F495335

General Info

Members Datasets Scaffolds Average Seq Length
1687 482 3374 110

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100387243|Ga0070684_1003872433
Length 111
Sequence MAFTQSRQQNGVLVVRSDGQLIVGNRHELKELVQGALAAGDRRFVLDFSHTGYIDSSGLGALVTVARQVRELGGEMRLAGLNDDLRSLFELTKLDTLFAIADSPAQALAGF

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
222 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
223 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
237 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
238 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
247 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
248 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
375 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
376 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
377 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
378 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
412 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
413 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
414 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
415 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
416 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
417 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
418 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
419 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
420 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
421 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
422 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
423 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
424 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
425 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
426 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
427 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
428 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
434 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
435 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
436 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
437 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
438 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
439 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
443 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
448 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
449 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
450 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
451 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
454 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
461 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
481 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
482 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 5.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100387243 3300005535 Bacteria 1288
2 JGI24750J21931_1019297 3300002070 Bacteria 944
3 JGI25406J46586_10052517 3300003203 Bacteria 1357
4 rootL2_10101677 3300003322 Bacteria 1969
5 Ga0032354_1121886 3300003693 Bacteria 633
6 Ga0058859_11814094 3300004798 Bacteria 531
7 Ga0058863_10023017 3300004799 Bacteria 973
8 Ga0058863_11749219 3300004799 Bacteria 515
9 Ga0058863_11766029 3300004799 Bacteria 957
10 Ga0058863_11873702 3300004799 Bacteria 1002
11 Ga0058863_11972071 3300004799 Bacteria 655
12 Ga0058861_11621628 3300004800 Unclassified 686
13 Ga0058861_11623768 3300004800 Bacteria 655
14 Ga0058861_11793331 3300004800 Bacteria 1332
15 Ga0058861_11819252 3300004800 Unclassified 612
16 Ga0058861_11862569 3300004800 Bacteria 1133
17 Ga0058861_11977672 3300004800 Bacteria 1094
18 Ga0058860_12016274 3300004801 Bacteria 548
19 Ga0058862_10007717 3300004803 Bacteria 705
20 Ga0058862_10139180 3300004803 Bacteria 889
21 Ga0058862_11895783 3300004803 Unclassified 575
22 Ga0058862_12536806 3300004803 Bacteria 589
23 Ga0058862_12551672 3300004803 Bacteria 568
24 Ga0058862_12614112 3300004803 Bacteria 793
25 Ga0058862_12730940 3300004803 Unclassified 831
26 Ga0058862_12733296 3300004803 Unclassified 560
27 Ga0058862_12860400 3300004803 Bacteria 1470
28 Ga0058862_12875333 3300004803 Bacteria 669
29 Ga0065704_10156196 3300005289 Bacteria 1382
30 Ga0065712_10002894 3300005290 Bacteria 4082
31 Ga0065715_10162401 3300005293 Bacteria 1617
32 Ga0065707_10113306 3300005295 Bacteria 2332
33 Ga0070658_10009701 3300005327 Bacteria 7729
34 Ga0070658_10035917 3300005327 Bacteria 3993
35 Ga0070658_10091002 3300005327 Bacteria 2514
36 Ga0070658_10188744 3300005327 Bacteria 1737
37 Ga0070658_10265771 3300005327 Bacteria 1458
38 Ga0070658_10295648 3300005327 Bacteria 1380
39 Ga0070658_10569624 3300005327 Bacteria 980
40 Ga0070658_10586066 3300005327 Bacteria 966
41 Ga0070676_10004346 3300005328 Bacteria 7442
42 Ga0070676_10830801 3300005328 Bacteria 684
43 Ga0070676_10948230 3300005328 Bacteria 643
44 Ga0070683_100000233 3300005329 Bacteria 38043
45 Ga0070683_100007640 3300005329 Bacteria 9148
46 Ga0070683_100021811 3300005329 Bacteria 5717
47 Ga0070683_100050905 3300005329 Bacteria 3836
48 Ga0070683_100088898 3300005329 Bacteria 2899
49 Ga0070683_100104030 3300005329 Bacteria 2676
50 Ga0070683_100141480 3300005329 Bacteria 2279
51 Ga0070683_100153583 3300005329 Bacteria 2183
52 Ga0070683_100225934 3300005329 Bacteria 1779
53 Ga0070683_100318464 3300005329 Bacteria 1480
54 Ga0070683_100567773 3300005329 Bacteria 1085
55 Ga0070683_100697499 3300005329 Bacteria 972
56 Ga0070683_100729882 3300005329 Bacteria 949
57 Ga0070683_101339638 3300005329 Bacteria 688
58 Ga0070690_100045286 3300005330 Bacteria 2794
59 Ga0070690_100430372 3300005330 Unclassified 975
60 Ga0070690_100568538 3300005330 Bacteria 857
61 Ga0070690_101566059 3300005330 Bacteria 533
62 Ga0070670_100007272 3300005331 Bacteria 9388
63 Ga0070670_100965521 3300005331 Bacteria 774
64 Ga0070670_101308577 3300005331 Bacteria 663
65 Ga0070677_10119039 3300005333 Bacteria 1190
66 Ga0070677_10445234 3300005333 Unclassified 692
67 Ga0068869_100010103 3300005334 Bacteria 6142
68 Ga0068869_100057602 3300005334 Bacteria 2837
69 Ga0068869_100895419 3300005334 Bacteria 768
70 Ga0070666_10117395 3300005335 Bacteria 1843
71 Ga0070666_10127916 3300005335 Bacteria 1764
72 Ga0070680_100027511 3300005336 Bacteria 4553
73 Ga0070680_100028065 3300005336 Bacteria 4513
74 Ga0070680_100043156 3300005336 Bacteria 3662
75 Ga0070680_100050348 3300005336 Bacteria 3397
76 Ga0070680_100069042 3300005336 Bacteria 2901
77 Ga0070680_100087628 3300005336 Bacteria 2575
78 Ga0070680_100314700 3300005336 Bacteria 1328
79 Ga0070680_100373251 3300005336 Bacteria 1214
80 Ga0070680_100378701 3300005336 Bacteria 1205
81 Ga0070680_100442334 3300005336 Bacteria 1110
82 Ga0070680_100471466 3300005336 Bacteria 1073
83 Ga0070682_100125509 3300005337 Bacteria 1729
84 Ga0070682_100229953 3300005337 Bacteria 1325
85 Ga0070682_100382888 3300005337 Bacteria 1058
86 Ga0070682_100556699 3300005337 Unclassified 898
87 Ga0070682_101686893 3300005337 Unclassified 550
88 Ga0070682_101724306 3300005337 Unclassified 545
89 Ga0068868_101341298 3300005338 Unclassified 665
90 Ga0070660_100012909 3300005339 Bacteria 5977
91 Ga0070660_100125019 3300005339 Bacteria 2055
92 Ga0070660_100666225 3300005339 Bacteria 872
93 Ga0070660_100741289 3300005339 Bacteria 825
94 Ga0070660_100785146 3300005339 Bacteria 801
95 Ga0070660_100945336 3300005339 Bacteria 728
96 Ga0070689_100125500 3300005340 Bacteria 2053
97 Ga0070691_10021952 3300005341 Bacteria 2958
98 Ga0070691_10178744 3300005341 Bacteria 1103
99 Ga0070691_10353471 3300005341 Bacteria 817
100 Ga0070691_10856079 3300005341 Unclassified 558
101 Ga0070687_100014103 3300005343 Bacteria 3582
102 Ga0070687_100275992 3300005343 Bacteria 1056
103 Ga0070687_100301426 3300005343 Bacteria 1017
104 Ga0070661_100002985 3300005344 Bacteria 11659
105 Ga0070661_100003411 3300005344 Bacteria 10978
106 Ga0070661_100003797 3300005344 Bacteria 10410
107 Ga0070661_100015035 3300005344 Bacteria 5460
108 Ga0070661_100035622 3300005344 Bacteria 3615
109 Ga0070661_100065843 3300005344 Bacteria 2662
110 Ga0070661_100092097 3300005344 Bacteria 2245
111 Ga0070661_100978447 3300005344 Bacteria 701
112 Ga0070692_10104273 3300005345 Bacteria 1559
113 Ga0070692_10452886 3300005345 Bacteria 822
114 Ga0070692_10455385 3300005345 Bacteria 820
115 Ga0070692_10543731 3300005345 Bacteria 760
116 Ga0070692_10798877 3300005345 Bacteria 644
117 Ga0070668_100003043 3300005347 Bacteria 12405
118 Ga0070668_100110467 3300005347 Bacteria 2188
119 Ga0070669_100003079 3300005353 Bacteria 12001
120 Ga0070669_100006567 3300005353 Bacteria 8369
121 Ga0070669_100017058 3300005353 Bacteria 5181
122 Ga0070669_100628490 3300005353 Bacteria 902
123 Ga0070669_101526970 3300005353 Bacteria 581
124 Ga0070675_100002631 3300005354 Bacteria 13492
125 Ga0070675_100002663 3300005354 Bacteria 13424
126 Ga0070675_100129213 3300005354 Bacteria 2152
127 Ga0070675_100443798 3300005354 Bacteria 1163
128 Ga0070675_100538919 3300005354 Bacteria 1054
129 Ga0070675_100628948 3300005354 Bacteria 975
130 Ga0070671_100023147 3300005355 Bacteria 5080
131 Ga0070671_100119992 3300005355 Bacteria 2212
132 Ga0070671_100306722 3300005355 Bacteria 1352
133 Ga0070671_100948637 3300005355 Bacteria 752
134 Ga0070674_100002673 3300005356 Bacteria 9876
135 Ga0070674_100005627 3300005356 Bacteria 7257
136 Ga0070674_100090184 3300005356 Bacteria 2211
137 Ga0070674_100716610 3300005356 Bacteria 857
138 Ga0070674_101373216 3300005356 Bacteria 632
139 Ga0070673_100071202 3300005364 Bacteria 2793
140 Ga0070673_100174961 3300005364 Bacteria 1834
141 Ga0070673_100423788 3300005364 Unclassified 1193
142 Ga0070688_100002319 3300005365 Bacteria 9618
143 Ga0070688_100210072 3300005365 Bacteria 1366
144 Ga0070659_100008807 3300005366 Bacteria 7392
145 Ga0070659_100045001 3300005366 Bacteria 3457
146 Ga0070659_100098927 3300005366 Bacteria 2346
147 Ga0070659_100125537 3300005366 Bacteria 2082
148 Ga0070659_100182606 3300005366 Bacteria 1722
149 Ga0070659_100372354 3300005366 Bacteria 1202
150 Ga0070659_101093415 3300005366 Bacteria 702
151 Ga0070659_101305541 3300005366 Bacteria 644
152 Ga0070667_100078670 3300005367 Unclassified 2817
153 Ga0070703_10045433 3300005406 Bacteria 1385
154 Ga0070709_10004387 3300005434 Bacteria 7607
155 Ga0070709_10127383 3300005434 Bacteria 1734
156 Ga0070709_10250300 3300005434 Unclassified 1276
157 Ga0070714_100017298 3300005435 Bacteria 5839
158 Ga0070714_100059789 3300005435 Bacteria 3268
159 Ga0070714_101233724 3300005435 Unclassified 729
160 Ga0070713_100007166 3300005436 Bacteria 7803
161 Ga0070713_100044534 3300005436 Bacteria 3633
162 Ga0070713_100116823 3300005436 Bacteria 2334
163 Ga0070713_100460388 3300005436 Unclassified 1196
164 Ga0070713_100497774 3300005436 Bacteria 1150
165 Ga0070713_102030405 3300005436 Unclassified 558
166 Ga0070710_10184315 3300005437 Unclassified 1309
167 Ga0070710_10208052 3300005437 Bacteria 1239
168 Ga0070701_10066722 3300005438 Bacteria 1913
169 Ga0070701_10081963 3300005438 Unclassified 1748
170 Ga0070701_10197945 3300005438 Bacteria 1186
171 Ga0070711_100032354 3300005439 Bacteria 3477
172 Ga0070711_100093604 3300005439 Bacteria 2170
173 Ga0070711_100197012 3300005439 Bacteria 1552
174 Ga0070711_100551202 3300005439 Bacteria 956
175 Ga0070711_101492201 3300005439 Bacteria 590
176 Ga0070705_100008002 3300005440 Bacteria 5226
177 Ga0070705_100260434 3300005440 Bacteria 1223
178 Ga0070700_100084227 3300005441 Bacteria 2060
179 Ga0070700_100273692 3300005441 Bacteria 1221
180 Ga0070700_100426352 3300005441 Bacteria 1003
181 Ga0070694_100026031 3300005444 Unclassified 3789
182 Ga0070694_100071018 3300005444 Bacteria 2399
183 Ga0070694_100389417 3300005444 Bacteria 1089
184 Ga0070708_100000198 3300005445 Bacteria 44012
185 Ga0070708_100319285 3300005445 Bacteria 1463
186 Ga0070708_100319362 3300005445 Bacteria 1463
187 Ga0070708_100335521 3300005445 Unclassified 1425
188 Ga0070708_102155434 3300005445 Unclassified 515
189 Ga0070663_100006553 3300005455 Bacteria 7017
190 Ga0070663_100026569 3300005455 Bacteria 3923
191 Ga0070663_100426316 3300005455 Unclassified 1089
192 Ga0070663_100462429 3300005455 Bacteria 1048
193 Ga0070663_100628698 3300005455 Bacteria 906
194 Ga0070663_100846071 3300005455 Unclassified 787
195 Ga0070663_100969771 3300005455 Bacteria 738
196 Ga0070678_100216556 3300005456 Bacteria 1589
197 Ga0070678_100318911 3300005456 Bacteria 1326
198 Ga0070678_100941283 3300005456 Unclassified 791
199 Ga0070678_101712329 3300005456 Unclassified 592
200 Ga0070662_100005643 3300005457 Bacteria 8003
201 Ga0070662_100008788 3300005457 Bacteria 6588
202 Ga0070662_100317522 3300005457 Bacteria 1269
203 Ga0070662_101025354 3300005457 Bacteria 707
204 Ga0070662_101027303 3300005457 Bacteria 706
205 Ga0070662_101457880 3300005457 Bacteria 590
206 Ga0070681_10000404 3300005458 Bacteria 35078
207 Ga0070681_10002832 3300005458 Bacteria 16029
208 Ga0070681_10003332 3300005458 Bacteria 15018
209 Ga0070681_10003955 3300005458 Bacteria 13970
210 Ga0070681_10010307 3300005458 Bacteria 9226
211 Ga0070681_10039341 3300005458 Bacteria 4741
212 Ga0070681_10044751 3300005458 Bacteria 4431
213 Ga0070681_10061350 3300005458 Bacteria 3735
214 Ga0070681_10169614 3300005458 Unclassified 2104
215 Ga0070681_10330035 3300005458 Bacteria 1435
216 Ga0070681_10363900 3300005458 Bacteria 1357
217 Ga0070681_10543348 3300005458 Bacteria 1076
218 Ga0070681_10586316 3300005458 Bacteria 1029
219 Ga0070681_11039480 3300005458 Bacteria 739
220 Ga0070681_11206837 3300005458 Bacteria 678
221 Ga0070681_11206838 3300005458 Bacteria 678
222 Ga0070681_12049106 3300005458 Unclassified 500
223 Ga0068867_100005117 3300005459 Bacteria 9266
224 Ga0068867_100010994 3300005459 Bacteria 6381
225 Ga0068867_100080320 3300005459 Bacteria 2455
226 Ga0068867_100937268 3300005459 Unclassified 781
227 Ga0068867_101231203 3300005459 Bacteria 689
228 Ga0068867_101566659 3300005459 Unclassified 615
229 Ga0070685_10237064 3300005466 Bacteria 1203
230 Ga0070706_100180612 3300005467 Bacteria 1970
231 Ga0070706_100638097 3300005467 Bacteria 989
232 Ga0070706_101174498 3300005467 Bacteria 706
233 Ga0070707_100172133 3300005468 Bacteria 2110
234 Ga0070707_100253278 3300005468 Bacteria 1713
235 Ga0070707_100338019 3300005468 Bacteria 1463
236 Ga0070707_100748109 3300005468 Unclassified 941
237 Ga0070698_100012821 3300005471 Bacteria 8876
238 Ga0070698_100033083 3300005471 Bacteria 5356
239 Ga0070698_100060582 3300005471 Bacteria 3820
240 Ga0070698_100245585 3300005471 Bacteria 1723
241 Ga0070698_100297994 3300005471 Unclassified 1543
242 Ga0070699_100075909 3300005518 Bacteria 2925
243 Ga0070699_100142767 3300005518 Bacteria 2115
244 Ga0070699_100269595 3300005518 Bacteria 1523
245 Ga0070699_100762451 3300005518 Unclassified 885
246 Ga0070679_100000919 3300005530 Bacteria 25597
247 Ga0070679_100001084 3300005530 Bacteria 23776
248 Ga0070679_100006169 3300005530 Bacteria 11157
249 Ga0070679_100043081 3300005530 Bacteria 4496
250 Ga0070679_100043325 3300005530 Bacteria 4482
251 Ga0070679_100095100 3300005530 Bacteria 2967
252 Ga0070679_100245133 3300005530 Bacteria 1749
253 Ga0070679_100359492 3300005530 Unclassified 1403
254 Ga0070679_100408428 3300005530 Bacteria 1303
255 Ga0070679_100670594 3300005530 Bacteria 980
256 Ga0070679_100702985 3300005530 Bacteria 954
257 Ga0070679_101279873 3300005530 Bacteria 679
258 Ga0070679_101506731 3300005530 Unclassified 619
259 Ga0070684_100006699 3300005535 Bacteria 8930
260 Ga0070684_100024585 3300005535 Bacteria 5055
261 Ga0070684_100038174 3300005535 Bacteria 4124
262 Ga0070684_100043865 3300005535 Bacteria 3864
263 Ga0070684_100076836 3300005535 Unclassified 2948
264 Ga0070684_100297248 3300005535 Bacteria 1481
265 Ga0070684_100301427 3300005535 Bacteria 1470
266 Ga0070684_100365457 3300005535 Bacteria 1328
267 Ga0070684_100390698 3300005535 Bacteria 1282
268 Ga0070684_100725714 3300005535 Bacteria 927
269 Ga0070697_100659546 3300005536 Bacteria 922
270 Ga0068853_100013646 3300005539 Bacteria 6638
271 Ga0068853_100016074 3300005539 Bacteria 6155
272 Ga0068853_100487555 3300005539 Bacteria 1162
273 Ga0068853_100531253 3300005539 Bacteria 1113
274 Ga0068853_100600016 3300005539 Bacteria 1045
275 Ga0068853_101020938 3300005539 Unclassified 796
276 Ga0070672_100004984 3300005543 Bacteria 8750
277 Ga0070672_100005766 3300005543 Bacteria 8256
278 Ga0070672_100206844 3300005543 Bacteria 1643
279 Ga0070672_102093168 3300005543 Bacteria 510
280 Ga0070686_100256050 3300005544 Bacteria 1281
281 Ga0070686_100505251 3300005544 Bacteria 939
282 Ga0070695_100001483 3300005545 Bacteria 13033
283 Ga0070695_100246326 3300005545 Bacteria 1299
284 Ga0070695_100441644 3300005545 Bacteria 995
285 Ga0070695_100461616 3300005545 Bacteria 975
286 Ga0070695_101161069 3300005545 Bacteria 634
287 Ga0070696_100001375 3300005546 Bacteria 15888
288 Ga0070696_100007637 3300005546 Bacteria 7228
289 Ga0070696_100077827 3300005546 Bacteria 2344
290 Ga0070696_100091579 3300005546 Unclassified 2165
291 Ga0070696_101883053 3300005546 Bacteria 518
292 Ga0070693_100008533 3300005547 Bacteria 5058
293 Ga0070693_100013713 3300005547 Bacteria 4136
294 Ga0070693_100057558 3300005547 Bacteria 2247
295 Ga0070693_100503499 3300005547 Bacteria 859
296 Ga0070693_100912568 3300005547 Unclassified 659
297 Ga0070665_100042538 3300005548 Bacteria 4567
298 Ga0070665_100052068 3300005548 Unclassified 4107
299 Ga0070665_102600001 3300005548 Bacteria 507
300 Ga0070704_100227659 3300005549 Bacteria 1519
301 Ga0070704_100285705 3300005549 Bacteria 1369
302 Ga0070704_101093287 3300005549 Bacteria 724
303 Ga0068855_100002169 3300005563 Bacteria 24243
304 Ga0068855_100005082 3300005563 Bacteria 16038
305 Ga0068855_100008571 3300005563 Bacteria 12363
306 Ga0068855_100043978 3300005563 Bacteria 5288
307 Ga0068855_100366932 3300005563 Bacteria 1583
308 Ga0068855_100381898 3300005563 Unclassified 1547
309 Ga0068855_100646997 3300005563 Bacteria 1136
310 Ga0068855_100990687 3300005563 Bacteria 883
311 Ga0068855_101054914 3300005563 Unclassified 851
312 Ga0068855_101547206 3300005563 Bacteria 680
313 Ga0070664_100013154 3300005564 Bacteria 6738
314 Ga0070664_100024766 3300005564 Bacteria 4968
315 Ga0070664_100051722 3300005564 Bacteria 3478
316 Ga0070664_100485014 3300005564 Bacteria 1138
317 Ga0070664_101004731 3300005564 Bacteria 784
318 Ga0070664_101389984 3300005564 Unclassified 663
319 Ga0068857_100012151 3300005577 Bacteria 7490
320 Ga0068857_100012440 3300005577 Bacteria 7408
321 Ga0068857_100015739 3300005577 Bacteria 6617
322 Ga0068857_100020862 3300005577 Bacteria 5764
323 Ga0068857_100087176 3300005577 Bacteria 2792
324 Ga0068857_100736577 3300005577 Bacteria 938
325 Ga0068854_100000340 3300005578 Bacteria 30112
326 Ga0068854_100034276 3300005578 Bacteria 3545
327 Ga0068854_100053241 3300005578 Bacteria 2905
328 Ga0068854_100420152 3300005578 Bacteria 1110
329 Ga0068854_100745723 3300005578 Bacteria 849
330 Ga0068854_100790047 3300005578 Unclassified 826
331 Ga0068854_101739925 3300005578 Unclassified 571
332 Ga0068856_100364022 3300005614 Bacteria 1465
333 Ga0068856_100457035 3300005614 Bacteria 1298
334 Ga0068856_100648460 3300005614 Bacteria 1076
335 Ga0068856_100680175 3300005614 Unclassified 1049
336 Ga0068856_100941185 3300005614 Unclassified 883
337 Ga0068856_101002356 3300005614 Unclassified 853
338 Ga0070702_100015870 3300005615 Bacteria 3854
339 Ga0070702_100518545 3300005615 Bacteria 879
340 Ga0068852_100014974 3300005616 Bacteria 5995
341 Ga0068852_100018984 3300005616 Bacteria 5431
342 Ga0068852_100069165 3300005616 Bacteria 3093
343 Ga0068852_100192890 3300005616 Bacteria 1923
344 Ga0068852_100202237 3300005616 Bacteria 1880
345 Ga0068852_100546103 3300005616 Unclassified 1159
346 Ga0068852_101079483 3300005616 Bacteria 823
347 Ga0068852_101434378 3300005616 Bacteria 712
348 Ga0068859_100056150 3300005617 Bacteria 3962
349 Ga0068859_100897660 3300005617 Unclassified 971
350 Ga0068864_100005386 3300005618 Bacteria 10484
351 Ga0068864_100038902 3300005618 Bacteria 4064
352 Ga0068864_100318803 3300005618 Bacteria 1459
353 Ga0068864_100369234 3300005618 Bacteria 1357
354 Ga0068864_101236591 3300005618 Bacteria 746
355 Ga0068866_10000524 3300005718 Bacteria 17645
356 Ga0068866_10116924 3300005718 Bacteria 1496
357 Ga0068866_10376060 3300005718 Unclassified 910
358 Ga0068866_10812860 3300005718 Bacteria 651
359 Ga0068861_100001019 3300005719 Bacteria 17119
360 Ga0068861_100049474 3300005719 Bacteria 3183
361 Ga0068861_100289917 3300005719 Bacteria 1413
362 Ga0068861_100944581 3300005719 Unclassified 820
363 Ga0068851_10015465 3300005834 Bacteria 3636
364 Ga0068851_10071393 3300005834 Unclassified 1797
365 Ga0068851_10269088 3300005834 Bacteria 971
366 Ga0068870_10002079 3300005840 Bacteria 8295
367 Ga0068870_10304076 3300005840 Bacteria 1008
368 Ga0068870_10408049 3300005840 Bacteria 886
369 Ga0068870_10428249 3300005840 Bacteria 867
370 Ga0068870_10492048 3300005840 Bacteria 816
371 Ga0068863_100041206 3300005841 Bacteria 4390
372 Ga0068863_100160660 3300005841 Bacteria 2153
373 Ga0068863_100319991 3300005841 Unclassified 1507
374 Ga0068858_100022826 3300005842 Bacteria 5836
375 Ga0068858_100321105 3300005842 Bacteria 1480
376 Ga0068860_100040126 3300005843 Bacteria 4476
377 Ga0068860_100227646 3300005843 Bacteria 1811
378 Ga0068860_100535547 3300005843 Bacteria 1172
379 Ga0068862_100000376 3300005844 Bacteria 48418
380 Ga0068862_100030151 3300005844 Bacteria 4570
381 Ga0068862_100126281 3300005844 Bacteria 2258
382 Ga0081455_10038603 3300005937 Bacteria 4227
383 Ga0081455_10050687 3300005937 Bacteria 3566
384 Ga0081539_10000104 3300005985 Bacteria 197478
385 Ga0081539_10043960 3300005985 Unclassified 2583
386 Ga0081539_10230857 3300005985 Bacteria 835
387 Ga0070717_10016213 3300006028 Bacteria 5773
388 Ga0070717_10418219 3300006028 Unclassified 1206
389 Ga0070717_10918133 3300006028 Unclassified 797
390 Ga0075432_10382237 3300006058 Unclassified 604
391 Ga0070716_100172719 3300006173 Bacteria 1412
392 Ga0070716_100338785 3300006173 Unclassified 1060
393 Ga0070716_100489729 3300006173 Bacteria 905
394 Ga0070716_100573872 3300006173 Bacteria 844
395 Ga0070716_100851716 3300006173 Bacteria 710
396 Ga0070712_100012458 3300006175 Bacteria 5407
397 Ga0070712_100028870 3300006175 Bacteria 3714
398 Ga0070712_100062454 3300006175 Bacteria 2634
399 Ga0070712_100347417 3300006175 Unclassified 1213
400 Ga0070712_100413145 3300006175 Unclassified 1117
401 Ga0070712_100488267 3300006175 Unclassified 1031
402 Ga0097621_100208928 3300006237 Bacteria 1697
403 Ga0068871_100139055 3300006358 Bacteria 2064
404 Ga0068871_100407653 3300006358 Bacteria 1211
405 Ga0075428_100235434 3300006844 Bacteria 1976
406 Ga0075428_100397778 3300006844 Bacteria 1477
407 Ga0075428_101094780 3300006844 Bacteria 842
408 Ga0075428_101376680 3300006844 Bacteria 741
409 Ga0075428_101708408 3300006844 Bacteria 657
410 Ga0075430_100003192 3300006846 Bacteria 13741
411 Ga0075430_100013015 3300006846 Bacteria 7091
412 Ga0075430_100019170 3300006846 Bacteria 5816
413 Ga0075430_100029938 3300006846 Bacteria 4622
414 Ga0075430_100194674 3300006846 Bacteria 1684
415 Ga0075430_100269583 3300006846 Bacteria 1409
416 Ga0075431_100024864 3300006847 Bacteria 6141
417 Ga0075431_100037185 3300006847 Bacteria 5017
418 Ga0075431_100053473 3300006847 Unclassified 4164
419 Ga0075431_100065457 3300006847 Bacteria 3753
420 Ga0075431_100076205 3300006847 Bacteria 3461
421 Ga0075431_100135269 3300006847 Bacteria 2541
422 Ga0075431_100186854 3300006847 Bacteria 2125
423 Ga0075431_100236239 3300006847 Bacteria 1861
424 Ga0075431_100247272 3300006847 Bacteria 1813
425 Ga0075431_100373540 3300006847 Unclassified 1431
426 Ga0075433_10005348 3300006852 Bacteria 10079
427 Ga0075433_10718897 3300006852 Bacteria 874
428 Ga0075434_100001804 3300006871 Bacteria 18514
429 Ga0075434_100035507 3300006871 Bacteria 4929
430 Ga0075434_100244634 3300006871 Bacteria 1814
431 Ga0075434_100261801 3300006871 Bacteria 1749
432 Ga0075434_100873154 3300006871 Bacteria 915
433 Ga0075434_100881508 3300006871 Bacteria 910
434 Ga0075429_100067642 3300006880 Bacteria 3108
435 Ga0075429_100208196 3300006880 Bacteria 1713
436 Ga0075429_100453510 3300006880 Bacteria 1124
437 Ga0075429_100470855 3300006880 Bacteria 1101
438 Ga0068865_100001514 3300006881 Bacteria 13558
439 Ga0068865_100117526 3300006881 Bacteria 1971
440 Ga0068865_100628234 3300006881 Unclassified 910
441 Ga0075436_100114952 3300006914 Bacteria 1879
442 Ga0075436_100194376 3300006914 Bacteria 1436
443 Ga0075436_100209048 3300006914 Bacteria 1383
444 Ga0097620_100056151 3300006931 Bacteria 3962
445 Ga0097620_100897771 3300006931 Unclassified 971
446 Ga0075435_100694998 3300007076 Bacteria 884
447 Ga0075435_100980540 3300007076 Unclassified 738
448 Ga0075435_101112837 3300007076 Bacteria 690
449 Ga0075435_101766042 3300007076 Unclassified 543
450 Ga0105240_10009204 3300009093 Bacteria 14007
451 Ga0105240_10011015 3300009093 Bacteria 12657
452 Ga0105240_10016684 3300009093 Bacteria 9932
453 Ga0105240_10037426 3300009093 Bacteria 6236
454 Ga0105240_10046608 3300009093 Bacteria 5492
455 Ga0105240_10070716 3300009093 Bacteria 4316
456 Ga0105240_10074073 3300009093 Bacteria 4204
457 Ga0105240_10090200 3300009093 Bacteria 3747
458 Ga0105240_10705779 3300009093 Bacteria 1101
459 Ga0105240_10890443 3300009093 Bacteria 958
460 Ga0105240_11048922 3300009093 Unclassified 870
461 Ga0111539_10042342 3300009094 Bacteria 5469
462 Ga0111539_10088891 3300009094 Bacteria 3629
463 Ga0111539_10150269 3300009094 Bacteria 2726
464 Ga0111539_10251608 3300009094 Bacteria 2057
465 Ga0111539_10920564 3300009094 Bacteria 1017
466 Ga0105245_10025521 3300009098 Bacteria 5198
467 Ga0105245_10036543 3300009098 Bacteria 4364
468 Ga0105245_12730105 3300009098 Bacteria 547
469 Ga0105247_10439480 3300009101 Bacteria 938
470 Ga0114129_10017266 3300009147 Bacteria 10277
471 Ga0114129_10068560 3300009147 Bacteria 4946
472 Ga0114129_10230022 3300009147 Bacteria 2497
473 Ga0114129_10273868 3300009147 Bacteria 2257
474 Ga0114129_10299783 3300009147 Bacteria 2143
475 Ga0114129_10477216 3300009147 Archaea 1632
476 Ga0114129_10941962 3300009147 Bacteria 1091
477 Ga0114129_11407312 3300009147 Bacteria 860
478 Ga0105243_10042543 3300009148 Bacteria 3556
479 Ga0105243_10242951 3300009148 Bacteria 1603
480 Ga0105243_10590746 3300009148 Bacteria 1067
481 Ga0105241_10000729 3300009174 Bacteria 24921
482 Ga0105241_10024142 3300009174 Bacteria 4515
483 Ga0105241_10116790 3300009174 Bacteria 2143
484 Ga0105241_10169367 3300009174 Bacteria 1803
485 Ga0105241_10525033 3300009174 Bacteria 1059
486 Ga0105241_10717479 3300009174 Bacteria 914
487 Ga0105241_11098168 3300009174 Unclassified 749
488 Ga0105242_10006526 3300009176 Bacteria 8978
489 Ga0105242_10015995 3300009176 Bacteria 5830
490 Ga0105242_10181321 3300009176 Unclassified 1858
491 Ga0105242_10993453 3300009176 Unclassified 846
492 Ga0105242_11994438 3300009176 Bacteria 622
493 Ga0105248_10009365 3300009177 Bacteria 10781
494 Ga0105248_10011120 3300009177 Bacteria 9932
495 Ga0105248_10104035 3300009177 Bacteria 3200
496 Ga0105248_10916580 3300009177 Bacteria 990
497 Ga0105248_12078802 3300009177 Bacteria 646
498 Ga0105237_10079939 3300009545 Bacteria 3259
499 Ga0105237_10149201 3300009545 Bacteria 2334
500 Ga0105237_10431669 3300009545 Bacteria 1323
501 Ga0105237_10472521 3300009545 Bacteria 1260
502 Ga0105237_11009553 3300009545 Bacteria 839
503 Ga0105237_11127262 3300009545 Unclassified 791
504 Ga0105238_10024368 3300009551 Bacteria 6168
505 Ga0105238_10066363 3300009551 Bacteria 3610
506 Ga0105238_10073038 3300009551 Bacteria 3425
507 Ga0105238_10087946 3300009551 Bacteria 3094
508 Ga0105238_10325721 3300009551 Bacteria 1523
509 Ga0105238_10816832 3300009551 Bacteria 948
510 Ga0105238_11465449 3300009551 Bacteria 711
511 Ga0105238_12277478 3300009551 Unclassified 577
512 Ga0105249_10000454 3300009553 Bacteria 38498
513 Ga0105249_10069734 3300009553 Bacteria 3245
514 Ga0105249_10190726 3300009553 Bacteria 2000
515 Ga0105249_10325281 3300009553 Bacteria 1550
516 Ga0105249_10809129 3300009553 Bacteria 1001
517 Ga0105239_10147980 3300010375 Bacteria 2620
518 Ga0105239_10231952 3300010375 Unclassified 2071
519 Ga0105239_10259676 3300010375 Bacteria 1952
520 Ga0105239_10382025 3300010375 Bacteria 1592
521 Ga0105239_11245419 3300010375 Unclassified 858
522 Ga0105239_12469307 3300010375 Unclassified 606
523 Ga0105246_10055844 3300011119 Bacteria 2727
524 Ga0105246_10471626 3300011119 Bacteria 1060
525 Ga0157342_1073673 3300012507 Unclassified 524
526 Ga0157373_10001473 3300013100 Bacteria 17949
527 Ga0157373_10027655 3300013100 Bacteria 4092
528 Ga0157373_10091952 3300013100 Bacteria 2136
529 Ga0157373_10152454 3300013100 Bacteria 1626
530 Ga0157373_10201626 3300013100 Bacteria 1403
531 Ga0157373_10237167 3300013100 Unclassified 1289
532 Ga0157373_11331309 3300013100 Bacteria 544
533 Ga0157371_10007275 3300013102 Bacteria 8992
534 Ga0157371_10714457 3300013102 Bacteria 751
535 Ga0157371_10743094 3300013102 Unclassified 736
536 Ga0157371_11534102 3300013102 Bacteria 520
537 Ga0157370_10003508 3300013104 Bacteria 18392
538 Ga0157370_10008754 3300013104 Bacteria 10881
539 Ga0157370_10041763 3300013104 Bacteria 4422
540 Ga0157370_10136189 3300013104 Bacteria 2289
541 Ga0157370_10165029 3300013104 Bacteria 2060
542 Ga0157370_10166493 3300013104 Bacteria 2050
543 Ga0157370_10282223 3300013104 Bacteria 1534
544 Ga0157370_10861985 3300013104 Unclassified 823
545 Ga0157370_11117989 3300013104 Bacteria 712
546 Ga0157370_11609613 3300013104 Unclassified 583
547 Ga0157369_10009705 3300013105 Bacteria 11007
548 Ga0157369_10017338 3300013105 Bacteria 8095
549 Ga0157369_10073925 3300013105 Bacteria 3656
550 Ga0157369_10115485 3300013105 Bacteria 2851
551 Ga0157369_10117595 3300013105 Bacteria 2822
552 Ga0157369_10119385 3300013105 Bacteria 2798
553 Ga0157369_10232225 3300013105 Bacteria 1928
554 Ga0157369_10232838 3300013105 Bacteria 1925
555 Ga0157369_10739412 3300013105 Bacteria 1012
556 Ga0157369_10743766 3300013105 Bacteria 1009
557 Ga0157369_11755948 3300013105 Unclassified 630
558 Ga0157374_10433589 3300013296 Bacteria 1314
559 Ga0157374_10990234 3300013296 Bacteria 860
560 Ga0157374_11098074 3300013296 Bacteria 816
561 Ga0157374_11385070 3300013296 Bacteria 726
562 Ga0157374_12425697 3300013296 Bacteria 552
563 Ga0157378_10005002 3300013297 Bacteria 11631
564 Ga0157378_10016080 3300013297 Bacteria 6553
565 Ga0157378_10429050 3300013297 Bacteria 1308
566 Ga0163162_10001492 3300013306 Bacteria 21813
567 Ga0163162_10013828 3300013306 Bacteria 7885
568 Ga0163162_10075056 3300013306 Bacteria 3441
569 Ga0163162_12869838 3300013306 Unclassified 555
570 Ga0163162_13441632 3300013306 Unclassified 504
571 Ga0157372_10010171 3300013307 Bacteria 9988
572 Ga0157372_10013087 3300013307 Bacteria 8852
573 Ga0157372_10015470 3300013307 Bacteria 8178
574 Ga0157372_10025540 3300013307 Bacteria 6425
575 Ga0157372_10068103 3300013307 Bacteria 4002
576 Ga0157372_10118363 3300013307 Bacteria 3039
577 Ga0157372_10124994 3300013307 Bacteria 2957
578 Ga0157372_10252248 3300013307 Bacteria 2048
579 Ga0157372_10317512 3300013307 Bacteria 1814
580 Ga0157372_10367523 3300013307 Bacteria 1676
581 Ga0157372_10382231 3300013307 Bacteria 1640
582 Ga0157372_10509511 3300013307 Bacteria 1403
583 Ga0157372_10519876 3300013307 Unclassified 1388
584 Ga0157372_10617092 3300013307 Bacteria 1264
585 Ga0157372_10636435 3300013307 Unclassified 1242
586 Ga0157372_10659924 3300013307 Bacteria 1218
587 Ga0157372_10696387 3300013307 Bacteria 1182
588 Ga0157372_11287462 3300013307 Bacteria 844
589 Ga0157372_11664064 3300013307 Bacteria 734
590 Ga0157372_11736237 3300013307 Bacteria 718
591 Ga0157372_11902482 3300013307 Bacteria 684
592 Ga0157372_12279322 3300013307 Bacteria 622
593 Ga0157372_12346199 3300013307 Bacteria 613
594 Ga0157372_12369999 3300013307 Unclassified 609
595 Ga0157372_12614981 3300013307 Bacteria 579
596 Ga0157375_10091745 3300013308 Bacteria 3100
597 Ga0157375_10100651 3300013308 Bacteria 2971
598 Ga0157375_10294846 3300013308 Bacteria 1785
599 Ga0157375_10840832 3300013308 Bacteria 1065
600 Ga0163163_10070485 3300014325 Bacteria 3481
601 Ga0163163_10660291 3300014325 Bacteria 1109
602 Ga0157380_10007646 3300014326 Bacteria 7684
603 Ga0157380_10033634 3300014326 Bacteria 3949
604 Ga0157380_10148905 3300014326 Bacteria 2021
605 Ga0157380_10278831 3300014326 Bacteria 1528
606 Ga0157380_12670253 3300014326 Bacteria 566
607 Ga0182008_10009299 3300014497 Bacteria 5312
608 Ga0182008_10081193 3300014497 Bacteria 1596
609 Ga0157377_10031866 3300014745 Bacteria 2867
610 Ga0157379_10015608 3300014968 Bacteria 6670
611 Ga0157379_10064796 3300014968 Bacteria 3265
612 Ga0157376_10093515 3300014969 Bacteria 2610
613 Ga0157376_10225367 3300014969 Unclassified 1739
614 Ga0157376_11130927 3300014969 Bacteria 810
615 Ga0157376_11883363 3300014969 Bacteria 635
616 Ga0182007_10042612 3300015262 Unclassified 1510
617 Ga0182007_10073079 3300015262 Unclassified 1123
618 Ga0182007_10210130 3300015262 Bacteria 684
619 Ga0182007_10215945 3300015262 Unclassified 676
620 Ga0182007_10254854 3300015262 Bacteria 631
621 Ga0182005_1079726 3300015265 Unclassified 903
622 Ga0163161_10150679 3300017792 Bacteria 1767
623 Ga0163161_11802713 3300017792 Unclassified 544
624 Ga0197907_11166881 3300020069 Bacteria 793
625 Ga0197907_11314107 3300020069 Bacteria 1027
626 Ga0206356_10116592 3300020070 Unclassified 681
627 Ga0206356_10125692 3300020070 Bacteria 1524
628 Ga0206356_10416445 3300020070 Bacteria 748
629 Ga0206356_10483138 3300020070 Bacteria 644
630 Ga0206356_10839536 3300020070 Unclassified 730
631 Ga0206356_11361504 3300020070 Bacteria 842
632 Ga0206356_11525656 3300020070 Bacteria 806
633 Ga0206356_11642972 3300020070 Bacteria 627
634 Ga0206356_11798847 3300020070 Bacteria 567
635 Ga0206355_1012074 3300020076 Bacteria 594
636 Ga0206355_1360271 3300020076 Bacteria 773
637 Ga0206352_10641371 3300020078 Bacteria 625
638 Ga0206352_10860556 3300020078 Bacteria 760
639 Ga0206352_10936146 3300020078 Bacteria 1046
640 Ga0206352_11130402 3300020078 Unclassified 791
641 Ga0206352_11362427 3300020078 Bacteria 1025
642 Ga0206350_10135957 3300020080 Bacteria 835
643 Ga0213876_10040236 3300021384 Bacteria 2469
644 Ga0224712_10152424 3300022467 Bacteria 1025
645 Ga0224712_10316866 3300022467 Unclassified 732
646 Ga0224712_10352983 3300022467 Bacteria 695
647 Ga0224712_10681828 3300022467 Bacteria 505
648 Ga0207666_1047325 3300025271 Unclassified 678
649 Ga0207673_1009498 3300025290 Bacteria 1243
650 Ga0207697_10005445 3300025315 Bacteria 5918
651 Ga0207697_10112113 3300025315 Bacteria 1169
652 Ga0207656_10006385 3300025321 Bacteria 4232
653 Ga0207656_10172199 3300025321 Bacteria 1035
654 Ga0207653_10092535 3300025885 Bacteria 1061
655 Ga0207682_10168826 3300025893 Bacteria 994
656 Ga0207692_10101751 3300025898 Bacteria 1579
657 Ga0207692_10231793 3300025898 Unclassified 1099
658 Ga0207642_10069746 3300025899 Bacteria 1668
659 Ga0207642_10150415 3300025899 Bacteria 1238
660 Ga0207688_10023241 3300025901 Bacteria 3394
661 Ga0207688_10186830 3300025901 Bacteria 1238
662 Ga0207680_10113171 3300025903 Bacteria 1764
663 Ga0207680_10213827 3300025903 Bacteria 1319
664 Ga0207680_10821322 3300025903 Unclassified 666
665 Ga0207647_10195587 3300025904 Bacteria 1171
666 Ga0207685_10513020 3300025905 Bacteria 632
667 Ga0207699_10008459 3300025906 Bacteria 5081
668 Ga0207699_10045530 3300025906 Bacteria 2561
669 Ga0207699_10106448 3300025906 Bacteria 1790
670 Ga0207699_10106541 3300025906 Bacteria 1789
671 Ga0207645_10000246 3300025907 Bacteria 44995
672 Ga0207645_10000971 3300025907 Bacteria 23712
673 Ga0207645_10067632 3300025907 Bacteria 2284
674 Ga0207643_10001951 3300025908 Bacteria 11403
675 Ga0207643_10076653 3300025908 Unclassified 1932
676 Ga0207643_10131229 3300025908 Bacteria 1491
677 Ga0207643_10266169 3300025908 Unclassified 1059
678 Ga0207705_10007986 3300025909 Bacteria 7763
679 Ga0207705_10085948 3300025909 Bacteria 2298
680 Ga0207705_10089643 3300025909 Bacteria 2251
681 Ga0207705_10092825 3300025909 Bacteria 2212
682 Ga0207705_10104101 3300025909 Bacteria 2091
683 Ga0207705_10568143 3300025909 Bacteria 882
684 Ga0207684_10135612 3300025910 Bacteria 2114
685 Ga0207684_10299794 3300025910 Bacteria 1386
686 Ga0207684_11538460 3300025910 Unclassified 540
687 Ga0207684_11568418 3300025910 Bacteria 534
688 Ga0207654_10000860 3300025911 Bacteria 16810
689 Ga0207654_10222487 3300025911 Bacteria 1253
690 Ga0207654_10324081 3300025911 Bacteria 1054
691 Ga0207654_10756775 3300025911 Bacteria 700
692 Ga0207654_10955665 3300025911 Bacteria 622
693 Ga0207654_11030082 3300025911 Bacteria 599
694 Ga0207707_10000929 3300025912 Bacteria 28400
695 Ga0207707_10002146 3300025912 Bacteria 17846
696 Ga0207707_10002891 3300025912 Bacteria 15329
697 Ga0207707_10007791 3300025912 Bacteria 9323
698 Ga0207707_10013410 3300025912 Bacteria 7146
699 Ga0207707_10018294 3300025912 Bacteria 6109
700 Ga0207707_10021378 3300025912 Bacteria 5656
701 Ga0207707_10029197 3300025912 Bacteria 4820
702 Ga0207707_10075721 3300025912 Bacteria 2937
703 Ga0207707_10138032 3300025912 Unclassified 2132
704 Ga0207707_10629028 3300025912 Bacteria 906
705 Ga0207707_10649450 3300025912 Bacteria 889
706 Ga0207707_11269747 3300025912 Bacteria 593
707 Ga0207695_10001441 3300025913 Bacteria 39845
708 Ga0207695_10004676 3300025913 Bacteria 18554
709 Ga0207695_10008984 3300025913 Bacteria 12435
710 Ga0207695_10014206 3300025913 Bacteria 9447
711 Ga0207695_10020766 3300025913 Bacteria 7513
712 Ga0207695_10044422 3300025913 Bacteria 4726
713 Ga0207695_10064710 3300025913 Bacteria 3763
714 Ga0207695_10081615 3300025913 Bacteria 3272
715 Ga0207695_10084488 3300025913 Bacteria 3205
716 Ga0207671_10019018 3300025914 Bacteria 5262
717 Ga0207671_10131053 3300025914 Bacteria 1924
718 Ga0207671_10390182 3300025914 Bacteria 1107
719 Ga0207693_10019839 3300025915 Bacteria 5346
720 Ga0207693_10041127 3300025915 Bacteria 3640
721 Ga0207693_10361743 3300025915 Bacteria 1135
722 Ga0207693_10406055 3300025915 Unclassified 1065
723 Ga0207693_10410453 3300025915 Unclassified 1058
724 Ga0207693_10421808 3300025915 Bacteria 1043
725 Ga0207693_10613331 3300025915 Bacteria 846
726 Ga0207663_10001490 3300025916 Bacteria 10915
727 Ga0207663_10080650 3300025916 Bacteria 2128
728 Ga0207663_10172527 3300025916 Bacteria 1537
729 Ga0207663_10243302 3300025916 Bacteria 1320
730 Ga0207663_10898578 3300025916 Bacteria 708
731 Ga0207663_11205783 3300025916 Bacteria 609
732 Ga0207660_10001809 3300025917 Bacteria 14242
733 Ga0207660_10017662 3300025917 Bacteria 4744
734 Ga0207660_10032222 3300025917 Bacteria 3616
735 Ga0207660_10065650 3300025917 Bacteria 2623
736 Ga0207660_10087746 3300025917 Bacteria 2299
737 Ga0207660_10090306 3300025917 Bacteria 2269
738 Ga0207660_10101186 3300025917 Bacteria 2152
739 Ga0207660_10141654 3300025917 Bacteria 1839
740 Ga0207660_10218233 3300025917 Bacteria 1496
741 Ga0207660_10239322 3300025917 Unclassified 1429
742 Ga0207660_10918590 3300025917 Bacteria 714
743 Ga0207660_11133214 3300025917 Bacteria 637
744 Ga0207662_10003841 3300025918 Bacteria 7805
745 Ga0207662_10105844 3300025918 Bacteria 1749
746 Ga0207662_10244175 3300025918 Unclassified 1176
747 Ga0207657_10005262 3300025919 Bacteria 13552
748 Ga0207657_10021232 3300025919 Bacteria 6115
749 Ga0207657_10237526 3300025919 Bacteria 1456
750 Ga0207657_10250158 3300025919 Bacteria 1413
751 Ga0207657_10541662 3300025919 Bacteria 910
752 Ga0207657_10685639 3300025919 Bacteria 796
753 Ga0207657_11469464 3300025919 Unclassified 510
754 Ga0207649_10029427 3300025920 Bacteria 3243
755 Ga0207649_10050337 3300025920 Bacteria 2576
756 Ga0207649_10096437 3300025920 Bacteria 1948
757 Ga0207649_10165257 3300025920 Bacteria 1537
758 Ga0207649_10174948 3300025920 Bacteria 1498
759 Ga0207649_10852542 3300025920 Bacteria 713
760 Ga0207652_10000470 3300025921 Bacteria 41380
761 Ga0207652_10003423 3300025921 Bacteria 13091
762 Ga0207652_10007324 3300025921 Bacteria 8892
763 Ga0207652_10020285 3300025921 Bacteria 5472
764 Ga0207652_10022221 3300025921 Bacteria 5244
765 Ga0207652_10024204 3300025921 Bacteria 5036
766 Ga0207652_10031148 3300025921 Bacteria 4476
767 Ga0207652_10086061 3300025921 Bacteria 2755
768 Ga0207652_10088832 3300025921 Bacteria 2712
769 Ga0207652_10267542 3300025921 Bacteria 1542
770 Ga0207652_10564050 3300025921 Bacteria 1023
771 Ga0207652_11525639 3300025921 Bacteria 572
772 Ga0207646_10123227 3300025922 Bacteria 2330
773 Ga0207646_10142024 3300025922 Bacteria 2163
774 Ga0207646_10424101 3300025922 Bacteria 1201
775 Ga0207681_10009785 3300025923 Bacteria 5864
776 Ga0207681_10054383 3300025923 Bacteria 2722
777 Ga0207681_10066558 3300025923 Bacteria 2494
778 Ga0207681_10221702 3300025923 Bacteria 1463
779 Ga0207694_10023333 3300025924 Bacteria 4696
780 Ga0207694_10137479 3300025924 Bacteria 1963
781 Ga0207694_10209118 3300025924 Bacteria 1589
782 Ga0207694_10360180 3300025924 Bacteria 1205
783 Ga0207694_10664094 3300025924 Bacteria 878
784 Ga0207694_11230706 3300025924 Unclassified 633
785 Ga0207650_10004487 3300025925 Bacteria 9540
786 Ga0207650_10101704 3300025925 Unclassified 2213
787 Ga0207650_10104656 3300025925 Bacteria 2184
788 Ga0207659_10003254 3300025926 Bacteria 9727
789 Ga0207659_10009170 3300025926 Bacteria 6179
790 Ga0207659_10555758 3300025926 Bacteria 976
791 Ga0207659_10642311 3300025926 Bacteria 907
792 Ga0207659_11039265 3300025926 Bacteria 705
793 Ga0207659_11089345 3300025926 Bacteria 687
794 Ga0207687_10039639 3300025927 Bacteria 3226
795 Ga0207687_10073181 3300025927 Bacteria 2453
796 Ga0207700_10038793 3300025928 Bacteria 3461
797 Ga0207700_10054883 3300025928 Bacteria 2993
798 Ga0207700_10089999 3300025928 Bacteria 2420
799 Ga0207700_10123261 3300025928 Bacteria 2105
800 Ga0207700_10243155 3300025928 Bacteria 1535
801 Ga0207700_10337740 3300025928 Bacteria 1309
802 Ga0207700_10819651 3300025928 Bacteria 832
803 Ga0207664_10025601 3300025929 Bacteria 4449
804 Ga0207664_10039577 3300025929 Bacteria 3661
805 Ga0207664_10119297 3300025929 Unclassified 2205
806 Ga0207664_10167885 3300025929 Unclassified 1876
807 Ga0207664_10572851 3300025929 Bacteria 1013
808 Ga0207644_10035451 3300025931 Bacteria 3496
809 Ga0207644_10257273 3300025931 Unclassified 1395
810 Ga0207644_10686395 3300025931 Bacteria 853
811 Ga0207644_10722079 3300025931 Bacteria 831
812 Ga0207690_10012598 3300025932 Bacteria 5063
813 Ga0207690_10037581 3300025932 Bacteria 3145
814 Ga0207690_10042611 3300025932 Bacteria 2982
815 Ga0207690_10044207 3300025932 Bacteria 2935
816 Ga0207690_10068413 3300025932 Bacteria 2440
817 Ga0207690_10278896 3300025932 Bacteria 1301
818 Ga0207690_10747510 3300025932 Unclassified 806
819 Ga0207690_11017212 3300025932 Bacteria 690
820 Ga0207690_11587498 3300025932 Bacteria 547
821 Ga0207706_10000065 3300025933 Bacteria 109080
822 Ga0207706_10000357 3300025933 Bacteria 49369
823 Ga0207706_10297873 3300025933 Bacteria 1406
824 Ga0207706_11025855 3300025933 Bacteria 692
825 Ga0207706_11312440 3300025933 Bacteria 597
826 Ga0207686_10001117 3300025934 Bacteria 15528
827 Ga0207686_10171259 3300025934 Unclassified 1531
828 Ga0207709_10004346 3300025935 Bacteria 8201
829 Ga0207709_10567253 3300025935 Bacteria 895
830 Ga0207709_10740090 3300025935 Bacteria 790
831 Ga0207670_10120778 3300025936 Bacteria 1904
832 Ga0207670_11386390 3300025936 Unclassified 597
833 Ga0207669_10001479 3300025937 Bacteria 10039
834 Ga0207669_10015931 3300025937 Bacteria 3805
835 Ga0207669_10077102 3300025937 Bacteria 2118
836 Ga0207669_10215008 3300025937 Bacteria 1406
837 Ga0207704_10058637 3300025938 Bacteria 2371
838 Ga0207704_10414369 3300025938 Bacteria 1066
839 Ga0207665_10157887 3300025939 Bacteria 1629
840 Ga0207665_10226418 3300025939 Bacteria 1373
841 Ga0207665_10407598 3300025939 Bacteria 1036
842 Ga0207665_11088389 3300025939 Bacteria 637
843 Ga0207665_11404281 3300025939 Bacteria 556
844 Ga0207691_10001355 3300025940 Bacteria 24425
845 Ga0207691_10001550 3300025940 Bacteria 22813
846 Ga0207691_10022438 3300025940 Bacteria 5953
847 Ga0207691_10131502 3300025940 Bacteria 2210
848 Ga0207711_10028892 3300025941 Bacteria 4671
849 Ga0207711_10222614 3300025941 Unclassified 1726
850 Ga0207711_10908831 3300025941 Bacteria 818
851 Ga0207689_10001360 3300025942 Bacteria 23476
852 Ga0207689_10007750 3300025942 Bacteria 9398
853 Ga0207689_10665749 3300025942 Bacteria 877
854 Ga0207689_11505011 3300025942 Bacteria 562
855 Ga0207661_10011833 3300025944 Bacteria 6336
856 Ga0207661_10019670 3300025944 Bacteria 5040
857 Ga0207661_10022228 3300025944 Bacteria 4771
858 Ga0207661_10032021 3300025944 Bacteria 4070
859 Ga0207661_10037459 3300025944 Bacteria 3793
860 Ga0207661_10068735 3300025944 Bacteria 2885
861 Ga0207661_10323213 3300025944 Bacteria 1387
862 Ga0207661_10716921 3300025944 Bacteria 920
863 Ga0207661_11987297 3300025944 Unclassified 527
864 Ga0207661_12145826 3300025944 Bacteria 505
865 Ga0207679_10000484 3300025945 Bacteria 27676
866 Ga0207679_10006509 3300025945 Bacteria 7385
867 Ga0207679_10024777 3300025945 Bacteria 4117
868 Ga0207679_10271920 3300025945 Bacteria 1449
869 Ga0207679_10276220 3300025945 Bacteria 1439
870 Ga0207679_10602183 3300025945 Bacteria 990
871 Ga0207667_10011137 3300025949 Bacteria 10468
872 Ga0207667_10019276 3300025949 Bacteria 7622
873 Ga0207667_10081585 3300025949 Bacteria 3350
874 Ga0207667_10187587 3300025949 Bacteria 2122
875 Ga0207667_10950863 3300025949 Bacteria 849
876 Ga0207651_10058551 3300025960 Bacteria 2663
877 Ga0207651_10150000 3300025960 Bacteria 1813
878 Ga0207651_10452791 3300025960 Bacteria 1101
879 Ga0207712_10001176 3300025961 Bacteria 18145
880 Ga0207712_10044891 3300025961 Bacteria 3058
881 Ga0207712_10130934 3300025961 Bacteria 1912
882 Ga0207712_10481269 3300025961 Bacteria 1058
883 Ga0207712_11682783 3300025961 Unclassified 569
884 Ga0207668_10021247 3300025972 Bacteria 4137
885 Ga0207668_10053139 3300025972 Bacteria 2806
886 Ga0207668_10730561 3300025972 Archaea 872
887 Ga0207640_10001456 3300025981 Bacteria 12799
888 Ga0207640_10050446 3300025981 Bacteria 2700
889 Ga0207640_10104663 3300025981 Bacteria 1993
890 Ga0207640_10110876 3300025981 Bacteria 1945
891 Ga0207640_10286487 3300025981 Bacteria 1297
892 Ga0207640_10370752 3300025981 Bacteria 1157
893 Ga0207640_10501830 3300025981 Unclassified 1010
894 Ga0207658_10060833 3300025986 Bacteria 2820
895 Ga0207658_10178304 3300025986 Bacteria 1756
896 Ga0207658_11525645 3300025986 Unclassified 611
897 Ga0207703_10156270 3300026035 Bacteria 1993
898 Ga0207639_10004358 3300026041 Bacteria 9545
899 Ga0207639_10116510 3300026041 Bacteria 2187
900 Ga0207639_10150381 3300026041 Bacteria 1949
901 Ga0207639_10331802 3300026041 Bacteria 1354
902 Ga0207639_10517425 3300026041 Bacteria 1092
903 Ga0207639_11916862 3300026041 Bacteria 553
904 Ga0207678_10041333 3300026067 Bacteria 3998
905 Ga0207678_10041868 3300026067 Bacteria 3970
906 Ga0207678_10068814 3300026067 Bacteria 3036
907 Ga0207678_10423890 3300026067 Unclassified 1154
908 Ga0207678_12011429 3300026067 Unclassified 503
909 Ga0207708_10098662 3300026075 Bacteria 2258
910 Ga0207708_10104714 3300026075 Bacteria 2192
911 Ga0207708_10154233 3300026075 Bacteria 1810
912 Ga0207708_10751038 3300026075 Bacteria 837
913 Ga0207702_10057844 3300026078 Bacteria 3297
914 Ga0207702_10071273 3300026078 Bacteria 2992
915 Ga0207702_10745631 3300026078 Unclassified 967
916 Ga0207702_10915538 3300026078 Bacteria 869
917 Ga0207702_10990133 3300026078 Bacteria 834
918 Ga0207702_11682985 3300026078 Bacteria 627
919 Ga0207641_10107617 3300026088 Bacteria 2466
920 Ga0207641_10345441 3300026088 Unclassified 1417
921 Ga0207648_10001169 3300026089 Bacteria 29362
922 Ga0207648_10005220 3300026089 Bacteria 13139
923 Ga0207648_10023923 3300026089 Bacteria 5460
924 Ga0207648_10046448 3300026089 Bacteria 3807
925 Ga0207648_12191754 3300026089 Unclassified 513
926 Ga0207676_10048851 3300026095 Bacteria 3287
927 Ga0207676_10093952 3300026095 Bacteria 2470
928 Ga0207676_10142837 3300026095 Bacteria 2051
929 Ga0207676_10163981 3300026095 Bacteria 1929
930 Ga0207676_10343365 3300026095 Bacteria 1378
931 Ga0207676_11694275 3300026095 Bacteria 630
932 Ga0207674_10003135 3300026116 Bacteria 20383
933 Ga0207674_10015526 3300026116 Bacteria 8364
934 Ga0207674_10018565 3300026116 Bacteria 7555
935 Ga0207674_10059142 3300026116 Bacteria 3880
936 Ga0207674_10140302 3300026116 Bacteria 2376
937 Ga0207674_10296301 3300026116 Unclassified 1566
938 Ga0207674_10677573 3300026116 Bacteria 995
939 Ga0207674_11584205 3300026116 Unclassified 624
940 Ga0207675_100000320 3300026118 Bacteria 45668
941 Ga0207675_100032261 3300026118 Bacteria 4879
942 Ga0207675_100059762 3300026118 Bacteria 3558
943 Ga0207675_100314828 3300026118 Bacteria 1527
944 Ga0207675_100341058 3300026118 Bacteria 1467
945 Ga0207683_10033546 3300026121 Bacteria 4459
946 Ga0207683_10041068 3300026121 Bacteria 4038
947 Ga0207683_10059100 3300026121 Bacteria 3367
948 Ga0207683_10295458 3300026121 Bacteria 1482
949 Ga0207698_10007055 3300026142 Bacteria 7036
950 Ga0207698_10013973 3300026142 Bacteria 5318
951 Ga0207698_10256188 3300026142 Bacteria 1604
952 Ga0207698_11013550 3300026142 Bacteria 841
953 Ga0207698_11089470 3300026142 Bacteria 811
954 Ga0207698_11123693 3300026142 Bacteria 799
955 Ga0207698_11183172 3300026142 Bacteria 778
956 Ga0207698_11211289 3300026142 Bacteria 769
957 Ga0207428_10075404 3300027907 Bacteria 2643
958 Ga0207428_10258988 3300027907 Bacteria 1296
959 Ga0268266_10083429 3300028379 Bacteria 2790
960 Ga0268266_10102533 3300028379 Bacteria 2524
961 Ga0268266_11123594 3300028379 Bacteria 760
962 Ga0268265_10002121 3300028380 Bacteria 15384
963 Ga0268265_10037895 3300028380 Bacteria 3541
964 Ga0268265_10266956 3300028380 Bacteria 1524
965 Ga0268265_10715986 3300028380 Unclassified 968
966 Ga0268265_10802452 3300028380 Bacteria 918
967 Ga0268264_10022106 3300028381 Bacteria 5192
968 Ga0268264_10480925 3300028381 Bacteria 1208
969 Ga0268264_10488128 3300028381 Bacteria 1199
970 Ga0316178_1053326 3300030735 Bacteria 540
971 Ga0307408_100008337 3300031548 Bacteria 6844
972 Ga0307408_100187150 3300031548 Bacteria 1665
973 Ga0307408_100297064 3300031548 Bacteria 1351
974 Ga0307408_100368413 3300031548 Bacteria 1224
975 Ga0307408_100559101 3300031548 Bacteria 1011
976 Ga0307408_100875500 3300031548 Bacteria 820
977 Ga0307408_102494544 3300031548 Bacteria 503
978 Ga0316579_10111135 3300031691 Bacteria 1315
979 Ga0316576_10002948 3300031727 Bacteria 9864
980 Ga0316578_10013404 3300031728 Bacteria 4349
981 Ga0316578_10015348 3300031728 Bacteria 4117
982 Ga0307405_10000187 3300031731 Bacteria 22922
983 Ga0307405_10014127 3300031731 Bacteria 4283
984 Ga0307405_10036009 3300031731 Bacteria 2962
985 Ga0307405_10092885 3300031731 Bacteria 2003
986 Ga0307405_10144722 3300031731 Bacteria 1663
987 Ga0307405_10154782 3300031731 Unclassified 1616
988 Ga0307405_10173627 3300031731 Bacteria 1540
989 Ga0307405_10258162 3300031731 Bacteria 1300
990 Ga0307405_10406577 3300031731 Bacteria 1067
991 Ga0307405_10487220 3300031731 Bacteria 985
992 Ga0307405_10986256 3300031731 Bacteria 718
993 Ga0307405_11102917 3300031731 Bacteria 682
994 Ga0307405_11372694 3300031731 Bacteria 617
995 Ga0307405_12113955 3300031731 Bacteria 505
996 Ga0307405_12137608 3300031731 Bacteria 503
997 Ga0316577_10002399 3300031733 Bacteria 9273
998 Ga0316577_10025102 3300031733 Bacteria 3315
999 Ga0307413_10000837 3300031824 Bacteria 10804
1000 Ga0307413_10002229 3300031824 Bacteria 7809
1001 Ga0307413_10030411 3300031824 Bacteria 3033
1002 Ga0307413_10042391 3300031824 Bacteria 2674
1003 Ga0307413_10055375 3300031824 Bacteria 2413
1004 Ga0307413_10073618 3300031824 Bacteria 2160
1005 Ga0307413_10140859 3300031824 Bacteria 1666
1006 Ga0307413_10171588 3300031824 Bacteria 1536
1007 Ga0307413_10284805 3300031824 Bacteria 1245
1008 Ga0307413_10457015 3300031824 Bacteria 1015
1009 Ga0307413_10640847 3300031824 Bacteria 875
1010 Ga0307413_10817679 3300031824 Unclassified 784
1011 Ga0307413_11214826 3300031824 Bacteria 656
1012 Ga0307410_10002520 3300031852 Bacteria 8857
1013 Ga0307410_10012076 3300031852 Bacteria 4972
1014 Ga0307410_10015315 3300031852 Bacteria 4545
1015 Ga0307410_10022976 3300031852 Bacteria 3867
1016 Ga0307410_10027658 3300031852 Bacteria 3587
1017 Ga0307410_10070059 3300031852 Bacteria 2427
1018 Ga0307410_10127016 3300031852 Bacteria 1868
1019 Ga0307410_10249681 3300031852 Bacteria 1379
1020 Ga0307410_10272665 3300031852 Bacteria 1324
1021 Ga0307410_10314703 3300031852 Bacteria 1240
1022 Ga0307410_10337316 3300031852 Bacteria 1200
1023 Ga0307410_10344968 3300031852 Bacteria 1188
1024 Ga0307410_10345358 3300031852 Bacteria 1187
1025 Ga0307410_10498068 3300031852 Bacteria 1002
1026 Ga0307410_10549744 3300031852 Bacteria 957
1027 Ga0307410_11023698 3300031852 Bacteria 713
1028 Ga0307410_11691523 3300031852 Unclassified 560
1029 Ga0307406_10001688 3300031901 Bacteria 12133
1030 Ga0307406_10002595 3300031901 Bacteria 9848
1031 Ga0307406_10014718 3300031901 Bacteria 4506
1032 Ga0307406_10023424 3300031901 Bacteria 3673
1033 Ga0307406_10028708 3300031901 Bacteria 3363
1034 Ga0307406_10043279 3300031901 Bacteria 2815
1035 Ga0307406_10085068 3300031901 Bacteria 2114
1036 Ga0307406_10108565 3300031901 Bacteria 1905
1037 Ga0307406_10146070 3300031901 Unclassified 1681
1038 Ga0307406_10230915 3300031901 Bacteria 1382
1039 Ga0307406_10260498 3300031901 Bacteria 1312
1040 Ga0307406_10362133 3300031901 Bacteria 1137
1041 Ga0307406_11611758 3300031901 Bacteria 573
1042 Ga0307407_10000201 3300031903 Bacteria 18078
1043 Ga0307407_10004682 3300031903 Bacteria 5843
1044 Ga0307407_10008899 3300031903 Bacteria 4640
1045 Ga0307407_10024361 3300031903 Bacteria 3173
1046 Ga0307407_10027368 3300031903 Bacteria 3033
1047 Ga0307407_10085331 3300031903 Bacteria 1921
1048 Ga0307407_10091391 3300031903 Bacteria 1866
1049 Ga0307407_10116337 3300031903 Bacteria 1687
1050 Ga0307407_10124907 3300031903 Bacteria 1637
1051 Ga0307407_10333724 3300031903 Bacteria 1068
1052 Ga0307407_10342090 3300031903 Bacteria 1057
1053 Ga0307407_10379864 3300031903 Bacteria 1008
1054 Ga0307407_10441069 3300031903 Bacteria 943
1055 Ga0307407_10525226 3300031903 Bacteria 871
1056 Ga0307407_10962072 3300031903 Unclassified 658
1057 Ga0307412_10012476 3300031911 Bacteria 4956
1058 Ga0307412_10028271 3300031911 Bacteria 3506
1059 Ga0307412_10129946 3300031911 Bacteria 1828
1060 Ga0307412_10193021 3300031911 Bacteria 1541
1061 Ga0307412_10234054 3300031911 Bacteria 1416
1062 Ga0307412_10398104 3300031911 Bacteria 1120
1063 Ga0307412_11261340 3300031911 Bacteria 664
1064 Ga0307409_100000144 3300031995 Bacteria 26764
1065 Ga0307409_100003493 3300031995 Bacteria 8552
1066 Ga0307409_100009411 3300031995 Bacteria 6000
1067 Ga0307409_100009792 3300031995 Bacteria 5910
1068 Ga0307409_100023234 3300031995 Bacteria 4291
1069 Ga0307409_100026152 3300031995 Bacteria 4111
1070 Ga0307409_100027599 3300031995 Bacteria 4027
1071 Ga0307409_100033448 3300031995 Bacteria 3742
1072 Ga0307409_100048332 3300031995 Bacteria 3236
1073 Ga0307409_100118546 3300031995 Bacteria 2236
1074 Ga0307409_100126080 3300031995 Unclassified 2178
1075 Ga0307409_100186505 3300031995 Bacteria 1842
1076 Ga0307409_100254667 3300031995 Unclassified 1607
1077 Ga0307409_100383328 3300031995 Bacteria 1337
1078 Ga0307409_100556156 3300031995 Bacteria 1127
1079 Ga0307409_100717738 3300031995 Bacteria 1000
1080 Ga0307409_100867596 3300031995 Bacteria 914
1081 Ga0307409_101141677 3300031995 Bacteria 801
1082 Ga0307416_100000828 3300032002 Bacteria 16247
1083 Ga0307416_100004156 3300032002 Bacteria 8675
1084 Ga0307416_100007355 3300032002 Bacteria 6994
1085 Ga0307416_100012718 3300032002 Bacteria 5685
1086 Ga0307416_100014248 3300032002 Bacteria 5438
1087 Ga0307416_100024844 3300032002 Bacteria 4381
1088 Ga0307416_100049239 3300032002 Bacteria 3349
1089 Ga0307416_100073566 3300032002 Bacteria 2850
1090 Ga0307416_100073588 3300032002 Bacteria 2850
1091 Ga0307416_100120247 3300032002 Bacteria 2338
1092 Ga0307416_100247873 3300032002 Bacteria 1731
1093 Ga0307416_100356860 3300032002 Bacteria 1482
1094 Ga0307416_100450307 3300032002 Bacteria 1340
1095 Ga0307416_100477679 3300032002 Bacteria 1306
1096 Ga0307416_100511350 3300032002 Bacteria 1267
1097 Ga0307416_100735010 3300032002 Bacteria 1078
1098 Ga0307416_101424102 3300032002 Bacteria 799
1099 Ga0307416_102811952 3300032002 Unclassified 582
1100 Ga0307416_103058978 3300032002 Bacteria 560
1101 Ga0307416_103753912 3300032002 Bacteria 508
1102 Ga0307414_10002383 3300032004 Bacteria 9831
1103 Ga0307414_10006027 3300032004 Bacteria 6721
1104 Ga0307414_10030309 3300032004 Bacteria 3532
1105 Ga0307414_10043031 3300032004 Bacteria 3073
1106 Ga0307414_10090810 3300032004 Bacteria 2268
1107 Ga0307414_10345745 3300032004 Bacteria 1275
1108 Ga0307414_10408267 3300032004 Bacteria 1181
1109 Ga0307414_10426642 3300032004 Bacteria 1157
1110 Ga0307414_10465715 3300032004 Bacteria 1112
1111 Ga0307414_11271125 3300032004 Bacteria 682
1112 Ga0307411_10001066 3300032005 Bacteria 10635
1113 Ga0307411_10006929 3300032005 Bacteria 5717
1114 Ga0307411_10007270 3300032005 Bacteria 5620
1115 Ga0307411_10017609 3300032005 Bacteria 4077
1116 Ga0307411_10028273 3300032005 Bacteria 3407
1117 Ga0307411_10045742 3300032005 Bacteria 2817
1118 Ga0307411_10062970 3300032005 Bacteria 2476
1119 Ga0307411_10141185 3300032005 Bacteria 1776
1120 Ga0307411_10147865 3300032005 Bacteria 1742
1121 Ga0307411_10166152 3300032005 Bacteria 1659
1122 Ga0307411_10208308 3300032005 Bacteria 1508
1123 Ga0307411_10276620 3300032005 Unclassified 1334
1124 Ga0307411_10282820 3300032005 Bacteria 1321
1125 Ga0307411_10531822 3300032005 Bacteria 1000
1126 Ga0307411_10645798 3300032005 Bacteria 915
1127 Ga0307411_10663386 3300032005 Bacteria 904
1128 Ga0307411_10672848 3300032005 Bacteria 898
1129 Ga0307411_10773159 3300032005 Bacteria 843
1130 Ga0307411_10858996 3300032005 Bacteria 803
1131 Ga0307411_11345317 3300032005 Unclassified 652
1132 Ga0307411_11551779 3300032005 Bacteria 610
1133 Ga0307411_11809007 3300032005 Bacteria 567
1134 Ga0307411_11845197 3300032005 Bacteria 562
1135 Ga0307415_100000419 3300032126 Bacteria 18192
1136 Ga0307415_100002432 3300032126 Bacteria 9294
1137 Ga0307415_100021813 3300032126 Bacteria 3944
1138 Ga0307415_100036475 3300032126 Bacteria 3222
1139 Ga0307415_100041599 3300032126 Bacteria 3052
1140 Ga0307415_100051781 3300032126 Bacteria 2788
1141 Ga0307415_100125154 3300032126 Bacteria 1936
1142 Ga0307415_100143241 3300032126 Bacteria 1829
1143 Ga0307415_100459811 3300032126 Bacteria 1102
1144 Ga0307415_100490786 3300032126 Bacteria 1071
1145 Ga0307415_100970217 3300032126 Bacteria 788
1146 Ga0307415_102463500 3300032126 Bacteria 512
1147 Ga0316583_10003563 3300032133 Bacteria 5495
1148 Ga0316585_10006893 3300032137 Bacteria 3261
1149 Ga0316596_1143350 3300033541 Unclassified 655
1150 Ga0373950_0167964 3300034818 Bacteria 510
1151 Ga0373938_0040184 3300034957 Unclassified 1037
1152 Ga0373926_0004167 3300035083 Bacteria 4716
1153 Ga0373928_0048895 3300035084 Bacteria 993
1154 Ga0373934_0005211 3300035086 Bacteria 4809
1155 Ga0373934_0037374 3300035086 Bacteria 1912
1156 Ga0373934_0040553 3300035086 Bacteria 1837
1157 Ga0373940_0070749 3300035088 Bacteria 1015
1158 Ga0373944_0396028 3300035089 Bacteria 532
1159 Ga0373951_0051655 3300035091 Bacteria 1012
1160 Ga0373952_0095406 3300035092 Bacteria 778
1161 Ga0373923_0007123 3300035111 Bacteria 3916
1162 Ga0373932_0198412 3300035112 Bacteria 712
1163 Ga0373936_0011918 3300035113 Bacteria 3299
1164 Ga0373936_0128849 3300035113 Bacteria 1086
1165 Ga0373941_0333309 3300035115 Unclassified 613
1166 Ga0373945_0258114 3300035116 Unclassified 738
1167 Ga0373953_0002759 3300035117 Bacteria 5334
1168 Ga0373953_0009331 3300035117 Bacteria 3370
1169 Ga0373953_0568949 3300035117 Bacteria 504
1170 Ga0373954_0057621 3300035118 Bacteria 1830
1171 Ga0373954_0066241 3300035118 Bacteria 1710
1172 Ga0373954_0440984 3300035118 Bacteria 644
1173 Ga0373956_0000678 3300035119 Bacteria 13976
1174 Ga0373956_0113697 3300035119 Bacteria 1261
1175 Ga0373956_0548048 3300035119 Unclassified 552
1176 Ga0373957_0099398 3300035120 Bacteria 1163
1177 Ga0373957_0165776 3300035120 Bacteria 911
1178 Ga0373960_0139748 3300035121 Unclassified 819
1179 Ga0373943_0016857 3300035170 Bacteria 3338
1180 Ga0373943_0028594 3300035170 Unclassified 2628
1181 Ga0373946_0009275 3300035171 Bacteria 3620
1182 Ga0373942_0342387 3300035207 Unclassified 527
1183 Ga0373961_0059628 3300035241 Bacteria 1154
1184 Ga0316574_0204529 3300035398 Bacteria 1268
1185 Ga0316574_0695716 3300035398 Bacteria 624
1186 Ga0373924_0002127 3300035410 Bacteria 6622
1187 Ga0373924_0285833 3300035410 Unclassified 732
1188 Ga0373931_0018182 3300035691 Bacteria 3492
1189 Ga0373931_0018416 3300035691 Bacteria 3474
1190 Ga0373935_0018031 3300035692 Bacteria 4290
1191 Ga0373935_0063447 3300035692 Bacteria 2368
1192 Ga0373935_0124591 3300035692 Unclassified 1725
1193 Ga0373935_0378071 3300035692 Bacteria 1014
1194 Ga0373927_0026060 3300035695 Bacteria 3821
1195 Ga0373927_1094838 3300035695 Bacteria 525
1196 Ga0373933_0001111 3300035724 Bacteria 16018
1197 Ga0373933_0013654 3300035724 Bacteria 4504
1198 Ga0373947_0002126 3300035725 Bacteria 12064
1199 Ga0373947_0048812 3300035725 Unclassified 2540
1200 Ga0373947_0115326 3300035725 Unclassified 1702
1201 Ga0373937_0002914 3300036401 Bacteria 14299
1202 Ga0373937_0065385 3300036401 Bacteria 3347
1203 Ga0373937_0096592 3300036401 Bacteria 2740
1204 Ga0316582_0026818 3300036647 Bacteria 3472
1205 Ga0316582_0075578 3300036647 Bacteria 2189
1206 Ga0316584_0009015 3300036712 Bacteria 6902
1207 Ga0373925_0034016 3300037068 Bacteria 3756
1208 Ga0373925_0216655 3300037068 Bacteria 1527
1209 Ga0373925_0592715 3300037068 Archaea 913
1210 Ga0395899_0038329 3300037312 Bacteria 3590
1211 Ga0395900_0005143 3300037418 Bacteria 13738
1212 Ga0395898_0365364 3300037466 Bacteria 1376
1213 Ga0395905_0049760 3300037471 Bacteria 3928
1214 Ga0395905_0117856 3300037471 Bacteria 2495
1215 Ga0395905_0624983 3300037471 Bacteria 979
1216 Ga0395905_1377214 3300037471 Bacteria 609
1217 Ga0316581_0052652 3300037588 Bacteria 1247
1218 Ga0436364_0287855 3300037853 Bacteria 1071
1219 Ga0395901_0003407 3300038443 Bacteria 16018
1220 Ga0395901_0694213 3300038443 Bacteria 1016
1221 Ga0395901_1490842 3300038443 Unclassified 632
1222 Ga0242420_024104 3300038996 Bacteria 1101
1223 Ga0242420_054477 3300038996 Bacteria 787
1224 Ga0436365_0290864 3300039437 Bacteria 776
1225 Ga0436365_0304609 3300039437 Bacteria 856
1226 Ga0436365_1159467 3300039437 Unclassified 506
1227 Ga0436365_1602166 3300039437 Bacteria 18827
1228 Ga0436363_0390436 3300039450 Bacteria 674
1229 Ga0436363_0732405 3300039450 Bacteria 543
1230 Ga0439439_0021339 3300041406 Bacteria 1614
1231 Ga0451839_1205934 3300041496 Bacteria 701
1232 Ga0451853_1987835 3300041512 Bacteria 543
1233 Ga0439448_0040558 3300042005 Bacteria 1504
1234 Ga0439457_103357 3300042014 Bacteria 665
1235 Ga0439462_0132713 3300042015 Unclassified 696
1236 Ga0439446_0184978 3300042156 Unclassified 698
1237 Ga0451577_0003975 3300042876 Bacteria 15941
1238 Ga0451577_0076398 3300042876 Bacteria 2986
1239 Ga0451577_0233619 3300042876 Bacteria 1663
1240 Ga0451577_0278304 3300042876 Unclassified 1516
1241 Ga0453683_0083881 3300044673 Bacteria 1997
1242 Ga0453683_1216232 3300044673 Bacteria 505
1243 Ga0466965_0319755 3300044683 Bacteria 845
1244 Ga0466966_0310517 3300044684 Bacteria 948
1245 Ga0466966_0984788 3300044684 Bacteria 509
1246 Ga0466961_0148652 3300044693 Bacteria 1464
1247 Ga0466964_0177363 3300044706 Bacteria 1008
1248 Ga0466964_0240783 3300044706 Bacteria 887
1249 Ga0466964_0355081 3300044706 Bacteria 754
1250 Ga0453684_1058605 3300044712 Bacteria 859
1251 Ga0466971_0083762 3300044719 Bacteria 1456
1252 Ga0466971_0634884 3300044719 Bacteria 534
1253 Ga0466970_0236236 3300044765 Bacteria 1022
1254 Ga0466957_1006802 3300044842 Unclassified 599
1255 Ga0466957_1282518 3300044842 Bacteria 531
1256 Ga0451576_0042077 3300045051 Bacteria 4824
1257 Ga0451576_0116352 3300045051 Bacteria 2784
1258 Ga0451576_0321037 3300045051 Bacteria 1620
1259 Ga0451576_0781793 3300045051 Bacteria 1003
1260 Ga0451576_1522734 3300045051 Unclassified 695
1261 Ga0466958_0130129 3300045836 Bacteria 1580
1262 Ga0466958_0334514 3300045836 Bacteria 974
1263 Ga0466967_0250970 3300045976 Bacteria 1690
1264 Ga0466967_0533636 3300045976 Bacteria 1154
1265 Ga0466967_0777573 3300045976 Unclassified 950
1266 Ga0466967_2175858 3300045976 Unclassified 551
1267 Ga0495592_0002525 3300046454 Bacteria 12917
1268 Ga0495592_0365590 3300046454 Bacteria 921
1269 Ga0495592_0902943 3300046454 Bacteria 519
1270 Ga0495603_0015387 3300046455 Bacteria 4628
1271 Ga0495603_0046197 3300046455 Bacteria 2595
1272 Ga0495603_0238765 3300046455 Unclassified 1047
1273 Ga0495629_0003115 3300046459 Bacteria 12567
1274 Ga0495629_0025075 3300046459 Bacteria 4241
1275 Ga0495629_0040407 3300046459 Bacteria 3281
1276 Ga0495629_0303378 3300046459 Bacteria 1093
1277 Ga0495629_0618441 3300046459 Bacteria 723
1278 Ga0495629_1112862 3300046459 Bacteria 510
1279 Ga0495651_0009970 3300046462 Bacteria 7304
1280 Ga0495651_0017083 3300046462 Bacteria 5622
1281 Ga0495651_0124418 3300046462 Bacteria 1890
1282 Ga0495651_0644771 3300046462 Bacteria 664
1283 Ga0495653_0000547 3300046463 Bacteria 28742
1284 Ga0495653_0006042 3300046463 Bacteria 9914
1285 Ga0495653_0636764 3300046463 Bacteria 652
1286 Ga0495580_0001189 3300046472 Bacteria 22911
1287 Ga0495580_0005504 3300046472 Bacteria 10461
1288 Ga0495580_0109372 3300046472 Bacteria 1919
1289 Ga0495580_0614116 3300046472 Unclassified 718
1290 Ga0495580_1020227 3300046472 Unclassified 526
1291 Ga0495582_0013598 3300046473 Bacteria 4481
1292 Ga0495582_0039450 3300046473 Bacteria 2600
1293 Ga0495582_0088607 3300046473 Bacteria 1724
1294 Ga0495582_0151791 3300046473 Bacteria 1315
1295 Ga0495582_0762531 3300046473 Unclassified 560
1296 Ga0495639_0000549 3300046475 Bacteria 17446
1297 Ga0495639_0011675 3300046475 Bacteria 3790
1298 Ga0495639_0316237 3300046475 Unclassified 780
1299 Ga0495662_0417003 3300046476 Unclassified 659
1300 Ga0495664_0281001 3300046477 Bacteria 1006
1301 Ga0495664_0714430 3300046477 Bacteria 592
1302 Ga0495585_0160087 3300046492 Unclassified 1169
1303 Ga0495594_0011878 3300046499 Bacteria 4531
1304 Ga0495594_0145232 3300046499 Bacteria 1346
1305 Ga0495607_0370303 3300046501 Unclassified 657
1306 Ga0495608_0000405 3300046511 Bacteria 30184
1307 Ga0495608_0028611 3300046511 Unclassified 3787
1308 Ga0495618_0153235 3300046514 Bacteria 1472
1309 Ga0495628_0000494 3300046516 Bacteria 36135
1310 Ga0495628_0040700 3300046516 Bacteria 3712
1311 Ga0495628_0122008 3300046516 Unclassified 1998
1312 Ga0495630_0002236 3300046517 Bacteria 13469
1313 Ga0495630_0003849 3300046517 Bacteria 10477
1314 Ga0495630_0015750 3300046517 Bacteria 5524
1315 Ga0495630_0085082 3300046517 Bacteria 2387
1316 Ga0495663_0099594 3300046525 Bacteria 956
1317 Ga0495666_0050611 3300046526 Bacteria 1997
1318 Ga0495652_0008315 3300046529 Bacteria 9480
1319 Ga0495652_0042274 3300046529 Bacteria 3930
1320 Ga0495665_0000358 3300046531 Bacteria 23104
1321 Ga0495665_0003130 3300046531 Bacteria 8950
1322 Ga0495665_0075851 3300046531 Bacteria 1770
1323 Ga0495665_0593238 3300046531 Bacteria 554
1324 Ga0495640_0359579 3300046533 Bacteria 898
1325 Ga0495586_0004190 3300046535 Bacteria 7724
1326 Ga0495587_0000269 3300046536 Bacteria 37262
1327 Ga0495587_0000334 3300046536 Bacteria 33589
1328 Ga0495587_0001945 3300046536 Bacteria 13762
1329 Ga0495587_0124263 3300046536 Unclassified 1477
1330 Ga0495621_0210913 3300046539 Bacteria 784
1331 Ga0495621_0343511 3300046539 Bacteria 625
1332 Ga0495645_0005088 3300046543 Bacteria 9010
1333 Ga0495645_0087646 3300046543 Bacteria 2227
1334 Ga0495622_0022950 3300046557 Bacteria 2908
1335 Ga0495622_0225599 3300046557 Bacteria 829
1336 Ga0495633_0152348 3300046558 Bacteria 1068
1337 Ga0495667_0000504 3300046559 Bacteria 24895
1338 Ga0495667_0001705 3300046559 Bacteria 14587
1339 Ga0495667_0005981 3300046559 Bacteria 8228
1340 Ga0495634_0830558 3300046642 Bacteria 526
1341 Ga0495635_0000200 3300046663 Bacteria 37911
1342 Ga0495635_0354627 3300046663 Unclassified 978
1343 Ga0495659_0150507 3300046664 Bacteria 934
1344 Ga0495659_0328021 3300046664 Unclassified 651
1345 Ga0495659_0379927 3300046664 Bacteria 607
1346 Ga0495588_0012498 3300046674 Bacteria 4015
1347 Ga0495588_0023908 3300046674 Bacteria 3031
1348 Ga0495657_0011939 3300046675 Bacteria 6471
1349 Ga0495657_0464029 3300046675 Unclassified 741
1350 Ga0495657_0876098 3300046675 Unclassified 511
1351 Ga0495599_0002011 3300046678 Bacteria 11757
1352 Ga0495599_0021680 3300046678 Bacteria 4008
1353 Ga0495599_0082661 3300046678 Bacteria 2006
1354 Ga0495623_0000156 3300046679 Bacteria 42279
1355 Ga0495623_0003024 3300046679 Bacteria 11067
1356 Ga0495623_0052162 3300046679 Bacteria 2585
1357 Ga0495646_0038350 3300046680 Bacteria 2959
1358 Ga0495658_0001403 3300046683 Bacteria 12652
1359 Ga0495658_0048011 3300046683 Bacteria 2406
1360 Ga0495658_0251892 3300046683 Bacteria 1111
1361 Ga0495658_0357189 3300046683 Unclassified 929
1362 Ga0495658_0662063 3300046683 Bacteria 669
1363 Ga0495613_0102611 3300046689 Bacteria 2065
1364 Ga0495613_0168100 3300046689 Bacteria 1557
1365 Ga0495613_0312533 3300046689 Bacteria 1086
1366 Ga0495613_0387039 3300046689 Unclassified 955
1367 Ga0495613_0510664 3300046689 Unclassified 808
1368 Ga0495670_0290462 3300046691 Bacteria 875
1369 Ga0495600_0003971 3300046809 Bacteria 8786
1370 Ga0495581_0000659 3300047315 Bacteria 18109
1371 Ga0495581_0016943 3300047315 Bacteria 4234
1372 Ga0495581_0051860 3300047315 Bacteria 2369
1373 Ga0495581_0564619 3300047315 Unclassified 660
1374 Ga0495581_0636522 3300047315 Bacteria 617
1375 Ga0495604_0004192 3300047317 Bacteria 11427
1376 Ga0495604_0025411 3300047317 Bacteria 4720
1377 Ga0495604_0939967 3300047317 Unclassified 538
1378 Ga0495636_0095234 3300047318 Unclassified 1297
1379 Ga0495674_0007567 3300047319 Bacteria 10378
1380 Ga0495674_0032263 3300047319 Bacteria 4752
1381 Ga0495674_0043600 3300047319 Bacteria 3993
1382 Ga0495674_0894607 3300047319 Bacteria 686
1383 Ga0495680_0004788 3300047322 Bacteria 12847
1384 Ga0495680_0791030 3300047322 Bacteria 620
1385 Ga0495675_0002012 3300047444 Bacteria 12138
1386 Ga0495675_0057891 3300047444 Bacteria 2458
1387 Ga0495675_0070071 3300047444 Bacteria 2213
1388 Ga0495675_0075070 3300047444 Bacteria 2130
1389 Ga0495675_0402624 3300047444 Unclassified 798
1390 Ga0495675_0837854 3300047444 Unclassified 507
1391 Ga0495684_0001442 3300047471 Bacteria 19043
1392 Ga0495684_0024474 3300047471 Bacteria 4647
1393 Ga0495684_0063191 3300047471 Bacteria 2815
1394 Ga0495593_0000356 3300047673 Bacteria 25268
1395 Ga0495593_0111707 3300047673 Bacteria 1395
1396 Ga0495593_0133358 3300047673 Bacteria 1260
1397 Ga0495593_0509573 3300047673 Bacteria 603
1398 Ga0495602_0003996 3300048088 Bacteria 15368
1399 Ga0495602_0039288 3300048088 Bacteria 4360
1400 Ga0495602_0133381 3300048088 Bacteria 1977
1401 Ga0495614_0000638 3300048089 Bacteria 14664
1402 Ga0495614_0279277 3300048089 Unclassified 769
1403 Ga0495615_0073472 3300048090 Bacteria 926
1404 Ga0496100_0073025 3300048903 Bacteria 2295
1405 Ga0496100_0171604 3300048903 Bacteria 1562
1406 Ga0496100_0202865 3300048903 Bacteria 1446
1407 Ga0496100_0835443 3300048903 Unclassified 722
1408 Ga0496100_0848128 3300048903 Bacteria 717
1409 Ga0496100_1059323 3300048903 Unclassified 639
1410 Ga0496101_0038807 3300048904 Bacteria 3384
1411 Ga0496101_0077774 3300048904 Bacteria 2446
1412 Ga0496101_1050509 3300048904 Bacteria 640
1413 Ga0496102_0067085 3300048905 Bacteria 3290
1414 Ga0496102_0134419 3300048905 Bacteria 2317
1415 Ga0496102_0451550 3300048905 Unclassified 1206
1416 Ga0496102_0749520 3300048905 Bacteria 899
1417 Ga0496102_1123092 3300048905 Bacteria 706
1418 Ga0496103_0181794 3300048906 Unclassified 1351
1419 Ga0496103_0431769 3300048906 Bacteria 845
1420 Ga0496104_0004744 3300048907 Bacteria 11832
1421 Ga0496104_0183124 3300048907 Unclassified 2005
1422 Ga0496104_0623643 3300048907 Bacteria 988
1423 Ga0496105_0572812 3300048908 Bacteria 879
1424 Ga0496106_0012262 3300048909 Bacteria 6328
1425 Ga0496106_0053593 3300048909 Bacteria 3047
1426 Ga0496106_0467735 3300048909 Bacteria 1013
1427 Ga0496106_0644154 3300048909 Bacteria 847
1428 Ga0496106_0649088 3300048909 Bacteria 843
1429 Ga0496107_0177846 3300048910 Bacteria 1580
1430 Ga0496107_0294105 3300048910 Bacteria 1209
1431 Ga0496108_0005237 3300048911 Bacteria 10474
1432 Ga0496108_0017435 3300048911 Bacteria 5876
1433 Ga0496108_0180869 3300048911 Bacteria 1826
1434 Ga0496108_0820892 3300048911 Unclassified 801
1435 Ga0496109_0007523 3300048912 Bacteria 9228
1436 Ga0496109_0071352 3300048912 Bacteria 3188
1437 Ga0496109_0382259 3300048912 Bacteria 1330
1438 Ga0496109_2049924 3300048912 Bacteria 504
1439 Ga0496110_0029147 3300048913 Bacteria 4747
1440 Ga0496110_0080168 3300048913 Bacteria 2908
1441 Ga0496111_0032614 3300048914 Bacteria 3714
1442 Ga0496111_0115469 3300048914 Bacteria 1979
1443 Ga0496112_0001950 3300048915 Bacteria 16300
1444 Ga0496112_0022068 3300048915 Bacteria 6062
1445 Ga0496112_0889592 3300048915 Bacteria 813
1446 Ga0496113_0000769 3300048916 Bacteria 16520
1447 Ga0496113_0068922 3300048916 Bacteria 2685
1448 Ga0496113_0116662 3300048916 Bacteria 2084
1449 Ga0496114_0134245 3300048917 Bacteria 2139
1450 Ga0496114_0384593 3300048917 Bacteria 1242
1451 Ga0496115_0004680 3300048918 Bacteria 9915
1452 Ga0496115_0215545 3300048918 Unclassified 1585
1453 Ga0501306_036833 3300049127 Unclassified 747
1454 Ga0501309_062896 3300049129 Bacteria 600
1455 Ga0501304_027104 3300049160 Bacteria 594
1456 Ga0501290_016941 3300049513 Bacteria 974
1457 Ga0501291_039674 3300049514 Unclassified 824
1458 Ga0501294_011442 3300049517 Bacteria 883
1459 Ga0501297_044363 3300049520 Bacteria 636
1460 Ga0501298_059127 3300049521 Bacteria 809
1461 Ga0501298_113859 3300049521 Bacteria 630
1462 Ga0501299_123283 3300049522 Bacteria 627
1463 Ga0501299_157296 3300049522 Bacteria 578
1464 Ga0501311_048452 3300049527 Bacteria 661
1465 Ga0501311_058505 3300049527 Bacteria 618
1466 Ga0501313_027753 3300049529 Bacteria 724
1467 Ga0501314_036812 3300049530 Bacteria 560
1468 Ga0501315_102951 3300049531 Unclassified 506
1469 Ga0501316_045992 3300049532 Bacteria 619
1470 Ga0501317_080926 3300049533 Bacteria 562
1471 Ga0501323_043397 3300049539 Bacteria 665
1472 Ga0501323_065499 3300049539 Bacteria 574
1473 Ga0501325_027581 3300049541 Bacteria 634
1474 Ga0501340_016227 3300049556 Bacteria 593
1475 Ga0501340_026915 3300049556 Bacteria 507
1476 Ga0501032_0043085 3300049569 Bacteria 3059
1477 Ga0501032_0160958 3300049569 Bacteria 1474
1478 Ga0501033_0031074 3300049570 Bacteria 4015
1479 Ga0501034_1216412 3300049571 Bacteria 632
1480 Ga0501036_0038635 3300049572 Bacteria 4040
1481 Ga0501036_0200401 3300049572 Bacteria 1679
1482 Ga0501037_0241493 3300049573 Bacteria 1266
1483 Ga0501038_0108158 3300049574 Bacteria 2306
1484 Ga0501038_0581194 3300049574 Bacteria 849
1485 Ga0501039_0160910 3300049575 Bacteria 1765
1486 Ga0501040_1191822 3300049576 Bacteria 553
1487 Ga0501041_0073333 3300049577 Bacteria 2104
1488 Ga0501041_0134378 3300049577 Bacteria 1541
1489 Ga0501041_0668060 3300049577 Unclassified 664
1490 Ga0501042_0144495 3300049578 Bacteria 1715
1491 Ga0501042_0244581 3300049578 Bacteria 1294
1492 Ga0501043_0048272 3300049579 Bacteria 3347
1493 Ga0501043_0108258 3300049579 Bacteria 2183
1494 Ga0501046_0133310 3300049580 Bacteria 1883
1495 Ga0501046_0945160 3300049580 Bacteria 600
1496 Ga0501047_0216687 3300049581 Bacteria 1771
1497 Ga0501047_0243318 3300049581 Bacteria 1649
1498 Ga0501067_0000353 3300049583 Bacteria 25052
1499 Ga0501067_0044515 3300049583 Bacteria 2465
1500 Ga0501067_0257517 3300049583 Unclassified 971
1501 Ga0501067_0334725 3300049583 Bacteria 843
1502 Ga0501068_0001339 3300049584 Bacteria 13056
1503 Ga0501068_0084626 3300049584 Unclassified 1951
1504 Ga0501068_0831386 3300049584 Bacteria 606
1505 Ga0501069_0026566 3300049585 Bacteria 3170
1506 Ga0501069_0032090 3300049585 Unclassified 2891
1507 Ga0501069_0032461 3300049585 Unclassified 2874
1508 Ga0501069_0166828 3300049585 Bacteria 1269
1509 Ga0501070_0000192 3300049586 Bacteria 57359
1510 Ga0501070_0123099 3300049586 Bacteria 2143
1511 Ga0501070_0137205 3300049586 Unclassified 2020
1512 Ga0501070_0168786 3300049586 Bacteria 1803
1513 Ga0501070_0369431 3300049586 Bacteria 1163
1514 Ga0501070_0726126 3300049586 Bacteria 784
1515 Ga0501071_0000678 3300049587 Bacteria 17791
1516 Ga0501071_0325048 3300049587 Bacteria 1168
1517 Ga0501071_0591982 3300049587 Bacteria 853
1518 Ga0501071_0796005 3300049587 Unclassified 729
1519 Ga0501072_0009721 3300049588 Bacteria 7315
1520 Ga0501072_0078699 3300049588 Bacteria 2611
1521 Ga0501072_0409368 3300049588 Bacteria 1076
1522 Ga0501072_0962943 3300049588 Bacteria 666
1523 Ga0501072_1102293 3300049588 Bacteria 618
1524 Ga0501072_1230604 3300049588 Bacteria 581
1525 Ga0501073_0000949 3300049589 Bacteria 20906
1526 Ga0501073_0631350 3300049589 Bacteria 739
1527 Ga0501073_0790902 3300049589 Bacteria 654
1528 Ga0501074_0000171 3300049590 Bacteria 34937
1529 Ga0501074_0368537 3300049590 Bacteria 1019
1530 Ga0501076_0149239 3300049592 Bacteria 1901
1531 Ga0501076_0194593 3300049592 Bacteria 1655
1532 Ga0501202_079250 3300049652 Bacteria 769
1533 Ga0501206_044105 3300049653 Unclassified 695
1534 Ga0501211_051127 3300049658 Bacteria 513
1535 Ga0501216_079627 3300049660 Bacteria 691
1536 Ga0501216_133714 3300049660 Unclassified 577
1537 Ga0501217_042743 3300049661 Unclassified 1158
1538 Ga0501217_066451 3300049661 Bacteria 973
1539 Ga0501217_090548 3300049661 Bacteria 858
1540 Ga0501217_201734 3300049661 Bacteria 620
1541 Ga0501223_050772 3300049663 Bacteria 805
1542 Ga0501227_041230 3300049665 Bacteria 1141
1543 Ga0501230_029252 3300049667 Bacteria 1017
1544 Ga0501239_036423 3300049672 Bacteria 665
1545 Ga0501242_003701 3300049674 Bacteria 1666
1546 Ga0501243_014106 3300049675 Bacteria 1274
1547 Ga0501243_072468 3300049675 Bacteria 657
1548 Ga0501248_012725 3300049678 Bacteria 778
1549 Ga0501249_006910 3300049679 Bacteria 2339
1550 Ga0501249_014954 3300049679 Bacteria 1657
1551 Ga0501256_002047 3300049685 Bacteria 1571
1552 Ga0501257_025964 3300049686 Bacteria 1396
1553 Ga0501257_034172 3300049686 Unclassified 1234
1554 Ga0501261_097815 3300049690 Unclassified 554
1555 Ga0501225_0104002 3300049705 Bacteria 832
1556 Ga0501245_027410 3300049708 Bacteria 924
1557 Ga0501079_0076548 3300049741 Bacteria 2588
1558 Ga0501079_0142055 3300049741 Bacteria 1870
1559 Ga0501079_0218931 3300049741 Bacteria 1487
1560 Ga0501080_0000060 3300049742 Bacteria 71292
1561 Ga0501080_0005735 3300049742 Bacteria 11107
1562 Ga0501080_0111578 3300049742 Bacteria 2535
1563 Ga0501080_0247391 3300049742 Bacteria 1626
1564 Ga0501081_0337820 3300049743 Bacteria 1109
1565 Ga0501081_0376070 3300049743 Bacteria 1049
1566 Ga0501081_0931676 3300049743 Bacteria 655
1567 Ga0501083_0008037 3300049744 Bacteria 7464
1568 Ga0501083_0529860 3300049744 Bacteria 767
1569 Ga0501264_006568 3300049761 Bacteria 1073
1570 Ga0501268_001006 3300049765 Bacteria 3352
1571 Ga0501268_045841 3300049765 Bacteria 835
1572 Ga0501272_005087 3300049769 Bacteria 1377
1573 Ga0501273_005428 3300049770 Bacteria 1439
1574 Ga0501273_045094 3300049770 Bacteria 662
1575 Ga0501275_011114 3300049772 Bacteria 972
1576 Ga0501275_042240 3300049772 Bacteria 643
1577 Ga0501276_019420 3300049773 Bacteria 640
1578 Ga0501283_085767 3300049779 Bacteria 598
1579 Ga0501044_0006673 3300049823 Bacteria 12723
1580 Ga0501044_0384435 3300049823 Bacteria 1318
1581 Ga0501045_0059366 3300049824 Bacteria 2802
1582 Ga0501045_0457465 3300049824 Bacteria 948
1583 Ga0501204_040726 3300049850 Bacteria 680
1584 Ga0501220_08404 3300049852 Bacteria 543
1585 nmdc:mga05p37_1158346_c1 3300050507 Bacteria 803
1586 nmdc:mga05p37_2129497_c1 3300050507 Unclassified 524
1587 nmdc:mga05p37_24458_c1 3300050507 Bacteria 2422
1588 nmdc:mga05p37_259528_c1 3300050507 Bacteria 2080
1589 nmdc:mga05p37_313439_c1 3300050507 Bacteria 1859
1590 nmdc:mga05p37_328502_c1 3300050507 Bacteria 1807
1591 nmdc:mga05p37_372223_c1 3300050507 Bacteria 1676
1592 nmdc:mga05p37_81382_c1 3300050507 Bacteria 3989
1593 nmdc:mga05p37_82134_c1 3300050507 Bacteria 3970
1594 nmdc:mga05p37_830499_c1 3300050507 Bacteria 1006
1595 nmdc:mga09592_132413_c1 3300050508 Bacteria 2146
1596 nmdc:mga09592_132896_c1 3300050508 Unclassified 2142
1597 nmdc:mga09592_216657_c1 3300050508 Bacteria 1659
1598 nmdc:mga09592_72535_c1 3300050508 Bacteria 2923
1599 nmdc:mga0qj67_10094_c1 3300050509 Bacteria 7046
1600 nmdc:mga0qj67_1478095_c1 3300050509 Unclassified 523
1601 nmdc:mga0qj67_18195_c1 3300050509 Bacteria 5353
1602 nmdc:mga0qj67_3022_c1 3300050509 Bacteria 12093
1603 nmdc:mga0qj67_3465_c1 3300050509 Bacteria 11369
1604 nmdc:mga0qj67_37040_c1 3300050509 Unclassified 3819
1605 nmdc:mga0qj67_505202_c1 3300050509 Unclassified 972
1606 nmdc:mga0qj67_52160_c1 3300050509 Bacteria 3236
1607 nmdc:mga06r32_139003_c1 3300050510 Bacteria 2404
1608 nmdc:mga06r32_1637814_c1 3300050510 Bacteria 581
1609 nmdc:mga06r32_186579_c1 3300050510 Bacteria 2061
1610 nmdc:mga06r32_363451_c1 3300050510 Bacteria 1431
1611 nmdc:mga06r32_406801_c1 3300050510 Bacteria 1343
1612 nmdc:mga06r32_533345_c1 3300050510 Bacteria 1149
1613 nmdc:mga06r32_712109_c1 3300050510 Unclassified 969
1614 nmdc:mga06r32_73470_c1 3300050510 Bacteria 3313
1615 nmdc:mga06r32_77166_c1 3300050510 Bacteria 3236
1616 nmdc:mga06r32_812426_c1 3300050510 Unclassified 895
1617 nmdc:mga08y16_1335218_c1 3300050511 Bacteria 682
1618 nmdc:mga08y16_345174_c1 3300050511 Bacteria 1530
1619 nmdc:mga08y16_479660_c1 3300050511 Bacteria 1266
1620 nmdc:mga08y16_560798_c1 3300050511 Bacteria 1155
1621 nmdc:mga08y16_9037_c1 3300050511 Bacteria 10459
1622 nmdc:mga0n895_1454242_c1 3300050512 Bacteria 653
1623 nmdc:mga0n895_1552889_c1 3300050512 Bacteria 627
1624 nmdc:mga0n895_24093_c1 3300050512 Bacteria 5731
1625 nmdc:mga0n895_40283_c1 3300050512 Bacteria 4537
1626 nmdc:mga0n895_42112_c1 3300050512 Bacteria 4442
1627 nmdc:mga0n895_753427_c1 3300050512 Bacteria 967
1628 nmdc:mga0n895_770868_c1 3300050512 Bacteria 954
1629 nmdc:mga0rr50_196370_c1 3300050513 Bacteria 1656
1630 nmdc:mga0rr50_545513_c1 3300050513 Bacteria 987
1631 nmdc:mga0rr50_820594_c1 3300050513 Bacteria 793
1632 nmdc:mga08x19_12152_c1 3300050514 Bacteria 5183
1633 nmdc:mga08x19_425860_c1 3300050514 Unclassified 932
1634 nmdc:mga0a205_32863_c1 3300050515 Bacteria 4975
1635 nmdc:mga0a205_37088_c1 3300050515 Bacteria 4687
1636 nmdc:mga0a205_605389_c1 3300050515 Unclassified 949
1637 nmdc:mga0a205_646225_c1 3300050515 Bacteria 909
1638 Ga0495601_0003937 3300053077 Bacteria 8549
1639 Ga0495601_0081254 3300053077 Bacteria 2080
1640 Ga0495601_0084821 3300053077 Bacteria 2035
1641 Ga0495601_0840966 3300053077 Bacteria 581
1642 Ga0495612_0000490 3300053078 Bacteria 15773
1643 Ga0495595_0024258 3300053084 Bacteria 2678
1644 Ga0495619_0002629 3300053085 Bacteria 11736
1645 Ga0495619_0062774 3300053085 Bacteria 2474
1646 Ga0495619_0414562 3300053085 Unclassified 929
1647 Ga0501084_0081149 3300054114 Bacteria 2720
1648 Ga0501084_0095051 3300054114 Bacteria 2503
1649 Ga0501084_0170156 3300054114 Bacteria 1839
1650 Ga0501084_0184919 3300054114 Bacteria 1759
1651 Ga0590071_031312 3300059421 Bacteria 1268
1652 Ga0590071_043838 3300059421 Bacteria 1078
1653 Ga0590075_026983 3300059424 Bacteria 1447
1654 Ga0590075_045298 3300059424 Bacteria 1127
1655 Ga0590077_022697 3300059426 Unclassified 1340
1656 Ga0587066_078833 3300059490 Bacteria 709
1657 Ga0587070_143242 3300059491 Bacteria 592
1658 Ga0587073_0057828 3300059492 Bacteria 900
1659 Ga0587073_0117544 3300059492 Bacteria 713
1660 Ga0587077_128672 3300059493 Bacteria 640
1661 Ga0587083_0108493 3300059505 Unclassified 702
1662 Ga0587083_0153285 3300059505 Bacteria 624
1663 Ga0587083_0260290 3300059505 Bacteria 520
1664 Ga0587085_026550 3300059506 Unclassified 923
1665 Ga0587088_101991 3300059508 Bacteria 642
1666 Ga0587088_104734 3300059508 Bacteria 636
1667 Ga0587089_057672 3300059509 Unclassified 636
1668 Ga0587091_071005 3300059511 Bacteria 762
1669 Ga0587092_118003 3300059512 Bacteria 564
1670 Ga0587094_083647 3300059513 Unclassified 594
1671 Ga0587101_077787 3300059623 Unclassified 623
1672 Ga0587117_093637 3300059627 Unclassified 564
1673 Ga0587128_084766 3300059630 Bacteria 640
1674 Ga0587062_056317 3300059639 Unclassified 679
1675 Ga0587067_156622 3300059640 Bacteria 576
1676 Ga0587067_189136 3300059640 Bacteria 541
1677 Ga0587072_083036 3300059643 Bacteria 695
1678 Ga0587072_091123 3300059643 Bacteria 672
1679 Ga0587075_107383 3300059644 Unclassified 564
1680 Ga0587076_078824 3300059645 Bacteria 699
1681 Ga0587076_103535 3300059645 Bacteria 639
1682 Ga0501082_0036435 3300060353 Bacteria 4238
1683 Ga0501082_0160735 3300060353 Bacteria 1952
1684 Ga0501082_0206675 3300060353 Unclassified 1708
1685 Ga0466962_0514034 3300061719 Bacteria 607
1686 Ga0530510_0335764 3300061734 Bacteria 1134
1687 Ga0530510_1264863 3300061734 Bacteria 566
1688 Ga0070684_100387243
1689 JGI24750J21931_1019297
1690 JGI25406J46586_10052517
1691 rootL2_10101677
1692 Ga0032354_1121886
1693 Ga0058859_11814094
1694 Ga0058863_10023017
1695 Ga0058863_11749219
1696 Ga0058863_11766029
1697 Ga0058863_11873702
1698 Ga0058863_11972071
1699 Ga0058861_11621628
1700 Ga0058861_11623768
1701 Ga0058861_11793331
1702 Ga0058861_11819252
1703 Ga0058861_11862569
1704 Ga0058861_11977672
1705 Ga0058860_12016274
1706 Ga0058862_10007717
1707 Ga0058862_10139180
1708 Ga0058862_11895783
1709 Ga0058862_12536806
1710 Ga0058862_12551672
1711 Ga0058862_12614112
1712 Ga0058862_12730940
1713 Ga0058862_12733296
1714 Ga0058862_12860400
1715 Ga0058862_12875333
1716 Ga0065704_10156196
1717 Ga0065712_10002894
1718 Ga0065715_10162401
1719 Ga0065707_10113306
1720 Ga0070658_10009701
1721 Ga0070658_10035917
1722 Ga0070658_10091002
1723 Ga0070658_10188744
1724 Ga0070658_10265771
1725 Ga0070658_10295648
1726 Ga0070658_10569624
1727 Ga0070658_10586066
1728 Ga0070676_10004346
1729 Ga0070676_10830801
1730 Ga0070676_10948230
1731 Ga0070683_100000233
1732 Ga0070683_100007640
1733 Ga0070683_100021811
1734 Ga0070683_100050905
1735 Ga0070683_100088898
1736 Ga0070683_100104030
1737 Ga0070683_100141480
1738 Ga0070683_100153583
1739 Ga0070683_100225934
1740 Ga0070683_100318464
1741 Ga0070683_100567773
1742 Ga0070683_100697499
1743 Ga0070683_100729882
1744 Ga0070683_101339638
1745 Ga0070690_100045286
1746 Ga0070690_100430372
1747 Ga0070690_100568538
1748 Ga0070690_101566059
1749 Ga0070670_100007272
1750 Ga0070670_100965521
1751 Ga0070670_101308577
1752 Ga0070677_10119039
1753 Ga0070677_10445234
1754 Ga0068869_100010103
1755 Ga0068869_100057602
1756 Ga0068869_100895419
1757 Ga0070666_10117395
1758 Ga0070666_10127916
1759 Ga0070680_100027511
1760 Ga0070680_100028065
1761 Ga0070680_100043156
1762 Ga0070680_100050348
1763 Ga0070680_100069042
1764 Ga0070680_100087628
1765 Ga0070680_100314700
1766 Ga0070680_100373251
1767 Ga0070680_100378701
1768 Ga0070680_100442334
1769 Ga0070680_100471466
1770 Ga0070682_100125509
1771 Ga0070682_100229953
1772 Ga0070682_100382888
1773 Ga0070682_100556699
1774 Ga0070682_101686893
1775 Ga0070682_101724306
1776 Ga0068868_101341298
1777 Ga0070660_100012909
1778 Ga0070660_100125019
1779 Ga0070660_100666225
1780 Ga0070660_100741289
1781 Ga0070660_100785146
1782 Ga0070660_100945336
1783 Ga0070689_100125500
1784 Ga0070691_10021952
1785 Ga0070691_10178744
1786 Ga0070691_10353471
1787 Ga0070691_10856079
1788 Ga0070687_100014103
1789 Ga0070687_100275992
1790 Ga0070687_100301426
1791 Ga0070661_100002985
1792 Ga0070661_100003411
1793 Ga0070661_100003797
1794 Ga0070661_100015035
1795 Ga0070661_100035622
1796 Ga0070661_100065843
1797 Ga0070661_100092097
1798 Ga0070661_100978447
1799 Ga0070692_10104273
1800 Ga0070692_10452886
1801 Ga0070692_10455385
1802 Ga0070692_10543731
1803 Ga0070692_10798877
1804 Ga0070668_100003043
1805 Ga0070668_100110467
1806 Ga0070669_100003079
1807 Ga0070669_100006567
1808 Ga0070669_100017058
1809 Ga0070669_100628490
1810 Ga0070669_101526970
1811 Ga0070675_100002631
1812 Ga0070675_100002663
1813 Ga0070675_100129213
1814 Ga0070675_100443798
1815 Ga0070675_100538919
1816 Ga0070675_100628948
1817 Ga0070671_100023147
1818 Ga0070671_100119992
1819 Ga0070671_100306722
1820 Ga0070671_100948637
1821 Ga0070674_100002673
1822 Ga0070674_100005627
1823 Ga0070674_100090184
1824 Ga0070674_100716610
1825 Ga0070674_101373216
1826 Ga0070673_100071202
1827 Ga0070673_100174961
1828 Ga0070673_100423788
1829 Ga0070688_100002319
1830 Ga0070688_100210072
1831 Ga0070659_100008807
1832 Ga0070659_100045001
1833 Ga0070659_100098927
1834 Ga0070659_100125537
1835 Ga0070659_100182606
1836 Ga0070659_100372354
1837 Ga0070659_101093415
1838 Ga0070659_101305541
1839 Ga0070667_100078670
1840 Ga0070703_10045433
1841 Ga0070709_10004387
1842 Ga0070709_10127383
1843 Ga0070709_10250300
1844 Ga0070714_100017298
1845 Ga0070714_100059789
1846 Ga0070714_101233724
1847 Ga0070713_100007166
1848 Ga0070713_100044534
1849 Ga0070713_100116823
1850 Ga0070713_100460388
1851 Ga0070713_100497774
1852 Ga0070713_102030405
1853 Ga0070710_10184315
1854 Ga0070710_10208052
1855 Ga0070701_10066722
1856 Ga0070701_10081963
1857 Ga0070701_10197945
1858 Ga0070711_100032354
1859 Ga0070711_100093604
1860 Ga0070711_100197012
1861 Ga0070711_100551202
1862 Ga0070711_101492201
1863 Ga0070705_100008002
1864 Ga0070705_100260434
1865 Ga0070700_100084227
1866 Ga0070700_100273692
1867 Ga0070700_100426352
1868 Ga0070694_100026031
1869 Ga0070694_100071018
1870 Ga0070694_100389417
1871 Ga0070708_100000198
1872 Ga0070708_100319285
1873 Ga0070708_100319362
1874 Ga0070708_100335521
1875 Ga0070708_102155434
1876 Ga0070663_100006553
1877 Ga0070663_100026569
1878 Ga0070663_100426316
1879 Ga0070663_100462429
1880 Ga0070663_100628698
1881 Ga0070663_100846071
1882 Ga0070663_100969771
1883 Ga0070678_100216556
1884 Ga0070678_100318911
1885 Ga0070678_100941283
1886 Ga0070678_101712329
1887 Ga0070662_100005643
1888 Ga0070662_100008788
1889 Ga0070662_100317522
1890 Ga0070662_101025354
1891 Ga0070662_101027303
1892 Ga0070662_101457880
1893 Ga0070681_10000404
1894 Ga0070681_10002832
1895 Ga0070681_10003332
1896 Ga0070681_10003955
1897 Ga0070681_10010307
1898 Ga0070681_10039341
1899 Ga0070681_10044751
1900 Ga0070681_10061350
1901 Ga0070681_10169614
1902 Ga0070681_10330035
1903 Ga0070681_10363900
1904 Ga0070681_10543348
1905 Ga0070681_10586316
1906 Ga0070681_11039480
1907 Ga0070681_11206837
1908 Ga0070681_11206838
1909 Ga0070681_12049106
1910 Ga0068867_100005117
1911 Ga0068867_100010994
1912 Ga0068867_100080320
1913 Ga0068867_100937268
1914 Ga0068867_101231203
1915 Ga0068867_101566659
1916 Ga0070685_10237064
1917 Ga0070706_100180612
1918 Ga0070706_100638097
1919 Ga0070706_101174498
1920 Ga0070707_100172133
1921 Ga0070707_100253278
1922 Ga0070707_100338019
1923 Ga0070707_100748109
1924 Ga0070698_100012821
1925 Ga0070698_100033083
1926 Ga0070698_100060582
1927 Ga0070698_100245585
1928 Ga0070698_100297994
1929 Ga0070699_100075909
1930 Ga0070699_100142767
1931 Ga0070699_100269595
1932 Ga0070699_100762451
1933 Ga0070679_100000919
1934 Ga0070679_100001084
1935 Ga0070679_100006169
1936 Ga0070679_100043081
1937 Ga0070679_100043325
1938 Ga0070679_100095100
1939 Ga0070679_100245133
1940 Ga0070679_100359492
1941 Ga0070679_100408428
1942 Ga0070679_100670594
1943 Ga0070679_100702985
1944 Ga0070679_101279873
1945 Ga0070679_101506731
1946 Ga0070684_100006699
1947 Ga0070684_100024585
1948 Ga0070684_100038174
1949 Ga0070684_100043865
1950 Ga0070684_100076836
1951 Ga0070684_100297248
1952 Ga0070684_100301427
1953 Ga0070684_100365457
1954 Ga0070684_100390698
1955 Ga0070684_100725714
1956 Ga0070697_100659546
1957 Ga0068853_100013646
1958 Ga0068853_100016074
1959 Ga0068853_100487555
1960 Ga0068853_100531253
1961 Ga0068853_100600016
1962 Ga0068853_101020938
1963 Ga0070672_100004984
1964 Ga0070672_100005766
1965 Ga0070672_100206844
1966 Ga0070672_102093168
1967 Ga0070686_100256050
1968 Ga0070686_100505251
1969 Ga0070695_100001483
1970 Ga0070695_100246326
1971 Ga0070695_100441644
1972 Ga0070695_100461616
1973 Ga0070695_101161069
1974 Ga0070696_100001375
1975 Ga0070696_100007637
1976 Ga0070696_100077827
1977 Ga0070696_100091579
1978 Ga0070696_101883053
1979 Ga0070693_100008533
1980 Ga0070693_100013713
1981 Ga0070693_100057558
1982 Ga0070693_100503499
1983 Ga0070693_100912568
1984 Ga0070665_100042538
1985 Ga0070665_100052068
1986 Ga0070665_102600001
1987 Ga0070704_100227659
1988 Ga0070704_100285705
1989 Ga0070704_101093287
1990 Ga0068855_100002169
1991 Ga0068855_100005082
1992 Ga0068855_100008571
1993 Ga0068855_100043978
1994 Ga0068855_100366932
1995 Ga0068855_100381898
1996 Ga0068855_100646997
1997 Ga0068855_100990687
1998 Ga0068855_101054914
1999 Ga0068855_101547206
2000 Ga0070664_100013154
2001 Ga0070664_100024766
2002 Ga0070664_100051722
2003 Ga0070664_100485014
2004 Ga0070664_101004731
2005 Ga0070664_101389984
2006 Ga0068857_100012151
2007 Ga0068857_100012440
2008 Ga0068857_100015739
2009 Ga0068857_100020862
2010 Ga0068857_100087176
2011 Ga0068857_100736577
2012 Ga0068854_100000340
2013 Ga0068854_100034276
2014 Ga0068854_100053241
2015 Ga0068854_100420152
2016 Ga0068854_100745723
2017 Ga0068854_100790047
2018 Ga0068854_101739925
2019 Ga0068856_100364022
2020 Ga0068856_100457035
2021 Ga0068856_100648460
2022 Ga0068856_100680175
2023 Ga0068856_100941185
2024 Ga0068856_101002356
2025 Ga0070702_100015870
2026 Ga0070702_100518545
2027 Ga0068852_100014974
2028 Ga0068852_100018984
2029 Ga0068852_100069165
2030 Ga0068852_100192890
2031 Ga0068852_100202237
2032 Ga0068852_100546103
2033 Ga0068852_101079483
2034 Ga0068852_101434378
2035 Ga0068859_100056150
2036 Ga0068859_100897660
2037 Ga0068864_100005386
2038 Ga0068864_100038902
2039 Ga0068864_100318803
2040 Ga0068864_100369234
2041 Ga0068864_101236591
2042 Ga0068866_10000524
2043 Ga0068866_10116924
2044 Ga0068866_10376060
2045 Ga0068866_10812860
2046 Ga0068861_100001019
2047 Ga0068861_100049474
2048 Ga0068861_100289917
2049 Ga0068861_100944581
2050 Ga0068851_10015465
2051 Ga0068851_10071393
2052 Ga0068851_10269088
2053 Ga0068870_10002079
2054 Ga0068870_10304076
2055 Ga0068870_10408049
2056 Ga0068870_10428249
2057 Ga0068870_10492048
2058 Ga0068863_100041206
2059 Ga0068863_100160660
2060 Ga0068863_100319991
2061 Ga0068858_100022826
2062 Ga0068858_100321105
2063 Ga0068860_100040126
2064 Ga0068860_100227646
2065 Ga0068860_100535547
2066 Ga0068862_100000376
2067 Ga0068862_100030151
2068 Ga0068862_100126281
2069 Ga0081455_10038603
2070 Ga0081455_10050687
2071 Ga0081539_10000104
2072 Ga0081539_10043960
2073 Ga0081539_10230857
2074 Ga0070717_10016213
2075 Ga0070717_10418219
2076 Ga0070717_10918133
2077 Ga0075432_10382237
2078 Ga0070716_100172719
2079 Ga0070716_100338785
2080 Ga0070716_100489729
2081 Ga0070716_100573872
2082 Ga0070716_100851716
2083 Ga0070712_100012458
2084 Ga0070712_100028870
2085 Ga0070712_100062454
2086 Ga0070712_100347417
2087 Ga0070712_100413145
2088 Ga0070712_100488267
2089 Ga0097621_100208928
2090 Ga0068871_100139055
2091 Ga0068871_100407653
2092 Ga0075428_100235434
2093 Ga0075428_100397778
2094 Ga0075428_101094780
2095 Ga0075428_101376680
2096 Ga0075428_101708408
2097 Ga0075430_100003192
2098 Ga0075430_100013015
2099 Ga0075430_100019170
2100 Ga0075430_100029938
2101 Ga0075430_100194674
2102 Ga0075430_100269583
2103 Ga0075431_100024864
2104 Ga0075431_100037185
2105 Ga0075431_100053473
2106 Ga0075431_100065457
2107 Ga0075431_100076205
2108 Ga0075431_100135269
2109 Ga0075431_100186854
2110 Ga0075431_100236239
2111 Ga0075431_100247272
2112 Ga0075431_100373540
2113 Ga0075433_10005348
2114 Ga0075433_10718897
2115 Ga0075434_100001804
2116 Ga0075434_100035507
2117 Ga0075434_100244634
2118 Ga0075434_100261801
2119 Ga0075434_100873154
2120 Ga0075434_100881508
2121 Ga0075429_100067642
2122 Ga0075429_100208196
2123 Ga0075429_100453510
2124 Ga0075429_100470855
2125 Ga0068865_100001514
2126 Ga0068865_100117526
2127 Ga0068865_100628234
2128 Ga0075436_100114952
2129 Ga0075436_100194376
2130 Ga0075436_100209048
2131 Ga0097620_100056151
2132 Ga0097620_100897771
2133 Ga0075435_100694998
2134 Ga0075435_100980540
2135 Ga0075435_101112837
2136 Ga0075435_101766042
2137 Ga0105240_10009204
2138 Ga0105240_10011015
2139 Ga0105240_10016684
2140 Ga0105240_10037426
2141 Ga0105240_10046608
2142 Ga0105240_10070716
2143 Ga0105240_10074073
2144 Ga0105240_10090200
2145 Ga0105240_10705779
2146 Ga0105240_10890443
2147 Ga0105240_11048922
2148 Ga0111539_10042342
2149 Ga0111539_10088891
2150 Ga0111539_10150269
2151 Ga0111539_10251608
2152 Ga0111539_10920564
2153 Ga0105245_10025521
2154 Ga0105245_10036543
2155 Ga0105245_12730105
2156 Ga0105247_10439480
2157 Ga0114129_10017266
2158 Ga0114129_10068560
2159 Ga0114129_10230022
2160 Ga0114129_10273868
2161 Ga0114129_10299783
2162 Ga0114129_10477216
2163 Ga0114129_10941962
2164 Ga0114129_11407312
2165 Ga0105243_10042543
2166 Ga0105243_10242951
2167 Ga0105243_10590746
2168 Ga0105241_10000729
2169 Ga0105241_10024142
2170 Ga0105241_10116790
2171 Ga0105241_10169367
2172 Ga0105241_10525033
2173 Ga0105241_10717479
2174 Ga0105241_11098168
2175 Ga0105242_10006526
2176 Ga0105242_10015995
2177 Ga0105242_10181321
2178 Ga0105242_10993453
2179 Ga0105242_11994438
2180 Ga0105248_10009365
2181 Ga0105248_10011120
2182 Ga0105248_10104035
2183 Ga0105248_10916580
2184 Ga0105248_12078802
2185 Ga0105237_10079939
2186 Ga0105237_10149201
2187 Ga0105237_10431669
2188 Ga0105237_10472521
2189 Ga0105237_11009553
2190 Ga0105237_11127262
2191 Ga0105238_10024368
2192 Ga0105238_10066363
2193 Ga0105238_10073038
2194 Ga0105238_10087946
2195 Ga0105238_10325721
2196 Ga0105238_10816832
2197 Ga0105238_11465449
2198 Ga0105238_12277478
2199 Ga0105249_10000454
2200 Ga0105249_10069734
2201 Ga0105249_10190726
2202 Ga0105249_10325281
2203 Ga0105249_10809129
2204 Ga0105239_10147980
2205 Ga0105239_10231952
2206 Ga0105239_10259676
2207 Ga0105239_10382025
2208 Ga0105239_11245419
2209 Ga0105239_12469307
2210 Ga0105246_10055844
2211 Ga0105246_10471626
2212 Ga0157342_1073673
2213 Ga0157373_10001473
2214 Ga0157373_10027655
2215 Ga0157373_10091952
2216 Ga0157373_10152454
2217 Ga0157373_10201626
2218 Ga0157373_10237167
2219 Ga0157373_11331309
2220 Ga0157371_10007275
2221 Ga0157371_10714457
2222 Ga0157371_10743094
2223 Ga0157371_11534102
2224 Ga0157370_10003508
2225 Ga0157370_10008754
2226 Ga0157370_10041763
2227 Ga0157370_10136189
2228 Ga0157370_10165029
2229 Ga0157370_10166493
2230 Ga0157370_10282223
2231 Ga0157370_10861985
2232 Ga0157370_11117989
2233 Ga0157370_11609613
2234 Ga0157369_10009705
2235 Ga0157369_10017338
2236 Ga0157369_10073925
2237 Ga0157369_10115485
2238 Ga0157369_10117595
2239 Ga0157369_10119385
2240 Ga0157369_10232225
2241 Ga0157369_10232838
2242 Ga0157369_10739412
2243 Ga0157369_10743766
2244 Ga0157369_11755948
2245 Ga0157374_10433589
2246 Ga0157374_10990234
2247 Ga0157374_11098074
2248 Ga0157374_11385070
2249 Ga0157374_12425697
2250 Ga0157378_10005002
2251 Ga0157378_10016080
2252 Ga0157378_10429050
2253 Ga0163162_10001492
2254 Ga0163162_10013828
2255 Ga0163162_10075056
2256 Ga0163162_12869838
2257 Ga0163162_13441632
2258 Ga0157372_10010171
2259 Ga0157372_10013087
2260 Ga0157372_10015470
2261 Ga0157372_10025540
2262 Ga0157372_10068103
2263 Ga0157372_10118363
2264 Ga0157372_10124994
2265 Ga0157372_10252248
2266 Ga0157372_10317512
2267 Ga0157372_10367523
2268 Ga0157372_10382231
2269 Ga0157372_10509511
2270 Ga0157372_10519876
2271 Ga0157372_10617092
2272 Ga0157372_10636435
2273 Ga0157372_10659924
2274 Ga0157372_10696387
2275 Ga0157372_11287462
2276 Ga0157372_11664064
2277 Ga0157372_11736237
2278 Ga0157372_11902482
2279 Ga0157372_12279322
2280 Ga0157372_12346199
2281 Ga0157372_12369999
2282 Ga0157372_12614981
2283 Ga0157375_10091745
2284 Ga0157375_10100651
2285 Ga0157375_10294846
2286 Ga0157375_10840832
2287 Ga0163163_10070485
2288 Ga0163163_10660291
2289 Ga0157380_10007646
2290 Ga0157380_10033634
2291 Ga0157380_10148905
2292 Ga0157380_10278831
2293 Ga0157380_12670253
2294 Ga0182008_10009299
2295 Ga0182008_10081193
2296 Ga0157377_10031866
2297 Ga0157379_10015608
2298 Ga0157379_10064796
2299 Ga0157376_10093515
2300 Ga0157376_10225367
2301 Ga0157376_11130927
2302 Ga0157376_11883363
2303 Ga0182007_10042612
2304 Ga0182007_10073079
2305 Ga0182007_10210130
2306 Ga0182007_10215945
2307 Ga0182007_10254854
2308 Ga0182005_1079726
2309 Ga0163161_10150679
2310 Ga0163161_11802713
2311 Ga0197907_11166881
2312 Ga0197907_11314107
2313 Ga0206356_10116592
2314 Ga0206356_10125692
2315 Ga0206356_10416445
2316 Ga0206356_10483138
2317 Ga0206356_10839536
2318 Ga0206356_11361504
2319 Ga0206356_11525656
2320 Ga0206356_11642972
2321 Ga0206356_11798847
2322 Ga0206355_1012074
2323 Ga0206355_1360271
2324 Ga0206352_10641371
2325 Ga0206352_10860556
2326 Ga0206352_10936146
2327 Ga0206352_11130402
2328 Ga0206352_11362427
2329 Ga0206350_10135957
2330 Ga0213876_10040236
2331 Ga0224712_10152424
2332 Ga0224712_10316866
2333 Ga0224712_10352983
2334 Ga0224712_10681828
2335 Ga0207666_1047325
2336 Ga0207673_1009498
2337 Ga0207697_10005445
2338 Ga0207697_10112113
2339 Ga0207656_10006385
2340 Ga0207656_10172199
2341 Ga0207653_10092535
2342 Ga0207682_10168826
2343 Ga0207692_10101751
2344 Ga0207692_10231793
2345 Ga0207642_10069746
2346 Ga0207642_10150415
2347 Ga0207688_10023241
2348 Ga0207688_10186830
2349 Ga0207680_10113171
2350 Ga0207680_10213827
2351 Ga0207680_10821322
2352 Ga0207647_10195587
2353 Ga0207685_10513020
2354 Ga0207699_10008459
2355 Ga0207699_10045530
2356 Ga0207699_10106448
2357 Ga0207699_10106541
2358 Ga0207645_10000246
2359 Ga0207645_10000971
2360 Ga0207645_10067632
2361 Ga0207643_10001951
2362 Ga0207643_10076653
2363 Ga0207643_10131229
2364 Ga0207643_10266169
2365 Ga0207705_10007986
2366 Ga0207705_10085948
2367 Ga0207705_10089643
2368 Ga0207705_10092825
2369 Ga0207705_10104101
2370 Ga0207705_10568143
2371 Ga0207684_10135612
2372 Ga0207684_10299794
2373 Ga0207684_11538460
2374 Ga0207684_11568418
2375 Ga0207654_10000860
2376 Ga0207654_10222487
2377 Ga0207654_10324081
2378 Ga0207654_10756775
2379 Ga0207654_10955665
2380 Ga0207654_11030082
2381 Ga0207707_10000929
2382 Ga0207707_10002146
2383 Ga0207707_10002891
2384 Ga0207707_10007791
2385 Ga0207707_10013410
2386 Ga0207707_10018294
2387 Ga0207707_10021378
2388 Ga0207707_10029197
2389 Ga0207707_10075721
2390 Ga0207707_10138032
2391 Ga0207707_10629028
2392 Ga0207707_10649450
2393 Ga0207707_11269747
2394 Ga0207695_10001441
2395 Ga0207695_10004676
2396 Ga0207695_10008984
2397 Ga0207695_10014206
2398 Ga0207695_10020766
2399 Ga0207695_10044422
2400 Ga0207695_10064710
2401 Ga0207695_10081615
2402 Ga0207695_10084488
2403 Ga0207671_10019018
2404 Ga0207671_10131053
2405 Ga0207671_10390182
2406 Ga0207693_10019839
2407 Ga0207693_10041127
2408 Ga0207693_10361743
2409 Ga0207693_10406055
2410 Ga0207693_10410453
2411 Ga0207693_10421808
2412 Ga0207693_10613331
2413 Ga0207663_10001490
2414 Ga0207663_10080650
2415 Ga0207663_10172527
2416 Ga0207663_10243302
2417 Ga0207663_10898578
2418 Ga0207663_11205783
2419 Ga0207660_10001809
2420 Ga0207660_10017662
2421 Ga0207660_10032222
2422 Ga0207660_10065650
2423 Ga0207660_10087746
2424 Ga0207660_10090306
2425 Ga0207660_10101186
2426 Ga0207660_10141654
2427 Ga0207660_10218233
2428 Ga0207660_10239322
2429 Ga0207660_10918590
2430 Ga0207660_11133214
2431 Ga0207662_10003841
2432 Ga0207662_10105844
2433 Ga0207662_10244175
2434 Ga0207657_10005262
2435 Ga0207657_10021232
2436 Ga0207657_10237526
2437 Ga0207657_10250158
2438 Ga0207657_10541662
2439 Ga0207657_10685639
2440 Ga0207657_11469464
2441 Ga0207649_10029427
2442 Ga0207649_10050337
2443 Ga0207649_10096437
2444 Ga0207649_10165257
2445 Ga0207649_10174948
2446 Ga0207649_10852542
2447 Ga0207652_10000470
2448 Ga0207652_10003423
2449 Ga0207652_10007324
2450 Ga0207652_10020285
2451 Ga0207652_10022221
2452 Ga0207652_10024204
2453 Ga0207652_10031148
2454 Ga0207652_10086061
2455 Ga0207652_10088832
2456 Ga0207652_10267542
2457 Ga0207652_10564050
2458 Ga0207652_11525639
2459 Ga0207646_10123227
2460 Ga0207646_10142024
2461 Ga0207646_10424101
2462 Ga0207681_10009785
2463 Ga0207681_10054383
2464 Ga0207681_10066558
2465 Ga0207681_10221702
2466 Ga0207694_10023333
2467 Ga0207694_10137479
2468 Ga0207694_10209118
2469 Ga0207694_10360180
2470 Ga0207694_10664094
2471 Ga0207694_11230706
2472 Ga0207650_10004487
2473 Ga0207650_10101704
2474 Ga0207650_10104656
2475 Ga0207659_10003254
2476 Ga0207659_10009170
2477 Ga0207659_10555758
2478 Ga0207659_10642311
2479 Ga0207659_11039265
2480 Ga0207659_11089345
2481 Ga0207687_10039639
2482 Ga0207687_10073181
2483 Ga0207700_10038793
2484 Ga0207700_10054883
2485 Ga0207700_10089999
2486 Ga0207700_10123261
2487 Ga0207700_10243155
2488 Ga0207700_10337740
2489 Ga0207700_10819651
2490 Ga0207664_10025601
2491 Ga0207664_10039577
2492 Ga0207664_10119297
2493 Ga0207664_10167885
2494 Ga0207664_10572851
2495 Ga0207644_10035451
2496 Ga0207644_10257273
2497 Ga0207644_10686395
2498 Ga0207644_10722079
2499 Ga0207690_10012598
2500 Ga0207690_10037581
2501 Ga0207690_10042611
2502 Ga0207690_10044207
2503 Ga0207690_10068413
2504 Ga0207690_10278896
2505 Ga0207690_10747510
2506 Ga0207690_11017212
2507 Ga0207690_11587498
2508 Ga0207706_10000065
2509 Ga0207706_10000357
2510 Ga0207706_10297873
2511 Ga0207706_11025855
2512 Ga0207706_11312440
2513 Ga0207686_10001117
2514 Ga0207686_10171259
2515 Ga0207709_10004346
2516 Ga0207709_10567253
2517 Ga0207709_10740090
2518 Ga0207670_10120778
2519 Ga0207670_11386390
2520 Ga0207669_10001479
2521 Ga0207669_10015931
2522 Ga0207669_10077102
2523 Ga0207669_10215008
2524 Ga0207704_10058637
2525 Ga0207704_10414369
2526 Ga0207665_10157887
2527 Ga0207665_10226418
2528 Ga0207665_10407598
2529 Ga0207665_11088389
2530 Ga0207665_11404281
2531 Ga0207691_10001355
2532 Ga0207691_10001550
2533 Ga0207691_10022438
2534 Ga0207691_10131502
2535 Ga0207711_10028892
2536 Ga0207711_10222614
2537 Ga0207711_10908831
2538 Ga0207689_10001360
2539 Ga0207689_10007750
2540 Ga0207689_10665749
2541 Ga0207689_11505011
2542 Ga0207661_10011833
2543 Ga0207661_10019670
2544 Ga0207661_10022228
2545 Ga0207661_10032021
2546 Ga0207661_10037459
2547 Ga0207661_10068735
2548 Ga0207661_10323213
2549 Ga0207661_10716921
2550 Ga0207661_11987297
2551 Ga0207661_12145826
2552 Ga0207679_10000484
2553 Ga0207679_10006509
2554 Ga0207679_10024777
2555 Ga0207679_10271920
2556 Ga0207679_10276220
2557 Ga0207679_10602183
2558 Ga0207667_10011137
2559 Ga0207667_10019276
2560 Ga0207667_10081585
2561 Ga0207667_10187587
2562 Ga0207667_10950863
2563 Ga0207651_10058551
2564 Ga0207651_10150000
2565 Ga0207651_10452791
2566 Ga0207712_10001176
2567 Ga0207712_10044891
2568 Ga0207712_10130934
2569 Ga0207712_10481269
2570 Ga0207712_11682783
2571 Ga0207668_10021247
2572 Ga0207668_10053139
2573 Ga0207668_10730561
2574 Ga0207640_10001456
2575 Ga0207640_10050446
2576 Ga0207640_10104663
2577 Ga0207640_10110876
2578 Ga0207640_10286487
2579 Ga0207640_10370752
2580 Ga0207640_10501830
2581 Ga0207658_10060833
2582 Ga0207658_10178304
2583 Ga0207658_11525645
2584 Ga0207703_10156270
2585 Ga0207639_10004358
2586 Ga0207639_10116510
2587 Ga0207639_10150381
2588 Ga0207639_10331802
2589 Ga0207639_10517425
2590 Ga0207639_11916862
2591 Ga0207678_10041333
2592 Ga0207678_10041868
2593 Ga0207678_10068814
2594 Ga0207678_10423890
2595 Ga0207678_12011429
2596 Ga0207708_10098662
2597 Ga0207708_10104714
2598 Ga0207708_10154233
2599 Ga0207708_10751038
2600 Ga0207702_10057844
2601 Ga0207702_10071273
2602 Ga0207702_10745631
2603 Ga0207702_10915538
2604 Ga0207702_10990133
2605 Ga0207702_11682985
2606 Ga0207641_10107617
2607 Ga0207641_10345441
2608 Ga0207648_10001169
2609 Ga0207648_10005220
2610 Ga0207648_10023923
2611 Ga0207648_10046448
2612 Ga0207648_12191754
2613 Ga0207676_10048851
2614 Ga0207676_10093952
2615 Ga0207676_10142837
2616 Ga0207676_10163981
2617 Ga0207676_10343365
2618 Ga0207676_11694275
2619 Ga0207674_10003135
2620 Ga0207674_10015526
2621 Ga0207674_10018565
2622 Ga0207674_10059142
2623 Ga0207674_10140302
2624 Ga0207674_10296301
2625 Ga0207674_10677573
2626 Ga0207674_11584205
2627 Ga0207675_100000320
2628 Ga0207675_100032261
2629 Ga0207675_100059762
2630 Ga0207675_100314828
2631 Ga0207675_100341058
2632 Ga0207683_10033546
2633 Ga0207683_10041068
2634 Ga0207683_10059100
2635 Ga0207683_10295458
2636 Ga0207698_10007055
2637 Ga0207698_10013973
2638 Ga0207698_10256188
2639 Ga0207698_11013550
2640 Ga0207698_11089470
2641 Ga0207698_11123693
2642 Ga0207698_11183172
2643 Ga0207698_11211289
2644 Ga0207428_10075404
2645 Ga0207428_10258988
2646 Ga0268266_10083429
2647 Ga0268266_10102533
2648 Ga0268266_11123594
2649 Ga0268265_10002121
2650 Ga0268265_10037895
2651 Ga0268265_10266956
2652 Ga0268265_10715986
2653 Ga0268265_10802452
2654 Ga0268264_10022106
2655 Ga0268264_10480925
2656 Ga0268264_10488128
2657 Ga0316178_1053326
2658 Ga0307408_100008337
2659 Ga0307408_100187150
2660 Ga0307408_100297064
2661 Ga0307408_100368413
2662 Ga0307408_100559101
2663 Ga0307408_100875500
2664 Ga0307408_102494544
2665 Ga0316579_10111135
2666 Ga0316576_10002948
2667 Ga0316578_10013404
2668 Ga0316578_10015348
2669 Ga0307405_10000187
2670 Ga0307405_10014127
2671 Ga0307405_10036009
2672 Ga0307405_10092885
2673 Ga0307405_10144722
2674 Ga0307405_10154782
2675 Ga0307405_10173627
2676 Ga0307405_10258162
2677 Ga0307405_10406577
2678 Ga0307405_10487220
2679 Ga0307405_10986256
2680 Ga0307405_11102917
2681 Ga0307405_11372694
2682 Ga0307405_12113955
2683 Ga0307405_12137608
2684 Ga0316577_10002399
2685 Ga0316577_10025102
2686 Ga0307413_10000837
2687 Ga0307413_10002229
2688 Ga0307413_10030411
2689 Ga0307413_10042391
2690 Ga0307413_10055375
2691 Ga0307413_10073618
2692 Ga0307413_10140859
2693 Ga0307413_10171588
2694 Ga0307413_10284805
2695 Ga0307413_10457015
2696 Ga0307413_10640847
2697 Ga0307413_10817679
2698 Ga0307413_11214826
2699 Ga0307410_10002520
2700 Ga0307410_10012076
2701 Ga0307410_10015315
2702 Ga0307410_10022976
2703 Ga0307410_10027658
2704 Ga0307410_10070059
2705 Ga0307410_10127016
2706 Ga0307410_10249681
2707 Ga0307410_10272665
2708 Ga0307410_10314703
2709 Ga0307410_10337316
2710 Ga0307410_10344968
2711 Ga0307410_10345358
2712 Ga0307410_10498068
2713 Ga0307410_10549744
2714 Ga0307410_11023698
2715 Ga0307410_11691523
2716 Ga0307406_10001688
2717 Ga0307406_10002595
2718 Ga0307406_10014718
2719 Ga0307406_10023424
2720 Ga0307406_10028708
2721 Ga0307406_10043279
2722 Ga0307406_10085068
2723 Ga0307406_10108565
2724 Ga0307406_10146070
2725 Ga0307406_10230915
2726 Ga0307406_10260498
2727 Ga0307406_10362133
2728 Ga0307406_11611758
2729 Ga0307407_10000201
2730 Ga0307407_10004682
2731 Ga0307407_10008899
2732 Ga0307407_10024361
2733 Ga0307407_10027368
2734 Ga0307407_10085331
2735 Ga0307407_10091391
2736 Ga0307407_10116337
2737 Ga0307407_10124907
2738 Ga0307407_10333724
2739 Ga0307407_10342090
2740 Ga0307407_10379864
2741 Ga0307407_10441069
2742 Ga0307407_10525226
2743 Ga0307407_10962072
2744 Ga0307412_10012476
2745 Ga0307412_10028271
2746 Ga0307412_10129946
2747 Ga0307412_10193021
2748 Ga0307412_10234054
2749 Ga0307412_10398104
2750 Ga0307412_11261340
2751 Ga0307409_100000144
2752 Ga0307409_100003493
2753 Ga0307409_100009411
2754 Ga0307409_100009792
2755 Ga0307409_100023234
2756 Ga0307409_100026152
2757 Ga0307409_100027599
2758 Ga0307409_100033448
2759 Ga0307409_100048332
2760 Ga0307409_100118546
2761 Ga0307409_100126080
2762 Ga0307409_100186505
2763 Ga0307409_100254667
2764 Ga0307409_100383328
2765 Ga0307409_100556156
2766 Ga0307409_100717738
2767 Ga0307409_100867596
2768 Ga0307409_101141677
2769 Ga0307416_100000828
2770 Ga0307416_100004156
2771 Ga0307416_100007355
2772 Ga0307416_100012718
2773 Ga0307416_100014248
2774 Ga0307416_100024844
2775 Ga0307416_100049239
2776 Ga0307416_100073566
2777 Ga0307416_100073588
2778 Ga0307416_100120247
2779 Ga0307416_100247873
2780 Ga0307416_100356860
2781 Ga0307416_100450307
2782 Ga0307416_100477679
2783 Ga0307416_100511350
2784 Ga0307416_100735010
2785 Ga0307416_101424102
2786 Ga0307416_102811952
2787 Ga0307416_103058978
2788 Ga0307416_103753912
2789 Ga0307414_10002383
2790 Ga0307414_10006027
2791 Ga0307414_10030309
2792 Ga0307414_10043031
2793 Ga0307414_10090810
2794 Ga0307414_10345745
2795 Ga0307414_10408267
2796 Ga0307414_10426642
2797 Ga0307414_10465715
2798 Ga0307414_11271125
2799 Ga0307411_10001066
2800 Ga0307411_10006929
2801 Ga0307411_10007270
2802 Ga0307411_10017609
2803 Ga0307411_10028273
2804 Ga0307411_10045742
2805 Ga0307411_10062970
2806 Ga0307411_10141185
2807 Ga0307411_10147865
2808 Ga0307411_10166152
2809 Ga0307411_10208308
2810 Ga0307411_10276620
2811 Ga0307411_10282820
2812 Ga0307411_10531822
2813 Ga0307411_10645798
2814 Ga0307411_10663386
2815 Ga0307411_10672848
2816 Ga0307411_10773159
2817 Ga0307411_10858996
2818 Ga0307411_11345317
2819 Ga0307411_11551779
2820 Ga0307411_11809007
2821 Ga0307411_11845197
2822 Ga0307415_100000419
2823 Ga0307415_100002432
2824 Ga0307415_100021813
2825 Ga0307415_100036475
2826 Ga0307415_100041599
2827 Ga0307415_100051781
2828 Ga0307415_100125154
2829 Ga0307415_100143241
2830 Ga0307415_100459811
2831 Ga0307415_100490786
2832 Ga0307415_100970217
2833 Ga0307415_102463500
2834 Ga0316583_10003563
2835 Ga0316585_10006893
2836 Ga0316596_1143350
2837 Ga0373950_0167964
2838 Ga0373938_0040184
2839 Ga0373926_0004167
2840 Ga0373928_0048895
2841 Ga0373934_0005211
2842 Ga0373934_0037374
2843 Ga0373934_0040553
2844 Ga0373940_0070749
2845 Ga0373944_0396028
2846 Ga0373951_0051655
2847 Ga0373952_0095406
2848 Ga0373923_0007123
2849 Ga0373932_0198412
2850 Ga0373936_0011918
2851 Ga0373936_0128849
2852 Ga0373941_0333309
2853 Ga0373945_0258114
2854 Ga0373953_0002759
2855 Ga0373953_0009331
2856 Ga0373953_0568949
2857 Ga0373954_0057621
2858 Ga0373954_0066241
2859 Ga0373954_0440984
2860 Ga0373956_0000678
2861 Ga0373956_0113697
2862 Ga0373956_0548048
2863 Ga0373957_0099398
2864 Ga0373957_0165776
2865 Ga0373960_0139748
2866 Ga0373943_0016857
2867 Ga0373943_0028594
2868 Ga0373946_0009275
2869 Ga0373942_0342387
2870 Ga0373961_0059628
2871 Ga0316574_0204529
2872 Ga0316574_0695716
2873 Ga0373924_0002127
2874 Ga0373924_0285833
2875 Ga0373931_0018182
2876 Ga0373931_0018416
2877 Ga0373935_0018031
2878 Ga0373935_0063447
2879 Ga0373935_0124591
2880 Ga0373935_0378071
2881 Ga0373927_0026060
2882 Ga0373927_1094838
2883 Ga0373933_0001111
2884 Ga0373933_0013654
2885 Ga0373947_0002126
2886 Ga0373947_0048812
2887 Ga0373947_0115326
2888 Ga0373937_0002914
2889 Ga0373937_0065385
2890 Ga0373937_0096592
2891 Ga0316582_0026818
2892 Ga0316582_0075578
2893 Ga0316584_0009015
2894 Ga0373925_0034016
2895 Ga0373925_0216655
2896 Ga0373925_0592715
2897 Ga0395899_0038329
2898 Ga0395900_0005143
2899 Ga0395898_0365364
2900 Ga0395905_0049760
2901 Ga0395905_0117856
2902 Ga0395905_0624983
2903 Ga0395905_1377214
2904 Ga0316581_0052652
2905 Ga0436364_0287855
2906 Ga0395901_0003407
2907 Ga0395901_0694213
2908 Ga0395901_1490842
2909 Ga0242420_024104
2910 Ga0242420_054477
2911 Ga0436365_0290864
2912 Ga0436365_0304609
2913 Ga0436365_1159467
2914 Ga0436365_1602166
2915 Ga0436363_0390436
2916 Ga0436363_0732405
2917 Ga0439439_0021339
2918 Ga0451839_1205934
2919 Ga0451853_1987835
2920 Ga0439448_0040558
2921 Ga0439457_103357
2922 Ga0439462_0132713
2923 Ga0439446_0184978
2924 Ga0451577_0003975
2925 Ga0451577_0076398
2926 Ga0451577_0233619
2927 Ga0451577_0278304
2928 Ga0453683_0083881
2929 Ga0453683_1216232
2930 Ga0466965_0319755
2931 Ga0466966_0310517
2932 Ga0466966_0984788
2933 Ga0466961_0148652
2934 Ga0466964_0177363
2935 Ga0466964_0240783
2936 Ga0466964_0355081
2937 Ga0453684_1058605
2938 Ga0466971_0083762
2939 Ga0466971_0634884
2940 Ga0466970_0236236
2941 Ga0466957_1006802
2942 Ga0466957_1282518
2943 Ga0451576_0042077
2944 Ga0451576_0116352
2945 Ga0451576_0321037
2946 Ga0451576_0781793
2947 Ga0451576_1522734
2948 Ga0466958_0130129
2949 Ga0466958_0334514
2950 Ga0466967_0250970
2951 Ga0466967_0533636
2952 Ga0466967_0777573
2953 Ga0466967_2175858
2954 Ga0495592_0002525
2955 Ga0495592_0365590
2956 Ga0495592_0902943
2957 Ga0495603_0015387
2958 Ga0495603_0046197
2959 Ga0495603_0238765
2960 Ga0495629_0003115
2961 Ga0495629_0025075
2962 Ga0495629_0040407
2963 Ga0495629_0303378
2964 Ga0495629_0618441
2965 Ga0495629_1112862
2966 Ga0495651_0009970
2967 Ga0495651_0017083
2968 Ga0495651_0124418
2969 Ga0495651_0644771
2970 Ga0495653_0000547
2971 Ga0495653_0006042
2972 Ga0495653_0636764
2973 Ga0495580_0001189
2974 Ga0495580_0005504
2975 Ga0495580_0109372
2976 Ga0495580_0614116
2977 Ga0495580_1020227
2978 Ga0495582_0013598
2979 Ga0495582_0039450
2980 Ga0495582_0088607
2981 Ga0495582_0151791
2982 Ga0495582_0762531
2983 Ga0495639_0000549
2984 Ga0495639_0011675
2985 Ga0495639_0316237
2986 Ga0495662_0417003
2987 Ga0495664_0281001
2988 Ga0495664_0714430
2989 Ga0495585_0160087
2990 Ga0495594_0011878
2991 Ga0495594_0145232
2992 Ga0495607_0370303
2993 Ga0495608_0000405
2994 Ga0495608_0028611
2995 Ga0495618_0153235
2996 Ga0495628_0000494
2997 Ga0495628_0040700
2998 Ga0495628_0122008
2999 Ga0495630_0002236
3000 Ga0495630_0003849
3001 Ga0495630_0015750
3002 Ga0495630_0085082
3003 Ga0495663_0099594
3004 Ga0495666_0050611
3005 Ga0495652_0008315
3006 Ga0495652_0042274
3007 Ga0495665_0000358
3008 Ga0495665_0003130
3009 Ga0495665_0075851
3010 Ga0495665_0593238
3011 Ga0495640_0359579
3012 Ga0495586_0004190
3013 Ga0495587_0000269
3014 Ga0495587_0000334
3015 Ga0495587_0001945
3016 Ga0495587_0124263
3017 Ga0495621_0210913
3018 Ga0495621_0343511
3019 Ga0495645_0005088
3020 Ga0495645_0087646
3021 Ga0495622_0022950
3022 Ga0495622_0225599
3023 Ga0495633_0152348
3024 Ga0495667_0000504
3025 Ga0495667_0001705
3026 Ga0495667_0005981
3027 Ga0495634_0830558
3028 Ga0495635_0000200
3029 Ga0495635_0354627
3030 Ga0495659_0150507
3031 Ga0495659_0328021
3032 Ga0495659_0379927
3033 Ga0495588_0012498
3034 Ga0495588_0023908
3035 Ga0495657_0011939
3036 Ga0495657_0464029
3037 Ga0495657_0876098
3038 Ga0495599_0002011
3039 Ga0495599_0021680
3040 Ga0495599_0082661
3041 Ga0495623_0000156
3042 Ga0495623_0003024
3043 Ga0495623_0052162
3044 Ga0495646_0038350
3045 Ga0495658_0001403
3046 Ga0495658_0048011
3047 Ga0495658_0251892
3048 Ga0495658_0357189
3049 Ga0495658_0662063
3050 Ga0495613_0102611
3051 Ga0495613_0168100
3052 Ga0495613_0312533
3053 Ga0495613_0387039
3054 Ga0495613_0510664
3055 Ga0495670_0290462
3056 Ga0495600_0003971
3057 Ga0495581_0000659
3058 Ga0495581_0016943
3059 Ga0495581_0051860
3060 Ga0495581_0564619
3061 Ga0495581_0636522
3062 Ga0495604_0004192
3063 Ga0495604_0025411
3064 Ga0495604_0939967
3065 Ga0495636_0095234
3066 Ga0495674_0007567
3067 Ga0495674_0032263
3068 Ga0495674_0043600
3069 Ga0495674_0894607
3070 Ga0495680_0004788
3071 Ga0495680_0791030
3072 Ga0495675_0002012
3073 Ga0495675_0057891
3074 Ga0495675_0070071
3075 Ga0495675_0075070
3076 Ga0495675_0402624
3077 Ga0495675_0837854
3078 Ga0495684_0001442
3079 Ga0495684_0024474
3080 Ga0495684_0063191
3081 Ga0495593_0000356
3082 Ga0495593_0111707
3083 Ga0495593_0133358
3084 Ga0495593_0509573
3085 Ga0495602_0003996
3086 Ga0495602_0039288
3087 Ga0495602_0133381
3088 Ga0495614_0000638
3089 Ga0495614_0279277
3090 Ga0495615_0073472
3091 Ga0496100_0073025
3092 Ga0496100_0171604
3093 Ga0496100_0202865
3094 Ga0496100_0835443
3095 Ga0496100_0848128
3096 Ga0496100_1059323
3097 Ga0496101_0038807
3098 Ga0496101_0077774
3099 Ga0496101_1050509
3100 Ga0496102_0067085
3101 Ga0496102_0134419
3102 Ga0496102_0451550
3103 Ga0496102_0749520
3104 Ga0496102_1123092
3105 Ga0496103_0181794
3106 Ga0496103_0431769
3107 Ga0496104_0004744
3108 Ga0496104_0183124
3109 Ga0496104_0623643
3110 Ga0496105_0572812
3111 Ga0496106_0012262
3112 Ga0496106_0053593
3113 Ga0496106_0467735
3114 Ga0496106_0644154
3115 Ga0496106_0649088
3116 Ga0496107_0177846
3117 Ga0496107_0294105
3118 Ga0496108_0005237
3119 Ga0496108_0017435
3120 Ga0496108_0180869
3121 Ga0496108_0820892
3122 Ga0496109_0007523
3123 Ga0496109_0071352
3124 Ga0496109_0382259
3125 Ga0496109_2049924
3126 Ga0496110_0029147
3127 Ga0496110_0080168
3128 Ga0496111_0032614
3129 Ga0496111_0115469
3130 Ga0496112_0001950
3131 Ga0496112_0022068
3132 Ga0496112_0889592
3133 Ga0496113_0000769
3134 Ga0496113_0068922
3135 Ga0496113_0116662
3136 Ga0496114_0134245
3137 Ga0496114_0384593
3138 Ga0496115_0004680
3139 Ga0496115_0215545
3140 Ga0501306_036833
3141 Ga0501309_062896
3142 Ga0501304_027104
3143 Ga0501290_016941
3144 Ga0501291_039674
3145 Ga0501294_011442
3146 Ga0501297_044363
3147 Ga0501298_059127
3148 Ga0501298_113859
3149 Ga0501299_123283
3150 Ga0501299_157296
3151 Ga0501311_048452
3152 Ga0501311_058505
3153 Ga0501313_027753
3154 Ga0501314_036812
3155 Ga0501315_102951
3156 Ga0501316_045992
3157 Ga0501317_080926
3158 Ga0501323_043397
3159 Ga0501323_065499
3160 Ga0501325_027581
3161 Ga0501340_016227
3162 Ga0501340_026915
3163 Ga0501032_0043085
3164 Ga0501032_0160958
3165 Ga0501033_0031074
3166 Ga0501034_1216412
3167 Ga0501036_0038635
3168 Ga0501036_0200401
3169 Ga0501037_0241493
3170 Ga0501038_0108158
3171 Ga0501038_0581194
3172 Ga0501039_0160910
3173 Ga0501040_1191822
3174 Ga0501041_0073333
3175 Ga0501041_0134378
3176 Ga0501041_0668060
3177 Ga0501042_0144495
3178 Ga0501042_0244581
3179 Ga0501043_0048272
3180 Ga0501043_0108258
3181 Ga0501046_0133310
3182 Ga0501046_0945160
3183 Ga0501047_0216687
3184 Ga0501047_0243318
3185 Ga0501067_0000353
3186 Ga0501067_0044515
3187 Ga0501067_0257517
3188 Ga0501067_0334725
3189 Ga0501068_0001339
3190 Ga0501068_0084626
3191 Ga0501068_0831386
3192 Ga0501069_0026566
3193 Ga0501069_0032090
3194 Ga0501069_0032461
3195 Ga0501069_0166828
3196 Ga0501070_0000192
3197 Ga0501070_0123099
3198 Ga0501070_0137205
3199 Ga0501070_0168786
3200 Ga0501070_0369431
3201 Ga0501070_0726126
3202 Ga0501071_0000678
3203 Ga0501071_0325048
3204 Ga0501071_0591982
3205 Ga0501071_0796005
3206 Ga0501072_0009721
3207 Ga0501072_0078699
3208 Ga0501072_0409368
3209 Ga0501072_0962943
3210 Ga0501072_1102293
3211 Ga0501072_1230604
3212 Ga0501073_0000949
3213 Ga0501073_0631350
3214 Ga0501073_0790902
3215 Ga0501074_0000171
3216 Ga0501074_0368537
3217 Ga0501076_0149239
3218 Ga0501076_0194593
3219 Ga0501202_079250
3220 Ga0501206_044105
3221 Ga0501211_051127
3222 Ga0501216_079627
3223 Ga0501216_133714
3224 Ga0501217_042743
3225 Ga0501217_066451
3226 Ga0501217_090548
3227 Ga0501217_201734
3228 Ga0501223_050772
3229 Ga0501227_041230
3230 Ga0501230_029252
3231 Ga0501239_036423
3232 Ga0501242_003701
3233 Ga0501243_014106
3234 Ga0501243_072468
3235 Ga0501248_012725
3236 Ga0501249_006910
3237 Ga0501249_014954
3238 Ga0501256_002047
3239 Ga0501257_025964
3240 Ga0501257_034172
3241 Ga0501261_097815
3242 Ga0501225_0104002
3243 Ga0501245_027410
3244 Ga0501079_0076548
3245 Ga0501079_0142055
3246 Ga0501079_0218931
3247 Ga0501080_0000060
3248 Ga0501080_0005735
3249 Ga0501080_0111578
3250 Ga0501080_0247391
3251 Ga0501081_0337820
3252 Ga0501081_0376070
3253 Ga0501081_0931676
3254 Ga0501083_0008037
3255 Ga0501083_0529860
3256 Ga0501264_006568
3257 Ga0501268_001006
3258 Ga0501268_045841
3259 Ga0501272_005087
3260 Ga0501273_005428
3261 Ga0501273_045094
3262 Ga0501275_011114
3263 Ga0501275_042240
3264 Ga0501276_019420
3265 Ga0501283_085767
3266 Ga0501044_0006673
3267 Ga0501044_0384435
3268 Ga0501045_0059366
3269 Ga0501045_0457465
3270 Ga0501204_040726
3271 Ga0501220_08404
3272 nmdc:mga05p37_1158346_c1
3273 nmdc:mga05p37_2129497_c1
3274 nmdc:mga05p37_24458_c1
3275 nmdc:mga05p37_259528_c1
3276 nmdc:mga05p37_313439_c1
3277 nmdc:mga05p37_328502_c1
3278 nmdc:mga05p37_372223_c1
3279 nmdc:mga05p37_81382_c1
3280 nmdc:mga05p37_82134_c1
3281 nmdc:mga05p37_830499_c1
3282 nmdc:mga09592_132413_c1
3283 nmdc:mga09592_132896_c1
3284 nmdc:mga09592_216657_c1
3285 nmdc:mga09592_72535_c1
3286 nmdc:mga0qj67_10094_c1
3287 nmdc:mga0qj67_1478095_c1
3288 nmdc:mga0qj67_18195_c1
3289 nmdc:mga0qj67_3022_c1
3290 nmdc:mga0qj67_3465_c1
3291 nmdc:mga0qj67_37040_c1
3292 nmdc:mga0qj67_505202_c1
3293 nmdc:mga0qj67_52160_c1
3294 nmdc:mga06r32_139003_c1
3295 nmdc:mga06r32_1637814_c1
3296 nmdc:mga06r32_186579_c1
3297 nmdc:mga06r32_363451_c1
3298 nmdc:mga06r32_406801_c1
3299 nmdc:mga06r32_533345_c1
3300 nmdc:mga06r32_712109_c1
3301 nmdc:mga06r32_73470_c1
3302 nmdc:mga06r32_77166_c1
3303 nmdc:mga06r32_812426_c1
3304 nmdc:mga08y16_1335218_c1
3305 nmdc:mga08y16_345174_c1
3306 nmdc:mga08y16_479660_c1
3307 nmdc:mga08y16_560798_c1
3308 nmdc:mga08y16_9037_c1
3309 nmdc:mga0n895_1454242_c1
3310 nmdc:mga0n895_1552889_c1
3311 nmdc:mga0n895_24093_c1
3312 nmdc:mga0n895_40283_c1
3313 nmdc:mga0n895_42112_c1
3314 nmdc:mga0n895_753427_c1
3315 nmdc:mga0n895_770868_c1
3316 nmdc:mga0rr50_196370_c1
3317 nmdc:mga0rr50_545513_c1
3318 nmdc:mga0rr50_820594_c1
3319 nmdc:mga08x19_12152_c1
3320 nmdc:mga08x19_425860_c1
3321 nmdc:mga0a205_32863_c1
3322 nmdc:mga0a205_37088_c1
3323 nmdc:mga0a205_605389_c1
3324 nmdc:mga0a205_646225_c1
3325 Ga0495601_0003937
3326 Ga0495601_0081254
3327 Ga0495601_0084821
3328 Ga0495601_0840966
3329 Ga0495612_0000490
3330 Ga0495595_0024258
3331 Ga0495619_0002629
3332 Ga0495619_0062774
3333 Ga0495619_0414562
3334 Ga0501084_0081149
3335 Ga0501084_0095051
3336 Ga0501084_0170156
3337 Ga0501084_0184919
3338 Ga0590071_031312
3339 Ga0590071_043838
3340 Ga0590075_026983
3341 Ga0590075_045298
3342 Ga0590077_022697
3343 Ga0587066_078833
3344 Ga0587070_143242
3345 Ga0587073_0057828
3346 Ga0587073_0117544
3347 Ga0587077_128672
3348 Ga0587083_0108493
3349 Ga0587083_0153285
3350 Ga0587083_0260290
3351 Ga0587085_026550
3352 Ga0587088_101991
3353 Ga0587088_104734
3354 Ga0587089_057672
3355 Ga0587091_071005
3356 Ga0587092_118003
3357 Ga0587094_083647
3358 Ga0587101_077787
3359 Ga0587117_093637
3360 Ga0587128_084766
3361 Ga0587062_056317
3362 Ga0587067_156622
3363 Ga0587067_189136
3364 Ga0587072_083036
3365 Ga0587072_091123
3366 Ga0587075_107383
3367 Ga0587076_078824
3368 Ga0587076_103535
3369 Ga0501082_0036435
3370 Ga0501082_0160735
3371 Ga0501082_0206675
3372 Ga0466962_0514034
3373 Ga0530510_0335764
3374 Ga0530510_1264863

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

4

107

0.96

PF13466

STAS_2

STAS domain

15

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9495 3 109
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.9366 2 105
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.934 2 109
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.9295 2 109
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9268 2 98
ID Description Score Start End Superfamily
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9293 6 108 3.30.750.24
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9241 44 109 3.30.750.24
af_A0A0R0KL09_2_75_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.92 52 109 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9176 2 109 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9138 2 109 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7W1H9L1-F1-model_v4 Anti-sigma factor antagonist 1.006 1 110 GO:0043856
AF-A0A7X5WEP3-F1-model_v4 deleted 1.005 1 110
AF-A0A2G4IH21-F1-model_v4 Anti-sigma factor antagonist 1.005 1 110 GO:0043856
AF-A0A7X4BDD0-F1-model_v4 Anti-sigma factor antagonist 1.001 1 107 GO:0043856
AF-A0A6B1FRW9-F1-model_v4 deleted 1.001 3 107

Map