F495335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1687 | 482 | 3374 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100387243|Ga0070684_1003872433 |
| Length | 111 |
| Sequence | MAFTQSRQQNGVLVVRSDGQLIVGNRHELKELVQGALAAGDRRFVLDFSHTGYIDSSGLGALVTVARQVRELGGEMRLAGLNDDLRSLFELTKLDTLFAIADSPAQALAGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 222 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 223 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 237 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 238 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 292 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 375 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 377 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 378 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 379 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 412 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 413 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 414 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 415 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 416 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 417 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 418 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 419 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 420 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 421 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 422 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 424 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 425 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 426 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 434 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 435 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 436 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 437 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 438 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 439 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 443 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 444 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 460 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 461 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 482 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 5.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 96.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070684_100387243 | 3300005535 | Bacteria | 1288 |
| 2 | JGI24750J21931_1019297 | 3300002070 | Bacteria | 944 |
| 3 | JGI25406J46586_10052517 | 3300003203 | Bacteria | 1357 |
| 4 | rootL2_10101677 | 3300003322 | Bacteria | 1969 |
| 5 | Ga0032354_1121886 | 3300003693 | Bacteria | 633 |
| 6 | Ga0058859_11814094 | 3300004798 | Bacteria | 531 |
| 7 | Ga0058863_10023017 | 3300004799 | Bacteria | 973 |
| 8 | Ga0058863_11749219 | 3300004799 | Bacteria | 515 |
| 9 | Ga0058863_11766029 | 3300004799 | Bacteria | 957 |
| 10 | Ga0058863_11873702 | 3300004799 | Bacteria | 1002 |
| 11 | Ga0058863_11972071 | 3300004799 | Bacteria | 655 |
| 12 | Ga0058861_11621628 | 3300004800 | Unclassified | 686 |
| 13 | Ga0058861_11623768 | 3300004800 | Bacteria | 655 |
| 14 | Ga0058861_11793331 | 3300004800 | Bacteria | 1332 |
| 15 | Ga0058861_11819252 | 3300004800 | Unclassified | 612 |
| 16 | Ga0058861_11862569 | 3300004800 | Bacteria | 1133 |
| 17 | Ga0058861_11977672 | 3300004800 | Bacteria | 1094 |
| 18 | Ga0058860_12016274 | 3300004801 | Bacteria | 548 |
| 19 | Ga0058862_10007717 | 3300004803 | Bacteria | 705 |
| 20 | Ga0058862_10139180 | 3300004803 | Bacteria | 889 |
| 21 | Ga0058862_11895783 | 3300004803 | Unclassified | 575 |
| 22 | Ga0058862_12536806 | 3300004803 | Bacteria | 589 |
| 23 | Ga0058862_12551672 | 3300004803 | Bacteria | 568 |
| 24 | Ga0058862_12614112 | 3300004803 | Bacteria | 793 |
| 25 | Ga0058862_12730940 | 3300004803 | Unclassified | 831 |
| 26 | Ga0058862_12733296 | 3300004803 | Unclassified | 560 |
| 27 | Ga0058862_12860400 | 3300004803 | Bacteria | 1470 |
| 28 | Ga0058862_12875333 | 3300004803 | Bacteria | 669 |
| 29 | Ga0065704_10156196 | 3300005289 | Bacteria | 1382 |
| 30 | Ga0065712_10002894 | 3300005290 | Bacteria | 4082 |
| 31 | Ga0065715_10162401 | 3300005293 | Bacteria | 1617 |
| 32 | Ga0065707_10113306 | 3300005295 | Bacteria | 2332 |
| 33 | Ga0070658_10009701 | 3300005327 | Bacteria | 7729 |
| 34 | Ga0070658_10035917 | 3300005327 | Bacteria | 3993 |
| 35 | Ga0070658_10091002 | 3300005327 | Bacteria | 2514 |
| 36 | Ga0070658_10188744 | 3300005327 | Bacteria | 1737 |
| 37 | Ga0070658_10265771 | 3300005327 | Bacteria | 1458 |
| 38 | Ga0070658_10295648 | 3300005327 | Bacteria | 1380 |
| 39 | Ga0070658_10569624 | 3300005327 | Bacteria | 980 |
| 40 | Ga0070658_10586066 | 3300005327 | Bacteria | 966 |
| 41 | Ga0070676_10004346 | 3300005328 | Bacteria | 7442 |
| 42 | Ga0070676_10830801 | 3300005328 | Bacteria | 684 |
| 43 | Ga0070676_10948230 | 3300005328 | Bacteria | 643 |
| 44 | Ga0070683_100000233 | 3300005329 | Bacteria | 38043 |
| 45 | Ga0070683_100007640 | 3300005329 | Bacteria | 9148 |
| 46 | Ga0070683_100021811 | 3300005329 | Bacteria | 5717 |
| 47 | Ga0070683_100050905 | 3300005329 | Bacteria | 3836 |
| 48 | Ga0070683_100088898 | 3300005329 | Bacteria | 2899 |
| 49 | Ga0070683_100104030 | 3300005329 | Bacteria | 2676 |
| 50 | Ga0070683_100141480 | 3300005329 | Bacteria | 2279 |
| 51 | Ga0070683_100153583 | 3300005329 | Bacteria | 2183 |
| 52 | Ga0070683_100225934 | 3300005329 | Bacteria | 1779 |
| 53 | Ga0070683_100318464 | 3300005329 | Bacteria | 1480 |
| 54 | Ga0070683_100567773 | 3300005329 | Bacteria | 1085 |
| 55 | Ga0070683_100697499 | 3300005329 | Bacteria | 972 |
| 56 | Ga0070683_100729882 | 3300005329 | Bacteria | 949 |
| 57 | Ga0070683_101339638 | 3300005329 | Bacteria | 688 |
| 58 | Ga0070690_100045286 | 3300005330 | Bacteria | 2794 |
| 59 | Ga0070690_100430372 | 3300005330 | Unclassified | 975 |
| 60 | Ga0070690_100568538 | 3300005330 | Bacteria | 857 |
| 61 | Ga0070690_101566059 | 3300005330 | Bacteria | 533 |
| 62 | Ga0070670_100007272 | 3300005331 | Bacteria | 9388 |
| 63 | Ga0070670_100965521 | 3300005331 | Bacteria | 774 |
| 64 | Ga0070670_101308577 | 3300005331 | Bacteria | 663 |
| 65 | Ga0070677_10119039 | 3300005333 | Bacteria | 1190 |
| 66 | Ga0070677_10445234 | 3300005333 | Unclassified | 692 |
| 67 | Ga0068869_100010103 | 3300005334 | Bacteria | 6142 |
| 68 | Ga0068869_100057602 | 3300005334 | Bacteria | 2837 |
| 69 | Ga0068869_100895419 | 3300005334 | Bacteria | 768 |
| 70 | Ga0070666_10117395 | 3300005335 | Bacteria | 1843 |
| 71 | Ga0070666_10127916 | 3300005335 | Bacteria | 1764 |
| 72 | Ga0070680_100027511 | 3300005336 | Bacteria | 4553 |
| 73 | Ga0070680_100028065 | 3300005336 | Bacteria | 4513 |
| 74 | Ga0070680_100043156 | 3300005336 | Bacteria | 3662 |
| 75 | Ga0070680_100050348 | 3300005336 | Bacteria | 3397 |
| 76 | Ga0070680_100069042 | 3300005336 | Bacteria | 2901 |
| 77 | Ga0070680_100087628 | 3300005336 | Bacteria | 2575 |
| 78 | Ga0070680_100314700 | 3300005336 | Bacteria | 1328 |
| 79 | Ga0070680_100373251 | 3300005336 | Bacteria | 1214 |
| 80 | Ga0070680_100378701 | 3300005336 | Bacteria | 1205 |
| 81 | Ga0070680_100442334 | 3300005336 | Bacteria | 1110 |
| 82 | Ga0070680_100471466 | 3300005336 | Bacteria | 1073 |
| 83 | Ga0070682_100125509 | 3300005337 | Bacteria | 1729 |
| 84 | Ga0070682_100229953 | 3300005337 | Bacteria | 1325 |
| 85 | Ga0070682_100382888 | 3300005337 | Bacteria | 1058 |
| 86 | Ga0070682_100556699 | 3300005337 | Unclassified | 898 |
| 87 | Ga0070682_101686893 | 3300005337 | Unclassified | 550 |
| 88 | Ga0070682_101724306 | 3300005337 | Unclassified | 545 |
| 89 | Ga0068868_101341298 | 3300005338 | Unclassified | 665 |
| 90 | Ga0070660_100012909 | 3300005339 | Bacteria | 5977 |
| 91 | Ga0070660_100125019 | 3300005339 | Bacteria | 2055 |
| 92 | Ga0070660_100666225 | 3300005339 | Bacteria | 872 |
| 93 | Ga0070660_100741289 | 3300005339 | Bacteria | 825 |
| 94 | Ga0070660_100785146 | 3300005339 | Bacteria | 801 |
| 95 | Ga0070660_100945336 | 3300005339 | Bacteria | 728 |
| 96 | Ga0070689_100125500 | 3300005340 | Bacteria | 2053 |
| 97 | Ga0070691_10021952 | 3300005341 | Bacteria | 2958 |
| 98 | Ga0070691_10178744 | 3300005341 | Bacteria | 1103 |
| 99 | Ga0070691_10353471 | 3300005341 | Bacteria | 817 |
| 100 | Ga0070691_10856079 | 3300005341 | Unclassified | 558 |
| 101 | Ga0070687_100014103 | 3300005343 | Bacteria | 3582 |
| 102 | Ga0070687_100275992 | 3300005343 | Bacteria | 1056 |
| 103 | Ga0070687_100301426 | 3300005343 | Bacteria | 1017 |
| 104 | Ga0070661_100002985 | 3300005344 | Bacteria | 11659 |
| 105 | Ga0070661_100003411 | 3300005344 | Bacteria | 10978 |
| 106 | Ga0070661_100003797 | 3300005344 | Bacteria | 10410 |
| 107 | Ga0070661_100015035 | 3300005344 | Bacteria | 5460 |
| 108 | Ga0070661_100035622 | 3300005344 | Bacteria | 3615 |
| 109 | Ga0070661_100065843 | 3300005344 | Bacteria | 2662 |
| 110 | Ga0070661_100092097 | 3300005344 | Bacteria | 2245 |
| 111 | Ga0070661_100978447 | 3300005344 | Bacteria | 701 |
| 112 | Ga0070692_10104273 | 3300005345 | Bacteria | 1559 |
| 113 | Ga0070692_10452886 | 3300005345 | Bacteria | 822 |
| 114 | Ga0070692_10455385 | 3300005345 | Bacteria | 820 |
| 115 | Ga0070692_10543731 | 3300005345 | Bacteria | 760 |
| 116 | Ga0070692_10798877 | 3300005345 | Bacteria | 644 |
| 117 | Ga0070668_100003043 | 3300005347 | Bacteria | 12405 |
| 118 | Ga0070668_100110467 | 3300005347 | Bacteria | 2188 |
| 119 | Ga0070669_100003079 | 3300005353 | Bacteria | 12001 |
| 120 | Ga0070669_100006567 | 3300005353 | Bacteria | 8369 |
| 121 | Ga0070669_100017058 | 3300005353 | Bacteria | 5181 |
| 122 | Ga0070669_100628490 | 3300005353 | Bacteria | 902 |
| 123 | Ga0070669_101526970 | 3300005353 | Bacteria | 581 |
| 124 | Ga0070675_100002631 | 3300005354 | Bacteria | 13492 |
| 125 | Ga0070675_100002663 | 3300005354 | Bacteria | 13424 |
| 126 | Ga0070675_100129213 | 3300005354 | Bacteria | 2152 |
| 127 | Ga0070675_100443798 | 3300005354 | Bacteria | 1163 |
| 128 | Ga0070675_100538919 | 3300005354 | Bacteria | 1054 |
| 129 | Ga0070675_100628948 | 3300005354 | Bacteria | 975 |
| 130 | Ga0070671_100023147 | 3300005355 | Bacteria | 5080 |
| 131 | Ga0070671_100119992 | 3300005355 | Bacteria | 2212 |
| 132 | Ga0070671_100306722 | 3300005355 | Bacteria | 1352 |
| 133 | Ga0070671_100948637 | 3300005355 | Bacteria | 752 |
| 134 | Ga0070674_100002673 | 3300005356 | Bacteria | 9876 |
| 135 | Ga0070674_100005627 | 3300005356 | Bacteria | 7257 |
| 136 | Ga0070674_100090184 | 3300005356 | Bacteria | 2211 |
| 137 | Ga0070674_100716610 | 3300005356 | Bacteria | 857 |
| 138 | Ga0070674_101373216 | 3300005356 | Bacteria | 632 |
| 139 | Ga0070673_100071202 | 3300005364 | Bacteria | 2793 |
| 140 | Ga0070673_100174961 | 3300005364 | Bacteria | 1834 |
| 141 | Ga0070673_100423788 | 3300005364 | Unclassified | 1193 |
| 142 | Ga0070688_100002319 | 3300005365 | Bacteria | 9618 |
| 143 | Ga0070688_100210072 | 3300005365 | Bacteria | 1366 |
| 144 | Ga0070659_100008807 | 3300005366 | Bacteria | 7392 |
| 145 | Ga0070659_100045001 | 3300005366 | Bacteria | 3457 |
| 146 | Ga0070659_100098927 | 3300005366 | Bacteria | 2346 |
| 147 | Ga0070659_100125537 | 3300005366 | Bacteria | 2082 |
| 148 | Ga0070659_100182606 | 3300005366 | Bacteria | 1722 |
| 149 | Ga0070659_100372354 | 3300005366 | Bacteria | 1202 |
| 150 | Ga0070659_101093415 | 3300005366 | Bacteria | 702 |
| 151 | Ga0070659_101305541 | 3300005366 | Bacteria | 644 |
| 152 | Ga0070667_100078670 | 3300005367 | Unclassified | 2817 |
| 153 | Ga0070703_10045433 | 3300005406 | Bacteria | 1385 |
| 154 | Ga0070709_10004387 | 3300005434 | Bacteria | 7607 |
| 155 | Ga0070709_10127383 | 3300005434 | Bacteria | 1734 |
| 156 | Ga0070709_10250300 | 3300005434 | Unclassified | 1276 |
| 157 | Ga0070714_100017298 | 3300005435 | Bacteria | 5839 |
| 158 | Ga0070714_100059789 | 3300005435 | Bacteria | 3268 |
| 159 | Ga0070714_101233724 | 3300005435 | Unclassified | 729 |
| 160 | Ga0070713_100007166 | 3300005436 | Bacteria | 7803 |
| 161 | Ga0070713_100044534 | 3300005436 | Bacteria | 3633 |
| 162 | Ga0070713_100116823 | 3300005436 | Bacteria | 2334 |
| 163 | Ga0070713_100460388 | 3300005436 | Unclassified | 1196 |
| 164 | Ga0070713_100497774 | 3300005436 | Bacteria | 1150 |
| 165 | Ga0070713_102030405 | 3300005436 | Unclassified | 558 |
| 166 | Ga0070710_10184315 | 3300005437 | Unclassified | 1309 |
| 167 | Ga0070710_10208052 | 3300005437 | Bacteria | 1239 |
| 168 | Ga0070701_10066722 | 3300005438 | Bacteria | 1913 |
| 169 | Ga0070701_10081963 | 3300005438 | Unclassified | 1748 |
| 170 | Ga0070701_10197945 | 3300005438 | Bacteria | 1186 |
| 171 | Ga0070711_100032354 | 3300005439 | Bacteria | 3477 |
| 172 | Ga0070711_100093604 | 3300005439 | Bacteria | 2170 |
| 173 | Ga0070711_100197012 | 3300005439 | Bacteria | 1552 |
| 174 | Ga0070711_100551202 | 3300005439 | Bacteria | 956 |
| 175 | Ga0070711_101492201 | 3300005439 | Bacteria | 590 |
| 176 | Ga0070705_100008002 | 3300005440 | Bacteria | 5226 |
| 177 | Ga0070705_100260434 | 3300005440 | Bacteria | 1223 |
| 178 | Ga0070700_100084227 | 3300005441 | Bacteria | 2060 |
| 179 | Ga0070700_100273692 | 3300005441 | Bacteria | 1221 |
| 180 | Ga0070700_100426352 | 3300005441 | Bacteria | 1003 |
| 181 | Ga0070694_100026031 | 3300005444 | Unclassified | 3789 |
| 182 | Ga0070694_100071018 | 3300005444 | Bacteria | 2399 |
| 183 | Ga0070694_100389417 | 3300005444 | Bacteria | 1089 |
| 184 | Ga0070708_100000198 | 3300005445 | Bacteria | 44012 |
| 185 | Ga0070708_100319285 | 3300005445 | Bacteria | 1463 |
| 186 | Ga0070708_100319362 | 3300005445 | Bacteria | 1463 |
| 187 | Ga0070708_100335521 | 3300005445 | Unclassified | 1425 |
| 188 | Ga0070708_102155434 | 3300005445 | Unclassified | 515 |
| 189 | Ga0070663_100006553 | 3300005455 | Bacteria | 7017 |
| 190 | Ga0070663_100026569 | 3300005455 | Bacteria | 3923 |
| 191 | Ga0070663_100426316 | 3300005455 | Unclassified | 1089 |
| 192 | Ga0070663_100462429 | 3300005455 | Bacteria | 1048 |
| 193 | Ga0070663_100628698 | 3300005455 | Bacteria | 906 |
| 194 | Ga0070663_100846071 | 3300005455 | Unclassified | 787 |
| 195 | Ga0070663_100969771 | 3300005455 | Bacteria | 738 |
| 196 | Ga0070678_100216556 | 3300005456 | Bacteria | 1589 |
| 197 | Ga0070678_100318911 | 3300005456 | Bacteria | 1326 |
| 198 | Ga0070678_100941283 | 3300005456 | Unclassified | 791 |
| 199 | Ga0070678_101712329 | 3300005456 | Unclassified | 592 |
| 200 | Ga0070662_100005643 | 3300005457 | Bacteria | 8003 |
| 201 | Ga0070662_100008788 | 3300005457 | Bacteria | 6588 |
| 202 | Ga0070662_100317522 | 3300005457 | Bacteria | 1269 |
| 203 | Ga0070662_101025354 | 3300005457 | Bacteria | 707 |
| 204 | Ga0070662_101027303 | 3300005457 | Bacteria | 706 |
| 205 | Ga0070662_101457880 | 3300005457 | Bacteria | 590 |
| 206 | Ga0070681_10000404 | 3300005458 | Bacteria | 35078 |
| 207 | Ga0070681_10002832 | 3300005458 | Bacteria | 16029 |
| 208 | Ga0070681_10003332 | 3300005458 | Bacteria | 15018 |
| 209 | Ga0070681_10003955 | 3300005458 | Bacteria | 13970 |
| 210 | Ga0070681_10010307 | 3300005458 | Bacteria | 9226 |
| 211 | Ga0070681_10039341 | 3300005458 | Bacteria | 4741 |
| 212 | Ga0070681_10044751 | 3300005458 | Bacteria | 4431 |
| 213 | Ga0070681_10061350 | 3300005458 | Bacteria | 3735 |
| 214 | Ga0070681_10169614 | 3300005458 | Unclassified | 2104 |
| 215 | Ga0070681_10330035 | 3300005458 | Bacteria | 1435 |
| 216 | Ga0070681_10363900 | 3300005458 | Bacteria | 1357 |
| 217 | Ga0070681_10543348 | 3300005458 | Bacteria | 1076 |
| 218 | Ga0070681_10586316 | 3300005458 | Bacteria | 1029 |
| 219 | Ga0070681_11039480 | 3300005458 | Bacteria | 739 |
| 220 | Ga0070681_11206837 | 3300005458 | Bacteria | 678 |
| 221 | Ga0070681_11206838 | 3300005458 | Bacteria | 678 |
| 222 | Ga0070681_12049106 | 3300005458 | Unclassified | 500 |
| 223 | Ga0068867_100005117 | 3300005459 | Bacteria | 9266 |
| 224 | Ga0068867_100010994 | 3300005459 | Bacteria | 6381 |
| 225 | Ga0068867_100080320 | 3300005459 | Bacteria | 2455 |
| 226 | Ga0068867_100937268 | 3300005459 | Unclassified | 781 |
| 227 | Ga0068867_101231203 | 3300005459 | Bacteria | 689 |
| 228 | Ga0068867_101566659 | 3300005459 | Unclassified | 615 |
| 229 | Ga0070685_10237064 | 3300005466 | Bacteria | 1203 |
| 230 | Ga0070706_100180612 | 3300005467 | Bacteria | 1970 |
| 231 | Ga0070706_100638097 | 3300005467 | Bacteria | 989 |
| 232 | Ga0070706_101174498 | 3300005467 | Bacteria | 706 |
| 233 | Ga0070707_100172133 | 3300005468 | Bacteria | 2110 |
| 234 | Ga0070707_100253278 | 3300005468 | Bacteria | 1713 |
| 235 | Ga0070707_100338019 | 3300005468 | Bacteria | 1463 |
| 236 | Ga0070707_100748109 | 3300005468 | Unclassified | 941 |
| 237 | Ga0070698_100012821 | 3300005471 | Bacteria | 8876 |
| 238 | Ga0070698_100033083 | 3300005471 | Bacteria | 5356 |
| 239 | Ga0070698_100060582 | 3300005471 | Bacteria | 3820 |
| 240 | Ga0070698_100245585 | 3300005471 | Bacteria | 1723 |
| 241 | Ga0070698_100297994 | 3300005471 | Unclassified | 1543 |
| 242 | Ga0070699_100075909 | 3300005518 | Bacteria | 2925 |
| 243 | Ga0070699_100142767 | 3300005518 | Bacteria | 2115 |
| 244 | Ga0070699_100269595 | 3300005518 | Bacteria | 1523 |
| 245 | Ga0070699_100762451 | 3300005518 | Unclassified | 885 |
| 246 | Ga0070679_100000919 | 3300005530 | Bacteria | 25597 |
| 247 | Ga0070679_100001084 | 3300005530 | Bacteria | 23776 |
| 248 | Ga0070679_100006169 | 3300005530 | Bacteria | 11157 |
| 249 | Ga0070679_100043081 | 3300005530 | Bacteria | 4496 |
| 250 | Ga0070679_100043325 | 3300005530 | Bacteria | 4482 |
| 251 | Ga0070679_100095100 | 3300005530 | Bacteria | 2967 |
| 252 | Ga0070679_100245133 | 3300005530 | Bacteria | 1749 |
| 253 | Ga0070679_100359492 | 3300005530 | Unclassified | 1403 |
| 254 | Ga0070679_100408428 | 3300005530 | Bacteria | 1303 |
| 255 | Ga0070679_100670594 | 3300005530 | Bacteria | 980 |
| 256 | Ga0070679_100702985 | 3300005530 | Bacteria | 954 |
| 257 | Ga0070679_101279873 | 3300005530 | Bacteria | 679 |
| 258 | Ga0070679_101506731 | 3300005530 | Unclassified | 619 |
| 259 | Ga0070684_100006699 | 3300005535 | Bacteria | 8930 |
| 260 | Ga0070684_100024585 | 3300005535 | Bacteria | 5055 |
| 261 | Ga0070684_100038174 | 3300005535 | Bacteria | 4124 |
| 262 | Ga0070684_100043865 | 3300005535 | Bacteria | 3864 |
| 263 | Ga0070684_100076836 | 3300005535 | Unclassified | 2948 |
| 264 | Ga0070684_100297248 | 3300005535 | Bacteria | 1481 |
| 265 | Ga0070684_100301427 | 3300005535 | Bacteria | 1470 |
| 266 | Ga0070684_100365457 | 3300005535 | Bacteria | 1328 |
| 267 | Ga0070684_100390698 | 3300005535 | Bacteria | 1282 |
| 268 | Ga0070684_100725714 | 3300005535 | Bacteria | 927 |
| 269 | Ga0070697_100659546 | 3300005536 | Bacteria | 922 |
| 270 | Ga0068853_100013646 | 3300005539 | Bacteria | 6638 |
| 271 | Ga0068853_100016074 | 3300005539 | Bacteria | 6155 |
| 272 | Ga0068853_100487555 | 3300005539 | Bacteria | 1162 |
| 273 | Ga0068853_100531253 | 3300005539 | Bacteria | 1113 |
| 274 | Ga0068853_100600016 | 3300005539 | Bacteria | 1045 |
| 275 | Ga0068853_101020938 | 3300005539 | Unclassified | 796 |
| 276 | Ga0070672_100004984 | 3300005543 | Bacteria | 8750 |
| 277 | Ga0070672_100005766 | 3300005543 | Bacteria | 8256 |
| 278 | Ga0070672_100206844 | 3300005543 | Bacteria | 1643 |
| 279 | Ga0070672_102093168 | 3300005543 | Bacteria | 510 |
| 280 | Ga0070686_100256050 | 3300005544 | Bacteria | 1281 |
| 281 | Ga0070686_100505251 | 3300005544 | Bacteria | 939 |
| 282 | Ga0070695_100001483 | 3300005545 | Bacteria | 13033 |
| 283 | Ga0070695_100246326 | 3300005545 | Bacteria | 1299 |
| 284 | Ga0070695_100441644 | 3300005545 | Bacteria | 995 |
| 285 | Ga0070695_100461616 | 3300005545 | Bacteria | 975 |
| 286 | Ga0070695_101161069 | 3300005545 | Bacteria | 634 |
| 287 | Ga0070696_100001375 | 3300005546 | Bacteria | 15888 |
| 288 | Ga0070696_100007637 | 3300005546 | Bacteria | 7228 |
| 289 | Ga0070696_100077827 | 3300005546 | Bacteria | 2344 |
| 290 | Ga0070696_100091579 | 3300005546 | Unclassified | 2165 |
| 291 | Ga0070696_101883053 | 3300005546 | Bacteria | 518 |
| 292 | Ga0070693_100008533 | 3300005547 | Bacteria | 5058 |
| 293 | Ga0070693_100013713 | 3300005547 | Bacteria | 4136 |
| 294 | Ga0070693_100057558 | 3300005547 | Bacteria | 2247 |
| 295 | Ga0070693_100503499 | 3300005547 | Bacteria | 859 |
| 296 | Ga0070693_100912568 | 3300005547 | Unclassified | 659 |
| 297 | Ga0070665_100042538 | 3300005548 | Bacteria | 4567 |
| 298 | Ga0070665_100052068 | 3300005548 | Unclassified | 4107 |
| 299 | Ga0070665_102600001 | 3300005548 | Bacteria | 507 |
| 300 | Ga0070704_100227659 | 3300005549 | Bacteria | 1519 |
| 301 | Ga0070704_100285705 | 3300005549 | Bacteria | 1369 |
| 302 | Ga0070704_101093287 | 3300005549 | Bacteria | 724 |
| 303 | Ga0068855_100002169 | 3300005563 | Bacteria | 24243 |
| 304 | Ga0068855_100005082 | 3300005563 | Bacteria | 16038 |
| 305 | Ga0068855_100008571 | 3300005563 | Bacteria | 12363 |
| 306 | Ga0068855_100043978 | 3300005563 | Bacteria | 5288 |
| 307 | Ga0068855_100366932 | 3300005563 | Bacteria | 1583 |
| 308 | Ga0068855_100381898 | 3300005563 | Unclassified | 1547 |
| 309 | Ga0068855_100646997 | 3300005563 | Bacteria | 1136 |
| 310 | Ga0068855_100990687 | 3300005563 | Bacteria | 883 |
| 311 | Ga0068855_101054914 | 3300005563 | Unclassified | 851 |
| 312 | Ga0068855_101547206 | 3300005563 | Bacteria | 680 |
| 313 | Ga0070664_100013154 | 3300005564 | Bacteria | 6738 |
| 314 | Ga0070664_100024766 | 3300005564 | Bacteria | 4968 |
| 315 | Ga0070664_100051722 | 3300005564 | Bacteria | 3478 |
| 316 | Ga0070664_100485014 | 3300005564 | Bacteria | 1138 |
| 317 | Ga0070664_101004731 | 3300005564 | Bacteria | 784 |
| 318 | Ga0070664_101389984 | 3300005564 | Unclassified | 663 |
| 319 | Ga0068857_100012151 | 3300005577 | Bacteria | 7490 |
| 320 | Ga0068857_100012440 | 3300005577 | Bacteria | 7408 |
| 321 | Ga0068857_100015739 | 3300005577 | Bacteria | 6617 |
| 322 | Ga0068857_100020862 | 3300005577 | Bacteria | 5764 |
| 323 | Ga0068857_100087176 | 3300005577 | Bacteria | 2792 |
| 324 | Ga0068857_100736577 | 3300005577 | Bacteria | 938 |
| 325 | Ga0068854_100000340 | 3300005578 | Bacteria | 30112 |
| 326 | Ga0068854_100034276 | 3300005578 | Bacteria | 3545 |
| 327 | Ga0068854_100053241 | 3300005578 | Bacteria | 2905 |
| 328 | Ga0068854_100420152 | 3300005578 | Bacteria | 1110 |
| 329 | Ga0068854_100745723 | 3300005578 | Bacteria | 849 |
| 330 | Ga0068854_100790047 | 3300005578 | Unclassified | 826 |
| 331 | Ga0068854_101739925 | 3300005578 | Unclassified | 571 |
| 332 | Ga0068856_100364022 | 3300005614 | Bacteria | 1465 |
| 333 | Ga0068856_100457035 | 3300005614 | Bacteria | 1298 |
| 334 | Ga0068856_100648460 | 3300005614 | Bacteria | 1076 |
| 335 | Ga0068856_100680175 | 3300005614 | Unclassified | 1049 |
| 336 | Ga0068856_100941185 | 3300005614 | Unclassified | 883 |
| 337 | Ga0068856_101002356 | 3300005614 | Unclassified | 853 |
| 338 | Ga0070702_100015870 | 3300005615 | Bacteria | 3854 |
| 339 | Ga0070702_100518545 | 3300005615 | Bacteria | 879 |
| 340 | Ga0068852_100014974 | 3300005616 | Bacteria | 5995 |
| 341 | Ga0068852_100018984 | 3300005616 | Bacteria | 5431 |
| 342 | Ga0068852_100069165 | 3300005616 | Bacteria | 3093 |
| 343 | Ga0068852_100192890 | 3300005616 | Bacteria | 1923 |
| 344 | Ga0068852_100202237 | 3300005616 | Bacteria | 1880 |
| 345 | Ga0068852_100546103 | 3300005616 | Unclassified | 1159 |
| 346 | Ga0068852_101079483 | 3300005616 | Bacteria | 823 |
| 347 | Ga0068852_101434378 | 3300005616 | Bacteria | 712 |
| 348 | Ga0068859_100056150 | 3300005617 | Bacteria | 3962 |
| 349 | Ga0068859_100897660 | 3300005617 | Unclassified | 971 |
| 350 | Ga0068864_100005386 | 3300005618 | Bacteria | 10484 |
| 351 | Ga0068864_100038902 | 3300005618 | Bacteria | 4064 |
| 352 | Ga0068864_100318803 | 3300005618 | Bacteria | 1459 |
| 353 | Ga0068864_100369234 | 3300005618 | Bacteria | 1357 |
| 354 | Ga0068864_101236591 | 3300005618 | Bacteria | 746 |
| 355 | Ga0068866_10000524 | 3300005718 | Bacteria | 17645 |
| 356 | Ga0068866_10116924 | 3300005718 | Bacteria | 1496 |
| 357 | Ga0068866_10376060 | 3300005718 | Unclassified | 910 |
| 358 | Ga0068866_10812860 | 3300005718 | Bacteria | 651 |
| 359 | Ga0068861_100001019 | 3300005719 | Bacteria | 17119 |
| 360 | Ga0068861_100049474 | 3300005719 | Bacteria | 3183 |
| 361 | Ga0068861_100289917 | 3300005719 | Bacteria | 1413 |
| 362 | Ga0068861_100944581 | 3300005719 | Unclassified | 820 |
| 363 | Ga0068851_10015465 | 3300005834 | Bacteria | 3636 |
| 364 | Ga0068851_10071393 | 3300005834 | Unclassified | 1797 |
| 365 | Ga0068851_10269088 | 3300005834 | Bacteria | 971 |
| 366 | Ga0068870_10002079 | 3300005840 | Bacteria | 8295 |
| 367 | Ga0068870_10304076 | 3300005840 | Bacteria | 1008 |
| 368 | Ga0068870_10408049 | 3300005840 | Bacteria | 886 |
| 369 | Ga0068870_10428249 | 3300005840 | Bacteria | 867 |
| 370 | Ga0068870_10492048 | 3300005840 | Bacteria | 816 |
| 371 | Ga0068863_100041206 | 3300005841 | Bacteria | 4390 |
| 372 | Ga0068863_100160660 | 3300005841 | Bacteria | 2153 |
| 373 | Ga0068863_100319991 | 3300005841 | Unclassified | 1507 |
| 374 | Ga0068858_100022826 | 3300005842 | Bacteria | 5836 |
| 375 | Ga0068858_100321105 | 3300005842 | Bacteria | 1480 |
| 376 | Ga0068860_100040126 | 3300005843 | Bacteria | 4476 |
| 377 | Ga0068860_100227646 | 3300005843 | Bacteria | 1811 |
| 378 | Ga0068860_100535547 | 3300005843 | Bacteria | 1172 |
| 379 | Ga0068862_100000376 | 3300005844 | Bacteria | 48418 |
| 380 | Ga0068862_100030151 | 3300005844 | Bacteria | 4570 |
| 381 | Ga0068862_100126281 | 3300005844 | Bacteria | 2258 |
| 382 | Ga0081455_10038603 | 3300005937 | Bacteria | 4227 |
| 383 | Ga0081455_10050687 | 3300005937 | Bacteria | 3566 |
| 384 | Ga0081539_10000104 | 3300005985 | Bacteria | 197478 |
| 385 | Ga0081539_10043960 | 3300005985 | Unclassified | 2583 |
| 386 | Ga0081539_10230857 | 3300005985 | Bacteria | 835 |
| 387 | Ga0070717_10016213 | 3300006028 | Bacteria | 5773 |
| 388 | Ga0070717_10418219 | 3300006028 | Unclassified | 1206 |
| 389 | Ga0070717_10918133 | 3300006028 | Unclassified | 797 |
| 390 | Ga0075432_10382237 | 3300006058 | Unclassified | 604 |
| 391 | Ga0070716_100172719 | 3300006173 | Bacteria | 1412 |
| 392 | Ga0070716_100338785 | 3300006173 | Unclassified | 1060 |
| 393 | Ga0070716_100489729 | 3300006173 | Bacteria | 905 |
| 394 | Ga0070716_100573872 | 3300006173 | Bacteria | 844 |
| 395 | Ga0070716_100851716 | 3300006173 | Bacteria | 710 |
| 396 | Ga0070712_100012458 | 3300006175 | Bacteria | 5407 |
| 397 | Ga0070712_100028870 | 3300006175 | Bacteria | 3714 |
| 398 | Ga0070712_100062454 | 3300006175 | Bacteria | 2634 |
| 399 | Ga0070712_100347417 | 3300006175 | Unclassified | 1213 |
| 400 | Ga0070712_100413145 | 3300006175 | Unclassified | 1117 |
| 401 | Ga0070712_100488267 | 3300006175 | Unclassified | 1031 |
| 402 | Ga0097621_100208928 | 3300006237 | Bacteria | 1697 |
| 403 | Ga0068871_100139055 | 3300006358 | Bacteria | 2064 |
| 404 | Ga0068871_100407653 | 3300006358 | Bacteria | 1211 |
| 405 | Ga0075428_100235434 | 3300006844 | Bacteria | 1976 |
| 406 | Ga0075428_100397778 | 3300006844 | Bacteria | 1477 |
| 407 | Ga0075428_101094780 | 3300006844 | Bacteria | 842 |
| 408 | Ga0075428_101376680 | 3300006844 | Bacteria | 741 |
| 409 | Ga0075428_101708408 | 3300006844 | Bacteria | 657 |
| 410 | Ga0075430_100003192 | 3300006846 | Bacteria | 13741 |
| 411 | Ga0075430_100013015 | 3300006846 | Bacteria | 7091 |
| 412 | Ga0075430_100019170 | 3300006846 | Bacteria | 5816 |
| 413 | Ga0075430_100029938 | 3300006846 | Bacteria | 4622 |
| 414 | Ga0075430_100194674 | 3300006846 | Bacteria | 1684 |
| 415 | Ga0075430_100269583 | 3300006846 | Bacteria | 1409 |
| 416 | Ga0075431_100024864 | 3300006847 | Bacteria | 6141 |
| 417 | Ga0075431_100037185 | 3300006847 | Bacteria | 5017 |
| 418 | Ga0075431_100053473 | 3300006847 | Unclassified | 4164 |
| 419 | Ga0075431_100065457 | 3300006847 | Bacteria | 3753 |
| 420 | Ga0075431_100076205 | 3300006847 | Bacteria | 3461 |
| 421 | Ga0075431_100135269 | 3300006847 | Bacteria | 2541 |
| 422 | Ga0075431_100186854 | 3300006847 | Bacteria | 2125 |
| 423 | Ga0075431_100236239 | 3300006847 | Bacteria | 1861 |
| 424 | Ga0075431_100247272 | 3300006847 | Bacteria | 1813 |
| 425 | Ga0075431_100373540 | 3300006847 | Unclassified | 1431 |
| 426 | Ga0075433_10005348 | 3300006852 | Bacteria | 10079 |
| 427 | Ga0075433_10718897 | 3300006852 | Bacteria | 874 |
| 428 | Ga0075434_100001804 | 3300006871 | Bacteria | 18514 |
| 429 | Ga0075434_100035507 | 3300006871 | Bacteria | 4929 |
| 430 | Ga0075434_100244634 | 3300006871 | Bacteria | 1814 |
| 431 | Ga0075434_100261801 | 3300006871 | Bacteria | 1749 |
| 432 | Ga0075434_100873154 | 3300006871 | Bacteria | 915 |
| 433 | Ga0075434_100881508 | 3300006871 | Bacteria | 910 |
| 434 | Ga0075429_100067642 | 3300006880 | Bacteria | 3108 |
| 435 | Ga0075429_100208196 | 3300006880 | Bacteria | 1713 |
| 436 | Ga0075429_100453510 | 3300006880 | Bacteria | 1124 |
| 437 | Ga0075429_100470855 | 3300006880 | Bacteria | 1101 |
| 438 | Ga0068865_100001514 | 3300006881 | Bacteria | 13558 |
| 439 | Ga0068865_100117526 | 3300006881 | Bacteria | 1971 |
| 440 | Ga0068865_100628234 | 3300006881 | Unclassified | 910 |
| 441 | Ga0075436_100114952 | 3300006914 | Bacteria | 1879 |
| 442 | Ga0075436_100194376 | 3300006914 | Bacteria | 1436 |
| 443 | Ga0075436_100209048 | 3300006914 | Bacteria | 1383 |
| 444 | Ga0097620_100056151 | 3300006931 | Bacteria | 3962 |
| 445 | Ga0097620_100897771 | 3300006931 | Unclassified | 971 |
| 446 | Ga0075435_100694998 | 3300007076 | Bacteria | 884 |
| 447 | Ga0075435_100980540 | 3300007076 | Unclassified | 738 |
| 448 | Ga0075435_101112837 | 3300007076 | Bacteria | 690 |
| 449 | Ga0075435_101766042 | 3300007076 | Unclassified | 543 |
| 450 | Ga0105240_10009204 | 3300009093 | Bacteria | 14007 |
| 451 | Ga0105240_10011015 | 3300009093 | Bacteria | 12657 |
| 452 | Ga0105240_10016684 | 3300009093 | Bacteria | 9932 |
| 453 | Ga0105240_10037426 | 3300009093 | Bacteria | 6236 |
| 454 | Ga0105240_10046608 | 3300009093 | Bacteria | 5492 |
| 455 | Ga0105240_10070716 | 3300009093 | Bacteria | 4316 |
| 456 | Ga0105240_10074073 | 3300009093 | Bacteria | 4204 |
| 457 | Ga0105240_10090200 | 3300009093 | Bacteria | 3747 |
| 458 | Ga0105240_10705779 | 3300009093 | Bacteria | 1101 |
| 459 | Ga0105240_10890443 | 3300009093 | Bacteria | 958 |
| 460 | Ga0105240_11048922 | 3300009093 | Unclassified | 870 |
| 461 | Ga0111539_10042342 | 3300009094 | Bacteria | 5469 |
| 462 | Ga0111539_10088891 | 3300009094 | Bacteria | 3629 |
| 463 | Ga0111539_10150269 | 3300009094 | Bacteria | 2726 |
| 464 | Ga0111539_10251608 | 3300009094 | Bacteria | 2057 |
| 465 | Ga0111539_10920564 | 3300009094 | Bacteria | 1017 |
| 466 | Ga0105245_10025521 | 3300009098 | Bacteria | 5198 |
| 467 | Ga0105245_10036543 | 3300009098 | Bacteria | 4364 |
| 468 | Ga0105245_12730105 | 3300009098 | Bacteria | 547 |
| 469 | Ga0105247_10439480 | 3300009101 | Bacteria | 938 |
| 470 | Ga0114129_10017266 | 3300009147 | Bacteria | 10277 |
| 471 | Ga0114129_10068560 | 3300009147 | Bacteria | 4946 |
| 472 | Ga0114129_10230022 | 3300009147 | Bacteria | 2497 |
| 473 | Ga0114129_10273868 | 3300009147 | Bacteria | 2257 |
| 474 | Ga0114129_10299783 | 3300009147 | Bacteria | 2143 |
| 475 | Ga0114129_10477216 | 3300009147 | Archaea | 1632 |
| 476 | Ga0114129_10941962 | 3300009147 | Bacteria | 1091 |
| 477 | Ga0114129_11407312 | 3300009147 | Bacteria | 860 |
| 478 | Ga0105243_10042543 | 3300009148 | Bacteria | 3556 |
| 479 | Ga0105243_10242951 | 3300009148 | Bacteria | 1603 |
| 480 | Ga0105243_10590746 | 3300009148 | Bacteria | 1067 |
| 481 | Ga0105241_10000729 | 3300009174 | Bacteria | 24921 |
| 482 | Ga0105241_10024142 | 3300009174 | Bacteria | 4515 |
| 483 | Ga0105241_10116790 | 3300009174 | Bacteria | 2143 |
| 484 | Ga0105241_10169367 | 3300009174 | Bacteria | 1803 |
| 485 | Ga0105241_10525033 | 3300009174 | Bacteria | 1059 |
| 486 | Ga0105241_10717479 | 3300009174 | Bacteria | 914 |
| 487 | Ga0105241_11098168 | 3300009174 | Unclassified | 749 |
| 488 | Ga0105242_10006526 | 3300009176 | Bacteria | 8978 |
| 489 | Ga0105242_10015995 | 3300009176 | Bacteria | 5830 |
| 490 | Ga0105242_10181321 | 3300009176 | Unclassified | 1858 |
| 491 | Ga0105242_10993453 | 3300009176 | Unclassified | 846 |
| 492 | Ga0105242_11994438 | 3300009176 | Bacteria | 622 |
| 493 | Ga0105248_10009365 | 3300009177 | Bacteria | 10781 |
| 494 | Ga0105248_10011120 | 3300009177 | Bacteria | 9932 |
| 495 | Ga0105248_10104035 | 3300009177 | Bacteria | 3200 |
| 496 | Ga0105248_10916580 | 3300009177 | Bacteria | 990 |
| 497 | Ga0105248_12078802 | 3300009177 | Bacteria | 646 |
| 498 | Ga0105237_10079939 | 3300009545 | Bacteria | 3259 |
| 499 | Ga0105237_10149201 | 3300009545 | Bacteria | 2334 |
| 500 | Ga0105237_10431669 | 3300009545 | Bacteria | 1323 |
| 501 | Ga0105237_10472521 | 3300009545 | Bacteria | 1260 |
| 502 | Ga0105237_11009553 | 3300009545 | Bacteria | 839 |
| 503 | Ga0105237_11127262 | 3300009545 | Unclassified | 791 |
| 504 | Ga0105238_10024368 | 3300009551 | Bacteria | 6168 |
| 505 | Ga0105238_10066363 | 3300009551 | Bacteria | 3610 |
| 506 | Ga0105238_10073038 | 3300009551 | Bacteria | 3425 |
| 507 | Ga0105238_10087946 | 3300009551 | Bacteria | 3094 |
| 508 | Ga0105238_10325721 | 3300009551 | Bacteria | 1523 |
| 509 | Ga0105238_10816832 | 3300009551 | Bacteria | 948 |
| 510 | Ga0105238_11465449 | 3300009551 | Bacteria | 711 |
| 511 | Ga0105238_12277478 | 3300009551 | Unclassified | 577 |
| 512 | Ga0105249_10000454 | 3300009553 | Bacteria | 38498 |
| 513 | Ga0105249_10069734 | 3300009553 | Bacteria | 3245 |
| 514 | Ga0105249_10190726 | 3300009553 | Bacteria | 2000 |
| 515 | Ga0105249_10325281 | 3300009553 | Bacteria | 1550 |
| 516 | Ga0105249_10809129 | 3300009553 | Bacteria | 1001 |
| 517 | Ga0105239_10147980 | 3300010375 | Bacteria | 2620 |
| 518 | Ga0105239_10231952 | 3300010375 | Unclassified | 2071 |
| 519 | Ga0105239_10259676 | 3300010375 | Bacteria | 1952 |
| 520 | Ga0105239_10382025 | 3300010375 | Bacteria | 1592 |
| 521 | Ga0105239_11245419 | 3300010375 | Unclassified | 858 |
| 522 | Ga0105239_12469307 | 3300010375 | Unclassified | 606 |
| 523 | Ga0105246_10055844 | 3300011119 | Bacteria | 2727 |
| 524 | Ga0105246_10471626 | 3300011119 | Bacteria | 1060 |
| 525 | Ga0157342_1073673 | 3300012507 | Unclassified | 524 |
| 526 | Ga0157373_10001473 | 3300013100 | Bacteria | 17949 |
| 527 | Ga0157373_10027655 | 3300013100 | Bacteria | 4092 |
| 528 | Ga0157373_10091952 | 3300013100 | Bacteria | 2136 |
| 529 | Ga0157373_10152454 | 3300013100 | Bacteria | 1626 |
| 530 | Ga0157373_10201626 | 3300013100 | Bacteria | 1403 |
| 531 | Ga0157373_10237167 | 3300013100 | Unclassified | 1289 |
| 532 | Ga0157373_11331309 | 3300013100 | Bacteria | 544 |
| 533 | Ga0157371_10007275 | 3300013102 | Bacteria | 8992 |
| 534 | Ga0157371_10714457 | 3300013102 | Bacteria | 751 |
| 535 | Ga0157371_10743094 | 3300013102 | Unclassified | 736 |
| 536 | Ga0157371_11534102 | 3300013102 | Bacteria | 520 |
| 537 | Ga0157370_10003508 | 3300013104 | Bacteria | 18392 |
| 538 | Ga0157370_10008754 | 3300013104 | Bacteria | 10881 |
| 539 | Ga0157370_10041763 | 3300013104 | Bacteria | 4422 |
| 540 | Ga0157370_10136189 | 3300013104 | Bacteria | 2289 |
| 541 | Ga0157370_10165029 | 3300013104 | Bacteria | 2060 |
| 542 | Ga0157370_10166493 | 3300013104 | Bacteria | 2050 |
| 543 | Ga0157370_10282223 | 3300013104 | Bacteria | 1534 |
| 544 | Ga0157370_10861985 | 3300013104 | Unclassified | 823 |
| 545 | Ga0157370_11117989 | 3300013104 | Bacteria | 712 |
| 546 | Ga0157370_11609613 | 3300013104 | Unclassified | 583 |
| 547 | Ga0157369_10009705 | 3300013105 | Bacteria | 11007 |
| 548 | Ga0157369_10017338 | 3300013105 | Bacteria | 8095 |
| 549 | Ga0157369_10073925 | 3300013105 | Bacteria | 3656 |
| 550 | Ga0157369_10115485 | 3300013105 | Bacteria | 2851 |
| 551 | Ga0157369_10117595 | 3300013105 | Bacteria | 2822 |
| 552 | Ga0157369_10119385 | 3300013105 | Bacteria | 2798 |
| 553 | Ga0157369_10232225 | 3300013105 | Bacteria | 1928 |
| 554 | Ga0157369_10232838 | 3300013105 | Bacteria | 1925 |
| 555 | Ga0157369_10739412 | 3300013105 | Bacteria | 1012 |
| 556 | Ga0157369_10743766 | 3300013105 | Bacteria | 1009 |
| 557 | Ga0157369_11755948 | 3300013105 | Unclassified | 630 |
| 558 | Ga0157374_10433589 | 3300013296 | Bacteria | 1314 |
| 559 | Ga0157374_10990234 | 3300013296 | Bacteria | 860 |
| 560 | Ga0157374_11098074 | 3300013296 | Bacteria | 816 |
| 561 | Ga0157374_11385070 | 3300013296 | Bacteria | 726 |
| 562 | Ga0157374_12425697 | 3300013296 | Bacteria | 552 |
| 563 | Ga0157378_10005002 | 3300013297 | Bacteria | 11631 |
| 564 | Ga0157378_10016080 | 3300013297 | Bacteria | 6553 |
| 565 | Ga0157378_10429050 | 3300013297 | Bacteria | 1308 |
| 566 | Ga0163162_10001492 | 3300013306 | Bacteria | 21813 |
| 567 | Ga0163162_10013828 | 3300013306 | Bacteria | 7885 |
| 568 | Ga0163162_10075056 | 3300013306 | Bacteria | 3441 |
| 569 | Ga0163162_12869838 | 3300013306 | Unclassified | 555 |
| 570 | Ga0163162_13441632 | 3300013306 | Unclassified | 504 |
| 571 | Ga0157372_10010171 | 3300013307 | Bacteria | 9988 |
| 572 | Ga0157372_10013087 | 3300013307 | Bacteria | 8852 |
| 573 | Ga0157372_10015470 | 3300013307 | Bacteria | 8178 |
| 574 | Ga0157372_10025540 | 3300013307 | Bacteria | 6425 |
| 575 | Ga0157372_10068103 | 3300013307 | Bacteria | 4002 |
| 576 | Ga0157372_10118363 | 3300013307 | Bacteria | 3039 |
| 577 | Ga0157372_10124994 | 3300013307 | Bacteria | 2957 |
| 578 | Ga0157372_10252248 | 3300013307 | Bacteria | 2048 |
| 579 | Ga0157372_10317512 | 3300013307 | Bacteria | 1814 |
| 580 | Ga0157372_10367523 | 3300013307 | Bacteria | 1676 |
| 581 | Ga0157372_10382231 | 3300013307 | Bacteria | 1640 |
| 582 | Ga0157372_10509511 | 3300013307 | Bacteria | 1403 |
| 583 | Ga0157372_10519876 | 3300013307 | Unclassified | 1388 |
| 584 | Ga0157372_10617092 | 3300013307 | Bacteria | 1264 |
| 585 | Ga0157372_10636435 | 3300013307 | Unclassified | 1242 |
| 586 | Ga0157372_10659924 | 3300013307 | Bacteria | 1218 |
| 587 | Ga0157372_10696387 | 3300013307 | Bacteria | 1182 |
| 588 | Ga0157372_11287462 | 3300013307 | Bacteria | 844 |
| 589 | Ga0157372_11664064 | 3300013307 | Bacteria | 734 |
| 590 | Ga0157372_11736237 | 3300013307 | Bacteria | 718 |
| 591 | Ga0157372_11902482 | 3300013307 | Bacteria | 684 |
| 592 | Ga0157372_12279322 | 3300013307 | Bacteria | 622 |
| 593 | Ga0157372_12346199 | 3300013307 | Bacteria | 613 |
| 594 | Ga0157372_12369999 | 3300013307 | Unclassified | 609 |
| 595 | Ga0157372_12614981 | 3300013307 | Bacteria | 579 |
| 596 | Ga0157375_10091745 | 3300013308 | Bacteria | 3100 |
| 597 | Ga0157375_10100651 | 3300013308 | Bacteria | 2971 |
| 598 | Ga0157375_10294846 | 3300013308 | Bacteria | 1785 |
| 599 | Ga0157375_10840832 | 3300013308 | Bacteria | 1065 |
| 600 | Ga0163163_10070485 | 3300014325 | Bacteria | 3481 |
| 601 | Ga0163163_10660291 | 3300014325 | Bacteria | 1109 |
| 602 | Ga0157380_10007646 | 3300014326 | Bacteria | 7684 |
| 603 | Ga0157380_10033634 | 3300014326 | Bacteria | 3949 |
| 604 | Ga0157380_10148905 | 3300014326 | Bacteria | 2021 |
| 605 | Ga0157380_10278831 | 3300014326 | Bacteria | 1528 |
| 606 | Ga0157380_12670253 | 3300014326 | Bacteria | 566 |
| 607 | Ga0182008_10009299 | 3300014497 | Bacteria | 5312 |
| 608 | Ga0182008_10081193 | 3300014497 | Bacteria | 1596 |
| 609 | Ga0157377_10031866 | 3300014745 | Bacteria | 2867 |
| 610 | Ga0157379_10015608 | 3300014968 | Bacteria | 6670 |
| 611 | Ga0157379_10064796 | 3300014968 | Bacteria | 3265 |
| 612 | Ga0157376_10093515 | 3300014969 | Bacteria | 2610 |
| 613 | Ga0157376_10225367 | 3300014969 | Unclassified | 1739 |
| 614 | Ga0157376_11130927 | 3300014969 | Bacteria | 810 |
| 615 | Ga0157376_11883363 | 3300014969 | Bacteria | 635 |
| 616 | Ga0182007_10042612 | 3300015262 | Unclassified | 1510 |
| 617 | Ga0182007_10073079 | 3300015262 | Unclassified | 1123 |
| 618 | Ga0182007_10210130 | 3300015262 | Bacteria | 684 |
| 619 | Ga0182007_10215945 | 3300015262 | Unclassified | 676 |
| 620 | Ga0182007_10254854 | 3300015262 | Bacteria | 631 |
| 621 | Ga0182005_1079726 | 3300015265 | Unclassified | 903 |
| 622 | Ga0163161_10150679 | 3300017792 | Bacteria | 1767 |
| 623 | Ga0163161_11802713 | 3300017792 | Unclassified | 544 |
| 624 | Ga0197907_11166881 | 3300020069 | Bacteria | 793 |
| 625 | Ga0197907_11314107 | 3300020069 | Bacteria | 1027 |
| 626 | Ga0206356_10116592 | 3300020070 | Unclassified | 681 |
| 627 | Ga0206356_10125692 | 3300020070 | Bacteria | 1524 |
| 628 | Ga0206356_10416445 | 3300020070 | Bacteria | 748 |
| 629 | Ga0206356_10483138 | 3300020070 | Bacteria | 644 |
| 630 | Ga0206356_10839536 | 3300020070 | Unclassified | 730 |
| 631 | Ga0206356_11361504 | 3300020070 | Bacteria | 842 |
| 632 | Ga0206356_11525656 | 3300020070 | Bacteria | 806 |
| 633 | Ga0206356_11642972 | 3300020070 | Bacteria | 627 |
| 634 | Ga0206356_11798847 | 3300020070 | Bacteria | 567 |
| 635 | Ga0206355_1012074 | 3300020076 | Bacteria | 594 |
| 636 | Ga0206355_1360271 | 3300020076 | Bacteria | 773 |
| 637 | Ga0206352_10641371 | 3300020078 | Bacteria | 625 |
| 638 | Ga0206352_10860556 | 3300020078 | Bacteria | 760 |
| 639 | Ga0206352_10936146 | 3300020078 | Bacteria | 1046 |
| 640 | Ga0206352_11130402 | 3300020078 | Unclassified | 791 |
| 641 | Ga0206352_11362427 | 3300020078 | Bacteria | 1025 |
| 642 | Ga0206350_10135957 | 3300020080 | Bacteria | 835 |
| 643 | Ga0213876_10040236 | 3300021384 | Bacteria | 2469 |
| 644 | Ga0224712_10152424 | 3300022467 | Bacteria | 1025 |
| 645 | Ga0224712_10316866 | 3300022467 | Unclassified | 732 |
| 646 | Ga0224712_10352983 | 3300022467 | Bacteria | 695 |
| 647 | Ga0224712_10681828 | 3300022467 | Bacteria | 505 |
| 648 | Ga0207666_1047325 | 3300025271 | Unclassified | 678 |
| 649 | Ga0207673_1009498 | 3300025290 | Bacteria | 1243 |
| 650 | Ga0207697_10005445 | 3300025315 | Bacteria | 5918 |
| 651 | Ga0207697_10112113 | 3300025315 | Bacteria | 1169 |
| 652 | Ga0207656_10006385 | 3300025321 | Bacteria | 4232 |
| 653 | Ga0207656_10172199 | 3300025321 | Bacteria | 1035 |
| 654 | Ga0207653_10092535 | 3300025885 | Bacteria | 1061 |
| 655 | Ga0207682_10168826 | 3300025893 | Bacteria | 994 |
| 656 | Ga0207692_10101751 | 3300025898 | Bacteria | 1579 |
| 657 | Ga0207692_10231793 | 3300025898 | Unclassified | 1099 |
| 658 | Ga0207642_10069746 | 3300025899 | Bacteria | 1668 |
| 659 | Ga0207642_10150415 | 3300025899 | Bacteria | 1238 |
| 660 | Ga0207688_10023241 | 3300025901 | Bacteria | 3394 |
| 661 | Ga0207688_10186830 | 3300025901 | Bacteria | 1238 |
| 662 | Ga0207680_10113171 | 3300025903 | Bacteria | 1764 |
| 663 | Ga0207680_10213827 | 3300025903 | Bacteria | 1319 |
| 664 | Ga0207680_10821322 | 3300025903 | Unclassified | 666 |
| 665 | Ga0207647_10195587 | 3300025904 | Bacteria | 1171 |
| 666 | Ga0207685_10513020 | 3300025905 | Bacteria | 632 |
| 667 | Ga0207699_10008459 | 3300025906 | Bacteria | 5081 |
| 668 | Ga0207699_10045530 | 3300025906 | Bacteria | 2561 |
| 669 | Ga0207699_10106448 | 3300025906 | Bacteria | 1790 |
| 670 | Ga0207699_10106541 | 3300025906 | Bacteria | 1789 |
| 671 | Ga0207645_10000246 | 3300025907 | Bacteria | 44995 |
| 672 | Ga0207645_10000971 | 3300025907 | Bacteria | 23712 |
| 673 | Ga0207645_10067632 | 3300025907 | Bacteria | 2284 |
| 674 | Ga0207643_10001951 | 3300025908 | Bacteria | 11403 |
| 675 | Ga0207643_10076653 | 3300025908 | Unclassified | 1932 |
| 676 | Ga0207643_10131229 | 3300025908 | Bacteria | 1491 |
| 677 | Ga0207643_10266169 | 3300025908 | Unclassified | 1059 |
| 678 | Ga0207705_10007986 | 3300025909 | Bacteria | 7763 |
| 679 | Ga0207705_10085948 | 3300025909 | Bacteria | 2298 |
| 680 | Ga0207705_10089643 | 3300025909 | Bacteria | 2251 |
| 681 | Ga0207705_10092825 | 3300025909 | Bacteria | 2212 |
| 682 | Ga0207705_10104101 | 3300025909 | Bacteria | 2091 |
| 683 | Ga0207705_10568143 | 3300025909 | Bacteria | 882 |
| 684 | Ga0207684_10135612 | 3300025910 | Bacteria | 2114 |
| 685 | Ga0207684_10299794 | 3300025910 | Bacteria | 1386 |
| 686 | Ga0207684_11538460 | 3300025910 | Unclassified | 540 |
| 687 | Ga0207684_11568418 | 3300025910 | Bacteria | 534 |
| 688 | Ga0207654_10000860 | 3300025911 | Bacteria | 16810 |
| 689 | Ga0207654_10222487 | 3300025911 | Bacteria | 1253 |
| 690 | Ga0207654_10324081 | 3300025911 | Bacteria | 1054 |
| 691 | Ga0207654_10756775 | 3300025911 | Bacteria | 700 |
| 692 | Ga0207654_10955665 | 3300025911 | Bacteria | 622 |
| 693 | Ga0207654_11030082 | 3300025911 | Bacteria | 599 |
| 694 | Ga0207707_10000929 | 3300025912 | Bacteria | 28400 |
| 695 | Ga0207707_10002146 | 3300025912 | Bacteria | 17846 |
| 696 | Ga0207707_10002891 | 3300025912 | Bacteria | 15329 |
| 697 | Ga0207707_10007791 | 3300025912 | Bacteria | 9323 |
| 698 | Ga0207707_10013410 | 3300025912 | Bacteria | 7146 |
| 699 | Ga0207707_10018294 | 3300025912 | Bacteria | 6109 |
| 700 | Ga0207707_10021378 | 3300025912 | Bacteria | 5656 |
| 701 | Ga0207707_10029197 | 3300025912 | Bacteria | 4820 |
| 702 | Ga0207707_10075721 | 3300025912 | Bacteria | 2937 |
| 703 | Ga0207707_10138032 | 3300025912 | Unclassified | 2132 |
| 704 | Ga0207707_10629028 | 3300025912 | Bacteria | 906 |
| 705 | Ga0207707_10649450 | 3300025912 | Bacteria | 889 |
| 706 | Ga0207707_11269747 | 3300025912 | Bacteria | 593 |
| 707 | Ga0207695_10001441 | 3300025913 | Bacteria | 39845 |
| 708 | Ga0207695_10004676 | 3300025913 | Bacteria | 18554 |
| 709 | Ga0207695_10008984 | 3300025913 | Bacteria | 12435 |
| 710 | Ga0207695_10014206 | 3300025913 | Bacteria | 9447 |
| 711 | Ga0207695_10020766 | 3300025913 | Bacteria | 7513 |
| 712 | Ga0207695_10044422 | 3300025913 | Bacteria | 4726 |
| 713 | Ga0207695_10064710 | 3300025913 | Bacteria | 3763 |
| 714 | Ga0207695_10081615 | 3300025913 | Bacteria | 3272 |
| 715 | Ga0207695_10084488 | 3300025913 | Bacteria | 3205 |
| 716 | Ga0207671_10019018 | 3300025914 | Bacteria | 5262 |
| 717 | Ga0207671_10131053 | 3300025914 | Bacteria | 1924 |
| 718 | Ga0207671_10390182 | 3300025914 | Bacteria | 1107 |
| 719 | Ga0207693_10019839 | 3300025915 | Bacteria | 5346 |
| 720 | Ga0207693_10041127 | 3300025915 | Bacteria | 3640 |
| 721 | Ga0207693_10361743 | 3300025915 | Bacteria | 1135 |
| 722 | Ga0207693_10406055 | 3300025915 | Unclassified | 1065 |
| 723 | Ga0207693_10410453 | 3300025915 | Unclassified | 1058 |
| 724 | Ga0207693_10421808 | 3300025915 | Bacteria | 1043 |
| 725 | Ga0207693_10613331 | 3300025915 | Bacteria | 846 |
| 726 | Ga0207663_10001490 | 3300025916 | Bacteria | 10915 |
| 727 | Ga0207663_10080650 | 3300025916 | Bacteria | 2128 |
| 728 | Ga0207663_10172527 | 3300025916 | Bacteria | 1537 |
| 729 | Ga0207663_10243302 | 3300025916 | Bacteria | 1320 |
| 730 | Ga0207663_10898578 | 3300025916 | Bacteria | 708 |
| 731 | Ga0207663_11205783 | 3300025916 | Bacteria | 609 |
| 732 | Ga0207660_10001809 | 3300025917 | Bacteria | 14242 |
| 733 | Ga0207660_10017662 | 3300025917 | Bacteria | 4744 |
| 734 | Ga0207660_10032222 | 3300025917 | Bacteria | 3616 |
| 735 | Ga0207660_10065650 | 3300025917 | Bacteria | 2623 |
| 736 | Ga0207660_10087746 | 3300025917 | Bacteria | 2299 |
| 737 | Ga0207660_10090306 | 3300025917 | Bacteria | 2269 |
| 738 | Ga0207660_10101186 | 3300025917 | Bacteria | 2152 |
| 739 | Ga0207660_10141654 | 3300025917 | Bacteria | 1839 |
| 740 | Ga0207660_10218233 | 3300025917 | Bacteria | 1496 |
| 741 | Ga0207660_10239322 | 3300025917 | Unclassified | 1429 |
| 742 | Ga0207660_10918590 | 3300025917 | Bacteria | 714 |
| 743 | Ga0207660_11133214 | 3300025917 | Bacteria | 637 |
| 744 | Ga0207662_10003841 | 3300025918 | Bacteria | 7805 |
| 745 | Ga0207662_10105844 | 3300025918 | Bacteria | 1749 |
| 746 | Ga0207662_10244175 | 3300025918 | Unclassified | 1176 |
| 747 | Ga0207657_10005262 | 3300025919 | Bacteria | 13552 |
| 748 | Ga0207657_10021232 | 3300025919 | Bacteria | 6115 |
| 749 | Ga0207657_10237526 | 3300025919 | Bacteria | 1456 |
| 750 | Ga0207657_10250158 | 3300025919 | Bacteria | 1413 |
| 751 | Ga0207657_10541662 | 3300025919 | Bacteria | 910 |
| 752 | Ga0207657_10685639 | 3300025919 | Bacteria | 796 |
| 753 | Ga0207657_11469464 | 3300025919 | Unclassified | 510 |
| 754 | Ga0207649_10029427 | 3300025920 | Bacteria | 3243 |
| 755 | Ga0207649_10050337 | 3300025920 | Bacteria | 2576 |
| 756 | Ga0207649_10096437 | 3300025920 | Bacteria | 1948 |
| 757 | Ga0207649_10165257 | 3300025920 | Bacteria | 1537 |
| 758 | Ga0207649_10174948 | 3300025920 | Bacteria | 1498 |
| 759 | Ga0207649_10852542 | 3300025920 | Bacteria | 713 |
| 760 | Ga0207652_10000470 | 3300025921 | Bacteria | 41380 |
| 761 | Ga0207652_10003423 | 3300025921 | Bacteria | 13091 |
| 762 | Ga0207652_10007324 | 3300025921 | Bacteria | 8892 |
| 763 | Ga0207652_10020285 | 3300025921 | Bacteria | 5472 |
| 764 | Ga0207652_10022221 | 3300025921 | Bacteria | 5244 |
| 765 | Ga0207652_10024204 | 3300025921 | Bacteria | 5036 |
| 766 | Ga0207652_10031148 | 3300025921 | Bacteria | 4476 |
| 767 | Ga0207652_10086061 | 3300025921 | Bacteria | 2755 |
| 768 | Ga0207652_10088832 | 3300025921 | Bacteria | 2712 |
| 769 | Ga0207652_10267542 | 3300025921 | Bacteria | 1542 |
| 770 | Ga0207652_10564050 | 3300025921 | Bacteria | 1023 |
| 771 | Ga0207652_11525639 | 3300025921 | Bacteria | 572 |
| 772 | Ga0207646_10123227 | 3300025922 | Bacteria | 2330 |
| 773 | Ga0207646_10142024 | 3300025922 | Bacteria | 2163 |
| 774 | Ga0207646_10424101 | 3300025922 | Bacteria | 1201 |
| 775 | Ga0207681_10009785 | 3300025923 | Bacteria | 5864 |
| 776 | Ga0207681_10054383 | 3300025923 | Bacteria | 2722 |
| 777 | Ga0207681_10066558 | 3300025923 | Bacteria | 2494 |
| 778 | Ga0207681_10221702 | 3300025923 | Bacteria | 1463 |
| 779 | Ga0207694_10023333 | 3300025924 | Bacteria | 4696 |
| 780 | Ga0207694_10137479 | 3300025924 | Bacteria | 1963 |
| 781 | Ga0207694_10209118 | 3300025924 | Bacteria | 1589 |
| 782 | Ga0207694_10360180 | 3300025924 | Bacteria | 1205 |
| 783 | Ga0207694_10664094 | 3300025924 | Bacteria | 878 |
| 784 | Ga0207694_11230706 | 3300025924 | Unclassified | 633 |
| 785 | Ga0207650_10004487 | 3300025925 | Bacteria | 9540 |
| 786 | Ga0207650_10101704 | 3300025925 | Unclassified | 2213 |
| 787 | Ga0207650_10104656 | 3300025925 | Bacteria | 2184 |
| 788 | Ga0207659_10003254 | 3300025926 | Bacteria | 9727 |
| 789 | Ga0207659_10009170 | 3300025926 | Bacteria | 6179 |
| 790 | Ga0207659_10555758 | 3300025926 | Bacteria | 976 |
| 791 | Ga0207659_10642311 | 3300025926 | Bacteria | 907 |
| 792 | Ga0207659_11039265 | 3300025926 | Bacteria | 705 |
| 793 | Ga0207659_11089345 | 3300025926 | Bacteria | 687 |
| 794 | Ga0207687_10039639 | 3300025927 | Bacteria | 3226 |
| 795 | Ga0207687_10073181 | 3300025927 | Bacteria | 2453 |
| 796 | Ga0207700_10038793 | 3300025928 | Bacteria | 3461 |
| 797 | Ga0207700_10054883 | 3300025928 | Bacteria | 2993 |
| 798 | Ga0207700_10089999 | 3300025928 | Bacteria | 2420 |
| 799 | Ga0207700_10123261 | 3300025928 | Bacteria | 2105 |
| 800 | Ga0207700_10243155 | 3300025928 | Bacteria | 1535 |
| 801 | Ga0207700_10337740 | 3300025928 | Bacteria | 1309 |
| 802 | Ga0207700_10819651 | 3300025928 | Bacteria | 832 |
| 803 | Ga0207664_10025601 | 3300025929 | Bacteria | 4449 |
| 804 | Ga0207664_10039577 | 3300025929 | Bacteria | 3661 |
| 805 | Ga0207664_10119297 | 3300025929 | Unclassified | 2205 |
| 806 | Ga0207664_10167885 | 3300025929 | Unclassified | 1876 |
| 807 | Ga0207664_10572851 | 3300025929 | Bacteria | 1013 |
| 808 | Ga0207644_10035451 | 3300025931 | Bacteria | 3496 |
| 809 | Ga0207644_10257273 | 3300025931 | Unclassified | 1395 |
| 810 | Ga0207644_10686395 | 3300025931 | Bacteria | 853 |
| 811 | Ga0207644_10722079 | 3300025931 | Bacteria | 831 |
| 812 | Ga0207690_10012598 | 3300025932 | Bacteria | 5063 |
| 813 | Ga0207690_10037581 | 3300025932 | Bacteria | 3145 |
| 814 | Ga0207690_10042611 | 3300025932 | Bacteria | 2982 |
| 815 | Ga0207690_10044207 | 3300025932 | Bacteria | 2935 |
| 816 | Ga0207690_10068413 | 3300025932 | Bacteria | 2440 |
| 817 | Ga0207690_10278896 | 3300025932 | Bacteria | 1301 |
| 818 | Ga0207690_10747510 | 3300025932 | Unclassified | 806 |
| 819 | Ga0207690_11017212 | 3300025932 | Bacteria | 690 |
| 820 | Ga0207690_11587498 | 3300025932 | Bacteria | 547 |
| 821 | Ga0207706_10000065 | 3300025933 | Bacteria | 109080 |
| 822 | Ga0207706_10000357 | 3300025933 | Bacteria | 49369 |
| 823 | Ga0207706_10297873 | 3300025933 | Bacteria | 1406 |
| 824 | Ga0207706_11025855 | 3300025933 | Bacteria | 692 |
| 825 | Ga0207706_11312440 | 3300025933 | Bacteria | 597 |
| 826 | Ga0207686_10001117 | 3300025934 | Bacteria | 15528 |
| 827 | Ga0207686_10171259 | 3300025934 | Unclassified | 1531 |
| 828 | Ga0207709_10004346 | 3300025935 | Bacteria | 8201 |
| 829 | Ga0207709_10567253 | 3300025935 | Bacteria | 895 |
| 830 | Ga0207709_10740090 | 3300025935 | Bacteria | 790 |
| 831 | Ga0207670_10120778 | 3300025936 | Bacteria | 1904 |
| 832 | Ga0207670_11386390 | 3300025936 | Unclassified | 597 |
| 833 | Ga0207669_10001479 | 3300025937 | Bacteria | 10039 |
| 834 | Ga0207669_10015931 | 3300025937 | Bacteria | 3805 |
| 835 | Ga0207669_10077102 | 3300025937 | Bacteria | 2118 |
| 836 | Ga0207669_10215008 | 3300025937 | Bacteria | 1406 |
| 837 | Ga0207704_10058637 | 3300025938 | Bacteria | 2371 |
| 838 | Ga0207704_10414369 | 3300025938 | Bacteria | 1066 |
| 839 | Ga0207665_10157887 | 3300025939 | Bacteria | 1629 |
| 840 | Ga0207665_10226418 | 3300025939 | Bacteria | 1373 |
| 841 | Ga0207665_10407598 | 3300025939 | Bacteria | 1036 |
| 842 | Ga0207665_11088389 | 3300025939 | Bacteria | 637 |
| 843 | Ga0207665_11404281 | 3300025939 | Bacteria | 556 |
| 844 | Ga0207691_10001355 | 3300025940 | Bacteria | 24425 |
| 845 | Ga0207691_10001550 | 3300025940 | Bacteria | 22813 |
| 846 | Ga0207691_10022438 | 3300025940 | Bacteria | 5953 |
| 847 | Ga0207691_10131502 | 3300025940 | Bacteria | 2210 |
| 848 | Ga0207711_10028892 | 3300025941 | Bacteria | 4671 |
| 849 | Ga0207711_10222614 | 3300025941 | Unclassified | 1726 |
| 850 | Ga0207711_10908831 | 3300025941 | Bacteria | 818 |
| 851 | Ga0207689_10001360 | 3300025942 | Bacteria | 23476 |
| 852 | Ga0207689_10007750 | 3300025942 | Bacteria | 9398 |
| 853 | Ga0207689_10665749 | 3300025942 | Bacteria | 877 |
| 854 | Ga0207689_11505011 | 3300025942 | Bacteria | 562 |
| 855 | Ga0207661_10011833 | 3300025944 | Bacteria | 6336 |
| 856 | Ga0207661_10019670 | 3300025944 | Bacteria | 5040 |
| 857 | Ga0207661_10022228 | 3300025944 | Bacteria | 4771 |
| 858 | Ga0207661_10032021 | 3300025944 | Bacteria | 4070 |
| 859 | Ga0207661_10037459 | 3300025944 | Bacteria | 3793 |
| 860 | Ga0207661_10068735 | 3300025944 | Bacteria | 2885 |
| 861 | Ga0207661_10323213 | 3300025944 | Bacteria | 1387 |
| 862 | Ga0207661_10716921 | 3300025944 | Bacteria | 920 |
| 863 | Ga0207661_11987297 | 3300025944 | Unclassified | 527 |
| 864 | Ga0207661_12145826 | 3300025944 | Bacteria | 505 |
| 865 | Ga0207679_10000484 | 3300025945 | Bacteria | 27676 |
| 866 | Ga0207679_10006509 | 3300025945 | Bacteria | 7385 |
| 867 | Ga0207679_10024777 | 3300025945 | Bacteria | 4117 |
| 868 | Ga0207679_10271920 | 3300025945 | Bacteria | 1449 |
| 869 | Ga0207679_10276220 | 3300025945 | Bacteria | 1439 |
| 870 | Ga0207679_10602183 | 3300025945 | Bacteria | 990 |
| 871 | Ga0207667_10011137 | 3300025949 | Bacteria | 10468 |
| 872 | Ga0207667_10019276 | 3300025949 | Bacteria | 7622 |
| 873 | Ga0207667_10081585 | 3300025949 | Bacteria | 3350 |
| 874 | Ga0207667_10187587 | 3300025949 | Bacteria | 2122 |
| 875 | Ga0207667_10950863 | 3300025949 | Bacteria | 849 |
| 876 | Ga0207651_10058551 | 3300025960 | Bacteria | 2663 |
| 877 | Ga0207651_10150000 | 3300025960 | Bacteria | 1813 |
| 878 | Ga0207651_10452791 | 3300025960 | Bacteria | 1101 |
| 879 | Ga0207712_10001176 | 3300025961 | Bacteria | 18145 |
| 880 | Ga0207712_10044891 | 3300025961 | Bacteria | 3058 |
| 881 | Ga0207712_10130934 | 3300025961 | Bacteria | 1912 |
| 882 | Ga0207712_10481269 | 3300025961 | Bacteria | 1058 |
| 883 | Ga0207712_11682783 | 3300025961 | Unclassified | 569 |
| 884 | Ga0207668_10021247 | 3300025972 | Bacteria | 4137 |
| 885 | Ga0207668_10053139 | 3300025972 | Bacteria | 2806 |
| 886 | Ga0207668_10730561 | 3300025972 | Archaea | 872 |
| 887 | Ga0207640_10001456 | 3300025981 | Bacteria | 12799 |
| 888 | Ga0207640_10050446 | 3300025981 | Bacteria | 2700 |
| 889 | Ga0207640_10104663 | 3300025981 | Bacteria | 1993 |
| 890 | Ga0207640_10110876 | 3300025981 | Bacteria | 1945 |
| 891 | Ga0207640_10286487 | 3300025981 | Bacteria | 1297 |
| 892 | Ga0207640_10370752 | 3300025981 | Bacteria | 1157 |
| 893 | Ga0207640_10501830 | 3300025981 | Unclassified | 1010 |
| 894 | Ga0207658_10060833 | 3300025986 | Bacteria | 2820 |
| 895 | Ga0207658_10178304 | 3300025986 | Bacteria | 1756 |
| 896 | Ga0207658_11525645 | 3300025986 | Unclassified | 611 |
| 897 | Ga0207703_10156270 | 3300026035 | Bacteria | 1993 |
| 898 | Ga0207639_10004358 | 3300026041 | Bacteria | 9545 |
| 899 | Ga0207639_10116510 | 3300026041 | Bacteria | 2187 |
| 900 | Ga0207639_10150381 | 3300026041 | Bacteria | 1949 |
| 901 | Ga0207639_10331802 | 3300026041 | Bacteria | 1354 |
| 902 | Ga0207639_10517425 | 3300026041 | Bacteria | 1092 |
| 903 | Ga0207639_11916862 | 3300026041 | Bacteria | 553 |
| 904 | Ga0207678_10041333 | 3300026067 | Bacteria | 3998 |
| 905 | Ga0207678_10041868 | 3300026067 | Bacteria | 3970 |
| 906 | Ga0207678_10068814 | 3300026067 | Bacteria | 3036 |
| 907 | Ga0207678_10423890 | 3300026067 | Unclassified | 1154 |
| 908 | Ga0207678_12011429 | 3300026067 | Unclassified | 503 |
| 909 | Ga0207708_10098662 | 3300026075 | Bacteria | 2258 |
| 910 | Ga0207708_10104714 | 3300026075 | Bacteria | 2192 |
| 911 | Ga0207708_10154233 | 3300026075 | Bacteria | 1810 |
| 912 | Ga0207708_10751038 | 3300026075 | Bacteria | 837 |
| 913 | Ga0207702_10057844 | 3300026078 | Bacteria | 3297 |
| 914 | Ga0207702_10071273 | 3300026078 | Bacteria | 2992 |
| 915 | Ga0207702_10745631 | 3300026078 | Unclassified | 967 |
| 916 | Ga0207702_10915538 | 3300026078 | Bacteria | 869 |
| 917 | Ga0207702_10990133 | 3300026078 | Bacteria | 834 |
| 918 | Ga0207702_11682985 | 3300026078 | Bacteria | 627 |
| 919 | Ga0207641_10107617 | 3300026088 | Bacteria | 2466 |
| 920 | Ga0207641_10345441 | 3300026088 | Unclassified | 1417 |
| 921 | Ga0207648_10001169 | 3300026089 | Bacteria | 29362 |
| 922 | Ga0207648_10005220 | 3300026089 | Bacteria | 13139 |
| 923 | Ga0207648_10023923 | 3300026089 | Bacteria | 5460 |
| 924 | Ga0207648_10046448 | 3300026089 | Bacteria | 3807 |
| 925 | Ga0207648_12191754 | 3300026089 | Unclassified | 513 |
| 926 | Ga0207676_10048851 | 3300026095 | Bacteria | 3287 |
| 927 | Ga0207676_10093952 | 3300026095 | Bacteria | 2470 |
| 928 | Ga0207676_10142837 | 3300026095 | Bacteria | 2051 |
| 929 | Ga0207676_10163981 | 3300026095 | Bacteria | 1929 |
| 930 | Ga0207676_10343365 | 3300026095 | Bacteria | 1378 |
| 931 | Ga0207676_11694275 | 3300026095 | Bacteria | 630 |
| 932 | Ga0207674_10003135 | 3300026116 | Bacteria | 20383 |
| 933 | Ga0207674_10015526 | 3300026116 | Bacteria | 8364 |
| 934 | Ga0207674_10018565 | 3300026116 | Bacteria | 7555 |
| 935 | Ga0207674_10059142 | 3300026116 | Bacteria | 3880 |
| 936 | Ga0207674_10140302 | 3300026116 | Bacteria | 2376 |
| 937 | Ga0207674_10296301 | 3300026116 | Unclassified | 1566 |
| 938 | Ga0207674_10677573 | 3300026116 | Bacteria | 995 |
| 939 | Ga0207674_11584205 | 3300026116 | Unclassified | 624 |
| 940 | Ga0207675_100000320 | 3300026118 | Bacteria | 45668 |
| 941 | Ga0207675_100032261 | 3300026118 | Bacteria | 4879 |
| 942 | Ga0207675_100059762 | 3300026118 | Bacteria | 3558 |
| 943 | Ga0207675_100314828 | 3300026118 | Bacteria | 1527 |
| 944 | Ga0207675_100341058 | 3300026118 | Bacteria | 1467 |
| 945 | Ga0207683_10033546 | 3300026121 | Bacteria | 4459 |
| 946 | Ga0207683_10041068 | 3300026121 | Bacteria | 4038 |
| 947 | Ga0207683_10059100 | 3300026121 | Bacteria | 3367 |
| 948 | Ga0207683_10295458 | 3300026121 | Bacteria | 1482 |
| 949 | Ga0207698_10007055 | 3300026142 | Bacteria | 7036 |
| 950 | Ga0207698_10013973 | 3300026142 | Bacteria | 5318 |
| 951 | Ga0207698_10256188 | 3300026142 | Bacteria | 1604 |
| 952 | Ga0207698_11013550 | 3300026142 | Bacteria | 841 |
| 953 | Ga0207698_11089470 | 3300026142 | Bacteria | 811 |
| 954 | Ga0207698_11123693 | 3300026142 | Bacteria | 799 |
| 955 | Ga0207698_11183172 | 3300026142 | Bacteria | 778 |
| 956 | Ga0207698_11211289 | 3300026142 | Bacteria | 769 |
| 957 | Ga0207428_10075404 | 3300027907 | Bacteria | 2643 |
| 958 | Ga0207428_10258988 | 3300027907 | Bacteria | 1296 |
| 959 | Ga0268266_10083429 | 3300028379 | Bacteria | 2790 |
| 960 | Ga0268266_10102533 | 3300028379 | Bacteria | 2524 |
| 961 | Ga0268266_11123594 | 3300028379 | Bacteria | 760 |
| 962 | Ga0268265_10002121 | 3300028380 | Bacteria | 15384 |
| 963 | Ga0268265_10037895 | 3300028380 | Bacteria | 3541 |
| 964 | Ga0268265_10266956 | 3300028380 | Bacteria | 1524 |
| 965 | Ga0268265_10715986 | 3300028380 | Unclassified | 968 |
| 966 | Ga0268265_10802452 | 3300028380 | Bacteria | 918 |
| 967 | Ga0268264_10022106 | 3300028381 | Bacteria | 5192 |
| 968 | Ga0268264_10480925 | 3300028381 | Bacteria | 1208 |
| 969 | Ga0268264_10488128 | 3300028381 | Bacteria | 1199 |
| 970 | Ga0316178_1053326 | 3300030735 | Bacteria | 540 |
| 971 | Ga0307408_100008337 | 3300031548 | Bacteria | 6844 |
| 972 | Ga0307408_100187150 | 3300031548 | Bacteria | 1665 |
| 973 | Ga0307408_100297064 | 3300031548 | Bacteria | 1351 |
| 974 | Ga0307408_100368413 | 3300031548 | Bacteria | 1224 |
| 975 | Ga0307408_100559101 | 3300031548 | Bacteria | 1011 |
| 976 | Ga0307408_100875500 | 3300031548 | Bacteria | 820 |
| 977 | Ga0307408_102494544 | 3300031548 | Bacteria | 503 |
| 978 | Ga0316579_10111135 | 3300031691 | Bacteria | 1315 |
| 979 | Ga0316576_10002948 | 3300031727 | Bacteria | 9864 |
| 980 | Ga0316578_10013404 | 3300031728 | Bacteria | 4349 |
| 981 | Ga0316578_10015348 | 3300031728 | Bacteria | 4117 |
| 982 | Ga0307405_10000187 | 3300031731 | Bacteria | 22922 |
| 983 | Ga0307405_10014127 | 3300031731 | Bacteria | 4283 |
| 984 | Ga0307405_10036009 | 3300031731 | Bacteria | 2962 |
| 985 | Ga0307405_10092885 | 3300031731 | Bacteria | 2003 |
| 986 | Ga0307405_10144722 | 3300031731 | Bacteria | 1663 |
| 987 | Ga0307405_10154782 | 3300031731 | Unclassified | 1616 |
| 988 | Ga0307405_10173627 | 3300031731 | Bacteria | 1540 |
| 989 | Ga0307405_10258162 | 3300031731 | Bacteria | 1300 |
| 990 | Ga0307405_10406577 | 3300031731 | Bacteria | 1067 |
| 991 | Ga0307405_10487220 | 3300031731 | Bacteria | 985 |
| 992 | Ga0307405_10986256 | 3300031731 | Bacteria | 718 |
| 993 | Ga0307405_11102917 | 3300031731 | Bacteria | 682 |
| 994 | Ga0307405_11372694 | 3300031731 | Bacteria | 617 |
| 995 | Ga0307405_12113955 | 3300031731 | Bacteria | 505 |
| 996 | Ga0307405_12137608 | 3300031731 | Bacteria | 503 |
| 997 | Ga0316577_10002399 | 3300031733 | Bacteria | 9273 |
| 998 | Ga0316577_10025102 | 3300031733 | Bacteria | 3315 |
| 999 | Ga0307413_10000837 | 3300031824 | Bacteria | 10804 |
| 1000 | Ga0307413_10002229 | 3300031824 | Bacteria | 7809 |
| 1001 | Ga0307413_10030411 | 3300031824 | Bacteria | 3033 |
| 1002 | Ga0307413_10042391 | 3300031824 | Bacteria | 2674 |
| 1003 | Ga0307413_10055375 | 3300031824 | Bacteria | 2413 |
| 1004 | Ga0307413_10073618 | 3300031824 | Bacteria | 2160 |
| 1005 | Ga0307413_10140859 | 3300031824 | Bacteria | 1666 |
| 1006 | Ga0307413_10171588 | 3300031824 | Bacteria | 1536 |
| 1007 | Ga0307413_10284805 | 3300031824 | Bacteria | 1245 |
| 1008 | Ga0307413_10457015 | 3300031824 | Bacteria | 1015 |
| 1009 | Ga0307413_10640847 | 3300031824 | Bacteria | 875 |
| 1010 | Ga0307413_10817679 | 3300031824 | Unclassified | 784 |
| 1011 | Ga0307413_11214826 | 3300031824 | Bacteria | 656 |
| 1012 | Ga0307410_10002520 | 3300031852 | Bacteria | 8857 |
| 1013 | Ga0307410_10012076 | 3300031852 | Bacteria | 4972 |
| 1014 | Ga0307410_10015315 | 3300031852 | Bacteria | 4545 |
| 1015 | Ga0307410_10022976 | 3300031852 | Bacteria | 3867 |
| 1016 | Ga0307410_10027658 | 3300031852 | Bacteria | 3587 |
| 1017 | Ga0307410_10070059 | 3300031852 | Bacteria | 2427 |
| 1018 | Ga0307410_10127016 | 3300031852 | Bacteria | 1868 |
| 1019 | Ga0307410_10249681 | 3300031852 | Bacteria | 1379 |
| 1020 | Ga0307410_10272665 | 3300031852 | Bacteria | 1324 |
| 1021 | Ga0307410_10314703 | 3300031852 | Bacteria | 1240 |
| 1022 | Ga0307410_10337316 | 3300031852 | Bacteria | 1200 |
| 1023 | Ga0307410_10344968 | 3300031852 | Bacteria | 1188 |
| 1024 | Ga0307410_10345358 | 3300031852 | Bacteria | 1187 |
| 1025 | Ga0307410_10498068 | 3300031852 | Bacteria | 1002 |
| 1026 | Ga0307410_10549744 | 3300031852 | Bacteria | 957 |
| 1027 | Ga0307410_11023698 | 3300031852 | Bacteria | 713 |
| 1028 | Ga0307410_11691523 | 3300031852 | Unclassified | 560 |
| 1029 | Ga0307406_10001688 | 3300031901 | Bacteria | 12133 |
| 1030 | Ga0307406_10002595 | 3300031901 | Bacteria | 9848 |
| 1031 | Ga0307406_10014718 | 3300031901 | Bacteria | 4506 |
| 1032 | Ga0307406_10023424 | 3300031901 | Bacteria | 3673 |
| 1033 | Ga0307406_10028708 | 3300031901 | Bacteria | 3363 |
| 1034 | Ga0307406_10043279 | 3300031901 | Bacteria | 2815 |
| 1035 | Ga0307406_10085068 | 3300031901 | Bacteria | 2114 |
| 1036 | Ga0307406_10108565 | 3300031901 | Bacteria | 1905 |
| 1037 | Ga0307406_10146070 | 3300031901 | Unclassified | 1681 |
| 1038 | Ga0307406_10230915 | 3300031901 | Bacteria | 1382 |
| 1039 | Ga0307406_10260498 | 3300031901 | Bacteria | 1312 |
| 1040 | Ga0307406_10362133 | 3300031901 | Bacteria | 1137 |
| 1041 | Ga0307406_11611758 | 3300031901 | Bacteria | 573 |
| 1042 | Ga0307407_10000201 | 3300031903 | Bacteria | 18078 |
| 1043 | Ga0307407_10004682 | 3300031903 | Bacteria | 5843 |
| 1044 | Ga0307407_10008899 | 3300031903 | Bacteria | 4640 |
| 1045 | Ga0307407_10024361 | 3300031903 | Bacteria | 3173 |
| 1046 | Ga0307407_10027368 | 3300031903 | Bacteria | 3033 |
| 1047 | Ga0307407_10085331 | 3300031903 | Bacteria | 1921 |
| 1048 | Ga0307407_10091391 | 3300031903 | Bacteria | 1866 |
| 1049 | Ga0307407_10116337 | 3300031903 | Bacteria | 1687 |
| 1050 | Ga0307407_10124907 | 3300031903 | Bacteria | 1637 |
| 1051 | Ga0307407_10333724 | 3300031903 | Bacteria | 1068 |
| 1052 | Ga0307407_10342090 | 3300031903 | Bacteria | 1057 |
| 1053 | Ga0307407_10379864 | 3300031903 | Bacteria | 1008 |
| 1054 | Ga0307407_10441069 | 3300031903 | Bacteria | 943 |
| 1055 | Ga0307407_10525226 | 3300031903 | Bacteria | 871 |
| 1056 | Ga0307407_10962072 | 3300031903 | Unclassified | 658 |
| 1057 | Ga0307412_10012476 | 3300031911 | Bacteria | 4956 |
| 1058 | Ga0307412_10028271 | 3300031911 | Bacteria | 3506 |
| 1059 | Ga0307412_10129946 | 3300031911 | Bacteria | 1828 |
| 1060 | Ga0307412_10193021 | 3300031911 | Bacteria | 1541 |
| 1061 | Ga0307412_10234054 | 3300031911 | Bacteria | 1416 |
| 1062 | Ga0307412_10398104 | 3300031911 | Bacteria | 1120 |
| 1063 | Ga0307412_11261340 | 3300031911 | Bacteria | 664 |
| 1064 | Ga0307409_100000144 | 3300031995 | Bacteria | 26764 |
| 1065 | Ga0307409_100003493 | 3300031995 | Bacteria | 8552 |
| 1066 | Ga0307409_100009411 | 3300031995 | Bacteria | 6000 |
| 1067 | Ga0307409_100009792 | 3300031995 | Bacteria | 5910 |
| 1068 | Ga0307409_100023234 | 3300031995 | Bacteria | 4291 |
| 1069 | Ga0307409_100026152 | 3300031995 | Bacteria | 4111 |
| 1070 | Ga0307409_100027599 | 3300031995 | Bacteria | 4027 |
| 1071 | Ga0307409_100033448 | 3300031995 | Bacteria | 3742 |
| 1072 | Ga0307409_100048332 | 3300031995 | Bacteria | 3236 |
| 1073 | Ga0307409_100118546 | 3300031995 | Bacteria | 2236 |
| 1074 | Ga0307409_100126080 | 3300031995 | Unclassified | 2178 |
| 1075 | Ga0307409_100186505 | 3300031995 | Bacteria | 1842 |
| 1076 | Ga0307409_100254667 | 3300031995 | Unclassified | 1607 |
| 1077 | Ga0307409_100383328 | 3300031995 | Bacteria | 1337 |
| 1078 | Ga0307409_100556156 | 3300031995 | Bacteria | 1127 |
| 1079 | Ga0307409_100717738 | 3300031995 | Bacteria | 1000 |
| 1080 | Ga0307409_100867596 | 3300031995 | Bacteria | 914 |
| 1081 | Ga0307409_101141677 | 3300031995 | Bacteria | 801 |
| 1082 | Ga0307416_100000828 | 3300032002 | Bacteria | 16247 |
| 1083 | Ga0307416_100004156 | 3300032002 | Bacteria | 8675 |
| 1084 | Ga0307416_100007355 | 3300032002 | Bacteria | 6994 |
| 1085 | Ga0307416_100012718 | 3300032002 | Bacteria | 5685 |
| 1086 | Ga0307416_100014248 | 3300032002 | Bacteria | 5438 |
| 1087 | Ga0307416_100024844 | 3300032002 | Bacteria | 4381 |
| 1088 | Ga0307416_100049239 | 3300032002 | Bacteria | 3349 |
| 1089 | Ga0307416_100073566 | 3300032002 | Bacteria | 2850 |
| 1090 | Ga0307416_100073588 | 3300032002 | Bacteria | 2850 |
| 1091 | Ga0307416_100120247 | 3300032002 | Bacteria | 2338 |
| 1092 | Ga0307416_100247873 | 3300032002 | Bacteria | 1731 |
| 1093 | Ga0307416_100356860 | 3300032002 | Bacteria | 1482 |
| 1094 | Ga0307416_100450307 | 3300032002 | Bacteria | 1340 |
| 1095 | Ga0307416_100477679 | 3300032002 | Bacteria | 1306 |
| 1096 | Ga0307416_100511350 | 3300032002 | Bacteria | 1267 |
| 1097 | Ga0307416_100735010 | 3300032002 | Bacteria | 1078 |
| 1098 | Ga0307416_101424102 | 3300032002 | Bacteria | 799 |
| 1099 | Ga0307416_102811952 | 3300032002 | Unclassified | 582 |
| 1100 | Ga0307416_103058978 | 3300032002 | Bacteria | 560 |
| 1101 | Ga0307416_103753912 | 3300032002 | Bacteria | 508 |
| 1102 | Ga0307414_10002383 | 3300032004 | Bacteria | 9831 |
| 1103 | Ga0307414_10006027 | 3300032004 | Bacteria | 6721 |
| 1104 | Ga0307414_10030309 | 3300032004 | Bacteria | 3532 |
| 1105 | Ga0307414_10043031 | 3300032004 | Bacteria | 3073 |
| 1106 | Ga0307414_10090810 | 3300032004 | Bacteria | 2268 |
| 1107 | Ga0307414_10345745 | 3300032004 | Bacteria | 1275 |
| 1108 | Ga0307414_10408267 | 3300032004 | Bacteria | 1181 |
| 1109 | Ga0307414_10426642 | 3300032004 | Bacteria | 1157 |
| 1110 | Ga0307414_10465715 | 3300032004 | Bacteria | 1112 |
| 1111 | Ga0307414_11271125 | 3300032004 | Bacteria | 682 |
| 1112 | Ga0307411_10001066 | 3300032005 | Bacteria | 10635 |
| 1113 | Ga0307411_10006929 | 3300032005 | Bacteria | 5717 |
| 1114 | Ga0307411_10007270 | 3300032005 | Bacteria | 5620 |
| 1115 | Ga0307411_10017609 | 3300032005 | Bacteria | 4077 |
| 1116 | Ga0307411_10028273 | 3300032005 | Bacteria | 3407 |
| 1117 | Ga0307411_10045742 | 3300032005 | Bacteria | 2817 |
| 1118 | Ga0307411_10062970 | 3300032005 | Bacteria | 2476 |
| 1119 | Ga0307411_10141185 | 3300032005 | Bacteria | 1776 |
| 1120 | Ga0307411_10147865 | 3300032005 | Bacteria | 1742 |
| 1121 | Ga0307411_10166152 | 3300032005 | Bacteria | 1659 |
| 1122 | Ga0307411_10208308 | 3300032005 | Bacteria | 1508 |
| 1123 | Ga0307411_10276620 | 3300032005 | Unclassified | 1334 |
| 1124 | Ga0307411_10282820 | 3300032005 | Bacteria | 1321 |
| 1125 | Ga0307411_10531822 | 3300032005 | Bacteria | 1000 |
| 1126 | Ga0307411_10645798 | 3300032005 | Bacteria | 915 |
| 1127 | Ga0307411_10663386 | 3300032005 | Bacteria | 904 |
| 1128 | Ga0307411_10672848 | 3300032005 | Bacteria | 898 |
| 1129 | Ga0307411_10773159 | 3300032005 | Bacteria | 843 |
| 1130 | Ga0307411_10858996 | 3300032005 | Bacteria | 803 |
| 1131 | Ga0307411_11345317 | 3300032005 | Unclassified | 652 |
| 1132 | Ga0307411_11551779 | 3300032005 | Bacteria | 610 |
| 1133 | Ga0307411_11809007 | 3300032005 | Bacteria | 567 |
| 1134 | Ga0307411_11845197 | 3300032005 | Bacteria | 562 |
| 1135 | Ga0307415_100000419 | 3300032126 | Bacteria | 18192 |
| 1136 | Ga0307415_100002432 | 3300032126 | Bacteria | 9294 |
| 1137 | Ga0307415_100021813 | 3300032126 | Bacteria | 3944 |
| 1138 | Ga0307415_100036475 | 3300032126 | Bacteria | 3222 |
| 1139 | Ga0307415_100041599 | 3300032126 | Bacteria | 3052 |
| 1140 | Ga0307415_100051781 | 3300032126 | Bacteria | 2788 |
| 1141 | Ga0307415_100125154 | 3300032126 | Bacteria | 1936 |
| 1142 | Ga0307415_100143241 | 3300032126 | Bacteria | 1829 |
| 1143 | Ga0307415_100459811 | 3300032126 | Bacteria | 1102 |
| 1144 | Ga0307415_100490786 | 3300032126 | Bacteria | 1071 |
| 1145 | Ga0307415_100970217 | 3300032126 | Bacteria | 788 |
| 1146 | Ga0307415_102463500 | 3300032126 | Bacteria | 512 |
| 1147 | Ga0316583_10003563 | 3300032133 | Bacteria | 5495 |
| 1148 | Ga0316585_10006893 | 3300032137 | Bacteria | 3261 |
| 1149 | Ga0316596_1143350 | 3300033541 | Unclassified | 655 |
| 1150 | Ga0373950_0167964 | 3300034818 | Bacteria | 510 |
| 1151 | Ga0373938_0040184 | 3300034957 | Unclassified | 1037 |
| 1152 | Ga0373926_0004167 | 3300035083 | Bacteria | 4716 |
| 1153 | Ga0373928_0048895 | 3300035084 | Bacteria | 993 |
| 1154 | Ga0373934_0005211 | 3300035086 | Bacteria | 4809 |
| 1155 | Ga0373934_0037374 | 3300035086 | Bacteria | 1912 |
| 1156 | Ga0373934_0040553 | 3300035086 | Bacteria | 1837 |
| 1157 | Ga0373940_0070749 | 3300035088 | Bacteria | 1015 |
| 1158 | Ga0373944_0396028 | 3300035089 | Bacteria | 532 |
| 1159 | Ga0373951_0051655 | 3300035091 | Bacteria | 1012 |
| 1160 | Ga0373952_0095406 | 3300035092 | Bacteria | 778 |
| 1161 | Ga0373923_0007123 | 3300035111 | Bacteria | 3916 |
| 1162 | Ga0373932_0198412 | 3300035112 | Bacteria | 712 |
| 1163 | Ga0373936_0011918 | 3300035113 | Bacteria | 3299 |
| 1164 | Ga0373936_0128849 | 3300035113 | Bacteria | 1086 |
| 1165 | Ga0373941_0333309 | 3300035115 | Unclassified | 613 |
| 1166 | Ga0373945_0258114 | 3300035116 | Unclassified | 738 |
| 1167 | Ga0373953_0002759 | 3300035117 | Bacteria | 5334 |
| 1168 | Ga0373953_0009331 | 3300035117 | Bacteria | 3370 |
| 1169 | Ga0373953_0568949 | 3300035117 | Bacteria | 504 |
| 1170 | Ga0373954_0057621 | 3300035118 | Bacteria | 1830 |
| 1171 | Ga0373954_0066241 | 3300035118 | Bacteria | 1710 |
| 1172 | Ga0373954_0440984 | 3300035118 | Bacteria | 644 |
| 1173 | Ga0373956_0000678 | 3300035119 | Bacteria | 13976 |
| 1174 | Ga0373956_0113697 | 3300035119 | Bacteria | 1261 |
| 1175 | Ga0373956_0548048 | 3300035119 | Unclassified | 552 |
| 1176 | Ga0373957_0099398 | 3300035120 | Bacteria | 1163 |
| 1177 | Ga0373957_0165776 | 3300035120 | Bacteria | 911 |
| 1178 | Ga0373960_0139748 | 3300035121 | Unclassified | 819 |
| 1179 | Ga0373943_0016857 | 3300035170 | Bacteria | 3338 |
| 1180 | Ga0373943_0028594 | 3300035170 | Unclassified | 2628 |
| 1181 | Ga0373946_0009275 | 3300035171 | Bacteria | 3620 |
| 1182 | Ga0373942_0342387 | 3300035207 | Unclassified | 527 |
| 1183 | Ga0373961_0059628 | 3300035241 | Bacteria | 1154 |
| 1184 | Ga0316574_0204529 | 3300035398 | Bacteria | 1268 |
| 1185 | Ga0316574_0695716 | 3300035398 | Bacteria | 624 |
| 1186 | Ga0373924_0002127 | 3300035410 | Bacteria | 6622 |
| 1187 | Ga0373924_0285833 | 3300035410 | Unclassified | 732 |
| 1188 | Ga0373931_0018182 | 3300035691 | Bacteria | 3492 |
| 1189 | Ga0373931_0018416 | 3300035691 | Bacteria | 3474 |
| 1190 | Ga0373935_0018031 | 3300035692 | Bacteria | 4290 |
| 1191 | Ga0373935_0063447 | 3300035692 | Bacteria | 2368 |
| 1192 | Ga0373935_0124591 | 3300035692 | Unclassified | 1725 |
| 1193 | Ga0373935_0378071 | 3300035692 | Bacteria | 1014 |
| 1194 | Ga0373927_0026060 | 3300035695 | Bacteria | 3821 |
| 1195 | Ga0373927_1094838 | 3300035695 | Bacteria | 525 |
| 1196 | Ga0373933_0001111 | 3300035724 | Bacteria | 16018 |
| 1197 | Ga0373933_0013654 | 3300035724 | Bacteria | 4504 |
| 1198 | Ga0373947_0002126 | 3300035725 | Bacteria | 12064 |
| 1199 | Ga0373947_0048812 | 3300035725 | Unclassified | 2540 |
| 1200 | Ga0373947_0115326 | 3300035725 | Unclassified | 1702 |
| 1201 | Ga0373937_0002914 | 3300036401 | Bacteria | 14299 |
| 1202 | Ga0373937_0065385 | 3300036401 | Bacteria | 3347 |
| 1203 | Ga0373937_0096592 | 3300036401 | Bacteria | 2740 |
| 1204 | Ga0316582_0026818 | 3300036647 | Bacteria | 3472 |
| 1205 | Ga0316582_0075578 | 3300036647 | Bacteria | 2189 |
| 1206 | Ga0316584_0009015 | 3300036712 | Bacteria | 6902 |
| 1207 | Ga0373925_0034016 | 3300037068 | Bacteria | 3756 |
| 1208 | Ga0373925_0216655 | 3300037068 | Bacteria | 1527 |
| 1209 | Ga0373925_0592715 | 3300037068 | Archaea | 913 |
| 1210 | Ga0395899_0038329 | 3300037312 | Bacteria | 3590 |
| 1211 | Ga0395900_0005143 | 3300037418 | Bacteria | 13738 |
| 1212 | Ga0395898_0365364 | 3300037466 | Bacteria | 1376 |
| 1213 | Ga0395905_0049760 | 3300037471 | Bacteria | 3928 |
| 1214 | Ga0395905_0117856 | 3300037471 | Bacteria | 2495 |
| 1215 | Ga0395905_0624983 | 3300037471 | Bacteria | 979 |
| 1216 | Ga0395905_1377214 | 3300037471 | Bacteria | 609 |
| 1217 | Ga0316581_0052652 | 3300037588 | Bacteria | 1247 |
| 1218 | Ga0436364_0287855 | 3300037853 | Bacteria | 1071 |
| 1219 | Ga0395901_0003407 | 3300038443 | Bacteria | 16018 |
| 1220 | Ga0395901_0694213 | 3300038443 | Bacteria | 1016 |
| 1221 | Ga0395901_1490842 | 3300038443 | Unclassified | 632 |
| 1222 | Ga0242420_024104 | 3300038996 | Bacteria | 1101 |
| 1223 | Ga0242420_054477 | 3300038996 | Bacteria | 787 |
| 1224 | Ga0436365_0290864 | 3300039437 | Bacteria | 776 |
| 1225 | Ga0436365_0304609 | 3300039437 | Bacteria | 856 |
| 1226 | Ga0436365_1159467 | 3300039437 | Unclassified | 506 |
| 1227 | Ga0436365_1602166 | 3300039437 | Bacteria | 18827 |
| 1228 | Ga0436363_0390436 | 3300039450 | Bacteria | 674 |
| 1229 | Ga0436363_0732405 | 3300039450 | Bacteria | 543 |
| 1230 | Ga0439439_0021339 | 3300041406 | Bacteria | 1614 |
| 1231 | Ga0451839_1205934 | 3300041496 | Bacteria | 701 |
| 1232 | Ga0451853_1987835 | 3300041512 | Bacteria | 543 |
| 1233 | Ga0439448_0040558 | 3300042005 | Bacteria | 1504 |
| 1234 | Ga0439457_103357 | 3300042014 | Bacteria | 665 |
| 1235 | Ga0439462_0132713 | 3300042015 | Unclassified | 696 |
| 1236 | Ga0439446_0184978 | 3300042156 | Unclassified | 698 |
| 1237 | Ga0451577_0003975 | 3300042876 | Bacteria | 15941 |
| 1238 | Ga0451577_0076398 | 3300042876 | Bacteria | 2986 |
| 1239 | Ga0451577_0233619 | 3300042876 | Bacteria | 1663 |
| 1240 | Ga0451577_0278304 | 3300042876 | Unclassified | 1516 |
| 1241 | Ga0453683_0083881 | 3300044673 | Bacteria | 1997 |
| 1242 | Ga0453683_1216232 | 3300044673 | Bacteria | 505 |
| 1243 | Ga0466965_0319755 | 3300044683 | Bacteria | 845 |
| 1244 | Ga0466966_0310517 | 3300044684 | Bacteria | 948 |
| 1245 | Ga0466966_0984788 | 3300044684 | Bacteria | 509 |
| 1246 | Ga0466961_0148652 | 3300044693 | Bacteria | 1464 |
| 1247 | Ga0466964_0177363 | 3300044706 | Bacteria | 1008 |
| 1248 | Ga0466964_0240783 | 3300044706 | Bacteria | 887 |
| 1249 | Ga0466964_0355081 | 3300044706 | Bacteria | 754 |
| 1250 | Ga0453684_1058605 | 3300044712 | Bacteria | 859 |
| 1251 | Ga0466971_0083762 | 3300044719 | Bacteria | 1456 |
| 1252 | Ga0466971_0634884 | 3300044719 | Bacteria | 534 |
| 1253 | Ga0466970_0236236 | 3300044765 | Bacteria | 1022 |
| 1254 | Ga0466957_1006802 | 3300044842 | Unclassified | 599 |
| 1255 | Ga0466957_1282518 | 3300044842 | Bacteria | 531 |
| 1256 | Ga0451576_0042077 | 3300045051 | Bacteria | 4824 |
| 1257 | Ga0451576_0116352 | 3300045051 | Bacteria | 2784 |
| 1258 | Ga0451576_0321037 | 3300045051 | Bacteria | 1620 |
| 1259 | Ga0451576_0781793 | 3300045051 | Bacteria | 1003 |
| 1260 | Ga0451576_1522734 | 3300045051 | Unclassified | 695 |
| 1261 | Ga0466958_0130129 | 3300045836 | Bacteria | 1580 |
| 1262 | Ga0466958_0334514 | 3300045836 | Bacteria | 974 |
| 1263 | Ga0466967_0250970 | 3300045976 | Bacteria | 1690 |
| 1264 | Ga0466967_0533636 | 3300045976 | Bacteria | 1154 |
| 1265 | Ga0466967_0777573 | 3300045976 | Unclassified | 950 |
| 1266 | Ga0466967_2175858 | 3300045976 | Unclassified | 551 |
| 1267 | Ga0495592_0002525 | 3300046454 | Bacteria | 12917 |
| 1268 | Ga0495592_0365590 | 3300046454 | Bacteria | 921 |
| 1269 | Ga0495592_0902943 | 3300046454 | Bacteria | 519 |
| 1270 | Ga0495603_0015387 | 3300046455 | Bacteria | 4628 |
| 1271 | Ga0495603_0046197 | 3300046455 | Bacteria | 2595 |
| 1272 | Ga0495603_0238765 | 3300046455 | Unclassified | 1047 |
| 1273 | Ga0495629_0003115 | 3300046459 | Bacteria | 12567 |
| 1274 | Ga0495629_0025075 | 3300046459 | Bacteria | 4241 |
| 1275 | Ga0495629_0040407 | 3300046459 | Bacteria | 3281 |
| 1276 | Ga0495629_0303378 | 3300046459 | Bacteria | 1093 |
| 1277 | Ga0495629_0618441 | 3300046459 | Bacteria | 723 |
| 1278 | Ga0495629_1112862 | 3300046459 | Bacteria | 510 |
| 1279 | Ga0495651_0009970 | 3300046462 | Bacteria | 7304 |
| 1280 | Ga0495651_0017083 | 3300046462 | Bacteria | 5622 |
| 1281 | Ga0495651_0124418 | 3300046462 | Bacteria | 1890 |
| 1282 | Ga0495651_0644771 | 3300046462 | Bacteria | 664 |
| 1283 | Ga0495653_0000547 | 3300046463 | Bacteria | 28742 |
| 1284 | Ga0495653_0006042 | 3300046463 | Bacteria | 9914 |
| 1285 | Ga0495653_0636764 | 3300046463 | Bacteria | 652 |
| 1286 | Ga0495580_0001189 | 3300046472 | Bacteria | 22911 |
| 1287 | Ga0495580_0005504 | 3300046472 | Bacteria | 10461 |
| 1288 | Ga0495580_0109372 | 3300046472 | Bacteria | 1919 |
| 1289 | Ga0495580_0614116 | 3300046472 | Unclassified | 718 |
| 1290 | Ga0495580_1020227 | 3300046472 | Unclassified | 526 |
| 1291 | Ga0495582_0013598 | 3300046473 | Bacteria | 4481 |
| 1292 | Ga0495582_0039450 | 3300046473 | Bacteria | 2600 |
| 1293 | Ga0495582_0088607 | 3300046473 | Bacteria | 1724 |
| 1294 | Ga0495582_0151791 | 3300046473 | Bacteria | 1315 |
| 1295 | Ga0495582_0762531 | 3300046473 | Unclassified | 560 |
| 1296 | Ga0495639_0000549 | 3300046475 | Bacteria | 17446 |
| 1297 | Ga0495639_0011675 | 3300046475 | Bacteria | 3790 |
| 1298 | Ga0495639_0316237 | 3300046475 | Unclassified | 780 |
| 1299 | Ga0495662_0417003 | 3300046476 | Unclassified | 659 |
| 1300 | Ga0495664_0281001 | 3300046477 | Bacteria | 1006 |
| 1301 | Ga0495664_0714430 | 3300046477 | Bacteria | 592 |
| 1302 | Ga0495585_0160087 | 3300046492 | Unclassified | 1169 |
| 1303 | Ga0495594_0011878 | 3300046499 | Bacteria | 4531 |
| 1304 | Ga0495594_0145232 | 3300046499 | Bacteria | 1346 |
| 1305 | Ga0495607_0370303 | 3300046501 | Unclassified | 657 |
| 1306 | Ga0495608_0000405 | 3300046511 | Bacteria | 30184 |
| 1307 | Ga0495608_0028611 | 3300046511 | Unclassified | 3787 |
| 1308 | Ga0495618_0153235 | 3300046514 | Bacteria | 1472 |
| 1309 | Ga0495628_0000494 | 3300046516 | Bacteria | 36135 |
| 1310 | Ga0495628_0040700 | 3300046516 | Bacteria | 3712 |
| 1311 | Ga0495628_0122008 | 3300046516 | Unclassified | 1998 |
| 1312 | Ga0495630_0002236 | 3300046517 | Bacteria | 13469 |
| 1313 | Ga0495630_0003849 | 3300046517 | Bacteria | 10477 |
| 1314 | Ga0495630_0015750 | 3300046517 | Bacteria | 5524 |
| 1315 | Ga0495630_0085082 | 3300046517 | Bacteria | 2387 |
| 1316 | Ga0495663_0099594 | 3300046525 | Bacteria | 956 |
| 1317 | Ga0495666_0050611 | 3300046526 | Bacteria | 1997 |
| 1318 | Ga0495652_0008315 | 3300046529 | Bacteria | 9480 |
| 1319 | Ga0495652_0042274 | 3300046529 | Bacteria | 3930 |
| 1320 | Ga0495665_0000358 | 3300046531 | Bacteria | 23104 |
| 1321 | Ga0495665_0003130 | 3300046531 | Bacteria | 8950 |
| 1322 | Ga0495665_0075851 | 3300046531 | Bacteria | 1770 |
| 1323 | Ga0495665_0593238 | 3300046531 | Bacteria | 554 |
| 1324 | Ga0495640_0359579 | 3300046533 | Bacteria | 898 |
| 1325 | Ga0495586_0004190 | 3300046535 | Bacteria | 7724 |
| 1326 | Ga0495587_0000269 | 3300046536 | Bacteria | 37262 |
| 1327 | Ga0495587_0000334 | 3300046536 | Bacteria | 33589 |
| 1328 | Ga0495587_0001945 | 3300046536 | Bacteria | 13762 |
| 1329 | Ga0495587_0124263 | 3300046536 | Unclassified | 1477 |
| 1330 | Ga0495621_0210913 | 3300046539 | Bacteria | 784 |
| 1331 | Ga0495621_0343511 | 3300046539 | Bacteria | 625 |
| 1332 | Ga0495645_0005088 | 3300046543 | Bacteria | 9010 |
| 1333 | Ga0495645_0087646 | 3300046543 | Bacteria | 2227 |
| 1334 | Ga0495622_0022950 | 3300046557 | Bacteria | 2908 |
| 1335 | Ga0495622_0225599 | 3300046557 | Bacteria | 829 |
| 1336 | Ga0495633_0152348 | 3300046558 | Bacteria | 1068 |
| 1337 | Ga0495667_0000504 | 3300046559 | Bacteria | 24895 |
| 1338 | Ga0495667_0001705 | 3300046559 | Bacteria | 14587 |
| 1339 | Ga0495667_0005981 | 3300046559 | Bacteria | 8228 |
| 1340 | Ga0495634_0830558 | 3300046642 | Bacteria | 526 |
| 1341 | Ga0495635_0000200 | 3300046663 | Bacteria | 37911 |
| 1342 | Ga0495635_0354627 | 3300046663 | Unclassified | 978 |
| 1343 | Ga0495659_0150507 | 3300046664 | Bacteria | 934 |
| 1344 | Ga0495659_0328021 | 3300046664 | Unclassified | 651 |
| 1345 | Ga0495659_0379927 | 3300046664 | Bacteria | 607 |
| 1346 | Ga0495588_0012498 | 3300046674 | Bacteria | 4015 |
| 1347 | Ga0495588_0023908 | 3300046674 | Bacteria | 3031 |
| 1348 | Ga0495657_0011939 | 3300046675 | Bacteria | 6471 |
| 1349 | Ga0495657_0464029 | 3300046675 | Unclassified | 741 |
| 1350 | Ga0495657_0876098 | 3300046675 | Unclassified | 511 |
| 1351 | Ga0495599_0002011 | 3300046678 | Bacteria | 11757 |
| 1352 | Ga0495599_0021680 | 3300046678 | Bacteria | 4008 |
| 1353 | Ga0495599_0082661 | 3300046678 | Bacteria | 2006 |
| 1354 | Ga0495623_0000156 | 3300046679 | Bacteria | 42279 |
| 1355 | Ga0495623_0003024 | 3300046679 | Bacteria | 11067 |
| 1356 | Ga0495623_0052162 | 3300046679 | Bacteria | 2585 |
| 1357 | Ga0495646_0038350 | 3300046680 | Bacteria | 2959 |
| 1358 | Ga0495658_0001403 | 3300046683 | Bacteria | 12652 |
| 1359 | Ga0495658_0048011 | 3300046683 | Bacteria | 2406 |
| 1360 | Ga0495658_0251892 | 3300046683 | Bacteria | 1111 |
| 1361 | Ga0495658_0357189 | 3300046683 | Unclassified | 929 |
| 1362 | Ga0495658_0662063 | 3300046683 | Bacteria | 669 |
| 1363 | Ga0495613_0102611 | 3300046689 | Bacteria | 2065 |
| 1364 | Ga0495613_0168100 | 3300046689 | Bacteria | 1557 |
| 1365 | Ga0495613_0312533 | 3300046689 | Bacteria | 1086 |
| 1366 | Ga0495613_0387039 | 3300046689 | Unclassified | 955 |
| 1367 | Ga0495613_0510664 | 3300046689 | Unclassified | 808 |
| 1368 | Ga0495670_0290462 | 3300046691 | Bacteria | 875 |
| 1369 | Ga0495600_0003971 | 3300046809 | Bacteria | 8786 |
| 1370 | Ga0495581_0000659 | 3300047315 | Bacteria | 18109 |
| 1371 | Ga0495581_0016943 | 3300047315 | Bacteria | 4234 |
| 1372 | Ga0495581_0051860 | 3300047315 | Bacteria | 2369 |
| 1373 | Ga0495581_0564619 | 3300047315 | Unclassified | 660 |
| 1374 | Ga0495581_0636522 | 3300047315 | Bacteria | 617 |
| 1375 | Ga0495604_0004192 | 3300047317 | Bacteria | 11427 |
| 1376 | Ga0495604_0025411 | 3300047317 | Bacteria | 4720 |
| 1377 | Ga0495604_0939967 | 3300047317 | Unclassified | 538 |
| 1378 | Ga0495636_0095234 | 3300047318 | Unclassified | 1297 |
| 1379 | Ga0495674_0007567 | 3300047319 | Bacteria | 10378 |
| 1380 | Ga0495674_0032263 | 3300047319 | Bacteria | 4752 |
| 1381 | Ga0495674_0043600 | 3300047319 | Bacteria | 3993 |
| 1382 | Ga0495674_0894607 | 3300047319 | Bacteria | 686 |
| 1383 | Ga0495680_0004788 | 3300047322 | Bacteria | 12847 |
| 1384 | Ga0495680_0791030 | 3300047322 | Bacteria | 620 |
| 1385 | Ga0495675_0002012 | 3300047444 | Bacteria | 12138 |
| 1386 | Ga0495675_0057891 | 3300047444 | Bacteria | 2458 |
| 1387 | Ga0495675_0070071 | 3300047444 | Bacteria | 2213 |
| 1388 | Ga0495675_0075070 | 3300047444 | Bacteria | 2130 |
| 1389 | Ga0495675_0402624 | 3300047444 | Unclassified | 798 |
| 1390 | Ga0495675_0837854 | 3300047444 | Unclassified | 507 |
| 1391 | Ga0495684_0001442 | 3300047471 | Bacteria | 19043 |
| 1392 | Ga0495684_0024474 | 3300047471 | Bacteria | 4647 |
| 1393 | Ga0495684_0063191 | 3300047471 | Bacteria | 2815 |
| 1394 | Ga0495593_0000356 | 3300047673 | Bacteria | 25268 |
| 1395 | Ga0495593_0111707 | 3300047673 | Bacteria | 1395 |
| 1396 | Ga0495593_0133358 | 3300047673 | Bacteria | 1260 |
| 1397 | Ga0495593_0509573 | 3300047673 | Bacteria | 603 |
| 1398 | Ga0495602_0003996 | 3300048088 | Bacteria | 15368 |
| 1399 | Ga0495602_0039288 | 3300048088 | Bacteria | 4360 |
| 1400 | Ga0495602_0133381 | 3300048088 | Bacteria | 1977 |
| 1401 | Ga0495614_0000638 | 3300048089 | Bacteria | 14664 |
| 1402 | Ga0495614_0279277 | 3300048089 | Unclassified | 769 |
| 1403 | Ga0495615_0073472 | 3300048090 | Bacteria | 926 |
| 1404 | Ga0496100_0073025 | 3300048903 | Bacteria | 2295 |
| 1405 | Ga0496100_0171604 | 3300048903 | Bacteria | 1562 |
| 1406 | Ga0496100_0202865 | 3300048903 | Bacteria | 1446 |
| 1407 | Ga0496100_0835443 | 3300048903 | Unclassified | 722 |
| 1408 | Ga0496100_0848128 | 3300048903 | Bacteria | 717 |
| 1409 | Ga0496100_1059323 | 3300048903 | Unclassified | 639 |
| 1410 | Ga0496101_0038807 | 3300048904 | Bacteria | 3384 |
| 1411 | Ga0496101_0077774 | 3300048904 | Bacteria | 2446 |
| 1412 | Ga0496101_1050509 | 3300048904 | Bacteria | 640 |
| 1413 | Ga0496102_0067085 | 3300048905 | Bacteria | 3290 |
| 1414 | Ga0496102_0134419 | 3300048905 | Bacteria | 2317 |
| 1415 | Ga0496102_0451550 | 3300048905 | Unclassified | 1206 |
| 1416 | Ga0496102_0749520 | 3300048905 | Bacteria | 899 |
| 1417 | Ga0496102_1123092 | 3300048905 | Bacteria | 706 |
| 1418 | Ga0496103_0181794 | 3300048906 | Unclassified | 1351 |
| 1419 | Ga0496103_0431769 | 3300048906 | Bacteria | 845 |
| 1420 | Ga0496104_0004744 | 3300048907 | Bacteria | 11832 |
| 1421 | Ga0496104_0183124 | 3300048907 | Unclassified | 2005 |
| 1422 | Ga0496104_0623643 | 3300048907 | Bacteria | 988 |
| 1423 | Ga0496105_0572812 | 3300048908 | Bacteria | 879 |
| 1424 | Ga0496106_0012262 | 3300048909 | Bacteria | 6328 |
| 1425 | Ga0496106_0053593 | 3300048909 | Bacteria | 3047 |
| 1426 | Ga0496106_0467735 | 3300048909 | Bacteria | 1013 |
| 1427 | Ga0496106_0644154 | 3300048909 | Bacteria | 847 |
| 1428 | Ga0496106_0649088 | 3300048909 | Bacteria | 843 |
| 1429 | Ga0496107_0177846 | 3300048910 | Bacteria | 1580 |
| 1430 | Ga0496107_0294105 | 3300048910 | Bacteria | 1209 |
| 1431 | Ga0496108_0005237 | 3300048911 | Bacteria | 10474 |
| 1432 | Ga0496108_0017435 | 3300048911 | Bacteria | 5876 |
| 1433 | Ga0496108_0180869 | 3300048911 | Bacteria | 1826 |
| 1434 | Ga0496108_0820892 | 3300048911 | Unclassified | 801 |
| 1435 | Ga0496109_0007523 | 3300048912 | Bacteria | 9228 |
| 1436 | Ga0496109_0071352 | 3300048912 | Bacteria | 3188 |
| 1437 | Ga0496109_0382259 | 3300048912 | Bacteria | 1330 |
| 1438 | Ga0496109_2049924 | 3300048912 | Bacteria | 504 |
| 1439 | Ga0496110_0029147 | 3300048913 | Bacteria | 4747 |
| 1440 | Ga0496110_0080168 | 3300048913 | Bacteria | 2908 |
| 1441 | Ga0496111_0032614 | 3300048914 | Bacteria | 3714 |
| 1442 | Ga0496111_0115469 | 3300048914 | Bacteria | 1979 |
| 1443 | Ga0496112_0001950 | 3300048915 | Bacteria | 16300 |
| 1444 | Ga0496112_0022068 | 3300048915 | Bacteria | 6062 |
| 1445 | Ga0496112_0889592 | 3300048915 | Bacteria | 813 |
| 1446 | Ga0496113_0000769 | 3300048916 | Bacteria | 16520 |
| 1447 | Ga0496113_0068922 | 3300048916 | Bacteria | 2685 |
| 1448 | Ga0496113_0116662 | 3300048916 | Bacteria | 2084 |
| 1449 | Ga0496114_0134245 | 3300048917 | Bacteria | 2139 |
| 1450 | Ga0496114_0384593 | 3300048917 | Bacteria | 1242 |
| 1451 | Ga0496115_0004680 | 3300048918 | Bacteria | 9915 |
| 1452 | Ga0496115_0215545 | 3300048918 | Unclassified | 1585 |
| 1453 | Ga0501306_036833 | 3300049127 | Unclassified | 747 |
| 1454 | Ga0501309_062896 | 3300049129 | Bacteria | 600 |
| 1455 | Ga0501304_027104 | 3300049160 | Bacteria | 594 |
| 1456 | Ga0501290_016941 | 3300049513 | Bacteria | 974 |
| 1457 | Ga0501291_039674 | 3300049514 | Unclassified | 824 |
| 1458 | Ga0501294_011442 | 3300049517 | Bacteria | 883 |
| 1459 | Ga0501297_044363 | 3300049520 | Bacteria | 636 |
| 1460 | Ga0501298_059127 | 3300049521 | Bacteria | 809 |
| 1461 | Ga0501298_113859 | 3300049521 | Bacteria | 630 |
| 1462 | Ga0501299_123283 | 3300049522 | Bacteria | 627 |
| 1463 | Ga0501299_157296 | 3300049522 | Bacteria | 578 |
| 1464 | Ga0501311_048452 | 3300049527 | Bacteria | 661 |
| 1465 | Ga0501311_058505 | 3300049527 | Bacteria | 618 |
| 1466 | Ga0501313_027753 | 3300049529 | Bacteria | 724 |
| 1467 | Ga0501314_036812 | 3300049530 | Bacteria | 560 |
| 1468 | Ga0501315_102951 | 3300049531 | Unclassified | 506 |
| 1469 | Ga0501316_045992 | 3300049532 | Bacteria | 619 |
| 1470 | Ga0501317_080926 | 3300049533 | Bacteria | 562 |
| 1471 | Ga0501323_043397 | 3300049539 | Bacteria | 665 |
| 1472 | Ga0501323_065499 | 3300049539 | Bacteria | 574 |
| 1473 | Ga0501325_027581 | 3300049541 | Bacteria | 634 |
| 1474 | Ga0501340_016227 | 3300049556 | Bacteria | 593 |
| 1475 | Ga0501340_026915 | 3300049556 | Bacteria | 507 |
| 1476 | Ga0501032_0043085 | 3300049569 | Bacteria | 3059 |
| 1477 | Ga0501032_0160958 | 3300049569 | Bacteria | 1474 |
| 1478 | Ga0501033_0031074 | 3300049570 | Bacteria | 4015 |
| 1479 | Ga0501034_1216412 | 3300049571 | Bacteria | 632 |
| 1480 | Ga0501036_0038635 | 3300049572 | Bacteria | 4040 |
| 1481 | Ga0501036_0200401 | 3300049572 | Bacteria | 1679 |
| 1482 | Ga0501037_0241493 | 3300049573 | Bacteria | 1266 |
| 1483 | Ga0501038_0108158 | 3300049574 | Bacteria | 2306 |
| 1484 | Ga0501038_0581194 | 3300049574 | Bacteria | 849 |
| 1485 | Ga0501039_0160910 | 3300049575 | Bacteria | 1765 |
| 1486 | Ga0501040_1191822 | 3300049576 | Bacteria | 553 |
| 1487 | Ga0501041_0073333 | 3300049577 | Bacteria | 2104 |
| 1488 | Ga0501041_0134378 | 3300049577 | Bacteria | 1541 |
| 1489 | Ga0501041_0668060 | 3300049577 | Unclassified | 664 |
| 1490 | Ga0501042_0144495 | 3300049578 | Bacteria | 1715 |
| 1491 | Ga0501042_0244581 | 3300049578 | Bacteria | 1294 |
| 1492 | Ga0501043_0048272 | 3300049579 | Bacteria | 3347 |
| 1493 | Ga0501043_0108258 | 3300049579 | Bacteria | 2183 |
| 1494 | Ga0501046_0133310 | 3300049580 | Bacteria | 1883 |
| 1495 | Ga0501046_0945160 | 3300049580 | Bacteria | 600 |
| 1496 | Ga0501047_0216687 | 3300049581 | Bacteria | 1771 |
| 1497 | Ga0501047_0243318 | 3300049581 | Bacteria | 1649 |
| 1498 | Ga0501067_0000353 | 3300049583 | Bacteria | 25052 |
| 1499 | Ga0501067_0044515 | 3300049583 | Bacteria | 2465 |
| 1500 | Ga0501067_0257517 | 3300049583 | Unclassified | 971 |
| 1501 | Ga0501067_0334725 | 3300049583 | Bacteria | 843 |
| 1502 | Ga0501068_0001339 | 3300049584 | Bacteria | 13056 |
| 1503 | Ga0501068_0084626 | 3300049584 | Unclassified | 1951 |
| 1504 | Ga0501068_0831386 | 3300049584 | Bacteria | 606 |
| 1505 | Ga0501069_0026566 | 3300049585 | Bacteria | 3170 |
| 1506 | Ga0501069_0032090 | 3300049585 | Unclassified | 2891 |
| 1507 | Ga0501069_0032461 | 3300049585 | Unclassified | 2874 |
| 1508 | Ga0501069_0166828 | 3300049585 | Bacteria | 1269 |
| 1509 | Ga0501070_0000192 | 3300049586 | Bacteria | 57359 |
| 1510 | Ga0501070_0123099 | 3300049586 | Bacteria | 2143 |
| 1511 | Ga0501070_0137205 | 3300049586 | Unclassified | 2020 |
| 1512 | Ga0501070_0168786 | 3300049586 | Bacteria | 1803 |
| 1513 | Ga0501070_0369431 | 3300049586 | Bacteria | 1163 |
| 1514 | Ga0501070_0726126 | 3300049586 | Bacteria | 784 |
| 1515 | Ga0501071_0000678 | 3300049587 | Bacteria | 17791 |
| 1516 | Ga0501071_0325048 | 3300049587 | Bacteria | 1168 |
| 1517 | Ga0501071_0591982 | 3300049587 | Bacteria | 853 |
| 1518 | Ga0501071_0796005 | 3300049587 | Unclassified | 729 |
| 1519 | Ga0501072_0009721 | 3300049588 | Bacteria | 7315 |
| 1520 | Ga0501072_0078699 | 3300049588 | Bacteria | 2611 |
| 1521 | Ga0501072_0409368 | 3300049588 | Bacteria | 1076 |
| 1522 | Ga0501072_0962943 | 3300049588 | Bacteria | 666 |
| 1523 | Ga0501072_1102293 | 3300049588 | Bacteria | 618 |
| 1524 | Ga0501072_1230604 | 3300049588 | Bacteria | 581 |
| 1525 | Ga0501073_0000949 | 3300049589 | Bacteria | 20906 |
| 1526 | Ga0501073_0631350 | 3300049589 | Bacteria | 739 |
| 1527 | Ga0501073_0790902 | 3300049589 | Bacteria | 654 |
| 1528 | Ga0501074_0000171 | 3300049590 | Bacteria | 34937 |
| 1529 | Ga0501074_0368537 | 3300049590 | Bacteria | 1019 |
| 1530 | Ga0501076_0149239 | 3300049592 | Bacteria | 1901 |
| 1531 | Ga0501076_0194593 | 3300049592 | Bacteria | 1655 |
| 1532 | Ga0501202_079250 | 3300049652 | Bacteria | 769 |
| 1533 | Ga0501206_044105 | 3300049653 | Unclassified | 695 |
| 1534 | Ga0501211_051127 | 3300049658 | Bacteria | 513 |
| 1535 | Ga0501216_079627 | 3300049660 | Bacteria | 691 |
| 1536 | Ga0501216_133714 | 3300049660 | Unclassified | 577 |
| 1537 | Ga0501217_042743 | 3300049661 | Unclassified | 1158 |
| 1538 | Ga0501217_066451 | 3300049661 | Bacteria | 973 |
| 1539 | Ga0501217_090548 | 3300049661 | Bacteria | 858 |
| 1540 | Ga0501217_201734 | 3300049661 | Bacteria | 620 |
| 1541 | Ga0501223_050772 | 3300049663 | Bacteria | 805 |
| 1542 | Ga0501227_041230 | 3300049665 | Bacteria | 1141 |
| 1543 | Ga0501230_029252 | 3300049667 | Bacteria | 1017 |
| 1544 | Ga0501239_036423 | 3300049672 | Bacteria | 665 |
| 1545 | Ga0501242_003701 | 3300049674 | Bacteria | 1666 |
| 1546 | Ga0501243_014106 | 3300049675 | Bacteria | 1274 |
| 1547 | Ga0501243_072468 | 3300049675 | Bacteria | 657 |
| 1548 | Ga0501248_012725 | 3300049678 | Bacteria | 778 |
| 1549 | Ga0501249_006910 | 3300049679 | Bacteria | 2339 |
| 1550 | Ga0501249_014954 | 3300049679 | Bacteria | 1657 |
| 1551 | Ga0501256_002047 | 3300049685 | Bacteria | 1571 |
| 1552 | Ga0501257_025964 | 3300049686 | Bacteria | 1396 |
| 1553 | Ga0501257_034172 | 3300049686 | Unclassified | 1234 |
| 1554 | Ga0501261_097815 | 3300049690 | Unclassified | 554 |
| 1555 | Ga0501225_0104002 | 3300049705 | Bacteria | 832 |
| 1556 | Ga0501245_027410 | 3300049708 | Bacteria | 924 |
| 1557 | Ga0501079_0076548 | 3300049741 | Bacteria | 2588 |
| 1558 | Ga0501079_0142055 | 3300049741 | Bacteria | 1870 |
| 1559 | Ga0501079_0218931 | 3300049741 | Bacteria | 1487 |
| 1560 | Ga0501080_0000060 | 3300049742 | Bacteria | 71292 |
| 1561 | Ga0501080_0005735 | 3300049742 | Bacteria | 11107 |
| 1562 | Ga0501080_0111578 | 3300049742 | Bacteria | 2535 |
| 1563 | Ga0501080_0247391 | 3300049742 | Bacteria | 1626 |
| 1564 | Ga0501081_0337820 | 3300049743 | Bacteria | 1109 |
| 1565 | Ga0501081_0376070 | 3300049743 | Bacteria | 1049 |
| 1566 | Ga0501081_0931676 | 3300049743 | Bacteria | 655 |
| 1567 | Ga0501083_0008037 | 3300049744 | Bacteria | 7464 |
| 1568 | Ga0501083_0529860 | 3300049744 | Bacteria | 767 |
| 1569 | Ga0501264_006568 | 3300049761 | Bacteria | 1073 |
| 1570 | Ga0501268_001006 | 3300049765 | Bacteria | 3352 |
| 1571 | Ga0501268_045841 | 3300049765 | Bacteria | 835 |
| 1572 | Ga0501272_005087 | 3300049769 | Bacteria | 1377 |
| 1573 | Ga0501273_005428 | 3300049770 | Bacteria | 1439 |
| 1574 | Ga0501273_045094 | 3300049770 | Bacteria | 662 |
| 1575 | Ga0501275_011114 | 3300049772 | Bacteria | 972 |
| 1576 | Ga0501275_042240 | 3300049772 | Bacteria | 643 |
| 1577 | Ga0501276_019420 | 3300049773 | Bacteria | 640 |
| 1578 | Ga0501283_085767 | 3300049779 | Bacteria | 598 |
| 1579 | Ga0501044_0006673 | 3300049823 | Bacteria | 12723 |
| 1580 | Ga0501044_0384435 | 3300049823 | Bacteria | 1318 |
| 1581 | Ga0501045_0059366 | 3300049824 | Bacteria | 2802 |
| 1582 | Ga0501045_0457465 | 3300049824 | Bacteria | 948 |
| 1583 | Ga0501204_040726 | 3300049850 | Bacteria | 680 |
| 1584 | Ga0501220_08404 | 3300049852 | Bacteria | 543 |
| 1585 | nmdc:mga05p37_1158346_c1 | 3300050507 | Bacteria | 803 |
| 1586 | nmdc:mga05p37_2129497_c1 | 3300050507 | Unclassified | 524 |
| 1587 | nmdc:mga05p37_24458_c1 | 3300050507 | Bacteria | 2422 |
| 1588 | nmdc:mga05p37_259528_c1 | 3300050507 | Bacteria | 2080 |
| 1589 | nmdc:mga05p37_313439_c1 | 3300050507 | Bacteria | 1859 |
| 1590 | nmdc:mga05p37_328502_c1 | 3300050507 | Bacteria | 1807 |
| 1591 | nmdc:mga05p37_372223_c1 | 3300050507 | Bacteria | 1676 |
| 1592 | nmdc:mga05p37_81382_c1 | 3300050507 | Bacteria | 3989 |
| 1593 | nmdc:mga05p37_82134_c1 | 3300050507 | Bacteria | 3970 |
| 1594 | nmdc:mga05p37_830499_c1 | 3300050507 | Bacteria | 1006 |
| 1595 | nmdc:mga09592_132413_c1 | 3300050508 | Bacteria | 2146 |
| 1596 | nmdc:mga09592_132896_c1 | 3300050508 | Unclassified | 2142 |
| 1597 | nmdc:mga09592_216657_c1 | 3300050508 | Bacteria | 1659 |
| 1598 | nmdc:mga09592_72535_c1 | 3300050508 | Bacteria | 2923 |
| 1599 | nmdc:mga0qj67_10094_c1 | 3300050509 | Bacteria | 7046 |
| 1600 | nmdc:mga0qj67_1478095_c1 | 3300050509 | Unclassified | 523 |
| 1601 | nmdc:mga0qj67_18195_c1 | 3300050509 | Bacteria | 5353 |
| 1602 | nmdc:mga0qj67_3022_c1 | 3300050509 | Bacteria | 12093 |
| 1603 | nmdc:mga0qj67_3465_c1 | 3300050509 | Bacteria | 11369 |
| 1604 | nmdc:mga0qj67_37040_c1 | 3300050509 | Unclassified | 3819 |
| 1605 | nmdc:mga0qj67_505202_c1 | 3300050509 | Unclassified | 972 |
| 1606 | nmdc:mga0qj67_52160_c1 | 3300050509 | Bacteria | 3236 |
| 1607 | nmdc:mga06r32_139003_c1 | 3300050510 | Bacteria | 2404 |
| 1608 | nmdc:mga06r32_1637814_c1 | 3300050510 | Bacteria | 581 |
| 1609 | nmdc:mga06r32_186579_c1 | 3300050510 | Bacteria | 2061 |
| 1610 | nmdc:mga06r32_363451_c1 | 3300050510 | Bacteria | 1431 |
| 1611 | nmdc:mga06r32_406801_c1 | 3300050510 | Bacteria | 1343 |
| 1612 | nmdc:mga06r32_533345_c1 | 3300050510 | Bacteria | 1149 |
| 1613 | nmdc:mga06r32_712109_c1 | 3300050510 | Unclassified | 969 |
| 1614 | nmdc:mga06r32_73470_c1 | 3300050510 | Bacteria | 3313 |
| 1615 | nmdc:mga06r32_77166_c1 | 3300050510 | Bacteria | 3236 |
| 1616 | nmdc:mga06r32_812426_c1 | 3300050510 | Unclassified | 895 |
| 1617 | nmdc:mga08y16_1335218_c1 | 3300050511 | Bacteria | 682 |
| 1618 | nmdc:mga08y16_345174_c1 | 3300050511 | Bacteria | 1530 |
| 1619 | nmdc:mga08y16_479660_c1 | 3300050511 | Bacteria | 1266 |
| 1620 | nmdc:mga08y16_560798_c1 | 3300050511 | Bacteria | 1155 |
| 1621 | nmdc:mga08y16_9037_c1 | 3300050511 | Bacteria | 10459 |
| 1622 | nmdc:mga0n895_1454242_c1 | 3300050512 | Bacteria | 653 |
| 1623 | nmdc:mga0n895_1552889_c1 | 3300050512 | Bacteria | 627 |
| 1624 | nmdc:mga0n895_24093_c1 | 3300050512 | Bacteria | 5731 |
| 1625 | nmdc:mga0n895_40283_c1 | 3300050512 | Bacteria | 4537 |
| 1626 | nmdc:mga0n895_42112_c1 | 3300050512 | Bacteria | 4442 |
| 1627 | nmdc:mga0n895_753427_c1 | 3300050512 | Bacteria | 967 |
| 1628 | nmdc:mga0n895_770868_c1 | 3300050512 | Bacteria | 954 |
| 1629 | nmdc:mga0rr50_196370_c1 | 3300050513 | Bacteria | 1656 |
| 1630 | nmdc:mga0rr50_545513_c1 | 3300050513 | Bacteria | 987 |
| 1631 | nmdc:mga0rr50_820594_c1 | 3300050513 | Bacteria | 793 |
| 1632 | nmdc:mga08x19_12152_c1 | 3300050514 | Bacteria | 5183 |
| 1633 | nmdc:mga08x19_425860_c1 | 3300050514 | Unclassified | 932 |
| 1634 | nmdc:mga0a205_32863_c1 | 3300050515 | Bacteria | 4975 |
| 1635 | nmdc:mga0a205_37088_c1 | 3300050515 | Bacteria | 4687 |
| 1636 | nmdc:mga0a205_605389_c1 | 3300050515 | Unclassified | 949 |
| 1637 | nmdc:mga0a205_646225_c1 | 3300050515 | Bacteria | 909 |
| 1638 | Ga0495601_0003937 | 3300053077 | Bacteria | 8549 |
| 1639 | Ga0495601_0081254 | 3300053077 | Bacteria | 2080 |
| 1640 | Ga0495601_0084821 | 3300053077 | Bacteria | 2035 |
| 1641 | Ga0495601_0840966 | 3300053077 | Bacteria | 581 |
| 1642 | Ga0495612_0000490 | 3300053078 | Bacteria | 15773 |
| 1643 | Ga0495595_0024258 | 3300053084 | Bacteria | 2678 |
| 1644 | Ga0495619_0002629 | 3300053085 | Bacteria | 11736 |
| 1645 | Ga0495619_0062774 | 3300053085 | Bacteria | 2474 |
| 1646 | Ga0495619_0414562 | 3300053085 | Unclassified | 929 |
| 1647 | Ga0501084_0081149 | 3300054114 | Bacteria | 2720 |
| 1648 | Ga0501084_0095051 | 3300054114 | Bacteria | 2503 |
| 1649 | Ga0501084_0170156 | 3300054114 | Bacteria | 1839 |
| 1650 | Ga0501084_0184919 | 3300054114 | Bacteria | 1759 |
| 1651 | Ga0590071_031312 | 3300059421 | Bacteria | 1268 |
| 1652 | Ga0590071_043838 | 3300059421 | Bacteria | 1078 |
| 1653 | Ga0590075_026983 | 3300059424 | Bacteria | 1447 |
| 1654 | Ga0590075_045298 | 3300059424 | Bacteria | 1127 |
| 1655 | Ga0590077_022697 | 3300059426 | Unclassified | 1340 |
| 1656 | Ga0587066_078833 | 3300059490 | Bacteria | 709 |
| 1657 | Ga0587070_143242 | 3300059491 | Bacteria | 592 |
| 1658 | Ga0587073_0057828 | 3300059492 | Bacteria | 900 |
| 1659 | Ga0587073_0117544 | 3300059492 | Bacteria | 713 |
| 1660 | Ga0587077_128672 | 3300059493 | Bacteria | 640 |
| 1661 | Ga0587083_0108493 | 3300059505 | Unclassified | 702 |
| 1662 | Ga0587083_0153285 | 3300059505 | Bacteria | 624 |
| 1663 | Ga0587083_0260290 | 3300059505 | Bacteria | 520 |
| 1664 | Ga0587085_026550 | 3300059506 | Unclassified | 923 |
| 1665 | Ga0587088_101991 | 3300059508 | Bacteria | 642 |
| 1666 | Ga0587088_104734 | 3300059508 | Bacteria | 636 |
| 1667 | Ga0587089_057672 | 3300059509 | Unclassified | 636 |
| 1668 | Ga0587091_071005 | 3300059511 | Bacteria | 762 |
| 1669 | Ga0587092_118003 | 3300059512 | Bacteria | 564 |
| 1670 | Ga0587094_083647 | 3300059513 | Unclassified | 594 |
| 1671 | Ga0587101_077787 | 3300059623 | Unclassified | 623 |
| 1672 | Ga0587117_093637 | 3300059627 | Unclassified | 564 |
| 1673 | Ga0587128_084766 | 3300059630 | Bacteria | 640 |
| 1674 | Ga0587062_056317 | 3300059639 | Unclassified | 679 |
| 1675 | Ga0587067_156622 | 3300059640 | Bacteria | 576 |
| 1676 | Ga0587067_189136 | 3300059640 | Bacteria | 541 |
| 1677 | Ga0587072_083036 | 3300059643 | Bacteria | 695 |
| 1678 | Ga0587072_091123 | 3300059643 | Bacteria | 672 |
| 1679 | Ga0587075_107383 | 3300059644 | Unclassified | 564 |
| 1680 | Ga0587076_078824 | 3300059645 | Bacteria | 699 |
| 1681 | Ga0587076_103535 | 3300059645 | Bacteria | 639 |
| 1682 | Ga0501082_0036435 | 3300060353 | Bacteria | 4238 |
| 1683 | Ga0501082_0160735 | 3300060353 | Bacteria | 1952 |
| 1684 | Ga0501082_0206675 | 3300060353 | Unclassified | 1708 |
| 1685 | Ga0466962_0514034 | 3300061719 | Bacteria | 607 |
| 1686 | Ga0530510_0335764 | 3300061734 | Bacteria | 1134 |
| 1687 | Ga0530510_1264863 | 3300061734 | Bacteria | 566 |
| 1688 | Ga0070684_100387243 | |||
| 1689 | JGI24750J21931_1019297 | |||
| 1690 | JGI25406J46586_10052517 | |||
| 1691 | rootL2_10101677 | |||
| 1692 | Ga0032354_1121886 | |||
| 1693 | Ga0058859_11814094 | |||
| 1694 | Ga0058863_10023017 | |||
| 1695 | Ga0058863_11749219 | |||
| 1696 | Ga0058863_11766029 | |||
| 1697 | Ga0058863_11873702 | |||
| 1698 | Ga0058863_11972071 | |||
| 1699 | Ga0058861_11621628 | |||
| 1700 | Ga0058861_11623768 | |||
| 1701 | Ga0058861_11793331 | |||
| 1702 | Ga0058861_11819252 | |||
| 1703 | Ga0058861_11862569 | |||
| 1704 | Ga0058861_11977672 | |||
| 1705 | Ga0058860_12016274 | |||
| 1706 | Ga0058862_10007717 | |||
| 1707 | Ga0058862_10139180 | |||
| 1708 | Ga0058862_11895783 | |||
| 1709 | Ga0058862_12536806 | |||
| 1710 | Ga0058862_12551672 | |||
| 1711 | Ga0058862_12614112 | |||
| 1712 | Ga0058862_12730940 | |||
| 1713 | Ga0058862_12733296 | |||
| 1714 | Ga0058862_12860400 | |||
| 1715 | Ga0058862_12875333 | |||
| 1716 | Ga0065704_10156196 | |||
| 1717 | Ga0065712_10002894 | |||
| 1718 | Ga0065715_10162401 | |||
| 1719 | Ga0065707_10113306 | |||
| 1720 | Ga0070658_10009701 | |||
| 1721 | Ga0070658_10035917 | |||
| 1722 | Ga0070658_10091002 | |||
| 1723 | Ga0070658_10188744 | |||
| 1724 | Ga0070658_10265771 | |||
| 1725 | Ga0070658_10295648 | |||
| 1726 | Ga0070658_10569624 | |||
| 1727 | Ga0070658_10586066 | |||
| 1728 | Ga0070676_10004346 | |||
| 1729 | Ga0070676_10830801 | |||
| 1730 | Ga0070676_10948230 | |||
| 1731 | Ga0070683_100000233 | |||
| 1732 | Ga0070683_100007640 | |||
| 1733 | Ga0070683_100021811 | |||
| 1734 | Ga0070683_100050905 | |||
| 1735 | Ga0070683_100088898 | |||
| 1736 | Ga0070683_100104030 | |||
| 1737 | Ga0070683_100141480 | |||
| 1738 | Ga0070683_100153583 | |||
| 1739 | Ga0070683_100225934 | |||
| 1740 | Ga0070683_100318464 | |||
| 1741 | Ga0070683_100567773 | |||
| 1742 | Ga0070683_100697499 | |||
| 1743 | Ga0070683_100729882 | |||
| 1744 | Ga0070683_101339638 | |||
| 1745 | Ga0070690_100045286 | |||
| 1746 | Ga0070690_100430372 | |||
| 1747 | Ga0070690_100568538 | |||
| 1748 | Ga0070690_101566059 | |||
| 1749 | Ga0070670_100007272 | |||
| 1750 | Ga0070670_100965521 | |||
| 1751 | Ga0070670_101308577 | |||
| 1752 | Ga0070677_10119039 | |||
| 1753 | Ga0070677_10445234 | |||
| 1754 | Ga0068869_100010103 | |||
| 1755 | Ga0068869_100057602 | |||
| 1756 | Ga0068869_100895419 | |||
| 1757 | Ga0070666_10117395 | |||
| 1758 | Ga0070666_10127916 | |||
| 1759 | Ga0070680_100027511 | |||
| 1760 | Ga0070680_100028065 | |||
| 1761 | Ga0070680_100043156 | |||
| 1762 | Ga0070680_100050348 | |||
| 1763 | Ga0070680_100069042 | |||
| 1764 | Ga0070680_100087628 | |||
| 1765 | Ga0070680_100314700 | |||
| 1766 | Ga0070680_100373251 | |||
| 1767 | Ga0070680_100378701 | |||
| 1768 | Ga0070680_100442334 | |||
| 1769 | Ga0070680_100471466 | |||
| 1770 | Ga0070682_100125509 | |||
| 1771 | Ga0070682_100229953 | |||
| 1772 | Ga0070682_100382888 | |||
| 1773 | Ga0070682_100556699 | |||
| 1774 | Ga0070682_101686893 | |||
| 1775 | Ga0070682_101724306 | |||
| 1776 | Ga0068868_101341298 | |||
| 1777 | Ga0070660_100012909 | |||
| 1778 | Ga0070660_100125019 | |||
| 1779 | Ga0070660_100666225 | |||
| 1780 | Ga0070660_100741289 | |||
| 1781 | Ga0070660_100785146 | |||
| 1782 | Ga0070660_100945336 | |||
| 1783 | Ga0070689_100125500 | |||
| 1784 | Ga0070691_10021952 | |||
| 1785 | Ga0070691_10178744 | |||
| 1786 | Ga0070691_10353471 | |||
| 1787 | Ga0070691_10856079 | |||
| 1788 | Ga0070687_100014103 | |||
| 1789 | Ga0070687_100275992 | |||
| 1790 | Ga0070687_100301426 | |||
| 1791 | Ga0070661_100002985 | |||
| 1792 | Ga0070661_100003411 | |||
| 1793 | Ga0070661_100003797 | |||
| 1794 | Ga0070661_100015035 | |||
| 1795 | Ga0070661_100035622 | |||
| 1796 | Ga0070661_100065843 | |||
| 1797 | Ga0070661_100092097 | |||
| 1798 | Ga0070661_100978447 | |||
| 1799 | Ga0070692_10104273 | |||
| 1800 | Ga0070692_10452886 | |||
| 1801 | Ga0070692_10455385 | |||
| 1802 | Ga0070692_10543731 | |||
| 1803 | Ga0070692_10798877 | |||
| 1804 | Ga0070668_100003043 | |||
| 1805 | Ga0070668_100110467 | |||
| 1806 | Ga0070669_100003079 | |||
| 1807 | Ga0070669_100006567 | |||
| 1808 | Ga0070669_100017058 | |||
| 1809 | Ga0070669_100628490 | |||
| 1810 | Ga0070669_101526970 | |||
| 1811 | Ga0070675_100002631 | |||
| 1812 | Ga0070675_100002663 | |||
| 1813 | Ga0070675_100129213 | |||
| 1814 | Ga0070675_100443798 | |||
| 1815 | Ga0070675_100538919 | |||
| 1816 | Ga0070675_100628948 | |||
| 1817 | Ga0070671_100023147 | |||
| 1818 | Ga0070671_100119992 | |||
| 1819 | Ga0070671_100306722 | |||
| 1820 | Ga0070671_100948637 | |||
| 1821 | Ga0070674_100002673 | |||
| 1822 | Ga0070674_100005627 | |||
| 1823 | Ga0070674_100090184 | |||
| 1824 | Ga0070674_100716610 | |||
| 1825 | Ga0070674_101373216 | |||
| 1826 | Ga0070673_100071202 | |||
| 1827 | Ga0070673_100174961 | |||
| 1828 | Ga0070673_100423788 | |||
| 1829 | Ga0070688_100002319 | |||
| 1830 | Ga0070688_100210072 | |||
| 1831 | Ga0070659_100008807 | |||
| 1832 | Ga0070659_100045001 | |||
| 1833 | Ga0070659_100098927 | |||
| 1834 | Ga0070659_100125537 | |||
| 1835 | Ga0070659_100182606 | |||
| 1836 | Ga0070659_100372354 | |||
| 1837 | Ga0070659_101093415 | |||
| 1838 | Ga0070659_101305541 | |||
| 1839 | Ga0070667_100078670 | |||
| 1840 | Ga0070703_10045433 | |||
| 1841 | Ga0070709_10004387 | |||
| 1842 | Ga0070709_10127383 | |||
| 1843 | Ga0070709_10250300 | |||
| 1844 | Ga0070714_100017298 | |||
| 1845 | Ga0070714_100059789 | |||
| 1846 | Ga0070714_101233724 | |||
| 1847 | Ga0070713_100007166 | |||
| 1848 | Ga0070713_100044534 | |||
| 1849 | Ga0070713_100116823 | |||
| 1850 | Ga0070713_100460388 | |||
| 1851 | Ga0070713_100497774 | |||
| 1852 | Ga0070713_102030405 | |||
| 1853 | Ga0070710_10184315 | |||
| 1854 | Ga0070710_10208052 | |||
| 1855 | Ga0070701_10066722 | |||
| 1856 | Ga0070701_10081963 | |||
| 1857 | Ga0070701_10197945 | |||
| 1858 | Ga0070711_100032354 | |||
| 1859 | Ga0070711_100093604 | |||
| 1860 | Ga0070711_100197012 | |||
| 1861 | Ga0070711_100551202 | |||
| 1862 | Ga0070711_101492201 | |||
| 1863 | Ga0070705_100008002 | |||
| 1864 | Ga0070705_100260434 | |||
| 1865 | Ga0070700_100084227 | |||
| 1866 | Ga0070700_100273692 | |||
| 1867 | Ga0070700_100426352 | |||
| 1868 | Ga0070694_100026031 | |||
| 1869 | Ga0070694_100071018 | |||
| 1870 | Ga0070694_100389417 | |||
| 1871 | Ga0070708_100000198 | |||
| 1872 | Ga0070708_100319285 | |||
| 1873 | Ga0070708_100319362 | |||
| 1874 | Ga0070708_100335521 | |||
| 1875 | Ga0070708_102155434 | |||
| 1876 | Ga0070663_100006553 | |||
| 1877 | Ga0070663_100026569 | |||
| 1878 | Ga0070663_100426316 | |||
| 1879 | Ga0070663_100462429 | |||
| 1880 | Ga0070663_100628698 | |||
| 1881 | Ga0070663_100846071 | |||
| 1882 | Ga0070663_100969771 | |||
| 1883 | Ga0070678_100216556 | |||
| 1884 | Ga0070678_100318911 | |||
| 1885 | Ga0070678_100941283 | |||
| 1886 | Ga0070678_101712329 | |||
| 1887 | Ga0070662_100005643 | |||
| 1888 | Ga0070662_100008788 | |||
| 1889 | Ga0070662_100317522 | |||
| 1890 | Ga0070662_101025354 | |||
| 1891 | Ga0070662_101027303 | |||
| 1892 | Ga0070662_101457880 | |||
| 1893 | Ga0070681_10000404 | |||
| 1894 | Ga0070681_10002832 | |||
| 1895 | Ga0070681_10003332 | |||
| 1896 | Ga0070681_10003955 | |||
| 1897 | Ga0070681_10010307 | |||
| 1898 | Ga0070681_10039341 | |||
| 1899 | Ga0070681_10044751 | |||
| 1900 | Ga0070681_10061350 | |||
| 1901 | Ga0070681_10169614 | |||
| 1902 | Ga0070681_10330035 | |||
| 1903 | Ga0070681_10363900 | |||
| 1904 | Ga0070681_10543348 | |||
| 1905 | Ga0070681_10586316 | |||
| 1906 | Ga0070681_11039480 | |||
| 1907 | Ga0070681_11206837 | |||
| 1908 | Ga0070681_11206838 | |||
| 1909 | Ga0070681_12049106 | |||
| 1910 | Ga0068867_100005117 | |||
| 1911 | Ga0068867_100010994 | |||
| 1912 | Ga0068867_100080320 | |||
| 1913 | Ga0068867_100937268 | |||
| 1914 | Ga0068867_101231203 | |||
| 1915 | Ga0068867_101566659 | |||
| 1916 | Ga0070685_10237064 | |||
| 1917 | Ga0070706_100180612 | |||
| 1918 | Ga0070706_100638097 | |||
| 1919 | Ga0070706_101174498 | |||
| 1920 | Ga0070707_100172133 | |||
| 1921 | Ga0070707_100253278 | |||
| 1922 | Ga0070707_100338019 | |||
| 1923 | Ga0070707_100748109 | |||
| 1924 | Ga0070698_100012821 | |||
| 1925 | Ga0070698_100033083 | |||
| 1926 | Ga0070698_100060582 | |||
| 1927 | Ga0070698_100245585 | |||
| 1928 | Ga0070698_100297994 | |||
| 1929 | Ga0070699_100075909 | |||
| 1930 | Ga0070699_100142767 | |||
| 1931 | Ga0070699_100269595 | |||
| 1932 | Ga0070699_100762451 | |||
| 1933 | Ga0070679_100000919 | |||
| 1934 | Ga0070679_100001084 | |||
| 1935 | Ga0070679_100006169 | |||
| 1936 | Ga0070679_100043081 | |||
| 1937 | Ga0070679_100043325 | |||
| 1938 | Ga0070679_100095100 | |||
| 1939 | Ga0070679_100245133 | |||
| 1940 | Ga0070679_100359492 | |||
| 1941 | Ga0070679_100408428 | |||
| 1942 | Ga0070679_100670594 | |||
| 1943 | Ga0070679_100702985 | |||
| 1944 | Ga0070679_101279873 | |||
| 1945 | Ga0070679_101506731 | |||
| 1946 | Ga0070684_100006699 | |||
| 1947 | Ga0070684_100024585 | |||
| 1948 | Ga0070684_100038174 | |||
| 1949 | Ga0070684_100043865 | |||
| 1950 | Ga0070684_100076836 | |||
| 1951 | Ga0070684_100297248 | |||
| 1952 | Ga0070684_100301427 | |||
| 1953 | Ga0070684_100365457 | |||
| 1954 | Ga0070684_100390698 | |||
| 1955 | Ga0070684_100725714 | |||
| 1956 | Ga0070697_100659546 | |||
| 1957 | Ga0068853_100013646 | |||
| 1958 | Ga0068853_100016074 | |||
| 1959 | Ga0068853_100487555 | |||
| 1960 | Ga0068853_100531253 | |||
| 1961 | Ga0068853_100600016 | |||
| 1962 | Ga0068853_101020938 | |||
| 1963 | Ga0070672_100004984 | |||
| 1964 | Ga0070672_100005766 | |||
| 1965 | Ga0070672_100206844 | |||
| 1966 | Ga0070672_102093168 | |||
| 1967 | Ga0070686_100256050 | |||
| 1968 | Ga0070686_100505251 | |||
| 1969 | Ga0070695_100001483 | |||
| 1970 | Ga0070695_100246326 | |||
| 1971 | Ga0070695_100441644 | |||
| 1972 | Ga0070695_100461616 | |||
| 1973 | Ga0070695_101161069 | |||
| 1974 | Ga0070696_100001375 | |||
| 1975 | Ga0070696_100007637 | |||
| 1976 | Ga0070696_100077827 | |||
| 1977 | Ga0070696_100091579 | |||
| 1978 | Ga0070696_101883053 | |||
| 1979 | Ga0070693_100008533 | |||
| 1980 | Ga0070693_100013713 | |||
| 1981 | Ga0070693_100057558 | |||
| 1982 | Ga0070693_100503499 | |||
| 1983 | Ga0070693_100912568 | |||
| 1984 | Ga0070665_100042538 | |||
| 1985 | Ga0070665_100052068 | |||
| 1986 | Ga0070665_102600001 | |||
| 1987 | Ga0070704_100227659 | |||
| 1988 | Ga0070704_100285705 | |||
| 1989 | Ga0070704_101093287 | |||
| 1990 | Ga0068855_100002169 | |||
| 1991 | Ga0068855_100005082 | |||
| 1992 | Ga0068855_100008571 | |||
| 1993 | Ga0068855_100043978 | |||
| 1994 | Ga0068855_100366932 | |||
| 1995 | Ga0068855_100381898 | |||
| 1996 | Ga0068855_100646997 | |||
| 1997 | Ga0068855_100990687 | |||
| 1998 | Ga0068855_101054914 | |||
| 1999 | Ga0068855_101547206 | |||
| 2000 | Ga0070664_100013154 | |||
| 2001 | Ga0070664_100024766 | |||
| 2002 | Ga0070664_100051722 | |||
| 2003 | Ga0070664_100485014 | |||
| 2004 | Ga0070664_101004731 | |||
| 2005 | Ga0070664_101389984 | |||
| 2006 | Ga0068857_100012151 | |||
| 2007 | Ga0068857_100012440 | |||
| 2008 | Ga0068857_100015739 | |||
| 2009 | Ga0068857_100020862 | |||
| 2010 | Ga0068857_100087176 | |||
| 2011 | Ga0068857_100736577 | |||
| 2012 | Ga0068854_100000340 | |||
| 2013 | Ga0068854_100034276 | |||
| 2014 | Ga0068854_100053241 | |||
| 2015 | Ga0068854_100420152 | |||
| 2016 | Ga0068854_100745723 | |||
| 2017 | Ga0068854_100790047 | |||
| 2018 | Ga0068854_101739925 | |||
| 2019 | Ga0068856_100364022 | |||
| 2020 | Ga0068856_100457035 | |||
| 2021 | Ga0068856_100648460 | |||
| 2022 | Ga0068856_100680175 | |||
| 2023 | Ga0068856_100941185 | |||
| 2024 | Ga0068856_101002356 | |||
| 2025 | Ga0070702_100015870 | |||
| 2026 | Ga0070702_100518545 | |||
| 2027 | Ga0068852_100014974 | |||
| 2028 | Ga0068852_100018984 | |||
| 2029 | Ga0068852_100069165 | |||
| 2030 | Ga0068852_100192890 | |||
| 2031 | Ga0068852_100202237 | |||
| 2032 | Ga0068852_100546103 | |||
| 2033 | Ga0068852_101079483 | |||
| 2034 | Ga0068852_101434378 | |||
| 2035 | Ga0068859_100056150 | |||
| 2036 | Ga0068859_100897660 | |||
| 2037 | Ga0068864_100005386 | |||
| 2038 | Ga0068864_100038902 | |||
| 2039 | Ga0068864_100318803 | |||
| 2040 | Ga0068864_100369234 | |||
| 2041 | Ga0068864_101236591 | |||
| 2042 | Ga0068866_10000524 | |||
| 2043 | Ga0068866_10116924 | |||
| 2044 | Ga0068866_10376060 | |||
| 2045 | Ga0068866_10812860 | |||
| 2046 | Ga0068861_100001019 | |||
| 2047 | Ga0068861_100049474 | |||
| 2048 | Ga0068861_100289917 | |||
| 2049 | Ga0068861_100944581 | |||
| 2050 | Ga0068851_10015465 | |||
| 2051 | Ga0068851_10071393 | |||
| 2052 | Ga0068851_10269088 | |||
| 2053 | Ga0068870_10002079 | |||
| 2054 | Ga0068870_10304076 | |||
| 2055 | Ga0068870_10408049 | |||
| 2056 | Ga0068870_10428249 | |||
| 2057 | Ga0068870_10492048 | |||
| 2058 | Ga0068863_100041206 | |||
| 2059 | Ga0068863_100160660 | |||
| 2060 | Ga0068863_100319991 | |||
| 2061 | Ga0068858_100022826 | |||
| 2062 | Ga0068858_100321105 | |||
| 2063 | Ga0068860_100040126 | |||
| 2064 | Ga0068860_100227646 | |||
| 2065 | Ga0068860_100535547 | |||
| 2066 | Ga0068862_100000376 | |||
| 2067 | Ga0068862_100030151 | |||
| 2068 | Ga0068862_100126281 | |||
| 2069 | Ga0081455_10038603 | |||
| 2070 | Ga0081455_10050687 | |||
| 2071 | Ga0081539_10000104 | |||
| 2072 | Ga0081539_10043960 | |||
| 2073 | Ga0081539_10230857 | |||
| 2074 | Ga0070717_10016213 | |||
| 2075 | Ga0070717_10418219 | |||
| 2076 | Ga0070717_10918133 | |||
| 2077 | Ga0075432_10382237 | |||
| 2078 | Ga0070716_100172719 | |||
| 2079 | Ga0070716_100338785 | |||
| 2080 | Ga0070716_100489729 | |||
| 2081 | Ga0070716_100573872 | |||
| 2082 | Ga0070716_100851716 | |||
| 2083 | Ga0070712_100012458 | |||
| 2084 | Ga0070712_100028870 | |||
| 2085 | Ga0070712_100062454 | |||
| 2086 | Ga0070712_100347417 | |||
| 2087 | Ga0070712_100413145 | |||
| 2088 | Ga0070712_100488267 | |||
| 2089 | Ga0097621_100208928 | |||
| 2090 | Ga0068871_100139055 | |||
| 2091 | Ga0068871_100407653 | |||
| 2092 | Ga0075428_100235434 | |||
| 2093 | Ga0075428_100397778 | |||
| 2094 | Ga0075428_101094780 | |||
| 2095 | Ga0075428_101376680 | |||
| 2096 | Ga0075428_101708408 | |||
| 2097 | Ga0075430_100003192 | |||
| 2098 | Ga0075430_100013015 | |||
| 2099 | Ga0075430_100019170 | |||
| 2100 | Ga0075430_100029938 | |||
| 2101 | Ga0075430_100194674 | |||
| 2102 | Ga0075430_100269583 | |||
| 2103 | Ga0075431_100024864 | |||
| 2104 | Ga0075431_100037185 | |||
| 2105 | Ga0075431_100053473 | |||
| 2106 | Ga0075431_100065457 | |||
| 2107 | Ga0075431_100076205 | |||
| 2108 | Ga0075431_100135269 | |||
| 2109 | Ga0075431_100186854 | |||
| 2110 | Ga0075431_100236239 | |||
| 2111 | Ga0075431_100247272 | |||
| 2112 | Ga0075431_100373540 | |||
| 2113 | Ga0075433_10005348 | |||
| 2114 | Ga0075433_10718897 | |||
| 2115 | Ga0075434_100001804 | |||
| 2116 | Ga0075434_100035507 | |||
| 2117 | Ga0075434_100244634 | |||
| 2118 | Ga0075434_100261801 | |||
| 2119 | Ga0075434_100873154 | |||
| 2120 | Ga0075434_100881508 | |||
| 2121 | Ga0075429_100067642 | |||
| 2122 | Ga0075429_100208196 | |||
| 2123 | Ga0075429_100453510 | |||
| 2124 | Ga0075429_100470855 | |||
| 2125 | Ga0068865_100001514 | |||
| 2126 | Ga0068865_100117526 | |||
| 2127 | Ga0068865_100628234 | |||
| 2128 | Ga0075436_100114952 | |||
| 2129 | Ga0075436_100194376 | |||
| 2130 | Ga0075436_100209048 | |||
| 2131 | Ga0097620_100056151 | |||
| 2132 | Ga0097620_100897771 | |||
| 2133 | Ga0075435_100694998 | |||
| 2134 | Ga0075435_100980540 | |||
| 2135 | Ga0075435_101112837 | |||
| 2136 | Ga0075435_101766042 | |||
| 2137 | Ga0105240_10009204 | |||
| 2138 | Ga0105240_10011015 | |||
| 2139 | Ga0105240_10016684 | |||
| 2140 | Ga0105240_10037426 | |||
| 2141 | Ga0105240_10046608 | |||
| 2142 | Ga0105240_10070716 | |||
| 2143 | Ga0105240_10074073 | |||
| 2144 | Ga0105240_10090200 | |||
| 2145 | Ga0105240_10705779 | |||
| 2146 | Ga0105240_10890443 | |||
| 2147 | Ga0105240_11048922 | |||
| 2148 | Ga0111539_10042342 | |||
| 2149 | Ga0111539_10088891 | |||
| 2150 | Ga0111539_10150269 | |||
| 2151 | Ga0111539_10251608 | |||
| 2152 | Ga0111539_10920564 | |||
| 2153 | Ga0105245_10025521 | |||
| 2154 | Ga0105245_10036543 | |||
| 2155 | Ga0105245_12730105 | |||
| 2156 | Ga0105247_10439480 | |||
| 2157 | Ga0114129_10017266 | |||
| 2158 | Ga0114129_10068560 | |||
| 2159 | Ga0114129_10230022 | |||
| 2160 | Ga0114129_10273868 | |||
| 2161 | Ga0114129_10299783 | |||
| 2162 | Ga0114129_10477216 | |||
| 2163 | Ga0114129_10941962 | |||
| 2164 | Ga0114129_11407312 | |||
| 2165 | Ga0105243_10042543 | |||
| 2166 | Ga0105243_10242951 | |||
| 2167 | Ga0105243_10590746 | |||
| 2168 | Ga0105241_10000729 | |||
| 2169 | Ga0105241_10024142 | |||
| 2170 | Ga0105241_10116790 | |||
| 2171 | Ga0105241_10169367 | |||
| 2172 | Ga0105241_10525033 | |||
| 2173 | Ga0105241_10717479 | |||
| 2174 | Ga0105241_11098168 | |||
| 2175 | Ga0105242_10006526 | |||
| 2176 | Ga0105242_10015995 | |||
| 2177 | Ga0105242_10181321 | |||
| 2178 | Ga0105242_10993453 | |||
| 2179 | Ga0105242_11994438 | |||
| 2180 | Ga0105248_10009365 | |||
| 2181 | Ga0105248_10011120 | |||
| 2182 | Ga0105248_10104035 | |||
| 2183 | Ga0105248_10916580 | |||
| 2184 | Ga0105248_12078802 | |||
| 2185 | Ga0105237_10079939 | |||
| 2186 | Ga0105237_10149201 | |||
| 2187 | Ga0105237_10431669 | |||
| 2188 | Ga0105237_10472521 | |||
| 2189 | Ga0105237_11009553 | |||
| 2190 | Ga0105237_11127262 | |||
| 2191 | Ga0105238_10024368 | |||
| 2192 | Ga0105238_10066363 | |||
| 2193 | Ga0105238_10073038 | |||
| 2194 | Ga0105238_10087946 | |||
| 2195 | Ga0105238_10325721 | |||
| 2196 | Ga0105238_10816832 | |||
| 2197 | Ga0105238_11465449 | |||
| 2198 | Ga0105238_12277478 | |||
| 2199 | Ga0105249_10000454 | |||
| 2200 | Ga0105249_10069734 | |||
| 2201 | Ga0105249_10190726 | |||
| 2202 | Ga0105249_10325281 | |||
| 2203 | Ga0105249_10809129 | |||
| 2204 | Ga0105239_10147980 | |||
| 2205 | Ga0105239_10231952 | |||
| 2206 | Ga0105239_10259676 | |||
| 2207 | Ga0105239_10382025 | |||
| 2208 | Ga0105239_11245419 | |||
| 2209 | Ga0105239_12469307 | |||
| 2210 | Ga0105246_10055844 | |||
| 2211 | Ga0105246_10471626 | |||
| 2212 | Ga0157342_1073673 | |||
| 2213 | Ga0157373_10001473 | |||
| 2214 | Ga0157373_10027655 | |||
| 2215 | Ga0157373_10091952 | |||
| 2216 | Ga0157373_10152454 | |||
| 2217 | Ga0157373_10201626 | |||
| 2218 | Ga0157373_10237167 | |||
| 2219 | Ga0157373_11331309 | |||
| 2220 | Ga0157371_10007275 | |||
| 2221 | Ga0157371_10714457 | |||
| 2222 | Ga0157371_10743094 | |||
| 2223 | Ga0157371_11534102 | |||
| 2224 | Ga0157370_10003508 | |||
| 2225 | Ga0157370_10008754 | |||
| 2226 | Ga0157370_10041763 | |||
| 2227 | Ga0157370_10136189 | |||
| 2228 | Ga0157370_10165029 | |||
| 2229 | Ga0157370_10166493 | |||
| 2230 | Ga0157370_10282223 | |||
| 2231 | Ga0157370_10861985 | |||
| 2232 | Ga0157370_11117989 | |||
| 2233 | Ga0157370_11609613 | |||
| 2234 | Ga0157369_10009705 | |||
| 2235 | Ga0157369_10017338 | |||
| 2236 | Ga0157369_10073925 | |||
| 2237 | Ga0157369_10115485 | |||
| 2238 | Ga0157369_10117595 | |||
| 2239 | Ga0157369_10119385 | |||
| 2240 | Ga0157369_10232225 | |||
| 2241 | Ga0157369_10232838 | |||
| 2242 | Ga0157369_10739412 | |||
| 2243 | Ga0157369_10743766 | |||
| 2244 | Ga0157369_11755948 | |||
| 2245 | Ga0157374_10433589 | |||
| 2246 | Ga0157374_10990234 | |||
| 2247 | Ga0157374_11098074 | |||
| 2248 | Ga0157374_11385070 | |||
| 2249 | Ga0157374_12425697 | |||
| 2250 | Ga0157378_10005002 | |||
| 2251 | Ga0157378_10016080 | |||
| 2252 | Ga0157378_10429050 | |||
| 2253 | Ga0163162_10001492 | |||
| 2254 | Ga0163162_10013828 | |||
| 2255 | Ga0163162_10075056 | |||
| 2256 | Ga0163162_12869838 | |||
| 2257 | Ga0163162_13441632 | |||
| 2258 | Ga0157372_10010171 | |||
| 2259 | Ga0157372_10013087 | |||
| 2260 | Ga0157372_10015470 | |||
| 2261 | Ga0157372_10025540 | |||
| 2262 | Ga0157372_10068103 | |||
| 2263 | Ga0157372_10118363 | |||
| 2264 | Ga0157372_10124994 | |||
| 2265 | Ga0157372_10252248 | |||
| 2266 | Ga0157372_10317512 | |||
| 2267 | Ga0157372_10367523 | |||
| 2268 | Ga0157372_10382231 | |||
| 2269 | Ga0157372_10509511 | |||
| 2270 | Ga0157372_10519876 | |||
| 2271 | Ga0157372_10617092 | |||
| 2272 | Ga0157372_10636435 | |||
| 2273 | Ga0157372_10659924 | |||
| 2274 | Ga0157372_10696387 | |||
| 2275 | Ga0157372_11287462 | |||
| 2276 | Ga0157372_11664064 | |||
| 2277 | Ga0157372_11736237 | |||
| 2278 | Ga0157372_11902482 | |||
| 2279 | Ga0157372_12279322 | |||
| 2280 | Ga0157372_12346199 | |||
| 2281 | Ga0157372_12369999 | |||
| 2282 | Ga0157372_12614981 | |||
| 2283 | Ga0157375_10091745 | |||
| 2284 | Ga0157375_10100651 | |||
| 2285 | Ga0157375_10294846 | |||
| 2286 | Ga0157375_10840832 | |||
| 2287 | Ga0163163_10070485 | |||
| 2288 | Ga0163163_10660291 | |||
| 2289 | Ga0157380_10007646 | |||
| 2290 | Ga0157380_10033634 | |||
| 2291 | Ga0157380_10148905 | |||
| 2292 | Ga0157380_10278831 | |||
| 2293 | Ga0157380_12670253 | |||
| 2294 | Ga0182008_10009299 | |||
| 2295 | Ga0182008_10081193 | |||
| 2296 | Ga0157377_10031866 | |||
| 2297 | Ga0157379_10015608 | |||
| 2298 | Ga0157379_10064796 | |||
| 2299 | Ga0157376_10093515 | |||
| 2300 | Ga0157376_10225367 | |||
| 2301 | Ga0157376_11130927 | |||
| 2302 | Ga0157376_11883363 | |||
| 2303 | Ga0182007_10042612 | |||
| 2304 | Ga0182007_10073079 | |||
| 2305 | Ga0182007_10210130 | |||
| 2306 | Ga0182007_10215945 | |||
| 2307 | Ga0182007_10254854 | |||
| 2308 | Ga0182005_1079726 | |||
| 2309 | Ga0163161_10150679 | |||
| 2310 | Ga0163161_11802713 | |||
| 2311 | Ga0197907_11166881 | |||
| 2312 | Ga0197907_11314107 | |||
| 2313 | Ga0206356_10116592 | |||
| 2314 | Ga0206356_10125692 | |||
| 2315 | Ga0206356_10416445 | |||
| 2316 | Ga0206356_10483138 | |||
| 2317 | Ga0206356_10839536 | |||
| 2318 | Ga0206356_11361504 | |||
| 2319 | Ga0206356_11525656 | |||
| 2320 | Ga0206356_11642972 | |||
| 2321 | Ga0206356_11798847 | |||
| 2322 | Ga0206355_1012074 | |||
| 2323 | Ga0206355_1360271 | |||
| 2324 | Ga0206352_10641371 | |||
| 2325 | Ga0206352_10860556 | |||
| 2326 | Ga0206352_10936146 | |||
| 2327 | Ga0206352_11130402 | |||
| 2328 | Ga0206352_11362427 | |||
| 2329 | Ga0206350_10135957 | |||
| 2330 | Ga0213876_10040236 | |||
| 2331 | Ga0224712_10152424 | |||
| 2332 | Ga0224712_10316866 | |||
| 2333 | Ga0224712_10352983 | |||
| 2334 | Ga0224712_10681828 | |||
| 2335 | Ga0207666_1047325 | |||
| 2336 | Ga0207673_1009498 | |||
| 2337 | Ga0207697_10005445 | |||
| 2338 | Ga0207697_10112113 | |||
| 2339 | Ga0207656_10006385 | |||
| 2340 | Ga0207656_10172199 | |||
| 2341 | Ga0207653_10092535 | |||
| 2342 | Ga0207682_10168826 | |||
| 2343 | Ga0207692_10101751 | |||
| 2344 | Ga0207692_10231793 | |||
| 2345 | Ga0207642_10069746 | |||
| 2346 | Ga0207642_10150415 | |||
| 2347 | Ga0207688_10023241 | |||
| 2348 | Ga0207688_10186830 | |||
| 2349 | Ga0207680_10113171 | |||
| 2350 | Ga0207680_10213827 | |||
| 2351 | Ga0207680_10821322 | |||
| 2352 | Ga0207647_10195587 | |||
| 2353 | Ga0207685_10513020 | |||
| 2354 | Ga0207699_10008459 | |||
| 2355 | Ga0207699_10045530 | |||
| 2356 | Ga0207699_10106448 | |||
| 2357 | Ga0207699_10106541 | |||
| 2358 | Ga0207645_10000246 | |||
| 2359 | Ga0207645_10000971 | |||
| 2360 | Ga0207645_10067632 | |||
| 2361 | Ga0207643_10001951 | |||
| 2362 | Ga0207643_10076653 | |||
| 2363 | Ga0207643_10131229 | |||
| 2364 | Ga0207643_10266169 | |||
| 2365 | Ga0207705_10007986 | |||
| 2366 | Ga0207705_10085948 | |||
| 2367 | Ga0207705_10089643 | |||
| 2368 | Ga0207705_10092825 | |||
| 2369 | Ga0207705_10104101 | |||
| 2370 | Ga0207705_10568143 | |||
| 2371 | Ga0207684_10135612 | |||
| 2372 | Ga0207684_10299794 | |||
| 2373 | Ga0207684_11538460 | |||
| 2374 | Ga0207684_11568418 | |||
| 2375 | Ga0207654_10000860 | |||
| 2376 | Ga0207654_10222487 | |||
| 2377 | Ga0207654_10324081 | |||
| 2378 | Ga0207654_10756775 | |||
| 2379 | Ga0207654_10955665 | |||
| 2380 | Ga0207654_11030082 | |||
| 2381 | Ga0207707_10000929 | |||
| 2382 | Ga0207707_10002146 | |||
| 2383 | Ga0207707_10002891 | |||
| 2384 | Ga0207707_10007791 | |||
| 2385 | Ga0207707_10013410 | |||
| 2386 | Ga0207707_10018294 | |||
| 2387 | Ga0207707_10021378 | |||
| 2388 | Ga0207707_10029197 | |||
| 2389 | Ga0207707_10075721 | |||
| 2390 | Ga0207707_10138032 | |||
| 2391 | Ga0207707_10629028 | |||
| 2392 | Ga0207707_10649450 | |||
| 2393 | Ga0207707_11269747 | |||
| 2394 | Ga0207695_10001441 | |||
| 2395 | Ga0207695_10004676 | |||
| 2396 | Ga0207695_10008984 | |||
| 2397 | Ga0207695_10014206 | |||
| 2398 | Ga0207695_10020766 | |||
| 2399 | Ga0207695_10044422 | |||
| 2400 | Ga0207695_10064710 | |||
| 2401 | Ga0207695_10081615 | |||
| 2402 | Ga0207695_10084488 | |||
| 2403 | Ga0207671_10019018 | |||
| 2404 | Ga0207671_10131053 | |||
| 2405 | Ga0207671_10390182 | |||
| 2406 | Ga0207693_10019839 | |||
| 2407 | Ga0207693_10041127 | |||
| 2408 | Ga0207693_10361743 | |||
| 2409 | Ga0207693_10406055 | |||
| 2410 | Ga0207693_10410453 | |||
| 2411 | Ga0207693_10421808 | |||
| 2412 | Ga0207693_10613331 | |||
| 2413 | Ga0207663_10001490 | |||
| 2414 | Ga0207663_10080650 | |||
| 2415 | Ga0207663_10172527 | |||
| 2416 | Ga0207663_10243302 | |||
| 2417 | Ga0207663_10898578 | |||
| 2418 | Ga0207663_11205783 | |||
| 2419 | Ga0207660_10001809 | |||
| 2420 | Ga0207660_10017662 | |||
| 2421 | Ga0207660_10032222 | |||
| 2422 | Ga0207660_10065650 | |||
| 2423 | Ga0207660_10087746 | |||
| 2424 | Ga0207660_10090306 | |||
| 2425 | Ga0207660_10101186 | |||
| 2426 | Ga0207660_10141654 | |||
| 2427 | Ga0207660_10218233 | |||
| 2428 | Ga0207660_10239322 | |||
| 2429 | Ga0207660_10918590 | |||
| 2430 | Ga0207660_11133214 | |||
| 2431 | Ga0207662_10003841 | |||
| 2432 | Ga0207662_10105844 | |||
| 2433 | Ga0207662_10244175 | |||
| 2434 | Ga0207657_10005262 | |||
| 2435 | Ga0207657_10021232 | |||
| 2436 | Ga0207657_10237526 | |||
| 2437 | Ga0207657_10250158 | |||
| 2438 | Ga0207657_10541662 | |||
| 2439 | Ga0207657_10685639 | |||
| 2440 | Ga0207657_11469464 | |||
| 2441 | Ga0207649_10029427 | |||
| 2442 | Ga0207649_10050337 | |||
| 2443 | Ga0207649_10096437 | |||
| 2444 | Ga0207649_10165257 | |||
| 2445 | Ga0207649_10174948 | |||
| 2446 | Ga0207649_10852542 | |||
| 2447 | Ga0207652_10000470 | |||
| 2448 | Ga0207652_10003423 | |||
| 2449 | Ga0207652_10007324 | |||
| 2450 | Ga0207652_10020285 | |||
| 2451 | Ga0207652_10022221 | |||
| 2452 | Ga0207652_10024204 | |||
| 2453 | Ga0207652_10031148 | |||
| 2454 | Ga0207652_10086061 | |||
| 2455 | Ga0207652_10088832 | |||
| 2456 | Ga0207652_10267542 | |||
| 2457 | Ga0207652_10564050 | |||
| 2458 | Ga0207652_11525639 | |||
| 2459 | Ga0207646_10123227 | |||
| 2460 | Ga0207646_10142024 | |||
| 2461 | Ga0207646_10424101 | |||
| 2462 | Ga0207681_10009785 | |||
| 2463 | Ga0207681_10054383 | |||
| 2464 | Ga0207681_10066558 | |||
| 2465 | Ga0207681_10221702 | |||
| 2466 | Ga0207694_10023333 | |||
| 2467 | Ga0207694_10137479 | |||
| 2468 | Ga0207694_10209118 | |||
| 2469 | Ga0207694_10360180 | |||
| 2470 | Ga0207694_10664094 | |||
| 2471 | Ga0207694_11230706 | |||
| 2472 | Ga0207650_10004487 | |||
| 2473 | Ga0207650_10101704 | |||
| 2474 | Ga0207650_10104656 | |||
| 2475 | Ga0207659_10003254 | |||
| 2476 | Ga0207659_10009170 | |||
| 2477 | Ga0207659_10555758 | |||
| 2478 | Ga0207659_10642311 | |||
| 2479 | Ga0207659_11039265 | |||
| 2480 | Ga0207659_11089345 | |||
| 2481 | Ga0207687_10039639 | |||
| 2482 | Ga0207687_10073181 | |||
| 2483 | Ga0207700_10038793 | |||
| 2484 | Ga0207700_10054883 | |||
| 2485 | Ga0207700_10089999 | |||
| 2486 | Ga0207700_10123261 | |||
| 2487 | Ga0207700_10243155 | |||
| 2488 | Ga0207700_10337740 | |||
| 2489 | Ga0207700_10819651 | |||
| 2490 | Ga0207664_10025601 | |||
| 2491 | Ga0207664_10039577 | |||
| 2492 | Ga0207664_10119297 | |||
| 2493 | Ga0207664_10167885 | |||
| 2494 | Ga0207664_10572851 | |||
| 2495 | Ga0207644_10035451 | |||
| 2496 | Ga0207644_10257273 | |||
| 2497 | Ga0207644_10686395 | |||
| 2498 | Ga0207644_10722079 | |||
| 2499 | Ga0207690_10012598 | |||
| 2500 | Ga0207690_10037581 | |||
| 2501 | Ga0207690_10042611 | |||
| 2502 | Ga0207690_10044207 | |||
| 2503 | Ga0207690_10068413 | |||
| 2504 | Ga0207690_10278896 | |||
| 2505 | Ga0207690_10747510 | |||
| 2506 | Ga0207690_11017212 | |||
| 2507 | Ga0207690_11587498 | |||
| 2508 | Ga0207706_10000065 | |||
| 2509 | Ga0207706_10000357 | |||
| 2510 | Ga0207706_10297873 | |||
| 2511 | Ga0207706_11025855 | |||
| 2512 | Ga0207706_11312440 | |||
| 2513 | Ga0207686_10001117 | |||
| 2514 | Ga0207686_10171259 | |||
| 2515 | Ga0207709_10004346 | |||
| 2516 | Ga0207709_10567253 | |||
| 2517 | Ga0207709_10740090 | |||
| 2518 | Ga0207670_10120778 | |||
| 2519 | Ga0207670_11386390 | |||
| 2520 | Ga0207669_10001479 | |||
| 2521 | Ga0207669_10015931 | |||
| 2522 | Ga0207669_10077102 | |||
| 2523 | Ga0207669_10215008 | |||
| 2524 | Ga0207704_10058637 | |||
| 2525 | Ga0207704_10414369 | |||
| 2526 | Ga0207665_10157887 | |||
| 2527 | Ga0207665_10226418 | |||
| 2528 | Ga0207665_10407598 | |||
| 2529 | Ga0207665_11088389 | |||
| 2530 | Ga0207665_11404281 | |||
| 2531 | Ga0207691_10001355 | |||
| 2532 | Ga0207691_10001550 | |||
| 2533 | Ga0207691_10022438 | |||
| 2534 | Ga0207691_10131502 | |||
| 2535 | Ga0207711_10028892 | |||
| 2536 | Ga0207711_10222614 | |||
| 2537 | Ga0207711_10908831 | |||
| 2538 | Ga0207689_10001360 | |||
| 2539 | Ga0207689_10007750 | |||
| 2540 | Ga0207689_10665749 | |||
| 2541 | Ga0207689_11505011 | |||
| 2542 | Ga0207661_10011833 | |||
| 2543 | Ga0207661_10019670 | |||
| 2544 | Ga0207661_10022228 | |||
| 2545 | Ga0207661_10032021 | |||
| 2546 | Ga0207661_10037459 | |||
| 2547 | Ga0207661_10068735 | |||
| 2548 | Ga0207661_10323213 | |||
| 2549 | Ga0207661_10716921 | |||
| 2550 | Ga0207661_11987297 | |||
| 2551 | Ga0207661_12145826 | |||
| 2552 | Ga0207679_10000484 | |||
| 2553 | Ga0207679_10006509 | |||
| 2554 | Ga0207679_10024777 | |||
| 2555 | Ga0207679_10271920 | |||
| 2556 | Ga0207679_10276220 | |||
| 2557 | Ga0207679_10602183 | |||
| 2558 | Ga0207667_10011137 | |||
| 2559 | Ga0207667_10019276 | |||
| 2560 | Ga0207667_10081585 | |||
| 2561 | Ga0207667_10187587 | |||
| 2562 | Ga0207667_10950863 | |||
| 2563 | Ga0207651_10058551 | |||
| 2564 | Ga0207651_10150000 | |||
| 2565 | Ga0207651_10452791 | |||
| 2566 | Ga0207712_10001176 | |||
| 2567 | Ga0207712_10044891 | |||
| 2568 | Ga0207712_10130934 | |||
| 2569 | Ga0207712_10481269 | |||
| 2570 | Ga0207712_11682783 | |||
| 2571 | Ga0207668_10021247 | |||
| 2572 | Ga0207668_10053139 | |||
| 2573 | Ga0207668_10730561 | |||
| 2574 | Ga0207640_10001456 | |||
| 2575 | Ga0207640_10050446 | |||
| 2576 | Ga0207640_10104663 | |||
| 2577 | Ga0207640_10110876 | |||
| 2578 | Ga0207640_10286487 | |||
| 2579 | Ga0207640_10370752 | |||
| 2580 | Ga0207640_10501830 | |||
| 2581 | Ga0207658_10060833 | |||
| 2582 | Ga0207658_10178304 | |||
| 2583 | Ga0207658_11525645 | |||
| 2584 | Ga0207703_10156270 | |||
| 2585 | Ga0207639_10004358 | |||
| 2586 | Ga0207639_10116510 | |||
| 2587 | Ga0207639_10150381 | |||
| 2588 | Ga0207639_10331802 | |||
| 2589 | Ga0207639_10517425 | |||
| 2590 | Ga0207639_11916862 | |||
| 2591 | Ga0207678_10041333 | |||
| 2592 | Ga0207678_10041868 | |||
| 2593 | Ga0207678_10068814 | |||
| 2594 | Ga0207678_10423890 | |||
| 2595 | Ga0207678_12011429 | |||
| 2596 | Ga0207708_10098662 | |||
| 2597 | Ga0207708_10104714 | |||
| 2598 | Ga0207708_10154233 | |||
| 2599 | Ga0207708_10751038 | |||
| 2600 | Ga0207702_10057844 | |||
| 2601 | Ga0207702_10071273 | |||
| 2602 | Ga0207702_10745631 | |||
| 2603 | Ga0207702_10915538 | |||
| 2604 | Ga0207702_10990133 | |||
| 2605 | Ga0207702_11682985 | |||
| 2606 | Ga0207641_10107617 | |||
| 2607 | Ga0207641_10345441 | |||
| 2608 | Ga0207648_10001169 | |||
| 2609 | Ga0207648_10005220 | |||
| 2610 | Ga0207648_10023923 | |||
| 2611 | Ga0207648_10046448 | |||
| 2612 | Ga0207648_12191754 | |||
| 2613 | Ga0207676_10048851 | |||
| 2614 | Ga0207676_10093952 | |||
| 2615 | Ga0207676_10142837 | |||
| 2616 | Ga0207676_10163981 | |||
| 2617 | Ga0207676_10343365 | |||
| 2618 | Ga0207676_11694275 | |||
| 2619 | Ga0207674_10003135 | |||
| 2620 | Ga0207674_10015526 | |||
| 2621 | Ga0207674_10018565 | |||
| 2622 | Ga0207674_10059142 | |||
| 2623 | Ga0207674_10140302 | |||
| 2624 | Ga0207674_10296301 | |||
| 2625 | Ga0207674_10677573 | |||
| 2626 | Ga0207674_11584205 | |||
| 2627 | Ga0207675_100000320 | |||
| 2628 | Ga0207675_100032261 | |||
| 2629 | Ga0207675_100059762 | |||
| 2630 | Ga0207675_100314828 | |||
| 2631 | Ga0207675_100341058 | |||
| 2632 | Ga0207683_10033546 | |||
| 2633 | Ga0207683_10041068 | |||
| 2634 | Ga0207683_10059100 | |||
| 2635 | Ga0207683_10295458 | |||
| 2636 | Ga0207698_10007055 | |||
| 2637 | Ga0207698_10013973 | |||
| 2638 | Ga0207698_10256188 | |||
| 2639 | Ga0207698_11013550 | |||
| 2640 | Ga0207698_11089470 | |||
| 2641 | Ga0207698_11123693 | |||
| 2642 | Ga0207698_11183172 | |||
| 2643 | Ga0207698_11211289 | |||
| 2644 | Ga0207428_10075404 | |||
| 2645 | Ga0207428_10258988 | |||
| 2646 | Ga0268266_10083429 | |||
| 2647 | Ga0268266_10102533 | |||
| 2648 | Ga0268266_11123594 | |||
| 2649 | Ga0268265_10002121 | |||
| 2650 | Ga0268265_10037895 | |||
| 2651 | Ga0268265_10266956 | |||
| 2652 | Ga0268265_10715986 | |||
| 2653 | Ga0268265_10802452 | |||
| 2654 | Ga0268264_10022106 | |||
| 2655 | Ga0268264_10480925 | |||
| 2656 | Ga0268264_10488128 | |||
| 2657 | Ga0316178_1053326 | |||
| 2658 | Ga0307408_100008337 | |||
| 2659 | Ga0307408_100187150 | |||
| 2660 | Ga0307408_100297064 | |||
| 2661 | Ga0307408_100368413 | |||
| 2662 | Ga0307408_100559101 | |||
| 2663 | Ga0307408_100875500 | |||
| 2664 | Ga0307408_102494544 | |||
| 2665 | Ga0316579_10111135 | |||
| 2666 | Ga0316576_10002948 | |||
| 2667 | Ga0316578_10013404 | |||
| 2668 | Ga0316578_10015348 | |||
| 2669 | Ga0307405_10000187 | |||
| 2670 | Ga0307405_10014127 | |||
| 2671 | Ga0307405_10036009 | |||
| 2672 | Ga0307405_10092885 | |||
| 2673 | Ga0307405_10144722 | |||
| 2674 | Ga0307405_10154782 | |||
| 2675 | Ga0307405_10173627 | |||
| 2676 | Ga0307405_10258162 | |||
| 2677 | Ga0307405_10406577 | |||
| 2678 | Ga0307405_10487220 | |||
| 2679 | Ga0307405_10986256 | |||
| 2680 | Ga0307405_11102917 | |||
| 2681 | Ga0307405_11372694 | |||
| 2682 | Ga0307405_12113955 | |||
| 2683 | Ga0307405_12137608 | |||
| 2684 | Ga0316577_10002399 | |||
| 2685 | Ga0316577_10025102 | |||
| 2686 | Ga0307413_10000837 | |||
| 2687 | Ga0307413_10002229 | |||
| 2688 | Ga0307413_10030411 | |||
| 2689 | Ga0307413_10042391 | |||
| 2690 | Ga0307413_10055375 | |||
| 2691 | Ga0307413_10073618 | |||
| 2692 | Ga0307413_10140859 | |||
| 2693 | Ga0307413_10171588 | |||
| 2694 | Ga0307413_10284805 | |||
| 2695 | Ga0307413_10457015 | |||
| 2696 | Ga0307413_10640847 | |||
| 2697 | Ga0307413_10817679 | |||
| 2698 | Ga0307413_11214826 | |||
| 2699 | Ga0307410_10002520 | |||
| 2700 | Ga0307410_10012076 | |||
| 2701 | Ga0307410_10015315 | |||
| 2702 | Ga0307410_10022976 | |||
| 2703 | Ga0307410_10027658 | |||
| 2704 | Ga0307410_10070059 | |||
| 2705 | Ga0307410_10127016 | |||
| 2706 | Ga0307410_10249681 | |||
| 2707 | Ga0307410_10272665 | |||
| 2708 | Ga0307410_10314703 | |||
| 2709 | Ga0307410_10337316 | |||
| 2710 | Ga0307410_10344968 | |||
| 2711 | Ga0307410_10345358 | |||
| 2712 | Ga0307410_10498068 | |||
| 2713 | Ga0307410_10549744 | |||
| 2714 | Ga0307410_11023698 | |||
| 2715 | Ga0307410_11691523 | |||
| 2716 | Ga0307406_10001688 | |||
| 2717 | Ga0307406_10002595 | |||
| 2718 | Ga0307406_10014718 | |||
| 2719 | Ga0307406_10023424 | |||
| 2720 | Ga0307406_10028708 | |||
| 2721 | Ga0307406_10043279 | |||
| 2722 | Ga0307406_10085068 | |||
| 2723 | Ga0307406_10108565 | |||
| 2724 | Ga0307406_10146070 | |||
| 2725 | Ga0307406_10230915 | |||
| 2726 | Ga0307406_10260498 | |||
| 2727 | Ga0307406_10362133 | |||
| 2728 | Ga0307406_11611758 | |||
| 2729 | Ga0307407_10000201 | |||
| 2730 | Ga0307407_10004682 | |||
| 2731 | Ga0307407_10008899 | |||
| 2732 | Ga0307407_10024361 | |||
| 2733 | Ga0307407_10027368 | |||
| 2734 | Ga0307407_10085331 | |||
| 2735 | Ga0307407_10091391 | |||
| 2736 | Ga0307407_10116337 | |||
| 2737 | Ga0307407_10124907 | |||
| 2738 | Ga0307407_10333724 | |||
| 2739 | Ga0307407_10342090 | |||
| 2740 | Ga0307407_10379864 | |||
| 2741 | Ga0307407_10441069 | |||
| 2742 | Ga0307407_10525226 | |||
| 2743 | Ga0307407_10962072 | |||
| 2744 | Ga0307412_10012476 | |||
| 2745 | Ga0307412_10028271 | |||
| 2746 | Ga0307412_10129946 | |||
| 2747 | Ga0307412_10193021 | |||
| 2748 | Ga0307412_10234054 | |||
| 2749 | Ga0307412_10398104 | |||
| 2750 | Ga0307412_11261340 | |||
| 2751 | Ga0307409_100000144 | |||
| 2752 | Ga0307409_100003493 | |||
| 2753 | Ga0307409_100009411 | |||
| 2754 | Ga0307409_100009792 | |||
| 2755 | Ga0307409_100023234 | |||
| 2756 | Ga0307409_100026152 | |||
| 2757 | Ga0307409_100027599 | |||
| 2758 | Ga0307409_100033448 | |||
| 2759 | Ga0307409_100048332 | |||
| 2760 | Ga0307409_100118546 | |||
| 2761 | Ga0307409_100126080 | |||
| 2762 | Ga0307409_100186505 | |||
| 2763 | Ga0307409_100254667 | |||
| 2764 | Ga0307409_100383328 | |||
| 2765 | Ga0307409_100556156 | |||
| 2766 | Ga0307409_100717738 | |||
| 2767 | Ga0307409_100867596 | |||
| 2768 | Ga0307409_101141677 | |||
| 2769 | Ga0307416_100000828 | |||
| 2770 | Ga0307416_100004156 | |||
| 2771 | Ga0307416_100007355 | |||
| 2772 | Ga0307416_100012718 | |||
| 2773 | Ga0307416_100014248 | |||
| 2774 | Ga0307416_100024844 | |||
| 2775 | Ga0307416_100049239 | |||
| 2776 | Ga0307416_100073566 | |||
| 2777 | Ga0307416_100073588 | |||
| 2778 | Ga0307416_100120247 | |||
| 2779 | Ga0307416_100247873 | |||
| 2780 | Ga0307416_100356860 | |||
| 2781 | Ga0307416_100450307 | |||
| 2782 | Ga0307416_100477679 | |||
| 2783 | Ga0307416_100511350 | |||
| 2784 | Ga0307416_100735010 | |||
| 2785 | Ga0307416_101424102 | |||
| 2786 | Ga0307416_102811952 | |||
| 2787 | Ga0307416_103058978 | |||
| 2788 | Ga0307416_103753912 | |||
| 2789 | Ga0307414_10002383 | |||
| 2790 | Ga0307414_10006027 | |||
| 2791 | Ga0307414_10030309 | |||
| 2792 | Ga0307414_10043031 | |||
| 2793 | Ga0307414_10090810 | |||
| 2794 | Ga0307414_10345745 | |||
| 2795 | Ga0307414_10408267 | |||
| 2796 | Ga0307414_10426642 | |||
| 2797 | Ga0307414_10465715 | |||
| 2798 | Ga0307414_11271125 | |||
| 2799 | Ga0307411_10001066 | |||
| 2800 | Ga0307411_10006929 | |||
| 2801 | Ga0307411_10007270 | |||
| 2802 | Ga0307411_10017609 | |||
| 2803 | Ga0307411_10028273 | |||
| 2804 | Ga0307411_10045742 | |||
| 2805 | Ga0307411_10062970 | |||
| 2806 | Ga0307411_10141185 | |||
| 2807 | Ga0307411_10147865 | |||
| 2808 | Ga0307411_10166152 | |||
| 2809 | Ga0307411_10208308 | |||
| 2810 | Ga0307411_10276620 | |||
| 2811 | Ga0307411_10282820 | |||
| 2812 | Ga0307411_10531822 | |||
| 2813 | Ga0307411_10645798 | |||
| 2814 | Ga0307411_10663386 | |||
| 2815 | Ga0307411_10672848 | |||
| 2816 | Ga0307411_10773159 | |||
| 2817 | Ga0307411_10858996 | |||
| 2818 | Ga0307411_11345317 | |||
| 2819 | Ga0307411_11551779 | |||
| 2820 | Ga0307411_11809007 | |||
| 2821 | Ga0307411_11845197 | |||
| 2822 | Ga0307415_100000419 | |||
| 2823 | Ga0307415_100002432 | |||
| 2824 | Ga0307415_100021813 | |||
| 2825 | Ga0307415_100036475 | |||
| 2826 | Ga0307415_100041599 | |||
| 2827 | Ga0307415_100051781 | |||
| 2828 | Ga0307415_100125154 | |||
| 2829 | Ga0307415_100143241 | |||
| 2830 | Ga0307415_100459811 | |||
| 2831 | Ga0307415_100490786 | |||
| 2832 | Ga0307415_100970217 | |||
| 2833 | Ga0307415_102463500 | |||
| 2834 | Ga0316583_10003563 | |||
| 2835 | Ga0316585_10006893 | |||
| 2836 | Ga0316596_1143350 | |||
| 2837 | Ga0373950_0167964 | |||
| 2838 | Ga0373938_0040184 | |||
| 2839 | Ga0373926_0004167 | |||
| 2840 | Ga0373928_0048895 | |||
| 2841 | Ga0373934_0005211 | |||
| 2842 | Ga0373934_0037374 | |||
| 2843 | Ga0373934_0040553 | |||
| 2844 | Ga0373940_0070749 | |||
| 2845 | Ga0373944_0396028 | |||
| 2846 | Ga0373951_0051655 | |||
| 2847 | Ga0373952_0095406 | |||
| 2848 | Ga0373923_0007123 | |||
| 2849 | Ga0373932_0198412 | |||
| 2850 | Ga0373936_0011918 | |||
| 2851 | Ga0373936_0128849 | |||
| 2852 | Ga0373941_0333309 | |||
| 2853 | Ga0373945_0258114 | |||
| 2854 | Ga0373953_0002759 | |||
| 2855 | Ga0373953_0009331 | |||
| 2856 | Ga0373953_0568949 | |||
| 2857 | Ga0373954_0057621 | |||
| 2858 | Ga0373954_0066241 | |||
| 2859 | Ga0373954_0440984 | |||
| 2860 | Ga0373956_0000678 | |||
| 2861 | Ga0373956_0113697 | |||
| 2862 | Ga0373956_0548048 | |||
| 2863 | Ga0373957_0099398 | |||
| 2864 | Ga0373957_0165776 | |||
| 2865 | Ga0373960_0139748 | |||
| 2866 | Ga0373943_0016857 | |||
| 2867 | Ga0373943_0028594 | |||
| 2868 | Ga0373946_0009275 | |||
| 2869 | Ga0373942_0342387 | |||
| 2870 | Ga0373961_0059628 | |||
| 2871 | Ga0316574_0204529 | |||
| 2872 | Ga0316574_0695716 | |||
| 2873 | Ga0373924_0002127 | |||
| 2874 | Ga0373924_0285833 | |||
| 2875 | Ga0373931_0018182 | |||
| 2876 | Ga0373931_0018416 | |||
| 2877 | Ga0373935_0018031 | |||
| 2878 | Ga0373935_0063447 | |||
| 2879 | Ga0373935_0124591 | |||
| 2880 | Ga0373935_0378071 | |||
| 2881 | Ga0373927_0026060 | |||
| 2882 | Ga0373927_1094838 | |||
| 2883 | Ga0373933_0001111 | |||
| 2884 | Ga0373933_0013654 | |||
| 2885 | Ga0373947_0002126 | |||
| 2886 | Ga0373947_0048812 | |||
| 2887 | Ga0373947_0115326 | |||
| 2888 | Ga0373937_0002914 | |||
| 2889 | Ga0373937_0065385 | |||
| 2890 | Ga0373937_0096592 | |||
| 2891 | Ga0316582_0026818 | |||
| 2892 | Ga0316582_0075578 | |||
| 2893 | Ga0316584_0009015 | |||
| 2894 | Ga0373925_0034016 | |||
| 2895 | Ga0373925_0216655 | |||
| 2896 | Ga0373925_0592715 | |||
| 2897 | Ga0395899_0038329 | |||
| 2898 | Ga0395900_0005143 | |||
| 2899 | Ga0395898_0365364 | |||
| 2900 | Ga0395905_0049760 | |||
| 2901 | Ga0395905_0117856 | |||
| 2902 | Ga0395905_0624983 | |||
| 2903 | Ga0395905_1377214 | |||
| 2904 | Ga0316581_0052652 | |||
| 2905 | Ga0436364_0287855 | |||
| 2906 | Ga0395901_0003407 | |||
| 2907 | Ga0395901_0694213 | |||
| 2908 | Ga0395901_1490842 | |||
| 2909 | Ga0242420_024104 | |||
| 2910 | Ga0242420_054477 | |||
| 2911 | Ga0436365_0290864 | |||
| 2912 | Ga0436365_0304609 | |||
| 2913 | Ga0436365_1159467 | |||
| 2914 | Ga0436365_1602166 | |||
| 2915 | Ga0436363_0390436 | |||
| 2916 | Ga0436363_0732405 | |||
| 2917 | Ga0439439_0021339 | |||
| 2918 | Ga0451839_1205934 | |||
| 2919 | Ga0451853_1987835 | |||
| 2920 | Ga0439448_0040558 | |||
| 2921 | Ga0439457_103357 | |||
| 2922 | Ga0439462_0132713 | |||
| 2923 | Ga0439446_0184978 | |||
| 2924 | Ga0451577_0003975 | |||
| 2925 | Ga0451577_0076398 | |||
| 2926 | Ga0451577_0233619 | |||
| 2927 | Ga0451577_0278304 | |||
| 2928 | Ga0453683_0083881 | |||
| 2929 | Ga0453683_1216232 | |||
| 2930 | Ga0466965_0319755 | |||
| 2931 | Ga0466966_0310517 | |||
| 2932 | Ga0466966_0984788 | |||
| 2933 | Ga0466961_0148652 | |||
| 2934 | Ga0466964_0177363 | |||
| 2935 | Ga0466964_0240783 | |||
| 2936 | Ga0466964_0355081 | |||
| 2937 | Ga0453684_1058605 | |||
| 2938 | Ga0466971_0083762 | |||
| 2939 | Ga0466971_0634884 | |||
| 2940 | Ga0466970_0236236 | |||
| 2941 | Ga0466957_1006802 | |||
| 2942 | Ga0466957_1282518 | |||
| 2943 | Ga0451576_0042077 | |||
| 2944 | Ga0451576_0116352 | |||
| 2945 | Ga0451576_0321037 | |||
| 2946 | Ga0451576_0781793 | |||
| 2947 | Ga0451576_1522734 | |||
| 2948 | Ga0466958_0130129 | |||
| 2949 | Ga0466958_0334514 | |||
| 2950 | Ga0466967_0250970 | |||
| 2951 | Ga0466967_0533636 | |||
| 2952 | Ga0466967_0777573 | |||
| 2953 | Ga0466967_2175858 | |||
| 2954 | Ga0495592_0002525 | |||
| 2955 | Ga0495592_0365590 | |||
| 2956 | Ga0495592_0902943 | |||
| 2957 | Ga0495603_0015387 | |||
| 2958 | Ga0495603_0046197 | |||
| 2959 | Ga0495603_0238765 | |||
| 2960 | Ga0495629_0003115 | |||
| 2961 | Ga0495629_0025075 | |||
| 2962 | Ga0495629_0040407 | |||
| 2963 | Ga0495629_0303378 | |||
| 2964 | Ga0495629_0618441 | |||
| 2965 | Ga0495629_1112862 | |||
| 2966 | Ga0495651_0009970 | |||
| 2967 | Ga0495651_0017083 | |||
| 2968 | Ga0495651_0124418 | |||
| 2969 | Ga0495651_0644771 | |||
| 2970 | Ga0495653_0000547 | |||
| 2971 | Ga0495653_0006042 | |||
| 2972 | Ga0495653_0636764 | |||
| 2973 | Ga0495580_0001189 | |||
| 2974 | Ga0495580_0005504 | |||
| 2975 | Ga0495580_0109372 | |||
| 2976 | Ga0495580_0614116 | |||
| 2977 | Ga0495580_1020227 | |||
| 2978 | Ga0495582_0013598 | |||
| 2979 | Ga0495582_0039450 | |||
| 2980 | Ga0495582_0088607 | |||
| 2981 | Ga0495582_0151791 | |||
| 2982 | Ga0495582_0762531 | |||
| 2983 | Ga0495639_0000549 | |||
| 2984 | Ga0495639_0011675 | |||
| 2985 | Ga0495639_0316237 | |||
| 2986 | Ga0495662_0417003 | |||
| 2987 | Ga0495664_0281001 | |||
| 2988 | Ga0495664_0714430 | |||
| 2989 | Ga0495585_0160087 | |||
| 2990 | Ga0495594_0011878 | |||
| 2991 | Ga0495594_0145232 | |||
| 2992 | Ga0495607_0370303 | |||
| 2993 | Ga0495608_0000405 | |||
| 2994 | Ga0495608_0028611 | |||
| 2995 | Ga0495618_0153235 | |||
| 2996 | Ga0495628_0000494 | |||
| 2997 | Ga0495628_0040700 | |||
| 2998 | Ga0495628_0122008 | |||
| 2999 | Ga0495630_0002236 | |||
| 3000 | Ga0495630_0003849 | |||
| 3001 | Ga0495630_0015750 | |||
| 3002 | Ga0495630_0085082 | |||
| 3003 | Ga0495663_0099594 | |||
| 3004 | Ga0495666_0050611 | |||
| 3005 | Ga0495652_0008315 | |||
| 3006 | Ga0495652_0042274 | |||
| 3007 | Ga0495665_0000358 | |||
| 3008 | Ga0495665_0003130 | |||
| 3009 | Ga0495665_0075851 | |||
| 3010 | Ga0495665_0593238 | |||
| 3011 | Ga0495640_0359579 | |||
| 3012 | Ga0495586_0004190 | |||
| 3013 | Ga0495587_0000269 | |||
| 3014 | Ga0495587_0000334 | |||
| 3015 | Ga0495587_0001945 | |||
| 3016 | Ga0495587_0124263 | |||
| 3017 | Ga0495621_0210913 | |||
| 3018 | Ga0495621_0343511 | |||
| 3019 | Ga0495645_0005088 | |||
| 3020 | Ga0495645_0087646 | |||
| 3021 | Ga0495622_0022950 | |||
| 3022 | Ga0495622_0225599 | |||
| 3023 | Ga0495633_0152348 | |||
| 3024 | Ga0495667_0000504 | |||
| 3025 | Ga0495667_0001705 | |||
| 3026 | Ga0495667_0005981 | |||
| 3027 | Ga0495634_0830558 | |||
| 3028 | Ga0495635_0000200 | |||
| 3029 | Ga0495635_0354627 | |||
| 3030 | Ga0495659_0150507 | |||
| 3031 | Ga0495659_0328021 | |||
| 3032 | Ga0495659_0379927 | |||
| 3033 | Ga0495588_0012498 | |||
| 3034 | Ga0495588_0023908 | |||
| 3035 | Ga0495657_0011939 | |||
| 3036 | Ga0495657_0464029 | |||
| 3037 | Ga0495657_0876098 | |||
| 3038 | Ga0495599_0002011 | |||
| 3039 | Ga0495599_0021680 | |||
| 3040 | Ga0495599_0082661 | |||
| 3041 | Ga0495623_0000156 | |||
| 3042 | Ga0495623_0003024 | |||
| 3043 | Ga0495623_0052162 | |||
| 3044 | Ga0495646_0038350 | |||
| 3045 | Ga0495658_0001403 | |||
| 3046 | Ga0495658_0048011 | |||
| 3047 | Ga0495658_0251892 | |||
| 3048 | Ga0495658_0357189 | |||
| 3049 | Ga0495658_0662063 | |||
| 3050 | Ga0495613_0102611 | |||
| 3051 | Ga0495613_0168100 | |||
| 3052 | Ga0495613_0312533 | |||
| 3053 | Ga0495613_0387039 | |||
| 3054 | Ga0495613_0510664 | |||
| 3055 | Ga0495670_0290462 | |||
| 3056 | Ga0495600_0003971 | |||
| 3057 | Ga0495581_0000659 | |||
| 3058 | Ga0495581_0016943 | |||
| 3059 | Ga0495581_0051860 | |||
| 3060 | Ga0495581_0564619 | |||
| 3061 | Ga0495581_0636522 | |||
| 3062 | Ga0495604_0004192 | |||
| 3063 | Ga0495604_0025411 | |||
| 3064 | Ga0495604_0939967 | |||
| 3065 | Ga0495636_0095234 | |||
| 3066 | Ga0495674_0007567 | |||
| 3067 | Ga0495674_0032263 | |||
| 3068 | Ga0495674_0043600 | |||
| 3069 | Ga0495674_0894607 | |||
| 3070 | Ga0495680_0004788 | |||
| 3071 | Ga0495680_0791030 | |||
| 3072 | Ga0495675_0002012 | |||
| 3073 | Ga0495675_0057891 | |||
| 3074 | Ga0495675_0070071 | |||
| 3075 | Ga0495675_0075070 | |||
| 3076 | Ga0495675_0402624 | |||
| 3077 | Ga0495675_0837854 | |||
| 3078 | Ga0495684_0001442 | |||
| 3079 | Ga0495684_0024474 | |||
| 3080 | Ga0495684_0063191 | |||
| 3081 | Ga0495593_0000356 | |||
| 3082 | Ga0495593_0111707 | |||
| 3083 | Ga0495593_0133358 | |||
| 3084 | Ga0495593_0509573 | |||
| 3085 | Ga0495602_0003996 | |||
| 3086 | Ga0495602_0039288 | |||
| 3087 | Ga0495602_0133381 | |||
| 3088 | Ga0495614_0000638 | |||
| 3089 | Ga0495614_0279277 | |||
| 3090 | Ga0495615_0073472 | |||
| 3091 | Ga0496100_0073025 | |||
| 3092 | Ga0496100_0171604 | |||
| 3093 | Ga0496100_0202865 | |||
| 3094 | Ga0496100_0835443 | |||
| 3095 | Ga0496100_0848128 | |||
| 3096 | Ga0496100_1059323 | |||
| 3097 | Ga0496101_0038807 | |||
| 3098 | Ga0496101_0077774 | |||
| 3099 | Ga0496101_1050509 | |||
| 3100 | Ga0496102_0067085 | |||
| 3101 | Ga0496102_0134419 | |||
| 3102 | Ga0496102_0451550 | |||
| 3103 | Ga0496102_0749520 | |||
| 3104 | Ga0496102_1123092 | |||
| 3105 | Ga0496103_0181794 | |||
| 3106 | Ga0496103_0431769 | |||
| 3107 | Ga0496104_0004744 | |||
| 3108 | Ga0496104_0183124 | |||
| 3109 | Ga0496104_0623643 | |||
| 3110 | Ga0496105_0572812 | |||
| 3111 | Ga0496106_0012262 | |||
| 3112 | Ga0496106_0053593 | |||
| 3113 | Ga0496106_0467735 | |||
| 3114 | Ga0496106_0644154 | |||
| 3115 | Ga0496106_0649088 | |||
| 3116 | Ga0496107_0177846 | |||
| 3117 | Ga0496107_0294105 | |||
| 3118 | Ga0496108_0005237 | |||
| 3119 | Ga0496108_0017435 | |||
| 3120 | Ga0496108_0180869 | |||
| 3121 | Ga0496108_0820892 | |||
| 3122 | Ga0496109_0007523 | |||
| 3123 | Ga0496109_0071352 | |||
| 3124 | Ga0496109_0382259 | |||
| 3125 | Ga0496109_2049924 | |||
| 3126 | Ga0496110_0029147 | |||
| 3127 | Ga0496110_0080168 | |||
| 3128 | Ga0496111_0032614 | |||
| 3129 | Ga0496111_0115469 | |||
| 3130 | Ga0496112_0001950 | |||
| 3131 | Ga0496112_0022068 | |||
| 3132 | Ga0496112_0889592 | |||
| 3133 | Ga0496113_0000769 | |||
| 3134 | Ga0496113_0068922 | |||
| 3135 | Ga0496113_0116662 | |||
| 3136 | Ga0496114_0134245 | |||
| 3137 | Ga0496114_0384593 | |||
| 3138 | Ga0496115_0004680 | |||
| 3139 | Ga0496115_0215545 | |||
| 3140 | Ga0501306_036833 | |||
| 3141 | Ga0501309_062896 | |||
| 3142 | Ga0501304_027104 | |||
| 3143 | Ga0501290_016941 | |||
| 3144 | Ga0501291_039674 | |||
| 3145 | Ga0501294_011442 | |||
| 3146 | Ga0501297_044363 | |||
| 3147 | Ga0501298_059127 | |||
| 3148 | Ga0501298_113859 | |||
| 3149 | Ga0501299_123283 | |||
| 3150 | Ga0501299_157296 | |||
| 3151 | Ga0501311_048452 | |||
| 3152 | Ga0501311_058505 | |||
| 3153 | Ga0501313_027753 | |||
| 3154 | Ga0501314_036812 | |||
| 3155 | Ga0501315_102951 | |||
| 3156 | Ga0501316_045992 | |||
| 3157 | Ga0501317_080926 | |||
| 3158 | Ga0501323_043397 | |||
| 3159 | Ga0501323_065499 | |||
| 3160 | Ga0501325_027581 | |||
| 3161 | Ga0501340_016227 | |||
| 3162 | Ga0501340_026915 | |||
| 3163 | Ga0501032_0043085 | |||
| 3164 | Ga0501032_0160958 | |||
| 3165 | Ga0501033_0031074 | |||
| 3166 | Ga0501034_1216412 | |||
| 3167 | Ga0501036_0038635 | |||
| 3168 | Ga0501036_0200401 | |||
| 3169 | Ga0501037_0241493 | |||
| 3170 | Ga0501038_0108158 | |||
| 3171 | Ga0501038_0581194 | |||
| 3172 | Ga0501039_0160910 | |||
| 3173 | Ga0501040_1191822 | |||
| 3174 | Ga0501041_0073333 | |||
| 3175 | Ga0501041_0134378 | |||
| 3176 | Ga0501041_0668060 | |||
| 3177 | Ga0501042_0144495 | |||
| 3178 | Ga0501042_0244581 | |||
| 3179 | Ga0501043_0048272 | |||
| 3180 | Ga0501043_0108258 | |||
| 3181 | Ga0501046_0133310 | |||
| 3182 | Ga0501046_0945160 | |||
| 3183 | Ga0501047_0216687 | |||
| 3184 | Ga0501047_0243318 | |||
| 3185 | Ga0501067_0000353 | |||
| 3186 | Ga0501067_0044515 | |||
| 3187 | Ga0501067_0257517 | |||
| 3188 | Ga0501067_0334725 | |||
| 3189 | Ga0501068_0001339 | |||
| 3190 | Ga0501068_0084626 | |||
| 3191 | Ga0501068_0831386 | |||
| 3192 | Ga0501069_0026566 | |||
| 3193 | Ga0501069_0032090 | |||
| 3194 | Ga0501069_0032461 | |||
| 3195 | Ga0501069_0166828 | |||
| 3196 | Ga0501070_0000192 | |||
| 3197 | Ga0501070_0123099 | |||
| 3198 | Ga0501070_0137205 | |||
| 3199 | Ga0501070_0168786 | |||
| 3200 | Ga0501070_0369431 | |||
| 3201 | Ga0501070_0726126 | |||
| 3202 | Ga0501071_0000678 | |||
| 3203 | Ga0501071_0325048 | |||
| 3204 | Ga0501071_0591982 | |||
| 3205 | Ga0501071_0796005 | |||
| 3206 | Ga0501072_0009721 | |||
| 3207 | Ga0501072_0078699 | |||
| 3208 | Ga0501072_0409368 | |||
| 3209 | Ga0501072_0962943 | |||
| 3210 | Ga0501072_1102293 | |||
| 3211 | Ga0501072_1230604 | |||
| 3212 | Ga0501073_0000949 | |||
| 3213 | Ga0501073_0631350 | |||
| 3214 | Ga0501073_0790902 | |||
| 3215 | Ga0501074_0000171 | |||
| 3216 | Ga0501074_0368537 | |||
| 3217 | Ga0501076_0149239 | |||
| 3218 | Ga0501076_0194593 | |||
| 3219 | Ga0501202_079250 | |||
| 3220 | Ga0501206_044105 | |||
| 3221 | Ga0501211_051127 | |||
| 3222 | Ga0501216_079627 | |||
| 3223 | Ga0501216_133714 | |||
| 3224 | Ga0501217_042743 | |||
| 3225 | Ga0501217_066451 | |||
| 3226 | Ga0501217_090548 | |||
| 3227 | Ga0501217_201734 | |||
| 3228 | Ga0501223_050772 | |||
| 3229 | Ga0501227_041230 | |||
| 3230 | Ga0501230_029252 | |||
| 3231 | Ga0501239_036423 | |||
| 3232 | Ga0501242_003701 | |||
| 3233 | Ga0501243_014106 | |||
| 3234 | Ga0501243_072468 | |||
| 3235 | Ga0501248_012725 | |||
| 3236 | Ga0501249_006910 | |||
| 3237 | Ga0501249_014954 | |||
| 3238 | Ga0501256_002047 | |||
| 3239 | Ga0501257_025964 | |||
| 3240 | Ga0501257_034172 | |||
| 3241 | Ga0501261_097815 | |||
| 3242 | Ga0501225_0104002 | |||
| 3243 | Ga0501245_027410 | |||
| 3244 | Ga0501079_0076548 | |||
| 3245 | Ga0501079_0142055 | |||
| 3246 | Ga0501079_0218931 | |||
| 3247 | Ga0501080_0000060 | |||
| 3248 | Ga0501080_0005735 | |||
| 3249 | Ga0501080_0111578 | |||
| 3250 | Ga0501080_0247391 | |||
| 3251 | Ga0501081_0337820 | |||
| 3252 | Ga0501081_0376070 | |||
| 3253 | Ga0501081_0931676 | |||
| 3254 | Ga0501083_0008037 | |||
| 3255 | Ga0501083_0529860 | |||
| 3256 | Ga0501264_006568 | |||
| 3257 | Ga0501268_001006 | |||
| 3258 | Ga0501268_045841 | |||
| 3259 | Ga0501272_005087 | |||
| 3260 | Ga0501273_005428 | |||
| 3261 | Ga0501273_045094 | |||
| 3262 | Ga0501275_011114 | |||
| 3263 | Ga0501275_042240 | |||
| 3264 | Ga0501276_019420 | |||
| 3265 | Ga0501283_085767 | |||
| 3266 | Ga0501044_0006673 | |||
| 3267 | Ga0501044_0384435 | |||
| 3268 | Ga0501045_0059366 | |||
| 3269 | Ga0501045_0457465 | |||
| 3270 | Ga0501204_040726 | |||
| 3271 | Ga0501220_08404 | |||
| 3272 | nmdc:mga05p37_1158346_c1 | |||
| 3273 | nmdc:mga05p37_2129497_c1 | |||
| 3274 | nmdc:mga05p37_24458_c1 | |||
| 3275 | nmdc:mga05p37_259528_c1 | |||
| 3276 | nmdc:mga05p37_313439_c1 | |||
| 3277 | nmdc:mga05p37_328502_c1 | |||
| 3278 | nmdc:mga05p37_372223_c1 | |||
| 3279 | nmdc:mga05p37_81382_c1 | |||
| 3280 | nmdc:mga05p37_82134_c1 | |||
| 3281 | nmdc:mga05p37_830499_c1 | |||
| 3282 | nmdc:mga09592_132413_c1 | |||
| 3283 | nmdc:mga09592_132896_c1 | |||
| 3284 | nmdc:mga09592_216657_c1 | |||
| 3285 | nmdc:mga09592_72535_c1 | |||
| 3286 | nmdc:mga0qj67_10094_c1 | |||
| 3287 | nmdc:mga0qj67_1478095_c1 | |||
| 3288 | nmdc:mga0qj67_18195_c1 | |||
| 3289 | nmdc:mga0qj67_3022_c1 | |||
| 3290 | nmdc:mga0qj67_3465_c1 | |||
| 3291 | nmdc:mga0qj67_37040_c1 | |||
| 3292 | nmdc:mga0qj67_505202_c1 | |||
| 3293 | nmdc:mga0qj67_52160_c1 | |||
| 3294 | nmdc:mga06r32_139003_c1 | |||
| 3295 | nmdc:mga06r32_1637814_c1 | |||
| 3296 | nmdc:mga06r32_186579_c1 | |||
| 3297 | nmdc:mga06r32_363451_c1 | |||
| 3298 | nmdc:mga06r32_406801_c1 | |||
| 3299 | nmdc:mga06r32_533345_c1 | |||
| 3300 | nmdc:mga06r32_712109_c1 | |||
| 3301 | nmdc:mga06r32_73470_c1 | |||
| 3302 | nmdc:mga06r32_77166_c1 | |||
| 3303 | nmdc:mga06r32_812426_c1 | |||
| 3304 | nmdc:mga08y16_1335218_c1 | |||
| 3305 | nmdc:mga08y16_345174_c1 | |||
| 3306 | nmdc:mga08y16_479660_c1 | |||
| 3307 | nmdc:mga08y16_560798_c1 | |||
| 3308 | nmdc:mga08y16_9037_c1 | |||
| 3309 | nmdc:mga0n895_1454242_c1 | |||
| 3310 | nmdc:mga0n895_1552889_c1 | |||
| 3311 | nmdc:mga0n895_24093_c1 | |||
| 3312 | nmdc:mga0n895_40283_c1 | |||
| 3313 | nmdc:mga0n895_42112_c1 | |||
| 3314 | nmdc:mga0n895_753427_c1 | |||
| 3315 | nmdc:mga0n895_770868_c1 | |||
| 3316 | nmdc:mga0rr50_196370_c1 | |||
| 3317 | nmdc:mga0rr50_545513_c1 | |||
| 3318 | nmdc:mga0rr50_820594_c1 | |||
| 3319 | nmdc:mga08x19_12152_c1 | |||
| 3320 | nmdc:mga08x19_425860_c1 | |||
| 3321 | nmdc:mga0a205_32863_c1 | |||
| 3322 | nmdc:mga0a205_37088_c1 | |||
| 3323 | nmdc:mga0a205_605389_c1 | |||
| 3324 | nmdc:mga0a205_646225_c1 | |||
| 3325 | Ga0495601_0003937 | |||
| 3326 | Ga0495601_0081254 | |||
| 3327 | Ga0495601_0084821 | |||
| 3328 | Ga0495601_0840966 | |||
| 3329 | Ga0495612_0000490 | |||
| 3330 | Ga0495595_0024258 | |||
| 3331 | Ga0495619_0002629 | |||
| 3332 | Ga0495619_0062774 | |||
| 3333 | Ga0495619_0414562 | |||
| 3334 | Ga0501084_0081149 | |||
| 3335 | Ga0501084_0095051 | |||
| 3336 | Ga0501084_0170156 | |||
| 3337 | Ga0501084_0184919 | |||
| 3338 | Ga0590071_031312 | |||
| 3339 | Ga0590071_043838 | |||
| 3340 | Ga0590075_026983 | |||
| 3341 | Ga0590075_045298 | |||
| 3342 | Ga0590077_022697 | |||
| 3343 | Ga0587066_078833 | |||
| 3344 | Ga0587070_143242 | |||
| 3345 | Ga0587073_0057828 | |||
| 3346 | Ga0587073_0117544 | |||
| 3347 | Ga0587077_128672 | |||
| 3348 | Ga0587083_0108493 | |||
| 3349 | Ga0587083_0153285 | |||
| 3350 | Ga0587083_0260290 | |||
| 3351 | Ga0587085_026550 | |||
| 3352 | Ga0587088_101991 | |||
| 3353 | Ga0587088_104734 | |||
| 3354 | Ga0587089_057672 | |||
| 3355 | Ga0587091_071005 | |||
| 3356 | Ga0587092_118003 | |||
| 3357 | Ga0587094_083647 | |||
| 3358 | Ga0587101_077787 | |||
| 3359 | Ga0587117_093637 | |||
| 3360 | Ga0587128_084766 | |||
| 3361 | Ga0587062_056317 | |||
| 3362 | Ga0587067_156622 | |||
| 3363 | Ga0587067_189136 | |||
| 3364 | Ga0587072_083036 | |||
| 3365 | Ga0587072_091123 | |||
| 3366 | Ga0587075_107383 | |||
| 3367 | Ga0587076_078824 | |||
| 3368 | Ga0587076_103535 | |||
| 3369 | Ga0501082_0036435 | |||
| 3370 | Ga0501082_0160735 | |||
| 3371 | Ga0501082_0206675 | |||
| 3372 | Ga0466962_0514034 | |||
| 3373 | Ga0530510_0335764 | |||
| 3374 | Ga0530510_1264863 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f43-assembly1.cif.gz_A-2 | crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution | 0.9495 | 3 | 109 |
| 1vc1-assembly1.cif.gz_B | crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv | 0.9366 | 2 | 105 |
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.934 | 2 | 109 |
| 1til-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii | 0.9295 | 2 | 109 |
| 6m36-assembly1.cif.gz_F | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9268 | 2 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f43A01 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9293 | 6 | 108 | 3.30.750.24 |
| af_A0A0N7KGR6_2_88_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9241 | 44 | 109 | 3.30.750.24 |
| af_A0A0R0KL09_2_75_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.92 | 52 | 109 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9176 | 2 | 109 | 3.30.750.24 |
| 4qtpB00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9138 | 2 | 109 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1H9L1-F1-model_v4 | Anti-sigma factor antagonist | 1.006 | 1 | 110 |
GO:0043856
|
| AF-A0A7X5WEP3-F1-model_v4 | deleted | 1.005 | 1 | 110 |
|
| AF-A0A2G4IH21-F1-model_v4 | Anti-sigma factor antagonist | 1.005 | 1 | 110 |
GO:0043856
|
| AF-A0A7X4BDD0-F1-model_v4 | Anti-sigma factor antagonist | 1.001 | 1 | 107 |
GO:0043856
|
| AF-A0A6B1FRW9-F1-model_v4 | deleted | 1.001 | 3 | 107 |
|