365 | 2721755822 | Bacteria | 6726041 |
| 1010 | 2724112172 | 2721755823 | Bacteria | 6752556 |
| 1011 | 2725945783 | 2724679232 | Bacteria | 7646494 |
| 1012 | 2730109727 | 2728369352 | Bacteria | 6745171 |
| 1013 | 2730166367 | 2728369365 | Bacteria | 6555560 |
| 1014 | 2730300278 | 2728369397 | Bacteria | 6274511 |
| 1015 | 2738801022 | 2738541293 | Bacteria | 7065685 |
| 1016 | 2738947099 | 2738541317 | Bacteria | 5340176 |
| 1017 | 2739037700 | 2738541333 | Bacteria | 7106503 |
| 1018 | 2739310265 | 2738543024 | Bacteria | 5603683 |
| 1019 | 2753360490 | 2751185800 | Bacteria | 5467370 |
| 1020 | 2753458478 | 2751185821 | Bacteria | 6189929 |
| 1021 | 2756673580 | 2756170246 | Bacteria | 7451806 |
| 1022 | 2757570405 | 2757320392 | Bacteria | 3737298 |
| 1023 | 2758642930 | 2758568016 | Bacteria | 5645291 |
| 1024 | 2765465763 | 2765235802 | Bacteria | 5618596 |
| 1025 | 2766064082 | 2765235942 | Bacteria | 7445910 |
| 1026 | 2770199121 | 2767802442 | Bacteria | 5747986 |
| 1027 | 2776269525 | 2775506902 | Bacteria | 6208009 |
| 1028 | 2776282456 | 2775506904 | Bacteria | 5954060 |
| 1029 | 2776915661 | 2775507049 | Bacteria | 6284736 |
| 1030 | 2778179219 | 2775507266 | Bacteria | 7392367 |
| 1031 | 2792582340 | 2791355082 | Bacteria | 5973319 |
| 1032 | 2792621806 | 2791355091 | Bacteria | 6135441 |
| 1033 | 2792628937 | 2791355092 | Bacteria | 6248105 |
| 1034 | 2792640077 | 2791355094 | Bacteria | 7011481 |
| 1035 | 2792747393 | 2791355123 | Bacteria | 8049106 |
| 1036 | 2793281833 | 2791355253 | Bacteria | 5171699 |
| 1037 | 2793295461 | 2791355256 | Bacteria | 6798008 |
| 1038 | 2793317959 | 2791355259 | Bacteria | 7254731 |
| 1039 | 2793324565 | 2791355260 | Bacteria | 6598818 |
| 1040 | 2793329608 | 2791355261 | Bacteria | 6661293 |
| 1041 | 2793332404 | 2791355262 | Bacteria | 6774204 |
| 1042 | 2793338998 | 2791355263 | Bacteria | 6872478 |
| 1043 | 2793346768 | 2791355264 | Bacteria | 6429314 |
| 1044 | 2793356784 | 2791355265 | Bacteria | 6539969 |
| 1045 | 2793359204 | 2791355266 | Bacteria | 7116587 |
| 1046 | 2793366072 | 2791355267 | Bacteria | 7222458 |
| 1047 | 2802717088 | 2802428858 | Bacteria | 6636079 |
| 1048 | 2802724924 | 2802428859 | Bacteria | 6667919 |
| 1049 | 2802729674 | 2802428860 | Bacteria | 6525526 |
| 1050 | 2802737020 | 2802428861 | Bacteria | 6534206 |
| 1051 | 2802743425 | 2802428862 | Bacteria | 6633353 |
| 1052 | 2802749449 | 2802428863 | Bacteria | 6410669 |
| 1053 | 2804753796 | 2802429268 | Bacteria | 6094027 |
| 1054 | 2805930911 | 2802429605 | Bacteria | 6875453 |
| 1055 | 2805936760 | 2802429606 | Bacteria | 6346811 |
| 1056 | 2806047756 | 2802429633 | Bacteria | 7341974 |
| 1057 | 2806055332 | 2802429634 | Bacteria | 7083200 |
| 1058 | 2806062213 | 2802429635 | Bacteria | 7650140 |
| 1059 | 2806070028 | 2802429636 | Bacteria | 7597525 |
| 1060 | 2806076672 | 2802429637 | Bacteria | 7067217 |
| 1061 | 2808988096 | 2808606387 | Bacteria | 5697198 |
| 1062 | 2819244464 | 2818991272 | Bacteria | 4622173 |
| 1063 | 2819561088 | 2818991439 | Bacteria | 6907412 |
| 1064 | 2819611975 | 2818991448 | Bacteria | 6772224 |
| 1065 | 2819638485 | 2818991453 | Bacteria | 7181617 |
| 1066 | 2819688363 | 2818991461 | Bacteria | 7026071 |
| 1067 | 2821129207 | 2821123053 | Bacteria | 7836056 |
| 1068 | 2837651386 | 2837651117 | Bacteria | 3772164 |
| 1069 | 2838018154 | 2838016132 | Bacteria | 6577831 |
| 1070 | 2838023835 | 2838022645 | Bacteria | 6494267 |
| 1071 | 2838042012 | 2838035591 | Bacteria | 7166484 |
| 1072 | 2838046758 | 2838042994 | Bacteria | 6046894 |
| 1073 | 2838050987 | 2838048938 | Bacteria | 6044578 |
| 1074 | 2838062753 | 2838061910 | Bacteria | 6794874 |
| 1075 | 2838072298 | 2838068647 | Bacteria | 6208656 |
| 1076 | 2838078061 | 2838074704 | Bacteria | 6785777 |
| 1077 | 2838668137 | 2838661181 | Bacteria | 7385261 |
| 1078 | 2838674231 | 2838668709 | Bacteria | 6671819 |
| 1079 | 2838678541 | 2838675328 | Bacteria | 4909118 |
| 1080 | 2838683707 | 2838680041 | Bacteria | 6545511 |
| 1081 | 2838693347 | 2838686498 | Bacteria | 7807632 |
| 1082 | 2838698235 | 2838694306 | Bacteria | 6853137 |
| 1083 | 2838706634 | 2838701080 | Bacteria | 6669771 |
| 1084 | 2838711350 | 2838707686 | Bacteria | 6619912 |
| 1085 | 2838718371 | 2838714209 | Bacteria | 5525906 |
| 1086 | 2838722837 | 2838719591 | Bacteria | 5523910 |
| 1087 | 2838728437 | 2838724970 | Bacteria | 4908691 |
| 1088 | 2838735341 | 2838729681 | Bacteria | 7400765 |
| 1089 | 2838742224 | 2838736955 | Bacteria | 5760694 |
| 1090 | 2838748110 | 2838742623 | Bacteria | 7396178 |
| 1091 | 2839993405 | 2839993093 | Bacteria | 5512535 |
| 1092 | 2840766415 | 2840764183 | Bacteria | 6358399 |
| 1093 | 2841736578 | 2841734538 | Bacteria | 6784580 |
| 1094 | 2841846080 | 2841840854 | Bacteria | 5761912 |
| 1095 | 2841850393 | 2841846520 | Bacteria | 5345850 |
| 1096 | 2841857413 | 2841851746 | Bacteria | 7532261 |
| 1097 | 2841863354 | 2841859092 | Bacteria | 5436171 |
| 1098 | 2841867583 | 2841864319 | Bacteria | 6742987 |
| 1099 | 2842081151 | 2842077413 | Bacteria | 6508645 |
| 1100 | 2842116598 | 2842110456 | Bacteria | 7656360 |
| 1101 | 2842122072 | 2842118031 | Bacteria | 7033875 |
| 1102 | 2842129097 | 2842124991 | Bacteria | 5346824 |
| 1103 | 2842133434 | 2842130223 | Bacteria | 4909145 |
| 1104 | 2842145784 | 2842140634 | Bacteria | 5759631 |
| 1105 | 2842148963 | 2842146304 | Bacteria | 5957337 |
| 1106 | 2842155655 | 2842152218 | Bacteria | 4908957 |
| 1107 | 2842162412 | 2842156927 | Bacteria | 6894975 |
| 1108 | 2842166887 | 2842163707 | Bacteria | 6916235 |
| 1109 | 2842174387 | 2842170452 | Bacteria | 5525737 |
| 1110 | 2842179048 | 2842175837 | Bacteria | 4908771 |
| 1111 | 2842186052 | 2842180545 | Bacteria | 6888678 |
| 1112 | 2842190795 | 2842187318 | Bacteria | 5524014 |
| 1113 | 2842194716 | 2842192696 | Bacteria | 6147454 |
| 1114 | 2842201189 | 2842198810 | Bacteria | 6608673 |
| 1115 | 2842207585 | 2842205361 | Bacteria | 6340321 |
| 1116 | 2842214881 | 2842211629 | Bacteria | 5523832 |
| 1117 | 2842221959 | 2842217011 | Bacteria | 7497767 |
| 1118 | 2842227602 | 2842224351 | Bacteria | 5524473 |
| 1119 | 2842235511 | 2842229732 | Bacteria | 7475766 |
| 1120 | 2842241086 | 2842237096 | Bacteria | 6620661 |
| 1121 | 2842249206 | 2842243621 | Bacteria | 7421798 |
| 1122 | 2842256425 | 2842250916 | Bacteria | 6579627 |
| 1123 | 2842263161 | 2842257432 | Bacteria | 7401195 |
| 1124 | 2842269274 | 2842264693 | Bacteria | 6472963 |
| 1125 | 2842277815 | 2842271015 | Bacteria | 7807131 |
| 1126 | 2842280704 | 2842278818 | Bacteria | 6340002 |
| 1127 | 2842290350 | 2842285085 | Bacteria | 6011953 |
| 1128 | 2842294808 | 2842291075 | Bacteria | 7076806 |
| 1129 | 2842302629 | 2842298080 | Bacteria | 6123127 |
| 1130 | 2842305642 | 2842304105 | Bacteria | 7023636 |
| 1131 | 2842311590 | 2842311132 | Bacteria | 6616990 |
| 1132 | 2842323650 | 2842317721 | Bacteria | 6793725 |
| 1133 | 2842346872 | 2842341865 | Bacteria | 7003929 |
| 1134 | 2842358869 | 2842357229 | Bacteria | 6485165 |
| 1135 | 2842366097 | 2842363717 | Bacteria | 6844742 |
| 1136 | 2842375174 | 2842370503 | Bacteria | 7038661 |
| 1137 | 2842381207 | 2842377471 | Bacteria | 7140707 |
| 1138 | 2842388277 | 2842384541 | Bacteria | 7057858 |
| 1139 | 2842395766 | 2842395702 | Bacteria | 6780583 |
| 1140 | 2842408184 | 2842402390 | Bacteria | 6681310 |
| 1141 | 2842414946 | 2842409023 | Bacteria | 6687331 |
| 1142 | 2842421545 | 2842415677 | Bacteria | 6596907 |
| 1143 | 2842425930 | 2842422224 | Bacteria | 6239196 |
| 1144 | 2842433442 | 2842428310 | Bacteria | 6767288 |
| 1145 | 2842439503 | 2842434925 | Bacteria | 6502746 |
| 1146 | 2842446189 | 2842441272 | Bacteria | 6769273 |
| 1147 | 2842448572 | 2842447887 | Bacteria | 6754142 |
| 1148 | 2842467691 | 2842462802 | Bacteria | 6588055 |
| 1149 | 2842474345 | 2842469257 | Bacteria | 6752936 |
| 1150 | 2842485283 | 2842482326 | Bacteria | 7212537 |
| 1151 | 2842491342 | 2842489311 | Bacteria | 6620893 |
| 1152 | 2842501923 | 2842495871 | Bacteria | 6820686 |
| 1153 | 2842514690 | 2842509118 | Bacteria | 6850950 |
| 1154 | 2842519909 | 2842515876 | Bacteria | 5436280 |
| 1155 | 2842527058 | 2842521101 | Bacteria | 6569494 |
| 1156 | 2842874027 | 2842871566 | Bacteria | 4827117 |
| 1157 | 2842926463 | 2842922631 | Bacteria | 5824079 |
| 1158 | 2844003250 | 2844002411 | Bacteria | 7168230 |
| 1159 | 2844010992 | 2844009547 | Bacteria | 6728125 |
| 1160 | 2844456804 | 2844454524 | Bacteria | 7952546 |
| 1161 | 2847420939 | 2847417321 | Bacteria | 6913799 |
| 1162 | 2847673604 | 2847670302 | Bacteria | 6165597 |
| 1163 | 2847690119 | 2847686936 | Bacteria | 6278406 |
| 1164 | 2848995770 | 2848992105 | Bacteria | 6810864 |
| 1165 | 2850082753 | 2850079185 | Bacteria | 6848280 |
| 1166 | 2852392106 | 2852387548 | Bacteria | 8025568 |
| 1167 | 2854897791 | 2854896431 | Bacteria | 5869725 |
| 1168 | 2854913701 | 2854911287 | Bacteria | 5582813 |
| 1169 | 2854922315 | 2854916844 | Bacteria | 5725939 |
| 1170 | 2855873634 | 2855872281 | Bacteria | 6964271 |
| 1171 | 2856318927 | 2856314179 | Bacteria | 6477897 |
| 1172 | 2856324040 | 2856320880 | Bacteria | 7263508 |
| 1173 | 2856329468 | 2856328259 | Bacteria | 6528202 |
| 1174 | 2856339771 | 2856334872 | Bacteria | 7037011 |
| 1175 | 2856348127 | 2856342000 | Bacteria | 7176905 |
| 1176 | 2856353026 | 2856349417 | Bacteria | 6230045 |
| 1177 | 2856362155 | 2856356410 | Bacteria | 6297484 |
| 1178 | 2856367360 | 2856364286 | Bacteria | 6939991 |
| 1179 | 2857353127 | 2857349434 | Bacteria | 7926032 |
| 1180 | 2857374291 | 2857367948 | Bacteria | 6965560 |
| 1181 | 2857519762 | 2857516855 | Bacteria | 7787325 |
| 1182 | 2857536148 | 2857531043 | Bacteria | 6754041 |
| 1183 | 2858803552 | 2858800743 | Bacteria | 6603254 |
| 1184 | 2869168661 | 2869162929 | Bacteria | 6399702 |
| 1185 | 2869171414 | 2869169390 | Bacteria | 6659796 |
| 1186 | 2869240172 | 2869234852 | Bacteria | 6654993 |
| 1187 | 2869244963 | 2869242130 | Bacteria | 6609239 |
| 1188 | 2869254016 | 2869249662 | Bacteria | 6868783 |
| 1189 | 2869258141 | 2869256925 | Bacteria | 6981691 |
| 1190 | 2869269843 | 2869264136 | Bacteria | 6880765 |
| 1191 | 2869275280 | 2869271264 | Bacteria | 6908218 |
| 1192 | 2869283076 | 2869278585 | Bacteria | 7077053 |
| 1193 | 2869288501 | 2869285874 | Bacteria | 6901219 |
| 1194 | 2871431168 | 2871429161 | Bacteria | 6547891 |
| 1195 | 2871436374 | 2871435913 | Bacteria | 6880295 |
| 1196 | 2871449143 | 2871444079 | Bacteria | 6423508 |
| 1197 | 2871453819 | 2871451962 | Bacteria | 7336357 |
| 1198 | 2871464749 | 2871459585 | Bacteria | 6866887 |
| 1199 | 2871473496 | 2871466892 | Bacteria | 6923287 |
| 1200 | 2871478564 | 2871474448 | Bacteria | 6806570 |
| 1201 | 2871484729 | 2871481445 | Bacteria | 6700002 |
| 1202 | 2871491598 | 2871488783 | Bacteria | 6929816 |
| 1203 | 2871498846 | 2871495908 | Bacteria | 6935695 |
| 1204 | 2874102408 | 2874102143 | Bacteria | 6342645 |
| 1205 | 2874114024 | 2874109183 | Bacteria | 6517025 |
| 1206 | 2874126322 | 2874123672 | Bacteria | 7238285 |
| 1207 | 2874135323 | 2874131515 | Bacteria | 6820270 |
| 1208 | 2874142735 | 2874139085 | Bacteria | 7021506 |
| 1209 | 2874150542 | 2874146452 | Bacteria | 7533118 |
| 1210 | 2874158283 | 2874155637 | Bacteria | 6724144 |
| 1211 | 2874163700 | 2874162495 | Bacteria | 6174670 |
| 1212 | 2874170561 | 2874168670 | Bacteria | 8062617 |
| 1213 | 2876364050 | 2876363079 | Bacteria | 6544991 |
| 1214 | 2876369827 | 2876369609 | Bacteria | 6807521 |
| 1215 | 2876383172 | 2876377896 | Bacteria | 6565995 |
| 1216 | 2876387545 | 2876386047 | Bacteria | 6698674 |
| 1217 | 2876399085 | 2876392853 | Bacteria | 6660880 |
| 1218 | 2876401087 | 2876399893 | Bacteria | 6927900 |
| 1219 | 2876407358 | 2876406927 | Bacteria | 6191900 |
| 1220 | 2876416591 | 2876413966 | Bacteria | 6831344 |
| 1221 | 2876423745 | 2876420981 | Bacteria | 6687741 |
| 1222 | 2878039271 | 2878035449 | Bacteria | 6555736 |
| 1223 | 2878738633 | 2878730984 | Bacteria | 6380721 |
| 1224 | 2878739838 | 2878738818 | Bacteria | 7136951 |
| 1225 | 2878747772 | 2878745973 | Bacteria | 6867388 |
| 1226 | 2878754786 | 2878753008 | Bacteria | 6922523 |
| 1227 | 2878763064 | 2878760144 | Bacteria | 6823465 |
| 1228 | 2878770034 | 2878767105 | Bacteria | 6898628 |
| 1229 | 2878780017 | 2878774303 | Bacteria | 6108671 |
| 1230 | 2878782034 | 2878781027 | Bacteria | 6834456 |
| 1231 | 2878789208 | 2878788777 | Bacteria | 6567085 |
| 1232 | 2881148398 | 2881147464 | Bacteria | 7779814 |
| 1233 | 2881159464 | 2881155292 | Bacteria | 6461656 |
| 1234 | 2881165183 | 2881161766 | Bacteria | 7127907 |
| 1235 | 2881846521 | 2881845957 | Bacteria | 6611900 |
| 1236 | 2881861059 | 2881853255 | Bacteria | 6698367 |
| 1237 | 2881862045 | 2881861095 | Bacteria | 7128710 |
| 1238 | 2882635209 | 2882632389 | Bacteria | 8154593 |
| 1239 | 2882915865 | 2882912400 | Bacteria | 6801539 |
| 1240 | 2885307060 | 2885305155 | Bacteria | 7348390 |
| 1241 | 2885313940 | 2885312484 | Bacteria | 6415165 |
| 1242 | 2885325714 | 2885318864 | Bacteria | 6729568 |
| 1243 | 2885328662 | 2885326080 | Bacteria | 7134805 |
| 1244 | 2885339030 | 2885334103 | Bacteria | 7216818 |
| 1245 | 2885347089 | 2885342637 | Bacteria | 7011821 |
| 1246 | 2885353594 | 2885350715 | Bacteria | 6787678 |
| 1247 | 2888343571 | 2888337043 | Bacteria | 6629336 |
| 1248 | 2888344552 | 2888343758 | Bacteria | 6611049 |
| 1249 | 2888353401 | 2888350351 | Bacteria | 7372807 |
| 1250 | 2889015117 | 2889010040 | Bacteria | 6749192 |
| 1251 | 2889019805 | 2889016732 | Bacteria | 6700763 |
| 1252 | 2889795797 | 2889790730 | Bacteria | 5689708 |
| 1253 | 2889916367 | 2889914905 | Bacteria | 5702301 |
| 1254 | 2891048624 | 2891048133 | Bacteria | 4447501 |
| 1255 | 2891377791 | 2891373044 | Bacteria | 5202277 |
| 1256 | 2894653722 | 2894652903 | Bacteria | 4587256 |
| 1257 | 2894821001 | 2894817345 | Bacteria | 4892941 |
| 1258 | 2896390087 | 2896384573 | Bacteria | 7700774 |
| 1259 | 2899794818 | 2899792073 | Bacteria | 4926588 |
| 1260 | 2899805007 | 2899803654 | Bacteria | 5577784 |
| 1261 | 2899849429 | 2899845264 | Bacteria | 5672268 |
| 1262 | 2903453850 | 2903448605 | Bacteria | 7357801 |
| 1263 | 2903500319 | 2903492973 | Bacteria | 13473544 |
| 1264 | 2903502253 | 2903492973 | Bacteria | 13473544 |
| 1265 | 2903519002 | 2903513507 | Bacteria | 6344008 |
| 1266 | 2903525790 | 2903521522 | Bacteria | 6525694 |
| 1267 | 2903532663 | 2903528002 | Bacteria | 6586099 |
| 1268 | 2903543648 | 2903540706 | Bacteria | 7062119 |
| 1269 | 2904579945 | 2904578770 | Bacteria | 5302906 |
| 1270 | 2904665612 | 2904659560 | Bacteria | 6685615 |
| 1271 | 2906310945 | 2906308376 | Bacteria | 6841989 |
| 1272 | 2906323056 | 2906321335 | Bacteria | 6579571 |
| 1273 | 2906334022 | 2906328253 | Bacteria | 6585166 |
| 1274 | 2906370169 | 2906363423 | Bacteria | 6856682 |
| 1275 | 2906377833 | 2906370794 | Bacteria | 6881062 |
| 1276 | 2906379157 | 2906378014 | Bacteria | 6911440 |
| 1277 | 2906386854 | 2906386501 | Bacteria | 5977019 |
| 1278 | 2906395778 | 2906393657 | Bacteria | 6790866 |
| 1279 | 2906402987 | 2906401398 | Bacteria | 6693206 |
| 1280 | 2906408962 | 2906408224 | Bacteria | 6162342 |
| 1281 | 2906418998 | 2906414383 | Bacteria | 6580790 |
| 1282 | 2913300286 | 2913295892 | Bacteria | 6333755 |
| 1283 | 2913312072 | 2913308742 | Bacteria | 5350706 |
| 1284 | 2915650587 | 2915650412 | Bacteria | 4288180 |
| 1285 | 2915981713 | 2915980308 | Bacteria | 6624279 |
| 1286 | 2916004475 | 2916000859 | Bacteria | 6865702 |
| 1287 | 2916019865 | 2916014648 | Bacteria | 6946486 |
| 1288 | 2916023931 | 2916021584 | Bacteria | 6854472 |
| 1289 | 2916031856 | 2916028427 | Bacteria | 6748433 |
| 1290 | 2916043430 | 2916041962 | Bacteria | 6820487 |
| 1291 | 2916050645 | 2916048683 | Bacteria | 6543552 |
| 1292 | 2916058691 | 2916055098 | Bacteria | 6758838 |
| 1293 | 2916066484 | 2916061851 | Bacteria | 6737736 |
| 1294 | 2916076084 | 2916068649 | Bacteria | 6943657 |
| 1295 | 2916082573 | 2916076590 | Bacteria | 6596108 |
| 1296 | 2919107945 | 2919100787 | Bacteria | 7710546 |
| 1297 | 2919118372 | 2919114240 | Bacteria | 5700270 |
| 1298 | 2919120383 | 2919119836 | Bacteria | 5208557 |
| 1299 | 2919170458 | 2919166419 | Bacteria | 4952238 |
| 1300 | 2919176883 | 2919171160 | Bacteria | 6499771 |
| 1301 | 2919411456 | 2919408235 | Bacteria | 6149349 |
| 1302 | 2921205068 | 2921201388 | Bacteria | 6926299 |
| 1303 | 2921240356 | 2921237296 | Bacteria | 6876710 |
| 1304 | 2921252802 | 2921250672 | Bacteria | 6677771 |
| 1305 | 2921260441 | 2921257292 | Bacteria | 6808382 |
| 1306 | 2921267525 | 2921263974 | Bacteria | 6864552 |
| 1307 | 2921293980 | 2921289301 | Bacteria | 7316391 |
| 1308 | 2921302300 | 2921296804 | Bacteria | 7176999 |
| 1309 | 2922136481 | 2922130491 | Bacteria | 7173936 |
| 1310 | 2922153547 | 2922151315 | Bacteria | 6902399 |
| 1311 | 2922162618 | 2922158528 | Bacteria | 6573167 |
| 1312 | 2922173234 | 2922172374 | Bacteria | 6167644 |
| 1313 | 2922185038 | 2922178524 | Bacteria | 6025201 |
| 1314 | 2922193166 | 2922185730 | Bacteria | 7113964 |
| 1315 | 2923559970 | 2923556063 | Bacteria | 6793593 |
| 1316 | 2924157660 | 2924150972 | Bacteria | 7169444 |
| 1317 | 2924168526 | 2924165586 | Bacteria | 7260590 |
| 1318 | 2924175798 | 2924172951 | Bacteria | 6749356 |
| 1319 | 2924183467 | 2924179722 | Bacteria | 6843264 |
| 1320 | 2924190214 | 2924186466 | Bacteria | 6876637 |
| 1321 | 2924214890 | 2924214083 | Bacteria | 7080103 |
| 1322 | 2924227133 | 2924221636 | Bacteria | 7113495 |
| 1323 | 2924710428 | 2924710171 | Bacteria | 6752351 |
| 1324 | 2924719012 | 2924718760 | Bacteria | 6331356 |
| 1325 | 2924728177 | 2924726620 | Bacteria | 6271473 |
| 1326 | 2924740527 | 2924733363 | Bacteria | 7574837 |
| 1327 | 2924746616 | 2924741084 | Bacteria | 6661321 |
| 1328 | 2924754032 | 2924748358 | Bacteria | 6154725 |
| 1329 | 2924762013 | 2924754689 | Bacteria | 6774424 |
| 1330 | 2924767528 | 2924762789 | Bacteria | 6561353 |
| 1331 | 2924778767 | 2924776078 | Bacteria | 7492003 |
| 1332 | 2924791006 | 2924784321 | Bacteria | 7416538 |
| 1333 | 2926754901 | 2926754445 | Bacteria | 5964435 |
| 1334 | 2926762066 | 2926760298 | Bacteria | 5505990 |
| 1335 | 2928522712 | 2928521798 | Bacteria | 4960112 |
| 1336 | 2929142002 | 2929138655 | Bacteria | 5810547 |
| 1337 | 2933010499 | 2933006813 | Bacteria | 4912075 |
| 1338 | 2933015829 | 2933011516 | Bacteria | 5439334 |
| 1339 | 2933017814 | 2933016740 | Bacteria | 6355406 |
| 1340 | 2933572149 | 2933570622 | Bacteria | 7023390 |
| 1341 | 2933592796 | 2933586486 | Bacteria | 7667493 |
| 1342 | 2933597433 | 2933594066 | Bacteria | 5594265 |
| 1343 | 2933602850 | 2933599457 | Bacteria | 5858799 |
| 1344 | 2935898112 | 2935894831 | Bacteria | 6620579 |
| 1345 | 2935903446 | 2935901341 | Bacteria | 7341747 |
| 1346 | 2936370080 | 2936367885 | Bacteria | 7324495 |
| 1347 | 2936379256 | 2936375103 | Bacteria | 6652732 |
| 1348 | 2936381767 | 2936381700 | Bacteria | 7006523 |
| 1349 | 2936997436 | 2936996657 | Bacteria | 6298727 |
| 1350 | 2937004100 | 2937002841 | Bacteria | 6934057 |
| 1351 | 2937010363 | 2937009748 | Bacteria | 6746052 |
| 1352 | 2937020645 | 2937016420 | Bacteria | 6782579 |
| 1353 | 2937023176 | 2937023124 | Bacteria | 6815156 |
| 1354 | 2937031725 | 2937029754 | Bacteria | 6424026 |
| 1355 | 2937037792 | 2937036028 | Bacteria | 6846469 |
| 1356 | 2937043156 | 2937042894 | Bacteria | 6741576 |
| 1357 | 2937055206 | 2937049772 | Bacteria | 6757901 |
| 1358 | 2937059373 | 2937056579 | Bacteria | 7107896 |
| 1359 | 2937070499 | 2937063883 | Bacteria | 7199456 |
| 1360 | 2937076117 | 2937071275 | Bacteria | 6984483 |
| 1361 | 2937081490 | 2937078374 | Bacteria | 6610289 |
| 1362 | 2937090878 | 2937084907 | Bacteria | 6618516 |
| 1363 | 2937093346 | 2937091812 | Bacteria | 6979387 |
| 1364 | 2937104327 | 2937098957 | Bacteria | 7249374 |
| 1365 | 2937113244 | 2937106411 | Bacteria | 6947143 |
| 1366 | 2937114244 | 2937113482 | Bacteria | 6505872 |
| 1367 | 2937120242 | 2937119839 | Bacteria | 6597547 |
| 1368 | 2937129777 | 2937126314 | Bacteria | 6771275 |
| 1369 | 2937815538 | 2937813078 | Bacteria | 7783518 |
| 1370 | 2937823429 | 2937822353 | Bacteria | 7290551 |
| 1371 | 2937838839 | 2937836603 | Bacteria | 6811263 |
| 1372 | 2937843747 | 2937843397 | Bacteria | 5256375 |
| 1373 | 2937865395 | 2937861824 | Bacteria | 6660327 |
| 1374 | 2937874628 | 2937868953 | Bacteria | 6639878 |
| 1375 | 2937880413 | 2937877337 | Bacteria | 7246526 |
| 1376 | 2937898369 | 2937891427 | Bacteria | 6357007 |
| 1377 | 2937976135 | 2937972304 | Bacteria | 7532020 |
| 1378 | 2937983973 | 2937980651 | Bacteria | 6517427 |
| 1379 | 2937997494 | 2937994558 | Bacteria | 7036190 |
| 1380 | 2938017198 | 2938014810 | Bacteria | 6700592 |
| 1381 | 2954013906 | 2954011201 | Bacteria | 4762601 |
| 1382 | 2957376792 | 2957375807 | Bacteria | 6425588 |
| 1383 | 2957384921 | 2957382221 | Bacteria | 6737050 |
| 1384 | 2957395196 | 2957388812 | Bacteria | 6778072 |
| 1385 | 2957399709 | 2957395598 | Bacteria | 6822399 |
| 1386 | 2957405547 | 2957402308 | Bacteria | 6741770 |
| 1387 | 2957411712 | 2957408893 | Bacteria | 6558585 |
| 1388 | 2957417469 | 2957415311 | Bacteria | 6991633 |
| 1389 | 2957422366 | 2957422303 | Bacteria | 7172205 |
| 1390 | 2957430080 | 2957430029 | Bacteria | 7022557 |
| 1391 | 2957441670 | 2957437181 | Bacteria | 6568994 |
| 1392 | 2957447639 | 2957443900 | Bacteria | 6869977 |
| 1393 | 2957454677 | 2957450854 | Bacteria | 6765715 |
| 1394 | 2957461000 | 2957457609 | Bacteria | 6967680 |
| 1395 | 2957466507 | 2957464669 | Bacteria | 6568877 |
| 1396 | 2957475393 | 2957471148 | Bacteria | 6797643 |
| 1397 | 2957481451 | 2957478035 | Bacteria | 6756658 |
| 1398 | 2957489083 | 2957484790 | Bacteria | 6703082 |
| 1399 | 2957494433 | 2957491536 | Bacteria | 6695180 |
| 1400 | 2957505172 | 2957498199 | Bacteria | 7126688 |
| 1401 | 2957508268 | 2957505466 | Bacteria | 7253085 |
| 1402 | 2958039060 | 2958034702 | Bacteria | 6989922 |
| 1403 | 2958049832 | 2958041894 | Bacteria | 13082850 |
| 1404 | 2958052131 | 2958041894 | Bacteria | 13082850 |
| 1405 | 2958070965 | 2958064165 | Bacteria | 7158582 |
| 1406 | 2958072356 | 2958071322 | Bacteria | 6815895 |
| 1407 | 2958087548 | 2958084443 | Bacteria | 7312792 |
| 1408 | 2958095834 | 2958092219 | Bacteria | 6861151 |
| 1409 | 2958102905 | 2958100919 | Bacteria | 6800575 |
| 1410 | 2958111538 | 2958108152 | Bacteria | 6681128 |
| 1411 | 2958120290 | 2958115193 | Bacteria | 6923548 |
| 1412 | 2958123358 | 2958122699 | Bacteria | 7280457 |
| 1413 | 2958132903 | 2958130278 | Bacteria | 6897202 |
| 1414 | 2958139055 | 2958137437 | Bacteria | 6050276 |
| 1415 | 2958150778 | 2958144490 | Bacteria | 6677056 |
| 1416 | 2958163970 | 2958158011 | Bacteria | 6058449 |
| 1417 | 2958167968 | 2958165035 | Bacteria | 6906348 |
| 1418 | 2958176816 | 2958172287 | Bacteria | 6716688 |
| 1419 | 2958182605 | 2958179912 | Bacteria | 6874908 |
| 1420 | 2960589445 | 2960584000 | Bacteria | 6864594 |
| 1421 | 2960592800 | 2960591022 | Bacteria | 6622873 |
| 1422 | 2960597897 | 2960597568 | Bacteria | 6550735 |
| 1423 | 2960607489 | 2960603979 | Bacteria | 6898737 |
| 1424 | 2960613677 | 2960610863 | Bacteria | 6691244 |
| 1425 | 2960619091 | 2960617483 | Bacteria | 6727748 |
| 1426 | 2960629062 | 2960624210 | Bacteria | 6875384 |
| 1427 | 2960634197 | 2960631154 | Bacteria | 6732508 |
| 1428 | 2960643583 | 2960637947 | Bacteria | 7296468 |
| 1429 | 2960650706 | 2960645483 | Bacteria | 7211087 |
| 1430 | 2960659188 | 2960652885 | Bacteria | 7083688 |
| 1431 | 2960663980 | 2960660292 | Bacteria | 7041660 |
| 1432 | 2960673289 | 2960667422 | Bacteria | 6763020 |
| 1433 | 2960674882 | 2960674078 | Bacteria | 6609048 |
| 1434 | 2960681725 | 2960680706 | Bacteria | 6624464 |
| 1435 | 2960689335 | 2960687367 | Bacteria | 6535474 |
| 1436 | 2960700651 | 2960693952 | Bacteria | 6749742 |
| 1437 | 2961080453 | 2961077736 | Bacteria | 7079850 |
| 1438 | 2961120955 | 2961114664 | Bacteria | 6680456 |
| 1439 | 2961131363 | 2961127735 | Bacteria | 7196641 |
| 1440 | 2961138877 | 2961136820 | Bacteria | 6775228 |
| 1441 | 2961166436 | 2961163497 | Bacteria | 6901077 |
| 1442 | 2961171977 | 2961170736 | Bacteria | 7072258 |
| 1443 | 2961185631 | 2961183825 | Bacteria | 6688536 |
| 1444 | 2963645508 | 2963644680 | Bacteria | 6530403 |
| 1445 | 2964608225 | 2964607997 | Bacteria | 7101408 |
| 1446 | 2964621669 | 2964615318 | Bacteria | 6809089 |
| 1447 | 2964625831 | 2964621998 | Bacteria | 6834995 |
| 1448 | 2964629534 | 2964628898 | Bacteria | 7083044 |
| 1449 | 2964639223 | 2964636051 | Bacteria | 7091832 |
| 1450 | 2964643608 | 2964643177 | Bacteria | 6820887 |
| 1451 | 2964655212 | 2964649959 | Bacteria | 6675118 |
| 1452 | 2964659979 | 2964656573 | Bacteria | 7100150 |
| 1453 | 2964669400 | 2964663802 | Bacteria | 7019362 |
| 1454 | 2964676866 | 2964670856 | Bacteria | 6851364 |
| 1455 | 2964681679 | 2964678106 | Bacteria | 6792020 |
| 1456 | 2964687453 | 2964685014 | Bacteria | 6839111 |
| 1457 | 2964695142 | 2964691889 | Bacteria | 6802758 |
| 1458 | 2964699160 | 2964698721 | Bacteria | 6765331 |
| 1459 | 2964711203 | 2964705432 | Bacteria | 7114648 |
| 1460 | 2964712659 | 2964712639 | Bacteria | 6695970 |
| 1461 | 2964719780 | 2964719344 | Bacteria | 7286602 |
| 1462 | 2965021255 | 2965018300 | Bacteria | 6883036 |
| 1463 | 2965026778 | 2965025482 | Bacteria | 6532201 |
| 1464 | 2965039474 | 2965032056 | Bacteria | 6887443 |
| 1465 | 2965047368 | 2965040258 | Bacteria | 6855979 |
| 1466 | 2965054621 | 2965047637 | Bacteria | 6623551 |
| 1467 | 2965065238 | 2965062239 | Bacteria | 7412989 |
| 1468 | 2965096248 | 2965089291 | Bacteria | 6866420 |
| 1469 | 2965107381 | 2965102966 | Bacteria | 6800987 |
| 1470 | 2965124382 | 2965119406 | Bacteria | 6956431 |
| 1471 | 2967668258 | 2967664464 | Bacteria | 6948836 |
| 1472 | 2967675607 | 2967671571 | Bacteria | 7021409 |
| 1473 | 2967681248 | 2967678726 | Bacteria | 7264382 |
| 1474 | 2967692427 | 2967686174 | Bacteria | 6678622 |
| 1475 | 2967699399 | 2967693043 | Bacteria | 6804451 |
| 1476 | 2967704813 | 2967699805 | Bacteria | 6854538 |
| 1477 | 2967713799 | 2967706974 | Bacteria | 7186053 |
| 1478 | 2967721196 | 2967714385 | Bacteria | 7000047 |
| 1479 | 2967724962 | 2967721400 | Bacteria | 7073753 |
| 1480 | 2967731832 | 2967728569 | Bacteria | 6641507 |
| 1481 | 2967738463 | 2967735183 | Bacteria | 6827012 |
| 1482 | 2967745460 | 2967742019 | Bacteria | 6794534 |
| 1483 | 2967752616 | 2967748971 | Bacteria | 6733771 |
| 1484 | 2967757747 | 2967755722 | Bacteria | 6814706 |
| 1485 | 2967765796 | 2967762386 | Bacteria | 6923502 |
| 1486 | 2967770346 | 2967769361 | Bacteria | 6587838 |
| 1487 | 2967780515 | 2967775926 | Bacteria | 6738189 |
| 1488 | 2967997449 | 2967996073 | Bacteria | 6787468 |
| 1489 | 2968006451 | 2968003550 | Bacteria | 6929263 |
| 1490 | 2968017435 | 2968016561 | Bacteria | 7022047 |
| 1491 | 2968085160 | 2968083720 | Bacteria | 7351627 |
| 1492 | 2968093401 | 2968091066 | Bacteria | 6052692 |
| 1493 | 2968098169 | 2968097103 | Bacteria | 6107094 |
| 1494 | 2968117105 | 2968110612 | Bacteria | 6814636 |
| 1495 | 2968122467 | 2968117919 | Bacteria | 6536078 |
| 1496 | 2968129525 | 2968128360 | Bacteria | 6270294 |
| 1497 | 2968142347 | 2968138860 | Bacteria | 6605449 |
| 1498 | 2968174837 | 2968171901 | Bacteria | 6894245 |
| 1499 | 2970021989 | 2970019648 | Bacteria | 7072033 |
| 1500 | 2970028678 | 2970026789 | Bacteria | 6785236 |
| 1501 | 2970038983 | 2970033650 | Bacteria | 7118744 |
| 1502 | 2970046599 | 2970040964 | Bacteria | 6731123 |
| 1503 | 2970049624 | 2970047711 | Bacteria | 7088379 |
| 1504 | 2970058836 | 2970054988 | Bacteria | 6611507 |
| 1505 | 2970066760 | 2970061556 | Bacteria | 7099761 |
| 1506 | 2970071174 | 2970068827 | Bacteria | 7123112 |
| 1507 | 2970076718 | 2970076120 | Bacteria | 6697332 |
| 1508 | 2970086749 | 2970082768 | Bacteria | 6183754 |
| 1509 | 2970092743 | 2970088815 | Bacteria | 6933825 |
| 1510 | 2970101171 | 2970095765 | Bacteria | 6936963 |
| 1511 | 2970104611 | 2970102677 | Bacteria | 6812532 |
| 1512 | 2970113927 | 2970109326 | Bacteria | 6863976 |
| 1513 | 2970118374 | 2970116247 | Bacteria | 6501857 |
| 1514 | 2970124506 | 2970122695 | Bacteria | 6625855 |
| 1515 | 2970133522 | 2970129317 | Bacteria | 6806560 |
| 1516 | 2970140893 | 2970136068 | Bacteria | 7207982 |
| 1517 | 2970147335 | 2970143518 | Bacteria | 6446480 |
| 1518 | 2970155841 | 2970149975 | Bacteria | 6779706 |
| 1519 | 2970161184 | 2970156795 | Bacteria | 7168044 |
| 1520 | 2970170755 | 2970164137 | Bacteria | 6861252 |
| 1521 | 2970174088 | 2970170962 | Bacteria | 6876229 |
| 1522 | 2970182118 | 2970177841 | Bacteria | 6768001 |
| 1523 | 2970189139 | 2970184632 | Bacteria | 7054431 |
| 1524 | 2970197913 | 2970191845 | Bacteria | 7032787 |
| 1525 | 2970472481 | 2970469710 | Bacteria | 6969209 |
| 1526 | 2970493600 | 2970489779 | Bacteria | 6517260 |
| 1527 | 2970504574 | 2970503327 | Bacteria | 7099517 |
| 1528 | 2970512238 | 2970510686 | Bacteria | 7006402 |
| 1529 | 2970526273 | 2970524798 | Bacteria | 6840927 |
| 1530 | 2970536260 | 2970532167 | Bacteria | 6553173 |
| 1531 | 2970541099 | 2970540015 | Bacteria | 6977556 |
| 1532 | 2970550873 | 2970547951 | Bacteria | 6931819 |
| 1533 | 2970557919 | 2970554993 | Bacteria | 6814252 |
| 1534 | 2970597695 | 2970593180 | Bacteria | 7073582 |
| 1535 | 2970620720 | 2970619444 | Bacteria | 6986144 |
| 1536 | 2970628819 | 2970627176 | Bacteria | 6680862 |
| 1537 | 2977520208 | 2977516862 | Bacteria | 6940108 |
| 1538 | 2977527397 | 2977523885 | Bacteria | 6960446 |
| 1539 | 2977531200 | 2977530762 | Bacteria | 6951399 |
| 1540 | 2977544470 | 2977537788 | Bacteria | 6929320 |
| 1541 | 2977547149 | 2977544691 | Bacteria | 6875412 |
| 1542 | 2977558012 | 2977551784 | Bacteria | 7125765 |
| 1543 | 2977564723 | 2977558990 | Bacteria | 6863948 |
| 1544 | 2977571312 | 2977565890 | Bacteria | 6901543 |
| 1545 | 2977577246 | 2977572785 | Bacteria | 6763888 |
| 1546 | 2977583343 | 2977579622 | Bacteria | 6772100 |
| 1547 | 2977824003 | 2977821940 | Bacteria | 6906439 |
| 1548 | 2977835288 | 2977828996 | Bacteria | 7007971 |
| 1549 | 2977846697 | 2977843712 | Bacteria | 6753583 |
| 1550 | 2977853268 | 2977851361 | Bacteria | 6694324 |
| 1551 | 2977858922 | 2977858184 | Bacteria | 6215359 |
| 1552 | 2977872207 | 2977864932 | Bacteria | 7534097 |
| 1553 | 2977876766 | 2977872689 | Bacteria | 7270173 |
| 1554 | 2977903478 | 2977898635 | Bacteria | 6675551 |
| 1555 | 2977912327 | 2977907340 | Bacteria | 6577984 |
| 1556 | 2977921128 | 2977915119 | Bacteria | 6829656 |
| 1557 | 2977924715 | 2977922695 | Bacteria | 6956781 |
| 1558 | 2977937985 | 2977935797 | Bacteria | 6252826 |
| 1559 | 2977945409 | 2977942078 | Bacteria | 7570577 |
| 1560 | 2977955392 | 2977950692 | Bacteria | 6893264 |
| 1561 | 2977958292 | 2977957713 | Bacteria | 6877875 |
| 1562 | 2977976125 | 2977971508 | Bacteria | 7472917 |
| 1563 | 2977988948 | 2977986579 | Bacteria | 6581278 |
| 1564 | 2978972746 | 2978969890 | Bacteria | 5400756 |
| 1565 | 2979092665 | 2979089926 | Bacteria | 5670289 |
| 1566 | 2979099944 | 2979095461 | Bacteria | 5669583 |
| 1567 | 2979104637 | 2979100975 | Bacteria | 5423623 |
| 1568 | 2979713116 | 2979710463 | Bacteria | 6785254 |
| 1569 | 2979743086 | 2979742915 | Bacteria | 7301278 |
| 1570 | 2979770001 | 2979764755 | Bacteria | 6610066 |
| 1571 | 2979772494 | 2979772303 | Bacteria | 6618277 |
| 1572 | 2979783247 | 2979779861 | Bacteria | 6219781 |
| 1573 | 2979793090 | 2979793036 | Bacteria | 6808957 |
| 1574 | 2979809212 | 2979808191 | Bacteria | 7179355 |
| 1575 | 2984513566 | 2984509177 | Bacteria | 5274802 |
| 1576 | 2984522854 | 2984518228 | Bacteria | 5277463 |
| 1577 | 2984542161 | 2984537506 | Bacteria | 5277481 |
| 1578 | 2984590998 | 2984587000 | Bacteria | 5263363 |
| 1579 | 2984601590 | 2984601300 | Bacteria | 5455244 |
| 1580 | 2987641719 | 2987636660 | Bacteria | 8088555 |
| 1581 | 2987645930 | 2987645492 | Bacteria | 6117018 |
| 1582 | 2987657627 | 2987652177 | Bacteria | 6969023 |
| 1583 | 2987662444 | 2987659509 | Bacteria | 6966464 |
| 1584 | 2987667156 | 2987666974 | Bacteria | 6509233 |
| 1585 | 2987675787 | 2987673487 | Bacteria | 6884027 |
| 1586 | 2989355074 | 2989349275 | Bacteria | 6349068 |
| 1587 | 2989771759 | 2989771324 | Bacteria | 5605128 |
| 1588 | 2989780251 | 2989776772 | Bacteria | 4843317 |
| 1589 | 2995394308 | 2995392953 | Bacteria | 4539380 |
| 1590 | 2996311632 | 2996310559 | Bacteria | 6357320 |
| 1591 | 2996341622 | 2996336353 | Bacteria | 5511628 |
| 1592 | 2996344890 | 2996341866 | Bacteria | 6643098 |
| 1593 | 2996349887 | 2996348954 | Bacteria | 7239054 |
| 1594 | 2996389057 | 2996386984 | Bacteria | 6978667 |
| 1595 | 2996890459 | 2996887358 | Bacteria | 5795980 |
| 1596 | 2996896209 | 2996893221 | Bacteria | 5823108 |
| 1597 | 3000137577 | 3000135777 | Bacteria | 6891109 |
| 1598 | 3002141746 | 3002141150 | Bacteria | 5254435 |
| 1599 | 3003931142 | 3003930520 | Bacteria | 5667563 |
| 1600 | 3004173506 | 3004167301 | Bacteria | 8330599 |
| 1601 | 3004191495 | 3004188549 | Bacteria | 6952365 |
| 1602 | 3004203125 | 3004195979 | Bacteria | 6776956 |
| 1603 | 3004209469 | 3004203850 | Bacteria | 7307914 |
| 1604 | 3004218506 | 3004211236 | Bacteria | 7417683 |
| 1605 | 3004223648 | 3004218560 | Bacteria | 7421728 |
| 1606 | 3004234223 | 3004232784 | Bacteria | 6662140 |
| 1607 | 3004243043 | 3004239961 | Bacteria | 6892290 |
| 1608 | 3004250753 | 3004248173 | Bacteria | 6563236 |
| 1609 | 3004274395 | 3004268573 | Bacteria | 7043476 |
| 1610 | 3004276589 | 3004275668 | Bacteria | 7114440 |
| 1611 | 3004290168 | 3004289098 | Bacteria | 6135450 |
| 1612 | 3004337044 | 3004334049 | Bacteria | 8449246 |
| 1613 | 3005415962 | 3005409236 | Bacteria | 7188837 |
| 1614 | 3005416886 | 3005416602 | Bacteria | 7064308 |
| 1615 | 3005449846 | 3005445848 | Bacteria | 6906074 |
| 1616 | 3005456137 | 3005452660 | Bacteria | 5889319 |
| 1617 | 637076808 | 637000159 | Bacteria | 7596297 |
| 1618 | 639650613 | 639633055 | Bacteria | 7751309 |
| 1619 | 643827527 | 643692032 | Bacteria | 6891900 |
| 1620 | 648737308 | 648276728 | Bacteria | 6968865 |
| 1621 | 649870745 | 649633066 | Bacteria | 6690028 |
| 1622 | 650741294 | 650716007 | Bacteria | 5573770 |
| 1623 | 8002286344 | 8002285264 | Bacteria | 6717907 |
| 1624 | 8003573644 | 8003570095 | Bacteria | 5747666 |
| 1625 | 8003995455 | 8003992118 | Bacteria | 7266902 |
| 1626 | 8004003214 | 8003999396 | Bacteria | 7063185 |
| 1627 | 8004303054 | 8004300914 | Bacteria | 6132239 |
| 1628 | 8004314547 | 8004312739 | Bacteria | 7444653 |
| 1629 | 8004366000 | 8004361976 | Bacteria | 6858373 |
| 1630 | 8004376368 | 8004374579 | Bacteria | 6898112 |
| 1631 | 8004390470 | 8004387939 | Bacteria | 7049250 |
| 1632 | 8004399919 | 8004395343 | Bacteria | 6620908 |
| 1633 | 8004452083 | 8004445564 | Bacteria | 6322258 |
| 1634 | 8004639891 | 8004633249 | Bacteria | 6723080 |
| 1635 | 8004641891 | 8004640170 | Bacteria | 6723001 |
| 1636 | 8004701373 | 8004695233 | Bacteria | 6731676 |
| 1637 | 8004706555 | 8004703790 | Bacteria | 8006957 |
| 1638 | 8004717162 | 8004714634 | Bacteria | 6776161 |
| 1639 | 8004730193 | 8004727605 | Bacteria | 6643904 |
| 1640 | 8005249412 | 8005246636 | Bacteria | 4933972 |
| 1641 | 8005262646 | 8005258706 | Bacteria | 6184835 |
| 1642 | 8005282610 | 8005275841 | Bacteria | 6929066 |
| 1643 | 8005286575 | 8005282627 | Bacteria | 6675747 |
| 1644 | 8005291987 | 8005289223 | Bacteria | 6634003 |
| 1645 | 8005306126 | 8005301065 | Bacteria | 6614431 |
| 1646 | 8005309700 | 8005307578 | Bacteria | 7395396 |
| 1647 | 8005315910 | 8005314921 | Bacteria | 7072929 |
| 1648 | 8005324986 | 8005321885 | Bacteria | 5795980 |
| 1649 | 8005381390 | 8005376324 | Bacteria | 6590079 |
| 1650 | 8005387600 | 8005382845 | Bacteria | 6732062 |
| 1651 | 8005398436 | 8005395548 | Bacteria | 6806915 |
| 1652 | 8005431963 | 8005430974 | Bacteria | 6689030 |
| 1653 | 8005465288 | 8005460587 | Bacteria | 7157962 |
| 1654 | 8005486997 | 8005484373 | Bacteria | 6297373 |
| 1655 | 8005497866 | 8005497431 | Bacteria | 6477605 |
| 1656 | 8005546871 | 8005542996 | Bacteria | 7077758 |
| 1657 | 8005561353 | 8005556819 | Bacteria | 6908598 |
| 1658 | 8005565975 | 8005563573 | Bacteria | 7153261 |
| 1659 | 8005572024 | 8005570704 | Bacteria | 6957481 |
| 1660 | 8005623600 | 8005619151 | Bacteria | 7030230 |
| 1661 | 8005630839 | 8005626139 | Bacteria | 6534237 |
| 1662 | 8005645194 | 8005645114 | Bacteria | 6950293 |
| 1663 | 8005660964 | 8005658619 | Bacteria | 4500593 |
| 1664 | 8005669272 | 8005668836 | Bacteria | 6953162 |
| 1665 | 8005687360 | 8005682033 | Bacteria | 6726518 |
| 1666 | 8005694177 | 8005688590 | Bacteria | 6610080 |
| 1667 | 8005695823 | 8005695170 | Bacteria | 6912330 |
| 1668 | 8018128668 | 8018127388 | Bacteria | 7351159 |
| 1669 | 8018153105 | 8018150411 | Bacteria | 5549903 |
| 1670 | 8018164910 | 8018163183 | Bacteria | 7277977 |
| 1671 | 8018177650 | 8018176218 | Bacteria | 6896178 |
| 1672 | 8023686731 | 8023680758 | Bacteria | 7729763 |
| 1673 | 8024484550 | 8024479707 | Bacteria | 6954785 |
| 1674 | 8024491014 | 8024486573 | Bacteria | 6540512 |
| 1675 | 8024504023 | 8024501048 | Bacteria | 6427847 |
| 1676 | 8046768370 | 8046767195 | Bacteria | 7547379 |
| 1677 | 8049296397 | 8049293176 | Bacteria | 6128433 |
| 1678 | 8054463886 | 8054460903 | Bacteria | 4872905 |
| 1679 | 8054559973 | 8054558443 | Bacteria | 5204801 |
| 1680 | 8055432957 | 8055431914 | Bacteria | 4551896 |
| 1681 | 8055618130 | 8055617313 | Bacteria | 7548464 |
| 1682 | 8056380584 | 8056375014 | Bacteria | 7006639 |
| 1683 | 8056383356 | 8056382006 | Bacteria | 6408074 |
| 1684 | 8056878361 | 8056875544 | Bacteria | 4355797 |
| 1685 | 8057581961 | 8057575449 | Bacteria | 7367519 |
| 1686 | 8057879469 | 8057874678 | Bacteria | 7494653 |
| 1687 | JGI24740J21852_10008046 | |||
| 1688 | JGI24739J22299_10026028 | |||
| 1689 | JGI24735J21928_10010743 | |||
| 1690 | JGI25155J39150_1000018 | |||
| 1691 | JGI25156J39149_1000055 | |||
| 1692 | JGI25156J39149_1005781 | |||
| 1693 | JGI25162J39368_1000524 | |||
| 1694 | JGI25162J39368_1001321 | |||
| 1695 | JGI25154J39366_1000069 | |||
| 1696 | JGI25158J39367_1000191 | |||
| 1697 | JGI25157J39369_1000076 | |||
| 1698 | JGI25157J39369_1002158 | |||
| 1699 | JGI25152J39213_1000169 | |||
| 1700 | JGI25152J39213_1001739 | |||
| 1701 | JGI25152J39213_1002279 | |||
| 1702 | JGI25152J39213_1006926 | |||
| 1703 | JGI25152J39213_1014945 | |||
| 1704 | JGI25150J39212_1000018 | |||
| 1705 | JGI25150J39212_1001891 | |||
| 1706 | JGI25150J39212_1011092 | |||
| 1707 | JGI25159J45721_1000022 | |||
| 1708 | JGI25159J45721_1000486 | |||
| 1709 | JGI25159J45721_1003195 | |||
| 1710 | JGI25151J46595_10000034 | |||
| 1711 | JGI25151J46595_10000879 | |||
| 1712 | JGI25151J46595_10003252 | |||
| 1713 | JGI25151J46595_10007778 | |||
| 1714 | JGI25151J46595_10049730 | |||
| 1715 | JGI25406J46586_10065927 | |||
| 1716 | JGI25165J46597_1000052 | |||
| 1717 | JGI25165J46597_1000723 | |||
| 1718 | JGI25165J46597_1001341 | |||
| 1719 | JGI25165J46597_1001646 | |||
| 1720 | JGI25165J46597_1002217 | |||
| 1721 | JGI25153J46596_10000759 | |||
| 1722 | JGI25153J46596_10004655 | |||
| 1723 | JGI25153J46596_10004904 | |||
| 1724 | JGI25153J46596_10005257 | |||
| 1725 | JGI25153J46596_10016210 | |||
| 1726 | JGI25153J46596_10016213 | |||
| 1727 | JGI25153J46596_10041591 | |||
| 1728 | JGI25160J50197_1000051 | |||
| 1729 | JGI25160J50197_1000056 | |||
| 1730 | JGI25160J50197_1000317 | |||
| 1731 | JGI25160J50197_1024851 | |||
| 1732 | JGI25161J50226_1000011 | |||
| 1733 | JGI25161J50226_1000214 | |||
| 1734 | JGI25161J50226_1000451 | |||
| 1735 | JGI25161J50226_1002111 | |||
| 1736 | Ga0006562J51391_1044604 | |||
| 1737 | Ga0055539_1003028 | |||
| 1738 | Ga0055542_1000284 | |||
| 1739 | Ga0055529_1007878 | |||
| 1740 | Ga0055526_1001496 | |||
| 1741 | Ga0055526_1001864 | |||
| 1742 | Ga0055526_1003195 | |||
| 1743 | Ga0055524_1000962 | |||
| 1744 | Ga0055524_1001781 | |||
| 1745 | Ga0055524_1002678 | |||
| 1746 | Ga0055524_1003666 | |||
| 1747 | Ga0055524_1004018 | |||
| 1748 | Ga0055524_1006695 | |||
| 1749 | Ga0055524_1011005 | |||
| 1750 | Ga0055524_1014485 | |||
| 1751 | Ga0055536_1004102 | |||
| 1752 | Ga0055536_1017871 | |||
| 1753 | Ga0055528_1000452 | |||
| 1754 | Ga0055528_1001257 | |||
| 1755 | Ga0055528_1002057 | |||
| 1756 | Ga0055528_1004002 | |||
| 1757 | Ga0055528_1012948 | |||
| 1758 | Ga0055528_1016826 | |||
| 1759 | Ga0055540_1000597 | |||
| 1760 | Ga0055540_1004729 | |||
| 1761 | Ga0055540_1007895 | |||
| 1762 | Ga0055540_1016975 | |||
| 1763 | Ga0055540_1017617 | |||
| 1764 | Ga0055531_10018670 | |||
| 1765 | Ga0058692_1002316 | |||
| 1766 | Ga0055543_1000041 | |||
| 1767 | Ga0055543_1000330 | |||
| 1768 | Ga0055543_1000682 | |||
| 1769 | Ga0055543_1001229 | |||
| 1770 | Ga0065165_1000155 | |||
| 1771 | Ga0065165_1000303 | |||
| 1772 | Ga0065165_1002015 | |||
| 1773 | Ga0065165_1012660 | |||
| 1774 | Ga0065704_10145387 | |||
| 1775 | Ga0070670_100000711 | |||
| 1776 | Ga0070666_10163594 | |||
| 1777 | Ga0070682_100046169 | |||
| 1778 | Ga0070669_100052021 | |||
| 1779 | Ga0070663_100233991 | |||
| 1780 | Ga0068867_100041403 | |||
| 1781 | Ga0068853_100312445 | |||
| 1782 | Ga0070665_100001728 | |||
| 1783 | Ga0070665_100024473 | |||
| 1784 | Ga0070665_100027905 | |||
| 1785 | Ga0070665_100046994 | |||
| 1786 | Ga0070665_100065392 | |||
| 1787 | Ga0070665_100081432 | |||
| 1788 | Ga0068855_100209256 | |||
| 1789 | Ga0068854_100043122 | |||
| 1790 | Ga0068856_100009588 | |||
| 1791 | Ga0068856_100107833 | |||
| 1792 | Ga0068856_100109572 | |||
| 1793 | Ga0068851_10023620 | |||
| 1794 | Ga0068860_100214379 | |||
| 1795 | Ga0081540_1088199 | |||
| 1796 | Ga0081539_10000690 | |||
| 1797 | Ga0075365_10008818 | |||
| 1798 | Ga0075365_10011801 | |||
| 1799 | Ga0075365_10015484 | |||
| 1800 | Ga0075365_10035579 | |||
| 1801 | Ga0075365_10065362 | |||
| 1802 | Ga0075365_10128777 | |||
| 1803 | Ga0075365_10169525 | |||
| 1804 | Ga0075365_10247244 | |||
| 1805 | Ga0075365_10250840 | |||
| 1806 | Ga0075368_10000331 | |||
| 1807 | Ga0075368_10013009 | |||
| 1808 | Ga0075364_10000055 | |||
| 1809 | Ga0075364_10002563 | |||
| 1810 | Ga0075364_10111164 | |||
| 1811 | Ga0075364_10113188 | |||
| 1812 | Ga0075364_10207119 | |||
| 1813 | Ga0075364_10376193 | |||
| 1814 | Ga0075362_10003009 | |||
| 1815 | Ga0075367_10001276 | |||
| 1816 | Ga0075367_10008172 | |||
| 1817 | Ga0075367_10012825 | |||
| 1818 | Ga0075369_10000313 | |||
| 1819 | Ga0075369_10000392 | |||
| 1820 | Ga0075369_10000984 | |||
| 1821 | Ga0075369_10059281 | |||
| 1822 | Ga0075366_10010073 | |||
| 1823 | Ga0075366_10018892 | |||
| 1824 | Ga0075366_10059537 | |||
| 1825 | Ga0075366_10169644 | |||
| 1826 | Ga0075370_10003473 | |||
| 1827 | Ga0075370_10030140 | |||
| 1828 | Ga0079104_1000310 | |||
| 1829 | Ga0079104_1002619 | |||
| 1830 | Ga0099826_10000813 | |||
| 1831 | Ga0105251_10005877 | |||
| 1832 | Ga0105244_10061279 | |||
| 1833 | Ga0105244_10148610 | |||
| 1834 | Ga0105244_10151217 | |||
| 1835 | Ga0105250_10005594 | |||
| 1836 | Ga0105240_10000142 | |||
| 1837 | Ga0105240_10117420 | |||
| 1838 | Ga0105247_10027296 | |||
| 1839 | Ga0105243_10013389 | |||
| 1840 | Ga0105243_10065194 | |||
| 1841 | Ga0105241_10094484 | |||
| 1842 | Ga0105248_10015451 | |||
| 1843 | Ga0105237_10073189 | |||
| 1844 | Ga0105238_10241903 | |||
| 1845 | Ga0105238_10399002 | |||
| 1846 | Ga0105249_10027699 | |||
| 1847 | Ga0105249_10076570 | |||
| 1848 | Ga0105249_10164867 | |||
| 1849 | Ga0123341_1011001 | |||
| 1850 | Ga0123342_1006148 | |||
| 1851 | Ga0105239_10040928 | |||
| 1852 | Ga0105239_10098844 | |||
| 1853 | Ga0105239_10145918 | |||
| 1854 | Ga0105239_10222728 | |||
| 1855 | Ga0105246_10125589 | |||
| 1856 | Ga0157373_10017981 | |||
| 1857 | Ga0157373_10052766 | |||
| 1858 | Ga0157371_10000071 | |||
| 1859 | Ga0157371_10016970 | |||
| 1860 | Ga0157371_10208933 | |||
| 1861 | Ga0157370_10000079 | |||
| 1862 | Ga0157370_10250954 | |||
| 1863 | Ga0157369_10058030 | |||
| 1864 | Ga0157369_10155592 | |||
| 1865 | Ga0157369_10301116 | |||
| 1866 | Ga0171463_1004 | |||
| 1867 | Ga0157374_10515719 | |||
| 1868 | Ga0163162_10240203 | |||
| 1869 | Ga0163162_10264290 | |||
| 1870 | Ga0163162_10407197 | |||
| 1871 | Ga0163163_10667340 | |||
| 1872 | Ga0182006_1045002 | |||
| 1873 | Ga0182007_10009040 | |||
| 1874 | Ga0182005_1011399 | |||
| 1875 | Ga0183363_1129 | |||
| 1876 | Ga0214542_1000064 | |||
| 1877 | Ga0214542_1012059 | |||
| 1878 | Ga0214543_1000015 | |||
| 1879 | Ga0214543_1000063 | |||
| 1880 | Ga0228710_1000002 | |||
| 1881 | Ga0209435_100031 | |||
| 1882 | Ga0209436_100013 | |||
| 1883 | Ga0209436_100428 | |||
| 1884 | Ga0209436_106719 | |||
| 1885 | Ga0207427_108179 | |||
| 1886 | Ga0209437_100179 | |||
| 1887 | Ga0209437_100181 | |||
| 1888 | Ga0207425_1000035 | |||
| 1889 | Ga0207425_1000818 | |||
| 1890 | Ga0207425_1003762 | |||
| 1891 | Ga0207425_1006981 | |||
| 1892 | Ga0207425_1016727 | |||
| 1893 | Ga0207425_1017715 | |||
| 1894 | Ga0209646_1000102 | |||
| 1895 | Ga0209026_1000096 | |||
| 1896 | Ga0209026_1000141 | |||
| 1897 | Ga0209677_100353 | |||
| 1898 | Ga0209148_1000111 | |||
| 1899 | Ga0209148_1006902 | |||
| 1900 | Ga0209759_1000090 | |||
| 1901 | Ga0209759_1000354 | |||
| 1902 | Ga0209129_1000029 | |||
| 1903 | Ga0209129_1000050 | |||
| 1904 | Ga0209129_1000826 | |||
| 1905 | Ga0209129_1002308 | |||
| 1906 | Ga0209129_1003458 | |||
| 1907 | Ga0209129_1003466 | |||
| 1908 | Ga0209233_1000118 | |||
| 1909 | Ga0209233_1000185 | |||
| 1910 | Ga0209233_1000212 | |||
| 1911 | Ga0209233_1000263 | |||
| 1912 | Ga0209233_1002000 | |||
| 1913 | Ga0209455_1000206 | |||
| 1914 | Ga0209673_1000033 | |||
| 1915 | Ga0209673_1000050 | |||
| 1916 | Ga0209673_1000370 | |||
| 1917 | Ga0209673_1001845 | |||
| 1918 | Ga0209673_1002753 | |||
| 1919 | Ga0209673_1004411 | |||
| 1920 | Ga0209673_1009772 | |||
| 1921 | Ga0209673_1012920 | |||
| 1922 | Ga0209673_1017809 | |||
| 1923 | Ga0209130_1000009 | |||
| 1924 | Ga0209130_1000058 | |||
| 1925 | Ga0209130_1000133 | |||
| 1926 | Ga0209130_1003685 | |||
| 1927 | Ga0209130_1009201 | |||
| 1928 | Ga0209676_1003603 | |||
| 1929 | Ga0209676_1017298 | |||
| 1930 | Ga0209025_1000042 | |||
| 1931 | Ga0209025_1000132 | |||
| 1932 | Ga0209025_1000453 | |||
| 1933 | Ga0209025_1000536 | |||
| 1934 | Ga0209025_1000815 | |||
| 1935 | Ga0209025_1003984 | |||
| 1936 | Ga0209025_1008993 | |||
| 1937 | Ga0209025_1009137 | |||
| 1938 | Ga0209025_1023470 | |||
| 1939 | Ga0209025_1044776 | |||
| 1940 | Ga0209025_1082425 | |||
| 1941 | Ga0209564_1000193 | |||
| 1942 | Ga0209564_1000227 | |||
| 1943 | Ga0209564_1000284 | |||
| 1944 | Ga0209564_1002592 | |||
| 1945 | Ga0209564_1007808 | |||
| 1946 | Ga0209564_1010209 | |||
| 1947 | Ga0209564_1010789 | |||
| 1948 | Ga0209564_1021755 | |||
| 1949 | Ga0209758_1000299 | |||
| 1950 | Ga0209758_1000406 | |||
| 1951 | Ga0209758_1000864 | |||
| 1952 | Ga0209758_1001412 | |||
| 1953 | Ga0209758_1001462 | |||
| 1954 | Ga0209758_1003168 | |||
| 1955 | Ga0209758_1003902 | |||
| 1956 | Ga0209758_1005846 | |||
| 1957 | Ga0209758_1007065 | |||
| 1958 | Ga0209758_1022438 | |||
| 1959 | Ga0209758_1028206 | |||
| 1960 | Ga0209050_1002699 | |||
| 1961 | Ga0209050_1004678 | |||
| 1962 | Ga0209050_1004888 | |||
| 1963 | Ga0209256_1000286 | |||
| 1964 | Ga0209256_1001479 | |||
| 1965 | Ga0209256_1001610 | |||
| 1966 | Ga0209256_1001820 | |||
| 1967 | Ga0209256_1002679 | |||
| 1968 | Ga0209256_1003742 | |||
| 1969 | Ga0209256_1005463 | |||
| 1970 | Ga0209256_1013906 | |||
| 1971 | Ga0209256_1015132 | |||
| 1972 | Ga0207426_1000041 | |||
| 1973 | Ga0207426_1000131 | |||
| 1974 | Ga0207426_1000214 | |||
| 1975 | Ga0207426_1000248 | |||
| 1976 | Ga0207426_1000682 | |||
| 1977 | Ga0209051_1000118 | |||
| 1978 | Ga0209051_1000822 | |||
| 1979 | Ga0209051_1001039 | |||
| 1980 | Ga0209051_1011245 | |||
| 1981 | Ga0209051_1012570 | |||
| 1982 | Ga0209257_1003194 | |||
| 1983 | Ga0209257_1003966 | |||
| 1984 | Ga0209257_1008273 | |||
| 1985 | Ga0209257_1021432 | |||
| 1986 | Ga0209257_1031374 | |||
| 1987 | Ga0209257_1032740 | |||
| 1988 | Ga0207713_1039001 | |||
| 1989 | Ga0207680_10460929 | |||
| 1990 | Ga0207647_10005393 | |||
| 1991 | Ga0207647_10029967 | |||
| 1992 | Ga0207647_10232840 | |||
| 1993 | Ga0207695_10000234 | |||
| 1994 | Ga0207671_10000234 | |||
| 1995 | Ga0207681_10044364 | |||
| 1996 | Ga0207650_10001757 | |||
| 1997 | Ga0207709_10041550 | |||
| 1998 | Ga0207709_10130227 | |||
| 1999 | Ga0207711_10015450 | |||
| 2000 | Ga0207667_10228498 | |||
| 2001 | Ga0207712_10015100 | |||
| 2002 | Ga0207640_10099697 | |||
| 2003 | Ga0207639_10264026 | |||
| 2004 | Ga0207678_10040358 | |||
| 2005 | Ga0207702_10028158 | |||
| 2006 | Ga0207702_10347382 | |||
| 2007 | Ga0207648_10017029 | |||
| 2008 | Ga0207683_10204603 | |||
| 2009 | Ga0207698_10158850 | |||
| 2010 | Ga0207698_10347438 | |||
| 2011 | Ga0209281_1000028 | |||
| 2012 | Ga0209281_1000030 | |||
| 2013 | Ga0209281_1000144 | |||
| 2014 | Ga0209371_1000037 | |||
| 2015 | Ga0209371_1001411 | |||
| 2016 | Ga0209282_1000004 | |||
| 2017 | Ga0209282_1000695 | |||
| 2018 | Ga0209813_10000656 | |||
| 2019 | Ga0209813_10005578 | |||
| 2020 | Ga0268266_10009948 | |||
| 2021 | Ga0268266_10020595 | |||
| 2022 | Ga0268266_10022456 | |||
| 2023 | Ga0268266_10024962 | |||
| 2024 | Ga0268266_10036055 | |||
| 2025 | Ga0268266_10048156 | |||
| 2026 | Ga0268266_10084479 | |||
| 2027 | Ga0268266_10107988 | |||
| 2028 | Ga0307515_10001049 | |||
| 2029 | Ga0307515_10001099 | |||
| 2030 | Ga0307515_10003215 | |||
| 2031 | Ga0307515_10012908 | |||
| 2032 | Ga0307515_10166092 | |||
| 2033 | Ga0307515_10405949 | |||
| 2034 | Ga0268256_1000039 | |||
| 2035 | Ga0268256_1001490 | |||
| 2036 | Ga0307513_10001726 | |||
| 2037 | Ga0307513_10293864 | |||
| 2038 | Ga0307513_10322135 | |||
| 2039 | Ga0307408_100174389 | |||
| 2040 | Ga0307408_100214882 | |||
| 2041 | Ga0307405_10000700 | |||
| 2042 | Ga0307405_10105294 | |||
| 2043 | Ga0307405_10107309 | |||
| 2044 | Ga0307406_10025694 | |||
| 2045 | Ga0307412_10000412 | |||
| 2046 | Ga0307412_10180321 | |||
| 2047 | Ga0315914_1000001 | |||
| 2048 | Ga0307409_100057973 | |||
| 2049 | Ga0307416_100117991 | |||
| 2050 | Ga0307414_10281880 | |||
| 2051 | Ga0315913_1000022 | |||
| 2052 | Ga0315915_1000002 | |||
| 2053 | Ga0373943_0022408 | |||
| 2054 | Ga0373927_0000068 | |||
| 2055 | Ga0373925_0009713 | |||
| 2056 | Ga0395899_0000114 | |||
| 2057 | Ga0395900_0000154 | |||
| 2058 | Ga0395898_0000308 | |||
| 2059 | Ga0395905_0000145 | |||
| 2060 | Ga0395905_0000153 | |||
| 2061 | Ga0395905_0002522 | |||
| 2062 | Ga0395905_0003283 | |||
| 2063 | Ga0395905_0006080 | |||
| 2064 | Ga0395905_0109772 | |||
| 2065 | Ga0395905_0140183 | |||
| 2066 | Ga0395905_0203194 | |||
| 2067 | Ga0395901_0000107 | |||
| 2068 | Ga0395901_0128293 | |||
| 2069 | Ga0439436_0020168 | |||
| 2070 | Ga0439438_022143 | |||
| 2071 | Ga0439465_0002941 | |||
| 2072 | Ga0439465_0008560 | |||
| 2073 | Ga0439465_0087910 | |||
| 2074 | Ga0439465_0109789 | |||
| 2075 | Ga0439465_0109951 | |||
| 2076 | Ga0451787_786302 | |||
| 2077 | Ga0451791_1084156 | |||
| 2078 | Ga0451795_0936408 | |||
| 2079 | Ga0451835_0541352 | |||
| 2080 | Ga0451837_1266342 | |||
| 2081 | Ga0451839_0960768 | |||
| 2082 | Ga0451839_1362450 | |||
| 2083 | Ga0451845_0818217 | |||
| 2084 | Ga0451846_16062 | |||
| 2085 | Ga0451847_0888644 | |||
| 2086 | Ga0451848_00496 | |||
| 2087 | Ga0451849_0622848 | |||
| 2088 | Ga0451849_1184580 | |||
| 2089 | Ga0451850_52452 | |||
| 2090 | Ga0451851_0296208 | |||
| 2091 | Ga0451851_1301903 | |||
| 2092 | Ga0451843_0006262 | |||
| 2093 | Ga0451843_0102315 | |||
| 2094 | Ga0451854_25229 | |||
| 2095 | Ga0451855_1956298 | |||
| 2096 | Ga0452271_63898 | |||
| 2097 | Ga0439449_0016640 | |||
| 2098 | Ga0439449_0082256 | |||
| 2099 | Ga0439462_0050030 | |||
| 2100 | Ga0450918_001271 | |||
| 2101 | Ga0466965_0038749 | |||
| 2102 | Ga0466968_0085444 | |||
| 2103 | Ga0466970_0057028 | |||
| 2104 | Ga0466960_0058815 | |||
| 2105 | Ga0466967_0122754 | |||
| 2106 | Ga0495590_0096483 | |||
| 2107 | Ga0495629_0228937 | |||
| 2108 | Ga0495638_0000110 | |||
| 2109 | Ga0495638_0009542 | |||
| 2110 | Ga0495638_0023446 | |||
| 2111 | Ga0495638_0072445 | |||
| 2112 | Ga0495605_0018627 | |||
| 2113 | Ga0495605_0018645 | |||
| 2114 | Ga0495585_0025166 | |||
| 2115 | Ga0495585_0273670 | |||
| 2116 | Ga0495607_0009290 | |||
| 2117 | Ga0495583_0002526 | |||
| 2118 | Ga0495583_0030411 | |||
| 2119 | Ga0495583_0036690 | |||
| 2120 | Ga0495583_0038784 | |||
| 2121 | Ga0495606_0008486 | |||
| 2122 | Ga0495610_0000363 | |||
| 2123 | Ga0495610_0114438 | |||
| 2124 | Ga0495620_0026048 | |||
| 2125 | Ga0495620_0032808 | |||
| 2126 | Ga0495620_0124812 | |||
| 2127 | Ga0495631_0009141 | |||
| 2128 | Ga0495631_0062843 | |||
| 2129 | Ga0495632_0002260 | |||
| 2130 | Ga0495632_0004424 | |||
| 2131 | Ga0495632_0031879 | |||
| 2132 | Ga0495632_0043756 | |||
| 2133 | Ga0495643_0014831 | |||
| 2134 | Ga0495643_0083550 | |||
| 2135 | Ga0495648_0023661 | |||
| 2136 | Ga0495648_0033988 | |||
| 2137 | Ga0495654_0000143 | |||
| 2138 | Ga0495654_0029808 | |||
| 2139 | Ga0495654_0102439 | |||
| 2140 | Ga0495640_0124115 | |||
| 2141 | Ga0495609_0047715 | |||
| 2142 | Ga0495597_0003665 | |||
| 2143 | Ga0495622_0003807 | |||
| 2144 | Ga0495633_0017760 | |||
| 2145 | Ga0495668_0013032 | |||
| 2146 | Ga0495668_0028753 | |||
| 2147 | Ga0495668_0044115 | |||
| 2148 | Ga0495668_0078372 | |||
| 2149 | Ga0495668_0166161 | |||
| 2150 | Ga0495611_0066298 | |||
| 2151 | Ga0495625_0018152 | |||
| 2152 | Ga0495625_0025839 | |||
| 2153 | Ga0495625_0032212 | |||
| 2154 | Ga0495625_0032944 | |||
| 2155 | Ga0495625_0036901 | |||
| 2156 | Ga0495625_0060171 | |||
| 2157 | Ga0495625_0087218 | |||
| 2158 | Ga0495625_0114829 | |||
| 2159 | Ga0495625_0153453 | |||
| 2160 | Ga0495625_0350247 | |||
| 2161 | Ga0495670_0124213 | |||
| 2162 | Ga0495649_0028221 | |||
| 2163 | Ga0495604_0040845 | |||
| 2164 | Ga0495672_0037794 | |||
| 2165 | Ga0495681_0006015 | |||
| 2166 | Ga0495681_0016034 | |||
| 2167 | Ga0495686_0002138 | |||
| 2168 | Ga0495686_0029027 | |||
| 2169 | Ga0495686_0034137 | |||
| 2170 | Ga0496100_0041778 | |||
| 2171 | Ga0496102_0027633 | |||
| 2172 | Ga0496102_0095857 | |||
| 2173 | Ga0496102_0231085 | |||
| 2174 | Ga0496102_0664044 | |||
| 2175 | Ga0496103_0035386 | |||
| 2176 | Ga0496104_0019186 | |||
| 2177 | Ga0496104_0572581 | |||
| 2178 | Ga0496105_0106434 | |||
| 2179 | Ga0496106_0000209 | |||
| 2180 | Ga0496110_0034043 | |||
| 2181 | Ga0496110_0037462 | |||
| 2182 | Ga0496111_0000529 | |||
| 2183 | Ga0496112_0059923 | |||
| 2184 | Ga0496113_0125184 | |||
| 2185 | Ga0496113_0182693 | |||
| 2186 | Ga0496115_0559841 | |||
| 2187 | Ga0496116_0000057 | |||
| 2188 | Ga0496116_0002951 | |||
| 2189 | Ga0496116_0004307 | |||
| 2190 | Ga0496116_0007377 | |||
| 2191 | Ga0496116_0012871 | |||
| 2192 | Ga0496116_0013281 | |||
| 2193 | Ga0496116_0027111 | |||
| 2194 | Ga0496116_0049893 | |||
| 2195 | Ga0496116_0089513 | |||
| 2196 | Ga0496117_0000031 | |||
| 2197 | Ga0496117_0004374 | |||
| 2198 | Ga0496117_0005859 | |||
| 2199 | Ga0496117_0008418 | |||
| 2200 | Ga0496117_0008839 | |||
| 2201 | Ga0496117_0025271 | |||
| 2202 | Ga0496117_0057733 | |||
| 2203 | Ga0496117_0062376 | |||
| 2204 | Ga0496118_0000208 | |||
| 2205 | Ga0496118_0008309 | |||
| 2206 | Ga0496118_0009542 | |||
| 2207 | Ga0496118_0010424 | |||
| 2208 | Ga0496118_0018069 | |||
| 2209 | Ga0496118_0026041 | |||
| 2210 | Ga0496118_0117856 | |||
| 2211 | Ga0496119_0010018 | |||
| 2212 | Ga0496119_0027187 | |||
| 2213 | Ga0496119_0028420 | |||
| 2214 | Ga0496119_0057969 | |||
| 2215 | Ga0496119_0058422 | |||
| 2216 | Ga0496119_0059282 | |||
| 2217 | Ga0496119_0098164 | |||
| 2218 | Ga0496119_0173109 | |||
| 2219 | Ga0496120_0000387 | |||
| 2220 | Ga0496120_0003353 | |||
| 2221 | Ga0496120_0009286 | |||
| 2222 | Ga0496120_0031754 | |||
| 2223 | Ga0496121_0000034 | |||
| 2224 | Ga0496121_0000888 | |||
| 2225 | Ga0496121_0003956 | |||
| 2226 | Ga0496121_0006665 | |||
| 2227 | Ga0496121_0011216 | |||
| 2228 | Ga0496121_0017687 | |||
| 2229 | Ga0496121_0021103 | |||
| 2230 | Ga0496121_0026581 | |||
| 2231 | Ga0496121_0062440 | |||
| 2232 | Ga0496121_0099186 | |||
| 2233 | Ga0496121_0368692 | |||
| 2234 | Ga0496121_0423096 | |||
| 2235 | Ga0496122_0000023 | |||
| 2236 | Ga0496122_0000082 | |||
| 2237 | Ga0496122_0000308 | |||
| 2238 | Ga0496122_0001941 | |||
| 2239 | Ga0496122_0009040 | |||
| 2240 | Ga0496122_0009440 | |||
| 2241 | Ga0496122_0016216 | |||
| 2242 | Ga0496122_0024313 | |||
| 2243 | Ga0496122_0046997 | |||
| 2244 | Ga0496122_0056321 | |||
| 2245 | Ga0496122_0069421 | |||
| 2246 | Ga0496122_0099299 | |||
| 2247 | Ga0496122_0179827 | |||
| 2248 | Ga0496122_0188034 | |||
| 2249 | Ga0496123_0000027 | |||
| 2250 | Ga0496123_0000066 | |||
| 2251 | Ga0496123_0000067 | |||
| 2252 | Ga0496123_0004280 | |||
| 2253 | Ga0496123_0005944 | |||
| 2254 | Ga0496123_0007760 | |||
| 2255 | Ga0496123_0014489 | |||
| 2256 | Ga0496123_0014788 | |||
| 2257 | Ga0496123_0017159 | |||
| 2258 | Ga0496123_0032615 | |||
| 2259 | Ga0496123_0091795 | |||
| 2260 | Ga0496123_0143543 | |||
| 2261 | Ga0496123_0147973 | |||
| 2262 | Ga0496124_0000294 | |||
| 2263 | Ga0496124_0001215 | |||
| 2264 | Ga0496124_0003574 | |||
| 2265 | Ga0496124_0004183 | |||
| 2266 | Ga0496124_0008477 | |||
| 2267 | Ga0496124_0021552 | |||
| 2268 | Ga0496124_0041507 | |||
| 2269 | Ga0496124_0066054 | |||
| 2270 | Ga0496124_0071829 | |||
| 2271 | Ga0496124_0132601 | |||
| 2272 | Ga0496124_0138206 | |||
| 2273 | Ga0496124_0196553 | |||
| 2274 | Ga0496125_0000030 | |||
| 2275 | Ga0496125_0000288 | |||
| 2276 | Ga0496125_0004702 | |||
| 2277 | Ga0496125_0005090 | |||
| 2278 | Ga0496125_0006385 | |||
| 2279 | Ga0496125_0010417 | |||
| 2280 | Ga0496125_0051919 | |||
| 2281 | Ga0496125_0122995 | |||
| 2282 | Ga0496125_0124822 | |||
| 2283 | Ga0496125_0225126 | |||
| 2284 | Ga0496126_0000115 | |||
| 2285 | Ga0496126_0000258 | |||
| 2286 | Ga0496126_0061541 | |||
| 2287 | Ga0496126_0125055 | |||
| 2288 | Ga0496126_0266582 | |||
| 2289 | Ga0496126_0281803 | |||
| 2290 | Ga0496126_0447962 | |||
| 2291 | Ga0496126_0519990 | |||
| 2292 | Ga0495678_051307 | |||
| 2293 | Ga0501300_002486 | |||
| 2294 | Ga0501031_0000009 | |||
| 2295 | Ga0501031_0038311 | |||
| 2296 | Ga0501031_0081844 | |||
| 2297 | Ga0501031_0109836 | |||
| 2298 | Ga0501031_0153985 | |||
| 2299 | Ga0501031_0160215 | |||
| 2300 | Ga0501032_0000001 | |||
| 2301 | Ga0501032_0000017 | |||
| 2302 | Ga0501032_0004117 | |||
| 2303 | Ga0501032_0161419 | |||
| 2304 | Ga0501032_0164065 | |||
| 2305 | Ga0501032_0188048 | |||
| 2306 | Ga0501032_0209990 | |||
| 2307 | Ga0501033_0000029 | |||
| 2308 | Ga0501033_0000741 | |||
| 2309 | Ga0501033_0000898 | |||
| 2310 | Ga0501033_0001913 | |||
| 2311 | Ga0501033_0015463 | |||
| 2312 | Ga0501033_0020825 | |||
| 2313 | Ga0501033_0041445 | |||
| 2314 | Ga0501033_0048357 | |||
| 2315 | Ga0501033_0142767 | |||
| 2316 | Ga0501033_0340796 | |||
| 2317 | Ga0501034_0000102 | |||
| 2318 | Ga0501034_0006657 | |||
| 2319 | Ga0501034_0008076 | |||
| 2320 | Ga0501034_0008287 | |||
| 2321 | Ga0501034_0048481 | |||
| 2322 | Ga0501034_0101447 | |||
| 2323 | Ga0501034_0116412 | |||
| 2324 | Ga0501034_0154163 | |||
| 2325 | Ga0501034_0379969 | |||
| 2326 | Ga0501036_0000011 | |||
| 2327 | Ga0501036_0000804 | |||
| 2328 | Ga0501036_0297214 | |||
| 2329 | Ga0501037_0000015 | |||
| 2330 | Ga0501037_0000089 | |||
| 2331 | Ga0501037_0000091 | |||
| 2332 | Ga0501037_0060985 | |||
| 2333 | Ga0501037_0125928 | |||
| 2334 | Ga0501038_0000016 | |||
| 2335 | Ga0501038_0000402 | |||
| 2336 | Ga0501038_0229756 | |||
| 2337 | Ga0501039_0000022 | |||
| 2338 | Ga0501039_0000023 | |||
| 2339 | Ga0501039_0045660 | |||
| 2340 | Ga0501040_0029026 | |||
| 2341 | Ga0501040_0494081 | |||
| 2342 | Ga0501042_0026781 | |||
| 2343 | Ga0501043_0000007 | |||
| 2344 | Ga0501043_0000093 | |||
| 2345 | Ga0501043_0000372 | |||
| 2346 | Ga0501043_0064351 | |||
| 2347 | Ga0501043_0092471 | |||
| 2348 | Ga0501046_0012425 | |||
| 2349 | Ga0501046_0087767 | |||
| 2350 | Ga0501046_0148875 | |||
| 2351 | Ga0501047_0001169 | |||
| 2352 | Ga0501047_0092127 | |||
| 2353 | Ga0501047_0214148 | |||
| 2354 | Ga0501048_0146250 | |||
| 2355 | Ga0501048_0460991 | |||
| 2356 | Ga0501067_0152752 | |||
| 2357 | Ga0501068_0006869 | |||
| 2358 | Ga0501068_0114354 | |||
| 2359 | Ga0501068_0211120 | |||
| 2360 | Ga0501069_0000001 | |||
| 2361 | Ga0501069_0038095 | |||
| 2362 | Ga0501069_0095787 | |||
| 2363 | Ga0501070_0000071 | |||
| 2364 | Ga0501070_0000771 | |||
| 2365 | Ga0501070_0001656 | |||
| 2366 | Ga0501070_0017382 | |||
| 2367 | Ga0501070_0055100 | |||
| 2368 | Ga0501070_0089623 | |||
| 2369 | Ga0501070_0144438 | |||
| 2370 | Ga0501070_0183253 | |||
| 2371 | Ga0501070_0409529 | |||
| 2372 | Ga0501071_0004826 | |||
| 2373 | Ga0501073_0003390 | |||
| 2374 | Ga0501074_0000003 | |||
| 2375 | Ga0501074_0092052 | |||
| 2376 | Ga0501074_0120102 | |||
| 2377 | Ga0501080_0000090 | |||
| 2378 | Ga0501080_0037802 | |||
| 2379 | Ga0501080_0243365 | |||
| 2380 | Ga0501083_0000012 | |||
| 2381 | Ga0501035_0000037 | |||
| 2382 | Ga0501035_0000038 | |||
| 2383 | Ga0501035_0000336 | |||
| 2384 | Ga0501035_0000646 | |||
| 2385 | Ga0501035_0002118 | |||
| 2386 | Ga0501035_0003768 | |||
| 2387 | Ga0501035_0056753 | |||
| 2388 | Ga0501035_0106057 | |||
| 2389 | Ga0501035_0144586 | |||
| 2390 | Ga0501035_0473060 | |||
| 2391 | Ga0501044_0000018 | |||
| 2392 | Ga0501044_0000046 | |||
| 2393 | Ga0501044_0004660 | |||
| 2394 | Ga0501044_0070887 | |||
| 2395 | Ga0501044_0080832 | |||
| 2396 | Ga0501044_0116263 | |||
| 2397 | Ga0501044_0155940 | |||
| 2398 | Ga0501044_0375518 | |||
| 2399 | Ga0501044_0557299 | |||
| 2400 | Ga0501044_0642147 | |||
| 2401 | Ga0501045_0073807 | |||
| 2402 | nmdc:mga03683_2458_c1 | |||
| 2403 | nmdc:mga03n38_17445_c1 | |||
| 2404 | nmdc:mga03n38_71079_c1 | |||
| 2405 | nmdc:mga00v17_125199_c1 | |||
| 2406 | nmdc:mga00v17_134185_c1 | |||
| 2407 | nmdc:mga00v17_15_c1 | |||
| 2408 | nmdc:mga00v17_324172_c1 | |||
| 2409 | nmdc:mga00v17_431_c1 | |||
| 2410 | nmdc:mga00v17_75770_c1 | |||
| 2411 | nmdc:mga00v17_81892_c1 | |||
| 2412 | nmdc:mga0yw44_119249_c1 | |||
| 2413 | nmdc:mga0yw44_1587_c2 | |||
| 2414 | nmdc:mga0yw44_1628_c1 | |||
| 2415 | nmdc:mga0yw44_164075_c1 | |||
| 2416 | nmdc:mga0yw44_180042_c1 | |||
| 2417 | nmdc:mga0yw44_240508_c1 | |||
| 2418 | nmdc:mga0yw44_25626_c2 | |||
| 2419 | nmdc:mga0yw44_29246_c1 | |||
| 2420 | nmdc:mga0yw44_86646_c1 | |||
| 2421 | nmdc:mga0k408_157793_c1 | |||
| 2422 | nmdc:mga0k408_3676_c1 | |||
| 2423 | nmdc:mga06z11_104916_c1 | |||
| 2424 | nmdc:mga06z11_114220_c1 | |||
| 2425 | nmdc:mga06z11_2118_c1 | |||
| 2426 | nmdc:mga06z11_28056_c1 | |||
| 2427 | nmdc:mga06z11_332165_c1 | |||
| 2428 | nmdc:mga06z11_5062_c1 | |||
| 2429 | nmdc:mga04h51_39041_c1 | |||
| 2430 | nmdc:mga04h51_6294_c1 | |||
| 2431 | nmdc:mga07m45_10477_c1 | |||
| 2432 | nmdc:mga07m45_374873_c1 | |||
| 2433 | nmdc:mga0sz30_13711_c1 | |||
| 2434 | nmdc:mga0sz30_2924_c1 | |||
| 2435 | nmdc:mga0sz30_55500_c1 | |||
| 2436 | Ga0500610_0011546 | |||
| 2437 | Ga0500578_0019247 | |||
| 2438 | Ga0500578_0050156 | |||
| 2439 | Ga0500643_000411 | |||
| 2440 | Ga0500643_004409 | |||
| 2441 | Ga0500643_004901 | |||
| 2442 | Ga0500643_012816 | |||
| 2443 | Ga0500643_023987 | |||
| 2444 | Ga0500646_0006695 | |||
| 2445 | Ga0500646_0046538 | |||
| 2446 | Ga0500651_0011997 | |||
| 2447 | Ga0500555_005686 | |||
| 2448 | Ga0500555_008223 | |||
| 2449 | Ga0500556_0009403 | |||
| 2450 | Ga0500556_0014812 | |||
| 2451 | Ga0500556_0100341 | |||
| 2452 | Ga0500557_000398 | |||
| 2453 | Ga0500560_001605 | |||
| 2454 | Ga0500560_018919 | |||
| 2455 | Ga0500562_000876 | |||
| 2456 | Ga0500562_048507 | |||
| 2457 | Ga0500569_011445 | |||
| 2458 | Ga0500594_0003502 | |||
| 2459 | Ga0500618_000513 | |||
| 2460 | Ga0500618_001619 | |||
| 2461 | Ga0500618_002829 | |||
| 2462 | Ga0500618_008883 | |||
| 2463 | Ga0500618_023169 | |||
| 2464 | Ga0500621_007448 | |||
| 2465 | Ga0500621_081022 | |||
| 2466 | Ga0500652_117154 | |||
| 2467 | Ga0500655_000376 | |||
| 2468 | Ga0500655_001263 | |||
| 2469 | Ga0500655_024401 | |||
| 2470 | Ga0500658_0001925 | |||
| 2471 | Ga0500559_0074872 | |||
| 2472 | Ga0500561_0000122 | |||
| 2473 | Ga0500568_0000010 | |||
| 2474 | Ga0500568_0000247 | |||
| 2475 | Ga0500568_0001724 | |||
| 2476 | Ga0500568_0017640 | |||
| 2477 | Ga0500568_0022137 | |||
| 2478 | Ga0500568_0096891 | |||
| 2479 | Ga0500573_0002132 | |||
| 2480 | Ga0500573_0002450 | |||
| 2481 | Ga0500590_000271 | |||
| 2482 | Ga0500604_0002160 | |||
| 2483 | Ga0500604_0003631 | |||
| 2484 | Ga0500604_0068900 | |||
| 2485 | Ga0500616_0000448 | |||
| 2486 | Ga0500616_0001820 | |||
| 2487 | Ga0500616_0007147 | |||
| 2488 | Ga0500616_0010751 | |||
| 2489 | Ga0500616_0172516 | |||
| 2490 | Ga0500620_000306 | |||
| 2491 | Ga0500622_0000169 | |||
| 2492 | Ga0500622_0000441 | |||
| 2493 | Ga0500622_0003398 | |||
| 2494 | Ga0500627_0001834 | |||
| 2495 | Ga0500627_0002598 | |||
| 2496 | Ga0500627_0018943 | |||
| 2497 | Ga0500627_0128084 | |||
| 2498 | Ga0500627_0163919 | |||
| 2499 | Ga0500633_0000081 | |||
| 2500 | Ga0500633_0099159 | |||
| 2501 | Ga0500634_0000956 | |||
| 2502 | Ga0500634_0001545 | |||
| 2503 | Ga0500636_0000030 | |||
| 2504 | Ga0500636_0002620 | |||
| 2505 | Ga0500645_003289 | |||
| 2506 | Ga0500645_004116 | |||
| 2507 | Ga0500645_004791 | |||
| 2508 | Ga0500645_017926 | |||
| 2509 | Ga0500645_018238 | |||
| 2510 | Ga0587067_014834 | |||
| 2511 | Ga0587072_005168 | |||
| 2512 | Ga0501082_0270955 | |||
| 2513 | 2937852746 | |||
| 2514 | 2503198912 | |||
| 2515 | 2509117935 | |||
| 2516 | 2509143087 | |||
| 2517 | 2509371521 | |||
| 2518 | 2509377991 | |||
| 2519 | 2509389234 | |||
| 2520 | 2509393785 | |||
| 2521 | 2509444797 | |||
| 2522 | 2510135421 | |||
| 2523 | 2510305822 | |||
| 2524 | 2510318462 | |||
| 2525 | 2510839189 | |||
| 2526 | 2510896880 | |||
| 2527 | 2511135845 | |||
| 2528 | 2511168427 | |||
| 2529 | 2511185227 | |||
| 2530 | 2511199354 | |||
| 2531 | 2511391875 | |||
| 2532 | 2511498588 | |||
| 2533 | 2512534737 | |||
| 2534 | 2512933695 | |||
| 2535 | 2512961846 | |||
| 2536 | 2512973451 | |||
| 2537 | 2513572880 | |||
| 2538 | 2513580413 | |||
| 2539 | 2513586364 | |||
| 2540 | 2513597848 | |||
| 2541 | 2513602032 | |||
| 2542 | 2513613811 | |||
| 2543 | 2513615821 | |||
| 2544 | 2513634915 | |||
| 2545 | 2513711524 | |||
| 2546 | 2513865127 | |||
| 2547 | 2513885387 | |||
| 2548 | 2513904656 | |||
| 2549 | 2513912903 | |||
| 2550 | 2513929496 | |||
| 2551 | 2513983486 | |||
| 2552 | 2514001719 | |||
| 2553 | 2514003369 | |||
| 2554 | 2514023182 | |||
| 2555 | 2514035473 | |||
| 2556 | 2514421928 | |||
| 2557 | 2514586563 | |||
| 2558 | 2515114593 | |||
| 2559 | 2515612432 | |||
| 2560 | 2515634987 | |||
| 2561 | 2515644449 | |||
| 2562 | 2515660974 | |||
| 2563 | 2515741776 | |||
| 2564 | 2516205696 | |||
| 2565 | 2516894865 | |||
| 2566 | 2517038236 | |||
| 2567 | 2517078514 | |||
| 2568 | 2517097253 | |||
| 2569 | 2517408358 | |||
| 2570 | 2517571546 | |||
| 2571 | 2520379796 | |||
| 2572 | 2524450318 | |||
| 2573 | 2524461185 | |||
| 2574 | 2530647181 | |||
| 2575 | 2535485501 | |||
| 2576 | 2537874460 | |||
| 2577 | 2551678469 | |||
| 2578 | 2551685174 | |||
| 2579 | 2551694002 | |||
| 2580 | 2551704510 | |||
| 2581 | 2551710798 | |||
| 2582 | 2551717206 | |||
| 2583 | 2551718204 | |||
| 2584 | 2551720985 | |||
| 2585 | 2551724596 | |||
| 2586 | 2551734490 | |||
| 2587 | 2551740723 | |||
| 2588 | 2554248990 | |||
| 2589 | 2558867507 | |||
| 2590 | 2559296078 | |||
| 2591 | 2561468551 | |||
| 2592 | 2585166504 | |||
| 2593 | 2585201550 | |||
| 2594 | 2585224109 | |||
| 2595 | 2585231871 | |||
| 2596 | 2585257173 | |||
| 2597 | 2585267175 | |||
| 2598 | 2585272065 | |||
| 2599 | 2585279630 | |||
| 2600 | 2585327467 | |||
| 2601 | 2585333994 | |||
| 2602 | 2585388226 | |||
| 2603 | 2585399941 | |||
| 2604 | 2585529187 | |||
| 2605 | 2585535709 | |||
| 2606 | 2585543004 | |||
| 2607 | 2585549809 | |||
| 2608 | 2585551087 | |||
| 2609 | 2585563390 | |||
| 2610 | 2585821030 | |||
| 2611 | 2585839227 | |||
| 2612 | 2585845063 | |||
| 2613 | 2585897189 | |||
| 2614 | 2585909103 | |||
| 2615 | 2585998077 | |||
| 2616 | 2586002656 | |||
| 2617 | 2587984517 | |||
| 2618 | 2588519776 | |||
| 2619 | 2597810842 | |||
| 2620 | 2599335749 | |||
| 2621 | 2599419962 | |||
| 2622 | 2599603129 | |||
| 2623 | 2599722638 | |||
| 2624 | 2599938835 | |||
| 2625 | 2600193975 | |||
| 2626 | 2600377442 | |||
| 2627 | 2601610966 | |||
| 2628 | 2601747740 | |||
| 2629 | 2616297547 | |||
| 2630 | 2616306417 | |||
| 2631 | 2616551095 | |||
| 2632 | 2617382326 | |||
| 2633 | 2643771707 | |||
| 2634 | 2643777315 | |||
| 2635 | 2643795763 | |||
| 2636 | 2643807939 | |||
| 2637 | 2643814887 | |||
| 2638 | 2643838023 | |||
| 2639 | 2643854822 | |||
| 2640 | 2643921602 | |||
| 2641 | 2643985964 | |||
| 2642 | 2644002645 | |||
| 2643 | 2644052442 | |||
| 2644 | 2644068870 | |||
| 2645 | 2644133943 | |||
| 2646 | 2644146355 | |||
| 2647 | 2644154451 | |||
| 2648 | 2644194648 | |||
| 2649 | 2644201175 | |||
| 2650 | 2644209666 | |||
| 2651 | 2644240313 | |||
| 2652 | 2644299688 | |||
| 2653 | 2644310374 | |||
| 2654 | 2644334841 | |||
| 2655 | 2644378404 | |||
| 2656 | 2644419941 | |||
| 2657 | 2644453297 | |||
| 2658 | 2644484720 | |||
| 2659 | 2644492557 | |||
| 2660 | 2644501240 | |||
| 2661 | 2644521656 | |||
| 2662 | 2644544965 | |||
| 2663 | 2644615385 | |||
| 2664 | 2644653194 | |||
| 2665 | 2644657916 | |||
| 2666 | 2644675096 | |||
| 2667 | 2644688676 | |||
| 2668 | 2657682310 | |||
| 2669 | 2671116026 | |||
| 2670 | 2688596186 | |||
| 2671 | 2692319837 | |||
| 2672 | 2694627682 | |||
| 2673 | 2694636793 | |||
| 2674 | 2719183132 | |||
| 2675 | 2719387852 | |||
| 2676 | 2719667472 | |||
| 2677 | 2719733849 | |||
| 2678 | 2720493892 | |||
| 2679 | 2720615353 | |||
| 2680 | 2720622141 | |||
| 2681 | 2720633495 | |||
| 2682 | 2720777193 | |||
| 2683 | 2721149244 | |||
| 2684 | 2721160646 | |||
| 2685 | 2721166057 | |||
| 2686 | 2721401485 | |||
| 2687 | 2722842227 | |||
| 2688 | 2723028791 | |||
| 2689 | 2723562404 | |||
| 2690 | 2723569100 | |||
| 2691 | 2723573322 | |||
| 2692 | 2724040299 | |||
| 2693 | 2724046605 | |||
| 2694 | 2724091800 | |||
| 2695 | 2724106365 | |||
| 2696 | 2724112172 | |||
| 2697 | 2725945783 | |||
| 2698 | 2730109727 | |||
| 2699 | 2730166367 | |||
| 2700 | 2730300278 | |||
| 2701 | 2738801022 | |||
| 2702 | 2738947099 | |||
| 2703 | 2739037700 | |||
| 2704 | 2739310265 | |||
| 2705 | 2753360490 | |||
| 2706 | 2753458478 | |||
| 2707 | 2756673580 | |||
| 2708 | 2757570405 | |||
| 2709 | 2758642930 | |||
| 2710 | 2765465763 | |||
| 2711 | 2766064082 | |||
| 2712 | 2770199121 | |||
| 2713 | 2776269525 | |||
| 2714 | 2776282456 | |||
| 2715 | 2776915661 | |||
| 2716 | 2778179219 | |||
| 2717 | 2792582340 | |||
| 2718 | 2792621806 | |||
| 2719 | 2792628937 | |||
| 2720 | 2792640077 | |||
| 2721 | 2792747393 | |||
| 2722 | 2793281833 | |||
| 2723 | 2793295461 | |||
| 2724 | 2793317959 | |||
| 2725 | 2793324565 | |||
| 2726 | 2793329608 | |||
| 2727 | 2793332404 | |||
| 2728 | 2793338998 | |||
| 2729 | 2793346768 | |||
| 2730 | 2793356784 | |||
| 2731 | 2793359204 | |||
| 2732 | 2793366072 | |||
| 2733 | 2802717088 | |||
| 2734 | 2802724924 | |||
| 2735 | 2802729674 | |||
| 2736 | 2802737020 | |||
| 2737 | 2802743425 | |||
| 2738 | 2802749449 | |||
| 2739 | 2804753796 | |||
| 2740 | 2805930911 | |||
| 2741 | 2805936760 | |||
| 2742 | 2806047756 | |||
| 2743 | 2806055332 | |||
| 2744 | 2806062213 | |||
| 2745 | 2806070028 | |||
| 2746 | 2806076672 | |||
| 2747 | 2808988096 | |||
| 2748 | 2819244464 | |||
| 2749 | 2819561088 | |||
| 2750 | 2819611975 | |||
| 2751 | 2819638485 | |||
| 2752 | 2819688363 | |||
| 2753 | 2821129207 | |||
| 2754 | 2837651386 | |||
| 2755 | 2838018154 | |||
| 2756 | 2838023835 | |||
| 2757 | 2838042012 | |||
| 2758 | 2838046758 | |||
| 2759 | 2838050987 | |||
| 2760 | 2838062753 | |||
| 2761 | 2838072298 | |||
| 2762 | 2838078061 | |||
| 2763 | 2838668137 | |||
| 2764 | 2838674231 | |||
| 2765 | 2838678541 | |||
| 2766 | 2838683707 | |||
| 2767 | 2838693347 | |||
| 2768 | 2838698235 | |||
| 2769 | 2838706634 | |||
| 2770 | 2838711350 | |||
| 2771 | 2838718371 | |||
| 2772 | 2838722837 | |||
| 2773 | 2838728437 | |||
| 2774 | 2838735341 | |||
| 2775 | 2838742224 | |||
| 2776 | 2838748110 | |||
| 2777 | 2839993405 | |||
| 2778 | 2840766415 | |||
| 2779 | 2841736578 | |||
| 2780 | 2841846080 | |||
| 2781 | 2841850393 | |||
| 2782 | 2841857413 | |||
| 2783 | 2841863354 | |||
| 2784 | 2841867583 | |||
| 2785 | 2842081151 | |||
| 2786 | 2842116598 | |||
| 2787 | 2842122072 | |||
| 2788 | 2842129097 | |||
| 2789 | 2842133434 | |||
| 2790 | 2842145784 | |||
| 2791 | 2842148963 | |||
| 2792 | 2842155655 | |||
| 2793 | 2842162412 | |||
| 2794 | 2842166887 | |||
| 2795 | 2842174387 | |||
| 2796 | 2842179048 | |||
| 2797 | 2842186052 | |||
| 2798 | 2842190795 | |||
| 2799 | 2842194716 | |||
| 2800 | 2842201189 | |||
| 2801 | 2842207585 | |||
| 2802 | 2842214881 | |||
| 2803 | 2842221959 | |||
| 2804 | 2842227602 | |||
| 2805 | 2842235511 | |||
| 2806 | 2842241086 | |||
| 2807 | 2842249206 | |||
| 2808 | 2842256425 | |||
| 2809 | 2842263161 | |||
| 2810 | 2842269274 | |||
| 2811 | 2842277815 | |||
| 2812 | 2842280704 | |||
| 2813 | 2842290350 | |||
| 2814 | 2842294808 | |||
| 2815 | 2842302629 | |||
| 2816 | 2842305642 | |||
| 2817 | 2842311590 | |||
| 2818 | 2842323650 | |||
| 2819 | 2842346872 | |||
| 2820 | 2842358869 | |||
| 2821 | 2842366097 | |||
| 2822 | 2842375174 | |||
| 2823 | 2842381207 | |||
| 2824 | 2842388277 | |||
| 2825 | 2842395766 | |||
| 2826 | 2842408184 | |||
| 2827 | 2842414946 | |||
| 2828 | 2842421545 | |||
| 2829 | 2842425930 | |||
| 2830 | 2842433442 | |||
| 2831 | 2842439503 | |||
| 2832 | 2842446189 | |||
| 2833 | 2842448572 | |||
| 2834 | 2842467691 | |||
| 2835 | 2842474345 | |||
| 2836 | 2842485283 | |||
| 2837 | 2842491342 | |||
| 2838 | 2842501923 | |||
| 2839 | 2842514690 | |||
| 2840 | 2842519909 | |||
| 2841 | 2842527058 | |||
| 2842 | 2842874027 | |||
| 2843 | 2842926463 | |||
| 2844 | 2844003250 | |||
| 2845 | 2844010992 | |||
| 2846 | 2844456804 | |||
| 2847 | 2847420939 | |||
| 2848 | 2847673604 | |||
| 2849 | 2847690119 | |||
| 2850 | 2848995770 | |||
| 2851 | 2850082753 | |||
| 2852 | 2852392106 | |||
| 2853 | 2854897791 | |||
| 2854 | 2854913701 | |||
| 2855 | 2854922315 | |||
| 2856 | 2855873634 | |||
| 2857 | 2856318927 | |||
| 2858 | 2856324040 | |||
| 2859 | 2856329468 | |||
| 2860 | 2856339771 | |||
| 2861 | 2856348127 | |||
| 2862 | 2856353026 | |||
| 2863 | 2856362155 | |||
| 2864 | 2856367360 | |||
| 2865 | 2857353127 | |||
| 2866 | 2857374291 | |||
| 2867 | 2857519762 | |||
| 2868 | 2857536148 | |||
| 2869 | 2858803552 | |||
| 2870 | 2869168661 | |||
| 2871 | 2869171414 | |||
| 2872 | 2869240172 | |||
| 2873 | 2869244963 | |||
| 2874 | 2869254016 | |||
| 2875 | 2869258141 | |||
| 2876 | 2869269843 | |||
| 2877 | 2869275280 | |||
| 2878 | 2869283076 | |||
| 2879 | 2869288501 | |||
| 2880 | 2871431168 | |||
| 2881 | 2871436374 | |||
| 2882 | 2871449143 | |||
| 2883 | 2871453819 | |||
| 2884 | 2871464749 | |||
| 2885 | 2871473496 | |||
| 2886 | 2871478564 | |||
| 2887 | 2871484729 | |||
| 2888 | 2871491598 | |||
| 2889 | 2871498846 | |||
| 2890 | 2874102408 | |||
| 2891 | 2874114024 | |||
| 2892 | 2874126322 | |||
| 2893 | 2874135323 | |||
| 2894 | 2874142735 | |||
| 2895 | 2874150542 | |||
| 2896 | 2874158283 | |||
| 2897 | 2874163700 | |||
| 2898 | 2874170561 | |||
| 2899 | 2876364050 | |||
| 2900 | 2876369827 | |||
| 2901 | 2876383172 | |||
| 2902 | 2876387545 | |||
| 2903 | 2876399085 | |||
| 2904 | 2876401087 | |||
| 2905 | 2876407358 | |||
| 2906 | 2876416591 | |||
| 2907 | 2876423745 | |||
| 2908 | 2878039271 | |||
| 2909 | 2878738633 | |||
| 2910 | 2878739838 | |||
| 2911 | 2878747772 | |||
| 2912 | 2878754786 | |||
| 2913 | 2878763064 | |||
| 2914 | 2878770034 | |||
| 2915 | 2878780017 | |||
| 2916 | 2878782034 | |||
| 2917 | 2878789208 | |||
| 2918 | 2881148398 | |||
| 2919 | 2881159464 | |||
| 2920 | 2881165183 | |||
| 2921 | 2881846521 | |||
| 2922 | 2881861059 | |||
| 2923 | 2881862045 | |||
| 2924 | 2882635209 | |||
| 2925 | 2882915865 | |||
| 2926 | 2885307060 | |||
| 2927 | 2885313940 | |||
| 2928 | 2885325714 | |||
| 2929 | 2885328662 | |||
| 2930 | 2885339030 | |||
| 2931 | 2885347089 | |||
| 2932 | 2885353594 | |||
| 2933 | 2888343571 | |||
| 2934 | 2888344552 | |||
| 2935 | 2888353401 | |||
| 2936 | 2889015117 | |||
| 2937 | 2889019805 | |||
| 2938 | 2889795797 | |||
| 2939 | 2889916367 | |||
| 2940 | 2891048624 | |||
| 2941 | 2891377791 | |||
| 2942 | 2894653722 | |||
| 2943 | 2894821001 | |||
| 2944 | 2896390087 | |||
| 2945 | 2899794818 | |||
| 2946 | 2899805007 | |||
| 2947 | 2899849429 | |||
| 2948 | 2903453850 | |||
| 2949 | 2903500319 | |||
| 2950 | 2903502253 | |||
| 2951 | 2903519002 | |||
| 2952 | 2903525790 | |||
| 2953 | 2903532663 | |||
| 2954 | 2903543648 | |||
| 2955 | 2904579945 | |||
| 2956 | 2904665612 | |||
| 2957 | 2906310945 | |||
| 2958 | 2906323056 | |||
| 2959 | 2906334022 | |||
| 2960 | 2906370169 | |||
| 2961 | 2906377833 | |||
| 2962 | 2906379157 | |||
| 2963 | 2906386854 | |||
| 2964 | 2906395778 | |||
| 2965 | 2906402987 | |||
| 2966 | 2906408962 | |||
| 2967 | 2906418998 | |||
| 2968 | 2913300286 | |||
| 2969 | 2913312072 | |||
| 2970 | 2915650587 | |||
| 2971 | 2915981713 | |||
| 2972 | 2916004475 | |||
| 2973 | 2916019865 | |||
| 2974 | 2916023931 | |||
| 2975 | 2916031856 | |||
| 2976 | 2916043430 | |||
| 2977 | 2916050645 | |||
| 2978 | 2916058691 | |||
| 2979 | 2916066484 | |||
| 2980 | 2916076084 | |||
| 2981 | 2916082573 | |||
| 2982 | 2919107945 | |||
| 2983 | 2919118372 | |||
| 2984 | 2919120383 | |||
| 2985 | 2919170458 | |||
| 2986 | 2919176883 | |||
| 2987 | 2919411456 | |||
| 2988 | 2921205068 | |||
| 2989 | 2921240356 | |||
| 2990 | 2921252802 | |||
| 2991 | 2921260441 | |||
| 2992 | 2921267525 | |||
| 2993 | 2921293980 | |||
| 2994 | 2921302300 | |||
| 2995 | 2922136481 | |||
| 2996 | 2922153547 | |||
| 2997 | 2922162618 | |||
| 2998 | 2922173234 | |||
| 2999 | 2922185038 | |||
| 3000 | 2922193166 | |||
| 3001 | 2923559970 | |||
| 3002 | 2924157660 | |||
| 3003 | 2924168526 | |||
| 3004 | 2924175798 | |||
| 3005 | 2924183467 | |||
| 3006 | 2924190214 | |||
| 3007 | 2924214890 | |||
| 3008 | 2924227133 | |||
| 3009 | 2924710428 | |||
| 3010 | 2924719012 | |||
| 3011 | 2924728177 | |||
| 3012 | 2924740527 | |||
| 3013 | 2924746616 | |||
| 3014 | 2924754032 | |||
| 3015 | 2924762013 | |||
| 3016 | 2924767528 | |||
| 3017 | 2924778767 | |||
| 3018 | 2924791006 | |||
| 3019 | 2926754901 | |||
| 3020 | 2926762066 | |||
| 3021 | 2928522712 | |||
| 3022 | 2929142002 | |||
| 3023 | 2933010499 | |||
| 3024 | 2933015829 | |||
| 3025 | 2933017814 | |||
| 3026 | 2933572149 | |||
| 3027 | 2933592796 | |||
| 3028 | 2933597433 | |||
| 3029 | 2933602850 | |||
| 3030 | 2935898112 | |||
| 3031 | 2935903446 | |||
| 3032 | 2936370080 | |||
| 3033 | 2936379256 | |||
| 3034 | 2936381767 | |||
| 3035 | 2936997436 | |||
| 3036 | 2937004100 | |||
| 3037 | 2937010363 | |||
| 3038 | 2937020645 | |||
| 3039 | 2937023176 | |||
| 3040 | 2937031725 | |||
| 3041 | 2937037792 | |||
| 3042 | 2937043156 | |||
| 3043 | 2937055206 | |||
| 3044 | 2937059373 | |||
| 3045 | 2937070499 | |||
| 3046 | 2937076117 | |||
| 3047 | 2937081490 | |||
| 3048 | 2937090878 | |||
| 3049 | 2937093346 | |||
| 3050 | 2937104327 | |||
| 3051 | 2937113244 | |||
| 3052 | 2937114244 | |||
| 3053 | 2937120242 | |||
| 3054 | 2937129777 | |||
| 3055 | 2937815538 | |||
| 3056 | 2937823429 | |||
| 3057 | 2937838839 | |||
| 3058 | 2937843747 | |||
| 3059 | 2937865395 | |||
| 3060 | 2937874628 | |||
| 3061 | 2937880413 | |||
| 3062 | 2937898369 | |||
| 3063 | 2937976135 | |||
| 3064 | 2937983973 | |||
| 3065 | 2937997494 | |||
| 3066 | 2938017198 | |||
| 3067 | 2954013906 | |||
| 3068 | 2957376792 | |||
| 3069 | 2957384921 | |||
| 3070 | 2957395196 | |||
| 3071 | 2957399709 | |||
| 3072 | 2957405547 | |||
| 3073 | 2957411712 | |||
| 3074 | 2957417469 | |||
| 3075 | 2957422366 | |||
| 3076 | 2957430080 | |||
| 3077 | 2957441670 | |||
| 3078 | 2957447639 | |||
| 3079 | 2957454677 | |||
| 3080 | 2957461000 | |||
| 3081 | 2957466507 | |||
| 3082 | 2957475393 | |||
| 3083 | 2957481451 | |||
| 3084 | 2957489083 | |||
| 3085 | 2957494433 | |||
| 3086 | 2957505172 | |||
| 3087 | 2957508268 | |||
| 3088 | 2958039060 | |||
| 3089 | 2958049832 | |||
| 3090 | 2958052131 | |||
| 3091 | 2958070965 | |||
| 3092 | 2958072356 | |||
| 3093 | 2958087548 | |||
| 3094 | 2958095834 | |||
| 3095 | 2958102905 | |||
| 3096 | 2958111538 | |||
| 3097 | 2958120290 | |||
| 3098 | 2958123358 | |||
| 3099 | 2958132903 | |||
| 3100 | 2958139055 | |||
| 3101 | 2958150778 | |||
| 3102 | 2958163970 | |||
| 3103 | 2958167968 | |||
| 3104 | 2958176816 | |||
| 3105 | 2958182605 | |||
| 3106 | 2960589445 | |||
| 3107 | 2960592800 | |||
| 3108 | 2960597897 | |||
| 3109 | 2960607489 | |||
| 3110 | 2960613677 | |||
| 3111 | 2960619091 | |||
| 3112 | 2960629062 | |||
| 3113 | 2960634197 | |||
| 3114 | 2960643583 | |||
| 3115 | 2960650706 | |||
| 3116 | 2960659188 | |||
| 3117 | 2960663980 | |||
| 3118 | 2960673289 | |||
| 3119 | 2960674882 | |||
| 3120 | 2960681725 | |||
| 3121 | 2960689335 | |||
| 3122 | 2960700651 | |||
| 3123 | 2961080453 | |||
| 3124 | 2961120955 | |||
| 3125 | 2961131363 | |||
| 3126 | 2961138877 | |||
| 3127 | 2961166436 | |||
| 3128 | 2961171977 | |||
| 3129 | 2961185631 | |||
| 3130 | 2963645508 | |||
| 3131 | 2964608225 | |||
| 3132 | 2964621669 | |||
| 3133 | 2964625831 | |||
| 3134 | 2964629534 | |||
| 3135 | 2964639223 | |||
| 3136 | 2964643608 | |||
| 3137 | 2964655212 | |||
| 3138 | 2964659979 | |||
| 3139 | 2964669400 | |||
| 3140 | 2964676866 | |||
| 3141 | 2964681679 | |||
| 3142 | 2964687453 | |||
| 3143 | 2964695142 | |||
| 3144 | 2964699160 | |||
| 3145 | 2964711203 | |||
| 3146 | 2964712659 | |||
| 3147 | 2964719780 | |||
| 3148 | 2965021255 | |||
| 3149 | 2965026778 | |||
| 3150 | 2965039474 | |||
| 3151 | 2965047368 | |||
| 3152 | 2965054621 | |||
| 3153 | 2965065238 | |||
| 3154 | 2965096248 | |||
| 3155 | 2965107381 | |||
| 3156 | 2965124382 | |||
| 3157 | 2967668258 | |||
| 3158 | 2967675607 | |||
| 3159 | 2967681248 | |||
| 3160 | 2967692427 | |||
| 3161 | 2967699399 | |||
| 3162 | 2967704813 | |||
| 3163 | 2967713799 | |||
| 3164 | 2967721196 | |||
| 3165 | 2967724962 | |||
| 3166 | 2967731832 | |||
| 3167 | 2967738463 | |||
| 3168 | 2967745460 | |||
| 3169 | 2967752616 | |||
| 3170 | 2967757747 | |||
| 3171 | 2967765796 | |||
| 3172 | 2967770346 | |||
| 3173 | 2967780515 | |||
| 3174 | 2967997449 | |||
| 3175 | 2968006451 | |||
| 3176 | 2968017435 | |||
| 3177 | 2968085160 | |||
| 3178 | 2968093401 | |||
| 3179 | 2968098169 | |||
| 3180 | 2968117105 | |||
| 3181 | 2968122467 | |||
| 3182 | 2968129525 | |||
| 3183 | 2968142347 | |||
| 3184 | 2968174837 | |||
| 3185 | 2970021989 | |||
| 3186 | 2970028678 | |||
| 3187 | 2970038983 | |||
| 3188 | 2970046599 | |||
| 3189 | 2970049624 | |||
| 3190 | 2970058836 | |||
| 3191 | 2970066760 | |||
| 3192 | 2970071174 | |||
| 3193 | 2970076718 | |||
| 3194 | 2970086749 | |||
| 3195 | 2970092743 | |||
| 3196 | 2970101171 | |||
| 3197 | 2970104611 | |||
| 3198 | 2970113927 | |||
| 3199 | 2970118374 | |||
| 3200 | 2970124506 | |||
| 3201 | 2970133522 | |||
| 3202 | 2970140893 | |||
| 3203 | 2970147335 | |||
| 3204 | 2970155841 | |||
| 3205 | 2970161184 | |||
| 3206 | 2970170755 | |||
| 3207 | 2970174088 | |||
| 3208 | 2970182118 | |||
| 3209 | 2970189139 | |||
| 3210 | 2970197913 | |||
| 3211 | 2970472481 | |||
| 3212 | 2970493600 | |||
| 3213 | 2970504574 | |||
| 3214 | 2970512238 | |||
| 3215 | 2970526273 | |||
| 3216 | 2970536260 | |||
| 3217 | 2970541099 | |||
| 3218 | 2970550873 | |||
| 3219 | 2970557919 | |||
| 3220 | 2970597695 | |||
| 3221 | 2970620720 | |||
| 3222 | 2970628819 | |||
| 3223 | 2977520208 | |||
| 3224 | 2977527397 | |||
| 3225 | 2977531200 | |||
| 3226 | 2977544470 | |||
| 3227 | 2977547149 | |||
| 3228 | 2977558012 | |||
| 3229 | 2977564723 | |||
| 3230 | 2977571312 | |||
| 3231 | 2977577246 | |||
| 3232 | 2977583343 | |||
| 3233 | 2977824003 | |||
| 3234 | 2977835288 | |||
| 3235 | 2977846697 | |||
| 3236 | 2977853268 | |||
| 3237 | 2977858922 | |||
| 3238 | 2977872207 | |||
| 3239 | 2977876766 | |||
| 3240 | 2977903478 | |||
| 3241 | 2977912327 | |||
| 3242 | 2977921128 | |||
| 3243 | 2977924715 | |||
| 3244 | 2977937985 | |||
| 3245 | 2977945409 | |||
| 3246 | 2977955392 | |||
| 3247 | 2977958292 | |||
| 3248 | 2977976125 | |||
| 3249 | 2977988948 | |||
| 3250 | 2978972746 | |||
| 3251 | 2979092665 | |||
| 3252 | 2979099944 | |||
| 3253 | 2979104637 | |||
| 3254 | 2979713116 | |||
| 3255 | 2979743086 | |||
| 3256 | 2979770001 | |||
| 3257 | 2979772494 | |||
| 3258 | 2979783247 | |||
| 3259 | 2979793090 | |||
| 3260 | 2979809212 | |||
| 3261 | 2984513566 | |||
| 3262 | 2984522854 | |||
| 3263 | 2984542161 | |||
| 3264 | 2984590998 | |||
| 3265 | 2984601590 | |||
| 3266 | 2987641719 | |||
| 3267 | 2987645930 | |||
| 3268 | 2987657627 | |||
| 3269 | 2987662444 | |||
| 3270 | 2987667156 | |||
| 3271 | 2987675787 | |||
| 3272 | 2989355074 | |||
| 3273 | 2989771759 | |||
| 3274 | 2989780251 | |||
| 3275 | 2995394308 | |||
| 3276 | 2996311632 | |||
| 3277 | 2996341622 | |||
| 3278 | 2996344890 | |||
| 3279 | 2996349887 | |||
| 3280 | 2996389057 | |||
| 3281 | 2996890459 | |||
| 3282 | 2996896209 | |||
| 3283 | 3000137577 | |||
| 3284 | 3002141746 | |||
| 3285 | 3003931142 | |||
| 3286 | 3004173506 | |||
| 3287 | 3004191495 | |||
| 3288 | 3004203125 | |||
| 3289 | 3004209469 | |||
| 3290 | 3004218506 | |||
| 3291 | 3004223648 | |||
| 3292 | 3004234223 | |||
| 3293 | 3004243043 | |||
| 3294 | 3004250753 | |||
| 3295 | 3004274395 | |||
| 3296 | 3004276589 | |||
| 3297 | 3004290168 | |||
| 3298 | 3004337044 | |||
| 3299 | 3005415962 | |||
| 3300 | 3005416886 | |||
| 3301 | 3005449846 | |||
| 3302 | 3005456137 | |||
| 3303 | 637076808 | |||
| 3304 | 639650613 | |||
| 3305 | 643827527 | |||
| 3306 | 648737308 | |||
| 3307 | 649870745 | |||
| 3308 | 650741294 | |||
| 3309 | 8002286344 | |||
| 3310 | 8003573644 | |||
| 3311 | 8003995455 | |||
| 3312 | 8004003214 | |||
| 3313 | 8004303054 | |||
| 3314 | 8004314547 | |||
| 3315 | 8004366000 | |||
| 3316 | 8004376368 | |||
| 3317 | 8004390470 | |||
| 3318 | 8004399919 | |||
| 3319 | 8004452083 | |||
| 3320 | 8004639891 | |||
| 3321 | 8004641891 | |||
| 3322 | 8004701373 | |||
| 3323 | 8004706555 | |||
| 3324 | 8004717162 | |||
| 3325 | 8004730193 | |||
| 3326 | 8005249412 | |||
| 3327 | 8005262646 | |||
| 3328 | 8005282610 | |||
| 3329 | 8005286575 | |||
| 3330 | 8005291987 | |||
| 3331 | 8005306126 | |||
| 3332 | 8005309700 | |||
| 3333 | 8005315910 | |||
| 3334 | 8005324986 | |||
| 3335 | 8005381390 | |||
| 3336 | 8005387600 | |||
| 3337 | 8005398436 | |||
| 3338 | 8005431963 | |||
| 3339 | 8005465288 | |||
| 3340 | 8005486997 | |||
| 3341 | 8005497866 | |||
| 3342 | 8005546871 | |||
| 3343 | 8005561353 | |||
| 3344 | 8005565975 | |||
| 3345 | 8005572024 | |||
| 3346 | 8005623600 | |||
| 3347 | 8005630839 | |||
| 3348 | 8005645194 | |||
| 3349 | 8005660964 | |||
| 3350 | 8005669272 | |||
| 3351 | 8005687360 | |||
| 3352 | 8005694177 | |||
| 3353 | 8005695823 | |||
| 3354 | 8018128668 | |||
| 3355 | 8018153105 | |||
| 3356 | 8018164910 | |||
| 3357 | 8018177650 | |||
| 3358 | 8023686731 | |||
| 3359 | 8024484550 | |||
| 3360 | 8024491014 | |||
| 3361 | 8024504023 | |||
| 3362 | 8046768370 | |||
| 3363 | 8049296397 | |||
| 3364 | 8054463886 | |||
| 3365 | 8054559973 | |||
| 3366 | 8055432957 | |||
| 3367 | 8055618130 | |||
| 3368 | 8056380584 | |||
| 3369 | 8056383356 | |||
| 3370 | 8056878361 | |||
| 3371 | 8057581961 | |||
| 3372 | 8057879469 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ihp-assembly1.cif.gz_A | crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium | 0.944 | 6 | 258 |
| 2bek-assembly2.cif.gz_D | structure of the bacterial chromosome segregation protein soj | 0.9351 | 5 | 256 |
| 5if9-assembly1.cif.gz_A | crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound atp analog and magnesium | 0.9347 | 6 | 255 |
| 2bej-assembly1.cif.gz_A | structure of the bacterial chromosome segregation protein soj | 0.9319 | 5 | 259 |
| 6iud-assembly1.cif.gz_A | structure of helicobacter pylori soj-adp complex bound to dna | 0.9285 | 5 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLT1_58_317_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.957 | 6 | 256 | 3.40.50.300 |
| af_Q1LVD4_80_340_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9443 | 5 | 256 | 3.40.50.300 |
| 5ihpA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.944 | 6 | 258 | 3.40.50.300 |
| 2bekD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9351 | 5 | 256 | 3.40.50.300 |
| af_P9WLT1_58_317_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9213 | 6 | 256 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P5VK06-F1-model_v4 | Chromosome partitioning protein ParA | 0.9671 | 5 | 209 |
|
| AF-A0A7X8DMG3-F1-model_v4 | ParA family protein | 0.9653 | 6 | 258 |
|
| AF-A0A6N4STV7-F1-model_v4 | Chromosome segregation ATPase | 0.964 | 6 | 257 |
|
| AF-A0A519GL87-F1-model_v4 | ParA family protein | 0.964 | 6 | 221 |
|
| AF-A0A2K3JD14-F1-model_v4 | AAA domain-containing protein | 0.9638 | 6 | 215 |
|