metagRoot

F495336

General Info

Members	Datasets	Scaffolds	Average Seq Length
1687	710	3374	257

Family's Representative Sequence

Representative Sequence	3300013105\|Ga0157369_10030614\|Ga0157369_100306147
Length	307
Sequence	MPAHLLACMRRNASRSWRWLSEQAPQAPRAEPAASNPERPHQRYWQNCKIMALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKISMNSSAVANPQLVKDATDKYGSQCIVVAIDAKRVSADGEPPRWEVFTHGGRKATGLEAVEWARKMAELGAGEILLTSMDRDGTKSGFDLALTRAVSDAVPIPVIASGGVGNLQHLADGIKNGHADAVLAASIFHYGEHTVGEAKRFMAGQGISVRL

Samples

	Sample ID	Description	Type	Environment
1	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
4	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
5	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
8	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
9	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
10	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
11	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
12	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
13	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
14	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
15	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
16	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
17	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
18	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
19	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
20	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
21	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
22	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
23	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
24	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
25	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
26	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
27	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
28	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
29	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
30	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
31	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
32	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
33	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
34	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
38	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
39	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
40	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
41	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
42	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
43	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
44	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
45	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
46	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
47	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
48	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
49	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
50	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
51	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
52	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
53	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
54	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
55	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
56	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
57	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
58	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
59	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
60	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
61	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
62	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
63	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
64	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
65	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
66	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
67	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
68	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
69	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
70	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
71	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
72	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
73	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
74	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
75	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
76	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
77	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
78	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
79	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
80	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
81	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
82	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
83	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
84	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
85	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
86	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
87	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
88	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
89	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
90	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
91	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
92	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
93	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
94	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
95	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
97	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
98	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
99	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
100	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
101	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
102	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
103	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
104	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
105	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
106	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
107	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
108	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
109	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
110	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
111	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
112	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
113	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
114	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
115	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
116	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
117	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
118	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
119	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
120	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
121	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
122	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
123	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
124	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
125	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
126	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
127	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
128	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
129	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
130	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
131	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
132	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
133	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
134	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
135	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
136	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
137	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
138	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
139	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
140	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
141	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
142	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
143	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
144	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
145	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
146	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
147	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
148	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
149	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
150	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
151	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
152	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
159	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
160	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
161	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
162	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
163	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
165	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
167	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
169	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
171	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
173	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
238	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
240	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
244	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
245	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
246	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
247	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
248	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
249	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
250	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
251	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
252	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
253	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
254	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
255	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
256	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
257	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
258	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
259	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
260	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
261	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
262	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
263	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
264	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
265	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
266	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
267	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
268	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
269	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
270	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
271	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
272	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
273	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
274	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
275	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
276	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
277	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
278	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
279	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
280	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
281	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
282	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
283	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
284	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
285	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
286	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
287	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
288	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
289	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
290	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
291	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
292	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
293	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
294	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
295	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
296	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
297	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
298	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
299	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
300	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
301	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
302	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
303	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
304	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
305	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
306	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
307	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
308	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
309	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
310	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
311	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
312	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
313	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
314	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
315	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
316	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
317	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
318	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
319	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
320	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
321	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
322	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
323	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
324	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
325	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
326	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
327	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
328	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
329	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
330	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
331	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
332	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
333	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
334	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
335	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
336	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
337	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
338	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
339	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
340	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
341	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
342	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
343	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
344	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
345	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
346	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
347	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
348	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
349	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
350	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
351	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
352	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
353	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
354	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
355	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
356	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
357	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
358	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
359	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
360	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
361	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
362	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
363	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
364	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
365	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
366	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
367	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
368	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
369	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
370	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
371	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
372	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
373	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
374	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
375	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
376	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
377	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
378	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
379	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
380	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
381	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
382	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
383	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
384	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
385	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
386	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
387	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
388	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
389	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
390	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
391	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
392	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
393	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
394	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
395	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
396	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
397	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
398	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
399	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
400	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
401	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
402	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
403	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
404	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
405	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
406	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
407	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
408	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
409	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
410	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
411	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
412	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
413	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
414	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
415	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
416	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
417	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
418	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
419	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
420	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
421	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
422	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
423	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
424	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
425	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
426	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
427	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
428	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
429	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
430	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
431	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
432	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
433	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
434	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
435	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
436	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
437	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
438	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
439	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
440	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
441	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
442	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
443	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
444	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
445	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
446	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
447	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
448	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
449	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
450	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
451	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
452	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
453	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
454	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
455	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
456	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
457	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
458	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
459	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
460	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
461	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
462	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
463	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
464	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
465	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
466	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
467	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
468	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
469	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
470	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
471	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
472	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
473	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
474	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
475	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
476	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
477	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
478	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
479	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
480	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
481	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
482	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
483	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
484	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
485	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
486	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
487	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
488	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
489	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
490	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
491	3300049656	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought	Metagenome	Rhizosphere
492	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
493	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
494	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
495	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
496	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
497	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
498	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
500	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
501	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
502	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
503	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
504	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
505	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
506	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
507	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
508	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
509	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
510	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
511	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
512	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
513	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
514	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
515	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
516	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
517	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
518	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
519	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
520	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
521	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
522	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
523	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
524	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
525	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
526	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
527	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
528	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
529	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
530	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
531	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
532	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
533	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
534	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
535	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
536	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
537	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
538	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
539	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
540	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
541	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
542	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
543	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
544	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
545	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
546	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
547	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
548	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
549	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
550	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
551	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
552	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
553	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
554	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
555	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
556	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
557	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
558	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
559	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
560	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
561	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
562	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
563	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
564	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
565	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
566	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
567	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
568	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
569	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
570	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
571	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
572	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
573	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
574	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
575	2643221591	Devosia sp. Root685	Isolate	Unclassified
576	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
577	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
578	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
579	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
580	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
581	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
582	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
583	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
584	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
585	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
586	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
587	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
588	2738541273	Elizabethkingia sp. YR214	Isolate	Unclassified
589	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
590	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
591	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
592	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
593	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
594	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
595	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
596	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
597	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
598	2738543014	Elizabethkingia sp. YR191	Isolate	Unclassified
599	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
600	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
601	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
602	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
603	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
604	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
605	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
606	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
607	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
608	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
609	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
610	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
611	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
612	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
613	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
614	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
615	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
616	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
617	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
618	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
619	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
620	2818991450	Burkholderia sp. 604	Isolate	Unclassified
621	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
622	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
623	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
624	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
625	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
626	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
627	2842698319	Methylobacterium sp. R-72139	Isolate	Unclassified
628	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
629	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
630	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
631	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
632	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
633	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
634	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
635	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
636	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
637	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
638	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
639	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
640	2902405164	Methylobacterium sp. P1-11	Isolate	Unclassified
641	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
642	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
643	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
644	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
645	2904564687	Burkholderia sp. 571	Isolate	Unclassified
646	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
647	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
648	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
649	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
650	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
651	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
652	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
653	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
654	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
655	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
656	2919450847	Ancylobacter sp. 3268	Isolate	Rhizosphere
657	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
658	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
659	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
660	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
661	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
662	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
663	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
664	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
665	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
666	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
667	2928163908	Burkholderia sp. 567	Isolate	Unclassified
668	2928170801	Burkholderia sp. 572	Isolate	Unclassified
669	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
670	2928536128	Burkholderia sola 565	Isolate	Unclassified
671	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
672	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
673	2939669807	Kaistia defluvii 3207	Isolate	Rhizosphere
674	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
675	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
676	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
677	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
678	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
679	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
680	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
681	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
682	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
683	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
684	2990196909	Pseudomonas mangrovi TC-11	Isolate	Unclassified
685	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
686	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
687	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
688	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
689	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
690	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
691	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
692	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
693	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
694	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
695	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
696	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
697	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
698	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
699	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
700	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
701	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
702	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
703	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
704	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
705	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
706	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule
707	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
708	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
709	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
710	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	88.92
Metatranscriptomes	0.53
Isolates	10.55

Biome Distribution

Category	Percentage (%)
Aerial Root	0.12
Bulb	0
Endosphere	5.81
Nodule	0.95
Rhizoplane	5.45
Rhizosphere	77.77
Stem	0
Stem Tuber	0
Unclassified	0.24

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0157369_10030614	3300013105	Bacteria	5934
2	SwRhRL2b_contig_1951000	2162886007	Bacteria	2738
3	JGI24736J21556_1007916	3300001904	Bacteria	1776
4	JGI24740J21852_10000985	3300001979	Bacteria	12731
5	JGI24740J21852_10008500	3300001979	Bacteria	4089
6	JGI24739J22299_10011896	3300001989	Bacteria	3203
7	JGI24735J21928_10000566	3300002067	Bacteria	12974
8	JGI24735J21928_10001570	3300002067	Bacteria	8103
9	JGI24735J21928_10004545	3300002067	Bacteria	4663
10	JGI24735J21928_10004725	3300002067	Bacteria	4546
11	JGI24735J21928_10013067	3300002067	Bacteria	2616
12	JGI24738J21930_10002006	3300002075	Bacteria	5470
13	JGI25156J39149_1007606	3300002705	Bacteria	2823
14	JGI25156J39149_1015378	3300002705	Bacteria	1532
15	JGI25406J46586_10009582	3300003203	Bacteria	4333
16	JGI25165J46597_1000794	3300003214	Bacteria	23941
17	JGI25160J50197_1000146	3300003354	Bacteria	63378
18	JGI25160J50197_1042858	3300003354	Bacteria	1025
19	Ga0055538_1000038	3300003751	Bacteria	186588
20	Ga0055538_1000115	3300003751	Bacteria	61470
21	Ga0055539_1000049	3300003752	Bacteria	186588
22	Ga0055539_1000162	3300003752	Bacteria	61470
23	Ga0055533_1000060	3300003756	Bacteria	186588
24	Ga0055533_1000164	3300003756	Bacteria	61470
25	Ga0055533_1000476	3300003756	Bacteria	15060
26	Ga0055532_1000092	3300003758	Bacteria	103243
27	Ga0055532_1000153	3300003758	Bacteria	61470
28	Ga0055525_1000068	3300003759	Bacteria	186588
29	Ga0055525_1000224	3300003759	Bacteria	61470
30	Ga0055527_1000035	3300003760	Bacteria	138481
31	Ga0055527_1000754	3300003760	Bacteria	9044
32	Ga0055535_1000050	3300003761	Bacteria	138481
33	Ga0055542_1000120	3300003762	Bacteria	103243
34	Ga0055542_1006002	3300003762	Bacteria	2654
35	Ga0055542_1006397	3300003762	Bacteria	2522
36	Ga0055529_1000089	3300003763	Bacteria	138481
37	Ga0055529_1002076	3300003763	Bacteria	4325
38	Ga0055528_1003212	3300003790	Bacteria	8351
39	Ga0055541_1000036	3300003841	Bacteria	186588
40	Ga0055541_1000107	3300003841	Bacteria	61470
41	Ga0058692_1002418	3300003856	Bacteria	6253
42	Ga0065165_1000648	3300005262	Bacteria	50260
43	Ga0065714_10012015	3300005288	Bacteria	2667
44	Ga0065712_10068411	3300005290	Bacteria	10856
45	Ga0065712_10087084	3300005290	Bacteria	2594
46	Ga0065707_10003041	3300005295	Bacteria	7882
47	Ga0070658_10004543	3300005327	Bacteria	11280
48	Ga0070658_10004734	3300005327	Bacteria	11068
49	Ga0070658_10016121	3300005327	Bacteria	5977
50	Ga0070658_10030943	3300005327	Bacteria	4299
51	Ga0070658_10065021	3300005327	Bacteria	2976
52	Ga0070683_100001760	3300005329	Bacteria	16847
53	Ga0070683_100067502	3300005329	Bacteria	3331
54	Ga0070683_100178539	3300005329	Bacteria	2015
55	Ga0070690_100003073	3300005330	Bacteria	9074
56	Ga0070690_100082320	3300005330	Bacteria	2107
57	Ga0070670_100004565	3300005331	Bacteria	11615
58	Ga0070670_100012109	3300005331	Bacteria	7376
59	Ga0070677_10091714	3300005333	Bacteria	1323
60	Ga0070666_10027412	3300005335	Bacteria	3732
61	Ga0070666_10030868	3300005335	Bacteria	3534
62	Ga0070680_100378244	3300005336	Bacteria	1205
63	Ga0070682_100042623	3300005337	Bacteria	2803
64	Ga0070682_100126100	3300005337	Bacteria	1726
65	Ga0070682_100198046	3300005337	Bacteria	1415
66	Ga0070682_100201650	3300005337	Bacteria	1404
67	Ga0068868_100355321	3300005338	Bacteria	1256
68	Ga0070660_100000025	3300005339	Bacteria	90277
69	Ga0070660_100000555	3300005339	Bacteria	25061
70	Ga0070660_100241946	3300005339	Bacteria	1470
71	Ga0070689_100000017	3300005340	Bacteria	158871
72	Ga0070689_100036969	3300005340	Bacteria	3735
73	Ga0070689_100039277	3300005340	Bacteria	3623
74	Ga0070687_100002682	3300005343	Bacteria	6731
75	Ga0070661_100004487	3300005344	Bacteria	9623
76	Ga0070661_100083767	3300005344	Bacteria	2356
77	Ga0070692_10030730	3300005345	Bacteria	2687
78	Ga0070692_10331746	3300005345	Bacteria	939
79	Ga0070669_100001095	3300005353	Bacteria	19842
80	Ga0070669_100043163	3300005353	Bacteria	3283
81	Ga0070671_100326186	3300005355	Bacteria	1308
82	Ga0070674_100009439	3300005356	Bacteria	5842
83	Ga0070674_100017948	3300005356	Bacteria	4462
84	Ga0070674_100142516	3300005356	Bacteria	1800
85	Ga0070674_100239156	3300005356	Bacteria	1421
86	Ga0070674_100374530	3300005356	Bacteria	1157
87	Ga0070673_100000620	3300005364	Bacteria	19450
88	Ga0070673_100022396	3300005364	Bacteria	4598
89	Ga0070673_100521336	3300005364	Bacteria	1077
90	Ga0070688_100010556	3300005365	Bacteria	5099
91	Ga0070659_100000264	3300005366	Bacteria	41481
92	Ga0070659_100231168	3300005366	Bacteria	1528
93	Ga0070659_100543731	3300005366	Bacteria	994
94	Ga0070667_100082688	3300005367	Bacteria	2750
95	Ga0070703_10071547	3300005406	Bacteria	1160
96	Ga0070709_10067503	3300005434	Bacteria	2296
97	Ga0070714_100239131	3300005435	Bacteria	1675
98	Ga0070714_100869380	3300005435	Bacteria	875
99	Ga0070713_100063796	3300005436	Bacteria	3090
100	Ga0070713_100338234	3300005436	Bacteria	1394
101	Ga0070711_100015814	3300005439	Bacteria	4779
102	Ga0070711_100504944	3300005439	Bacteria	998
103	Ga0070708_100000301	3300005445	Bacteria	37024
104	Ga0070708_100009986	3300005445	Bacteria	7679
105	Ga0070708_100058087	3300005445	Bacteria	3446
106	Ga0070708_100207972	3300005445	Bacteria	1833
107	Ga0070708_100553667	3300005445	Bacteria	1085
108	Ga0070708_100627710	3300005445	Bacteria	1013
109	Ga0070663_100000091	3300005455	Bacteria	40975
110	Ga0070663_100030019	3300005455	Bacteria	3721
111	Ga0070663_100133146	3300005455	Bacteria	1890
112	Ga0070662_100000855	3300005457	Bacteria	18716
113	Ga0070681_10006771	3300005458	Bacteria	11155
114	Ga0070681_10022668	3300005458	Bacteria	6308
115	Ga0070681_10079056	3300005458	Bacteria	3246
116	Ga0070681_10133753	3300005458	Bacteria	2411
117	Ga0068867_100005433	3300005459	Bacteria	9017
118	Ga0068867_100043008	3300005459	Bacteria	3306
119	Ga0070685_10173695	3300005466	Bacteria	1382
120	Ga0070706_100000675	3300005467	Bacteria	38685
121	Ga0070706_100001950	3300005467	Bacteria	21262
122	Ga0070706_100126979	3300005467	Bacteria	2379
123	Ga0070707_100002396	3300005468	Bacteria	17896
124	Ga0070707_100216066	3300005468	Bacteria	1868
125	Ga0070698_100018223	3300005471	Bacteria	7394
126	Ga0070698_100021077	3300005471	Bacteria	6826
127	Ga0070698_100445832	3300005471	Bacteria	1230
128	Ga0070699_100002387	3300005518	Bacteria	16842
129	Ga0070699_100019780	3300005518	Bacteria	5803
130	Ga0070699_100254187	3300005518	Bacteria	1570
131	Ga0070699_100538822	3300005518	Bacteria	1062
132	Ga0070679_100014023	3300005530	Bacteria	7684
133	Ga0070679_100014273	3300005530	Bacteria	7627
134	Ga0070679_100014417	3300005530	Bacteria	7591
135	Ga0070679_100025092	3300005530	Bacteria	5846
136	Ga0070679_100098050	3300005530	Bacteria	2919
137	Ga0070679_100192113	3300005530	Bacteria	2010
138	Ga0070679_100342278	3300005530	Bacteria	1443
139	Ga0070684_100129164	3300005535	Bacteria	2279
140	Ga0070697_100001239	3300005536	Bacteria	19305
141	Ga0070697_100012683	3300005536	Bacteria	6602
142	Ga0070697_100054173	3300005536	Bacteria	3260
143	Ga0068853_100000029	3300005539	Bacteria	121775
144	Ga0068853_100102759	3300005539	Bacteria	2529
145	Ga0068853_100680949	3300005539	Bacteria	980
146	Ga0070672_100021623	3300005543	Bacteria	4711
147	Ga0070672_100079752	3300005543	Bacteria	2621
148	Ga0070672_100110384	3300005543	Bacteria	2241
149	Ga0070686_100001282	3300005544	Bacteria	14217
150	Ga0070695_100015052	3300005545	Bacteria	4668
151	Ga0070696_100082908	3300005546	Bacteria	2273
152	Ga0070665_100042512	3300005548	Bacteria	4568
153	Ga0068855_100027271	3300005563	Bacteria	6834
154	Ga0068855_100028719	3300005563	Bacteria	6655
155	Ga0068855_100051124	3300005563	Bacteria	4868
156	Ga0068855_100056021	3300005563	Bacteria	4627
157	Ga0068855_100216195	3300005563	Bacteria	2151
158	Ga0068855_100398032	3300005563	Bacteria	1509
159	Ga0068855_100756845	3300005563	Bacteria	1035
160	Ga0070664_100011142	3300005564	Bacteria	7293
161	Ga0070664_100052183	3300005564	Bacteria	3463
162	Ga0068857_100053732	3300005577	Bacteria	3573
163	Ga0068857_100058082	3300005577	Bacteria	3435
164	Ga0068857_100081747	3300005577	Bacteria	2885
165	Ga0068854_100001922	3300005578	Bacteria	12666
166	Ga0068856_100079027	3300005614	Bacteria	3262
167	Ga0068856_100101735	3300005614	Bacteria	2866
168	Ga0068856_100143192	3300005614	Bacteria	2398
169	Ga0068856_100398169	3300005614	Bacteria	1397
170	Ga0068852_100020390	3300005616	Bacteria	5272
171	Ga0068852_100190519	3300005616	Bacteria	1935
172	Ga0068852_100270227	3300005616	Bacteria	1636
173	Ga0068859_100018925	3300005617	Bacteria	6918
174	Ga0068859_100103229	3300005617	Bacteria	2909
175	Ga0068866_10116709	3300005718	Bacteria	1498
176	Ga0068866_10234347	3300005718	Bacteria	1115
177	Ga0068851_10000035	3300005834	Bacteria	106588
178	Ga0068851_10038719	3300005834	Bacteria	2393
179	Ga0068863_100214669	3300005841	Bacteria	1853
180	Ga0068863_100429489	3300005841	Bacteria	1295
181	Ga0068858_100021735	3300005842	Bacteria	5994
182	Ga0068858_100035861	3300005842	Bacteria	4599
183	Ga0068858_100226662	3300005842	Bacteria	1771
184	Ga0068860_100115367	3300005843	Bacteria	2569
185	Ga0068862_100262270	3300005844	Bacteria	1578
186	Ga0068862_100550588	3300005844	Bacteria	1101
187	Ga0081455_10222811	3300005937	Bacteria	1396
188	Ga0081540_1006469	3300005983	Bacteria	8524
189	Ga0081540_1018894	3300005983	Bacteria	4210
190	Ga0081539_10001498	3300005985	Bacteria	39469
191	Ga0070717_10089874	3300006028	Bacteria	2591
192	Ga0070717_10200561	3300006028	Bacteria	1747
193	Ga0070717_10327078	3300006028	Bacteria	1367
194	Ga0075363_100064189	3300006048	Bacteria	1983
195	Ga0075364_10296513	3300006051	Bacteria	1100
196	Ga0070716_100055301	3300006173	Bacteria	2270
197	Ga0070716_100157463	3300006173	Bacteria	1468
198	Ga0070716_100215352	3300006173	Bacteria	1286
199	Ga0075367_10027238	3300006178	Bacteria	3250
200	Ga0075367_10073286	3300006178	Bacteria	2063
201	Ga0075367_10075508	3300006178	Bacteria	2033
202	Ga0075366_10040495	3300006195	Bacteria	2756
203	Ga0075366_10258459	3300006195	Bacteria	1063
204	Ga0097621_100015272	3300006237	Bacteria	5774
205	Ga0097621_100265574	3300006237	Bacteria	1507
206	Ga0075370_10107977	3300006353	Bacteria	1614
207	Ga0075370_10222138	3300006353	Bacteria	1117
208	Ga0068871_100531551	3300006358	Bacteria	1063
209	Ga0075428_100386262	3300006844	Bacteria	1501
210	Ga0075430_100037292	3300006846	Bacteria	4121
211	Ga0075430_100069476	3300006846	Bacteria	2955
212	Ga0075430_100160725	3300006846	Bacteria	1870
213	Ga0075431_100000766	3300006847	Bacteria	27825
214	Ga0075431_100024177	3300006847	Bacteria	6221
215	Ga0075431_100047007	3300006847	Bacteria	4450
216	Ga0075431_100150816	3300006847	Bacteria	2393
217	Ga0075431_100274545	3300006847	Bacteria	1707
218	Ga0075433_10442273	3300006852	Bacteria	1146
219	Ga0075434_100008839	3300006871	Bacteria	9374
220	Ga0075434_100094551	3300006871	Bacteria	2994
221	Ga0075434_100297456	3300006871	Bacteria	1634
222	Ga0075429_100042397	3300006880	Bacteria	3960
223	Ga0075429_100046650	3300006880	Bacteria	3770
224	Ga0075429_100108275	3300006880	Bacteria	2429
225	Ga0068865_100000463	3300006881	Bacteria	22698
226	Ga0075436_100199569	3300006914	Bacteria	1417
227	Ga0097620_100018925	3300006931	Bacteria	6918
228	Ga0097620_100103222	3300006931	Bacteria	2909
229	Ga0075435_100157349	3300007076	Bacteria	1912
230	Ga0099794_10010321	3300007265	Bacteria	3961
231	Ga0099795_10014037	3300007788	Bacteria	2473
232	Ga0105251_10000009	3300009011	Bacteria	192384
233	Ga0105251_10000781	3300009011	Bacteria	28894
234	Ga0105251_10004276	3300009011	Bacteria	9817
235	Ga0105251_10004471	3300009011	Bacteria	9497
236	Ga0105251_10006725	3300009011	Bacteria	7257
237	Ga0105251_10027875	3300009011	Bacteria	2858
238	Ga0105251_10039795	3300009011	Bacteria	2294
239	Ga0105244_10011664	3300009036	Bacteria	5248
240	Ga0105244_10012264	3300009036	Bacteria	5075
241	Ga0105244_10015770	3300009036	Bacteria	4325
242	Ga0105244_10031576	3300009036	Bacteria	2810
243	Ga0105244_10049313	3300009036	Bacteria	2152
244	Ga0105250_10001470	3300009092	Bacteria	12739
245	Ga0105250_10002368	3300009092	Bacteria	9521
246	Ga0105250_10002788	3300009092	Bacteria	8571
247	Ga0105250_10020938	3300009092	Bacteria	2640
248	Ga0105250_10029714	3300009092	Bacteria	2199
249	Ga0105240_10001157	3300009093	Bacteria	46192
250	Ga0105240_10055159	3300009093	Bacteria	4977
251	Ga0105240_10058928	3300009093	Bacteria	4793
252	Ga0105240_10090508	3300009093	Bacteria	3739
253	Ga0105240_10103759	3300009093	Bacteria	3453
254	Ga0105240_10148476	3300009093	Bacteria	2794
255	Ga0105240_10616615	3300009093	Bacteria	1193
256	Ga0111539_10013445	3300009094	Bacteria	10230
257	Ga0111539_10020447	3300009094	Bacteria	8152
258	Ga0111539_10083256	3300009094	Bacteria	3762
259	Ga0111539_10203392	3300009094	Bacteria	2309
260	Ga0111539_10526935	3300009094	Bacteria	1376
261	Ga0105245_10199064	3300009098	Bacteria	1923
262	Ga0105245_10850295	3300009098	Bacteria	952
263	Ga0105247_10316444	3300009101	Bacteria	1087
264	Ga0114129_10212920	3300009147	Bacteria	2611
265	Ga0114129_10572092	3300009147	Bacteria	1467
266	Ga0114129_10940148	3300009147	Bacteria	1093
267	Ga0105243_10040823	3300009148	Bacteria	3626
268	Ga0105243_10084814	3300009148	Bacteria	2595
269	Ga0105243_10145723	3300009148	Bacteria	2026
270	Ga0105241_10682856	3300009174	Bacteria	936
271	Ga0105242_10000465	3300009176	Bacteria	32243
272	Ga0105248_10013830	3300009177	Bacteria	8880
273	Ga0105248_10047554	3300009177	Bacteria	4812
274	Ga0105248_10095787	3300009177	Bacteria	3341
275	Ga0105248_10408521	3300009177	Bacteria	1529
276	Ga0105237_10003215	3300009545	Bacteria	19566
277	Ga0105237_10004566	3300009545	Bacteria	15986
278	Ga0105237_10258586	3300009545	Bacteria	1744
279	Ga0105238_10000037	3300009551	Bacteria	163954
280	Ga0105238_10001318	3300009551	Bacteria	24876
281	Ga0105238_10003778	3300009551	Bacteria	15045
282	Ga0105238_10004242	3300009551	Bacteria	14244
283	Ga0105238_10064293	3300009551	Bacteria	3669
284	Ga0105238_10155824	3300009551	Bacteria	2259
285	Ga0105238_10250065	3300009551	Bacteria	1751
286	Ga0105249_10032517	3300009553	Bacteria	4720
287	Ga0105249_10181359	3300009553	Bacteria	2049
288	Ga0105249_10216673	3300009553	Bacteria	1882
289	Ga0105239_10003694	3300010375	Bacteria	18647
290	Ga0105239_10003869	3300010375	Bacteria	18166
291	Ga0105239_10008689	3300010375	Bacteria	11501
292	Ga0105239_10039665	3300010375	Bacteria	5159
293	Ga0105239_10131957	3300010375	Bacteria	2779
294	Ga0105239_10682159	3300010375	Bacteria	1174
295	Ga0105246_10014482	3300011119	Bacteria	4961
296	Ga0157371_10017064	3300013102	Bacteria	5401
297	Ga0157371_10074427	3300013102	Bacteria	2405
298	Ga0157370_10000390	3300013104	Bacteria	55059
299	Ga0157370_10000560	3300013104	Bacteria	46440
300	Ga0157370_10029498	3300013104	Bacteria	5381
301	Ga0157370_10052390	3300013104	Bacteria	3896
302	Ga0157369_10000147	3300013105	Bacteria	100084
303	Ga0157369_10000872	3300013105	Bacteria	38509
304	Ga0157369_10002777	3300013105	Bacteria	20906
305	Ga0157369_10003810	3300013105	Bacteria	17909
306	Ga0157369_10029479	3300013105	Bacteria	6063
307	Ga0157369_10124862	3300013105	Bacteria	2730
308	Ga0157369_10602500	3300013105	Bacteria	1134
309	Ga0157374_10000251	3300013296	Bacteria	49614
310	Ga0157374_10012779	3300013296	Bacteria	7315
311	Ga0157374_10182419	3300013296	Bacteria	2051
312	Ga0157374_10201408	3300013296	Bacteria	1949
313	Ga0157378_10037095	3300013297	Bacteria	4316
314	Ga0157378_10114219	3300013297	Bacteria	2480
315	Ga0163162_10232003	3300013306	Bacteria	1976
316	Ga0157372_10000323	3300013307	Bacteria	52602
317	Ga0157375_10011856	3300013308	Bacteria	7711
318	Ga0157375_10057467	3300013308	Bacteria	3846
319	Ga0163163_10009138	3300014325	Bacteria	8833
320	Ga0163163_10051441	3300014325	Bacteria	4063
321	Ga0182008_10020191	3300014497	Bacteria	3432
322	Ga0182008_10061566	3300014497	Bacteria	1850
323	Ga0182008_10126410	3300014497	Bacteria	1273
324	Ga0157379_10030536	3300014968	Bacteria	4797
325	Ga0157376_10041971	3300014969	Bacteria	3748
326	Ga0157376_10293828	3300014969	Bacteria	1535
327	Ga0182006_1004523	3300015261	Bacteria	6847
328	Ga0182007_10000932	3300015262	Bacteria	16098
329	Ga0182007_10025299	3300015262	Bacteria	2069
330	Ga0182007_10042080	3300015262	Bacteria	1521
331	Ga0182005_1005113	3300015265	Bacteria	4134
332	Ga0183361_10015	3300016635	Bacteria	166772
333	Ga0163161_10055657	3300017792	Bacteria	2872
334	Ga0206356_11626400	3300020070	Bacteria	5245
335	Ga0206356_11640873	3300020070	Bacteria	1603
336	Ga0206354_10295002	3300020081	Bacteria	6820
337	Ga0206353_10258239	3300020082	Bacteria	1846
338	Ga0206353_10332135	3300020082	Bacteria	974
339	Ga0206353_10944309	3300020082	Bacteria	5042
340	Ga0206353_11407798	3300020082	Bacteria	1142
341	Ga0213873_10041970	3300021358	Bacteria	1181
342	Ga0213872_10001084	3300021361	Bacteria	18723
343	Ga0213872_10011215	3300021361	Bacteria	4244
344	Ga0213872_10091915	3300021361	Bacteria	1358
345	Ga0213872_10114800	3300021361	Bacteria	1194
346	Ga0213876_10065273	3300021384	Bacteria	1921
347	Ga0213876_10102796	3300021384	Bacteria	1515
348	Ga0213875_10026941	3300021388	Bacteria	2734
349	Ga0224712_10000002	3300022467	Bacteria	45137
350	Ga0209435_102153	3300025206	Bacteria	2347
351	Ga0209784_100021	3300025224	Bacteria	408534
352	Ga0209784_100087	3300025224	Bacteria	122062
353	Ga0209566_100039	3300025225	Bacteria	303368
354	Ga0209566_100106	3300025225	Bacteria	122062
355	Ga0209566_101146	3300025225	Bacteria	9967
356	Ga0209674_100036	3300025226	Bacteria	408534
357	Ga0209674_100128	3300025226	Bacteria	122062
358	Ga0209674_100153	3300025226	Bacteria	94333
359	Ga0209674_100296	3300025226	Bacteria	34844
360	Ga0209672_100054	3300025228	Bacteria	222217
361	Ga0209672_100072	3300025228	Bacteria	167942
362	Ga0209672_100073	3300025228	Bacteria	166621
363	Ga0209672_100570	3300025228	Bacteria	19598
364	Ga0209147_100085	3300025229	Bacteria	185813
365	Ga0209147_100093	3300025229	Bacteria	167196
366	Ga0209147_100100	3300025229	Bacteria	162747
367	Ga0209147_100129	3300025229	Bacteria	122062
368	Ga0209563_100040	3300025230	Bacteria	408534
369	Ga0209563_100122	3300025230	Bacteria	122062
370	Ga0207427_103353	3300025231	Bacteria	3432
371	Ga0209258_100140	3300025242	Bacteria	167245
372	Ga0209258_100168	3300025242	Bacteria	145329
373	Ga0209258_100352	3300025242	Bacteria	64206
374	Ga0209258_100397	3300025242	Bacteria	54750
375	Ga0209646_1000310	3300025246	Bacteria	38640
376	Ga0209026_1004124	3300025250	Bacteria	4465
377	Ga0209677_100023	3300025253	Bacteria	408534
378	Ga0209677_100078	3300025253	Bacteria	122062
379	Ga0209148_1000119	3300025254	Bacteria	188079
380	Ga0209148_1000140	3300025254	Bacteria	166819
381	Ga0209148_1004328	3300025254	Bacteria	3528
382	Ga0209759_1000281	3300025256	Bacteria	71594
383	Ga0209759_1000329	3300025256	Bacteria	62253
384	Ga0209759_1000362	3300025256	Bacteria	58080
385	Ga0209759_1004329	3300025256	Bacteria	5341
386	Ga0209759_1005092	3300025256	Bacteria	4697
387	Ga0209759_1014467	3300025256	Bacteria	2086
388	Ga0209759_1025149	3300025256	Bacteria	1273
389	Ga0209233_1000173	3300025261	Bacteria	145995
390	Ga0209565_1009798	3300025263	Bacteria	2405
391	Ga0209455_1000125	3300025272	Bacteria	166819
392	Ga0209455_1000217	3300025272	Bacteria	80610
393	Ga0209673_1000098	3300025273	Bacteria	193352
394	Ga0209130_1011394	3300025284	Bacteria	2383
395	Ga0209675_1004204	3300025291	Bacteria	6504
396	Ga0209025_1000853	3300025294	Bacteria	48270
397	Ga0209564_1017081	3300025295	Bacteria	2850
398	Ga0207426_1000199	3300025302	Bacteria	145826
399	Ga0207426_1002772	3300025302	Bacteria	10553
400	Ga0207656_10000008	3300025321	Bacteria	275365
401	Ga0207696_1000020	3300025711	Bacteria	434998
402	Ga0207696_1000084	3300025711	Bacteria	196086
403	Ga0207696_1025259	3300025711	Bacteria	1855
404	Ga0207655_1000495	3300025728	Bacteria	50771
405	Ga0207655_1052827	3300025728	Bacteria	1631
406	Ga0207713_1000032	3300025735	Bacteria	276465
407	Ga0207713_1000186	3300025735	Bacteria	87336
408	Ga0207713_1001816	3300025735	Bacteria	16301
409	Ga0207713_1002540	3300025735	Bacteria	13201
410	Ga0207713_1010399	3300025735	Bacteria	5150
411	Ga0207713_1036728	3300025735	Bacteria	2098
412	Ga0207653_10090442	3300025885	Bacteria	1071
413	Ga0207682_10016787	3300025893	Bacteria	2857
414	Ga0207692_10095192	3300025898	Bacteria	1623
415	Ga0207688_10270571	3300025901	Bacteria	1033
416	Ga0207680_10101560	3300025903	Bacteria	1849
417	Ga0207647_10000126	3300025904	Bacteria	59628
418	Ga0207647_10010761	3300025904	Bacteria	6442
419	Ga0207647_10062309	3300025904	Bacteria	2273
420	Ga0207685_10004056	3300025905	Bacteria	3662
421	Ga0207699_10204695	3300025906	Bacteria	1339
422	Ga0207645_10002491	3300025907	Bacteria	14450
423	Ga0207705_10006000	3300025909	Bacteria	9043
424	Ga0207705_10011142	3300025909	Bacteria	6517
425	Ga0207705_10019586	3300025909	Bacteria	4838
426	Ga0207705_10057687	3300025909	Bacteria	2800
427	Ga0207705_10120295	3300025909	Bacteria	1948
428	Ga0207705_10218594	3300025909	Bacteria	1447
429	Ga0207684_10018222	3300025910	Bacteria	6014
430	Ga0207684_10019787	3300025910	Bacteria	5757
431	Ga0207684_10029562	3300025910	Bacteria	4665
432	Ga0207684_10236181	3300025910	Bacteria	1577
433	Ga0207707_10011890	3300025912	Bacteria	7572
434	Ga0207707_10014353	3300025912	Bacteria	6899
435	Ga0207707_10065293	3300025912	Bacteria	3170
436	Ga0207695_10001836	3300025913	Bacteria	33328
437	Ga0207695_10004822	3300025913	Bacteria	18234
438	Ga0207695_10016358	3300025913	Bacteria	8681
439	Ga0207695_10022014	3300025913	Bacteria	7255
440	Ga0207695_10030027	3300025913	Bacteria	5993
441	Ga0207695_10109628	3300025913	Bacteria	2742
442	Ga0207695_10112231	3300025913	Bacteria	2704
443	Ga0207671_10000015	3300025914	Bacteria	439607
444	Ga0207671_10000351	3300025914	Bacteria	66364
445	Ga0207671_10029655	3300025914	Bacteria	4084
446	Ga0207671_10084561	3300025914	Bacteria	2383
447	Ga0207671_10097780	3300025914	Bacteria	2220
448	Ga0207671_10358813	3300025914	Bacteria	1156
449	Ga0207693_10010921	3300025915	Bacteria	7362
450	Ga0207693_10064340	3300025915	Bacteria	2873
451	Ga0207693_10108597	3300025915	Bacteria	2176
452	Ga0207693_10307327	3300025915	Bacteria	1242
453	Ga0207663_10115737	3300025916	Bacteria	1827
454	Ga0207662_10005509	3300025918	Bacteria	6758
455	Ga0207662_10038480	3300025918	Bacteria	2803
456	Ga0207662_10091271	3300025918	Bacteria	1874
457	Ga0207657_10000065	3300025919	Bacteria	98751
458	Ga0207657_10001751	3300025919	Bacteria	23419
459	Ga0207649_10000001	3300025920	Bacteria	537851
460	Ga0207652_10000514	3300025921	Bacteria	39197
461	Ga0207652_10006010	3300025921	Bacteria	9824
462	Ga0207646_10002645	3300025922	Bacteria	21032
463	Ga0207646_10010060	3300025922	Bacteria	9273
464	Ga0207646_10030001	3300025922	Bacteria	4936
465	Ga0207646_10118367	3300025922	Bacteria	2380
466	Ga0207646_10283317	3300025922	Bacteria	1498
467	Ga0207646_10551624	3300025922	Bacteria	1036
468	Ga0207681_10001783	3300025923	Bacteria	13821
469	Ga0207681_10016535	3300025923	Bacteria	4616
470	Ga0207694_10000054	3300025924	Bacteria	152124
471	Ga0207694_10016623	3300025924	Bacteria	5558
472	Ga0207694_10017087	3300025924	Bacteria	5481
473	Ga0207694_10030031	3300025924	Bacteria	4150
474	Ga0207694_10056136	3300025924	Bacteria	3058
475	Ga0207694_10146909	3300025924	Bacteria	1898
476	Ga0207694_10163751	3300025924	Bacteria	1798
477	Ga0207650_10000186	3300025925	Bacteria	72380
478	Ga0207650_10000741	3300025925	Bacteria	25168
479	Ga0207650_10006857	3300025925	Bacteria	7767
480	Ga0207659_10030526	3300025926	Bacteria	3684
481	Ga0207700_10093859	3300025928	Bacteria	2376
482	Ga0207700_10177607	3300025928	Bacteria	1780
483	Ga0207664_10070679	3300025929	Bacteria	2810
484	Ga0207664_10175704	3300025929	Bacteria	1836
485	Ga0207664_10203833	3300025929	Bacteria	1708
486	Ga0207664_10616399	3300025929	Bacteria	975
487	Ga0207690_10000040	3300025932	Bacteria	130300
488	Ga0207690_10283960	3300025932	Bacteria	1290
489	Ga0207690_10315813	3300025932	Bacteria	1227
490	Ga0207706_10000081	3300025933	Bacteria	98791
491	Ga0207706_10132919	3300025933	Bacteria	2188
492	Ga0207706_10201166	3300025933	Bacteria	1747
493	Ga0207706_10226294	3300025933	Bacteria	1637
494	Ga0207686_10012980	3300025934	Bacteria	4597
495	Ga0207686_10019792	3300025934	Bacteria	3835
496	Ga0207709_10075656	3300025935	Bacteria	2152
497	Ga0207709_10092553	3300025935	Bacteria	1980
498	Ga0207670_10000017	3300025936	Bacteria	158856
499	Ga0207670_10004256	3300025936	Bacteria	7680
500	Ga0207670_10114254	3300025936	Bacteria	1951
501	Ga0207669_10284058	3300025937	Bacteria	1250
502	Ga0207669_10285816	3300025937	Bacteria	1246
503	Ga0207704_10033009	3300025938	Bacteria	2938
504	Ga0207704_10331162	3300025938	Bacteria	1178
505	Ga0207665_10011235	3300025939	Bacteria	5875
506	Ga0207665_10141468	3300025939	Bacteria	1716
507	Ga0207665_10173570	3300025939	Bacteria	1558
508	Ga0207665_10319162	3300025939	Bacteria	1165
509	Ga0207665_10362970	3300025939	Bacteria	1096
510	Ga0207665_10492875	3300025939	Bacteria	946
511	Ga0207691_10149091	3300025940	Bacteria	2057
512	Ga0207691_10182104	3300025940	Bacteria	1835
513	Ga0207691_10410815	3300025940	Bacteria	1154
514	Ga0207711_10011206	3300025941	Bacteria	7451
515	Ga0207711_10262959	3300025941	Bacteria	1586
516	Ga0207661_10003719	3300025944	Bacteria	10634
517	Ga0207661_10260714	3300025944	Bacteria	1544
518	Ga0207679_10000009	3300025945	Bacteria	357262
519	Ga0207679_10153200	3300025945	Bacteria	1879
520	Ga0207667_10000043	3300025949	Bacteria	261426
521	Ga0207667_10008425	3300025949	Bacteria	12250
522	Ga0207667_10010182	3300025949	Bacteria	11012
523	Ga0207667_10021698	3300025949	Bacteria	7115
524	Ga0207651_10009202	3300025960	Bacteria	5388
525	Ga0207651_10045649	3300025960	Bacteria	2940
526	Ga0207712_10290394	3300025961	Bacteria	1338
527	Ga0207712_10366796	3300025961	Bacteria	1201
528	Ga0207712_10789112	3300025961	Bacteria	834
529	Ga0207668_10034688	3300025972	Bacteria	3352
530	Ga0207640_10047283	3300025981	Bacteria	2774
531	Ga0207677_10008799	3300026023	Bacteria	5657
532	Ga0207677_10115507	3300026023	Bacteria	2008
533	Ga0207703_10086473	3300026035	Bacteria	2626
534	Ga0207703_10243596	3300026035	Bacteria	1617
535	Ga0207639_10000090	3300026041	Bacteria	76134
536	Ga0207639_10001959	3300026041	Bacteria	13826
537	Ga0207678_10002149	3300026067	Bacteria	17846
538	Ga0207678_10038889	3300026067	Bacteria	4130
539	Ga0207678_10049586	3300026067	Bacteria	3628
540	Ga0207678_10264295	3300026067	Bacteria	1475
541	Ga0207641_10146083	3300026088	Bacteria	2138
542	Ga0207641_10526722	3300026088	Bacteria	1150
543	Ga0207648_10008005	3300026089	Bacteria	10305
544	Ga0207648_10042868	3300026089	Bacteria	3973
545	Ga0207648_10056307	3300026089	Bacteria	3432
546	Ga0207648_10246171	3300026089	Bacteria	1593
547	Ga0207674_10137634	3300026116	Bacteria	2403
548	Ga0207674_10137814	3300026116	Bacteria	2401
549	Ga0207674_10141753	3300026116	Bacteria	2363
550	Ga0207674_10158271	3300026116	Bacteria	2220
551	Ga0207674_10213518	3300026116	Bacteria	1878
552	Ga0207674_10317004	3300026116	Bacteria	1508
553	Ga0207674_10788727	3300026116	Bacteria	917
554	Ga0207675_100340995	3300026118	Bacteria	1467
555	Ga0207675_100367975	3300026118	Bacteria	1411
556	Ga0207675_100659210	3300026118	Bacteria	1053
557	Ga0207683_10069976	3300026121	Bacteria	3099
558	Ga0207683_10149860	3300026121	Bacteria	2105
559	Ga0207698_10128635	3300026142	Bacteria	2160
560	Ga0207698_10833454	3300026142	Bacteria	926
561	Ga0209371_1000141	3300027312	Bacteria	118767
562	Ga0209371_1003202	3300027312	Bacteria	8247
563	Ga0209179_1011067	3300027512	Bacteria	1589
564	Ga0209983_1007221	3300027665	Bacteria	2278
565	Ga0209588_1007394	3300027671	Bacteria	3228
566	Ga0209971_1002033	3300027682	Bacteria	4918
567	Ga0209813_10144592	3300027866	Bacteria	847
568	Ga0209974_10001114	3300027876	Bacteria	9526
569	Ga0207428_10021207	3300027907	Bacteria	5503
570	Ga0207428_10026521	3300027907	Bacteria	4837
571	Ga0268266_10069228	3300028379	Bacteria	3057
572	Ga0268266_10078546	3300028379	Bacteria	2872
573	Ga0268266_10079585	3300028379	Bacteria	2854
574	Ga0268265_10115957	3300028380	Bacteria	2197
575	Ga0268265_10270496	3300028380	Bacteria	1515
576	Ga0268264_10020417	3300028381	Bacteria	5414
577	Ga0268264_10124342	3300028381	Bacteria	2277
578	Ga0265337_1012674	3300028556	Bacteria	2856
579	Ga0265318_10000066	3300028577	Bacteria	101380
580	Ga0265318_10000460	3300028577	Bacteria	30388
581	Ga0265318_10085159	3300028577	Bacteria	1165
582	Ga0265323_10014974	3300028653	Bacteria	3056
583	Ga0265323_10069988	3300028653	Bacteria	1201
584	Ga0265323_10094172	3300028653	Unclassified	997
585	Ga0265322_10034269	3300028654	Bacteria	1447
586	Ga0307515_10001873	3300028794	Bacteria	46808
587	Ga0307515_10010443	3300028794	Bacteria	17789
588	Ga0307515_10020861	3300028794	Bacteria	11649
589	Ga0265338_10003131	3300028800	Bacteria	23632
590	Ga0265338_10014668	3300028800	Bacteria	8688
591	Ga0265324_10000134	3300029957	Bacteria	58308
592	Ga0265324_10008346	3300029957	Bacteria	4120
593	Ga0268256_1000205	3300030500	Bacteria	67044
594	Ga0268256_1002888	3300030500	Bacteria	8247
595	Ga0307512_10095322	3300030522	Bacteria	2048
596	Ga0265330_10000221	3300031235	Bacteria	43507
597	Ga0265330_10000713	3300031235	Bacteria	21000
598	Ga0265330_10000949	3300031235	Bacteria	17886
599	Ga0265330_10001677	3300031235	Bacteria	12549
600	Ga0265330_10010021	3300031235	Bacteria	4484
601	Ga0265330_10119838	3300031235	Bacteria	1121
602	Ga0265332_10000177	3300031238	Bacteria	52614
603	Ga0265332_10003497	3300031238	Bacteria	7556
604	Ga0265332_10017861	3300031238	Bacteria	3128
605	Ga0265332_10033961	3300031238	Bacteria	2219
606	Ga0265328_10000273	3300031239	Bacteria	23951
607	Ga0265328_10003483	3300031239	Bacteria	6947
608	Ga0265328_10006586	3300031239	Bacteria	4895
609	Ga0265328_10065585	3300031239	Bacteria	1334
610	Ga0265320_10000060	3300031240	Bacteria	101623
611	Ga0265320_10003883	3300031240	Bacteria	9892
612	Ga0265320_10005658	3300031240	Bacteria	7980
613	Ga0265320_10008484	3300031240	Bacteria	6287
614	Ga0265320_10035342	3300031240	Bacteria	2534
615	Ga0265325_10007036	3300031241	Bacteria	6783
616	Ga0265325_10041411	3300031241	Bacteria	2414
617	Ga0265325_10088440	3300031241	Bacteria	1530
618	Ga0265329_10000004	3300031242	Bacteria	108465
619	Ga0265329_10001182	3300031242	Bacteria	12828
620	Ga0265329_10005020	3300031242	Bacteria	5405
621	Ga0265340_10000043	3300031247	Bacteria	57790
622	Ga0265340_10048960	3300031247	Bacteria	2054
623	Ga0265339_10000010	3300031249	Bacteria	214721
624	Ga0265339_10000982	3300031249	Bacteria	21848
625	Ga0265339_10005541	3300031249	Bacteria	8390
626	Ga0265339_10006031	3300031249	Bacteria	8010
627	Ga0265339_10013410	3300031249	Bacteria	4968
628	Ga0265331_10000124	3300031250	Bacteria	101315
629	Ga0265331_10003155	3300031250	Bacteria	10764
630	Ga0265331_10003933	3300031250	Bacteria	9388
631	Ga0265327_10000027	3300031251	Bacteria	364541
632	Ga0265316_10000046	3300031344	Bacteria	129393
633	Ga0265316_10001763	3300031344	Bacteria	22895
634	Ga0265316_10009372	3300031344	Bacteria	9016
635	Ga0265316_10014604	3300031344	Bacteria	6904
636	Ga0265316_10014941	3300031344	Bacteria	6809
637	Ga0265316_10018469	3300031344	Bacteria	5991
638	Ga0265316_10029799	3300031344	Bacteria	4482
639	Ga0265316_10055719	3300031344	Bacteria	3091
640	Ga0265316_10118095	3300031344	Unclassified	2004
641	Ga0265316_10269487	3300031344	Bacteria	1246
642	Ga0265316_10443151	3300031344	Unclassified	932
643	Ga0307513_10039995	3300031456	Bacteria	5190
644	Ga0307513_10152482	3300031456	Bacteria	2217
645	Ga0307513_10243994	3300031456	Bacteria	1598
646	Ga0307509_10023873	3300031507	Bacteria	6855
647	Ga0307408_100000005	3300031548	Bacteria	529098
648	Ga0307408_100000019	3300031548	Bacteria	344502
649	Ga0265313_10000104	3300031595	Bacteria	85002
650	Ga0265313_10000227	3300031595	Bacteria	60770
651	Ga0265313_10003430	3300031595	Bacteria	12830
652	Ga0265313_10007578	3300031595	Bacteria	7379
653	Ga0265313_10008438	3300031595	Bacteria	6841
654	Ga0265313_10011389	3300031595	Bacteria	5535
655	Ga0265313_10022527	3300031595	Bacteria	3414
656	Ga0265313_10026527	3300031595	Bacteria	3050
657	Ga0265313_10094113	3300031595	Bacteria	1339
658	Ga0307508_10000053	3300031616	Bacteria	128020
659	Ga0316575_10025801	3300031665	Bacteria	2281
660	Ga0316575_10026544	3300031665	Bacteria	2251
661	Ga0316575_10152295	3300031665	Bacteria	954
662	Ga0265314_10000008	3300031711	Bacteria	485166
663	Ga0265314_10000165	3300031711	Bacteria	101034
664	Ga0265314_10002294	3300031711	Bacteria	19784
665	Ga0265314_10002874	3300031711	Bacteria	17106
666	Ga0265314_10004332	3300031711	Bacteria	13234
667	Ga0265314_10046901	3300031711	Bacteria	3045
668	Ga0265314_10049587	3300031711	Bacteria	2938
669	Ga0265314_10052404	3300031711	Bacteria	2836
670	Ga0265314_10126530	3300031711	Bacteria	1599
671	Ga0265342_10000048	3300031712	Bacteria	126158
672	Ga0265342_10000171	3300031712	Bacteria	71706
673	Ga0265342_10000465	3300031712	Bacteria	43891
674	Ga0265342_10000520	3300031712	Bacteria	40945
675	Ga0265342_10001286	3300031712	Bacteria	23595
676	Ga0265342_10006466	3300031712	Bacteria	8725
677	Ga0265342_10036144	3300031712	Bacteria	3019
678	Ga0265342_10055814	3300031712	Bacteria	2343
679	Ga0265342_10074140	3300031712	Bacteria	1978
680	Ga0316576_10087596	3300031727	Bacteria	2317
681	Ga0316576_10119682	3300031727	Bacteria	1976
682	Ga0316578_10030993	3300031728	Bacteria	3044
683	Ga0316578_10179638	3300031728	Bacteria	1275
684	Ga0307516_10005097	3300031730	Bacteria	15875
685	Ga0307405_10513353	3300031731	Bacteria	963
686	Ga0307413_10087243	3300031824	Bacteria	2020
687	Ga0307406_10000030	3300031901	Bacteria	87564
688	Ga0307412_10000056	3300031911	Bacteria	145861
689	Ga0307412_10042058	3300031911	Bacteria	2966
690	Ga0307412_10095110	3300031911	Bacteria	2094
691	Ga0307414_10070567	3300032004	Bacteria	2516
692	Ga0307411_10355928	3300032005	Bacteria	1195
693	Ga0307415_100496728	3300032126	Bacteria	1066
694	Ga0316583_10010602	3300032133	Bacteria	3324
695	Ga0316585_10006317	3300032137	Bacteria	3384
696	Ga0316593_10004055	3300032168	Bacteria	3712
697	Ga0307507_10088285	3300033179	Bacteria	2675
698	Ga0307510_10025504	3300033180	Bacteria	6815
699	Ga0307510_10320578	3300033180	Bacteria	1007
700	Ga0373950_0000009	3300034818	Bacteria	379994
701	Ga0373950_0000027	3300034818	Bacteria	172704
702	Ga0373934_0039874	3300035086	Bacteria	1852
703	Ga0373934_0080280	3300035086	Bacteria	1310
704	Ga0373944_0003204	3300035089	Bacteria	4205
705	Ga0373944_0003597	3300035089	Bacteria	4005
706	Ga0373944_0011316	3300035089	Bacteria	2443
707	Ga0373951_0068437	3300035091	Bacteria	901
708	Ga0373936_0017884	3300035113	Bacteria	2733
709	Ga0373936_0034498	3300035113	Bacteria	2010
710	Ga0373945_0008499	3300035116	Bacteria	3346
711	Ga0373945_0014169	3300035116	Bacteria	2667
712	Ga0373945_0114616	3300035116	Bacteria	1066
713	Ga0373953_0004396	3300035117	Bacteria	4492
714	Ga0373953_0101754	3300035117	Bacteria	1210
715	Ga0373953_0118001	3300035117	Bacteria	1126
716	Ga0373954_0004893	3300035118	Bacteria	5780
717	Ga0373954_0030168	3300035118	Bacteria	2500
718	Ga0373956_0019878	3300035119	Bacteria	2852
719	Ga0373956_0051238	3300035119	Bacteria	1855
720	Ga0373957_0034962	3300035120	Bacteria	1864
721	Ga0373957_0108939	3300035120	Bacteria	1114
722	Ga0373943_0001682	3300035170	Bacteria	10041
723	Ga0373943_0003799	3300035170	Bacteria	6857
724	Ga0373943_0003862	3300035170	Bacteria	6813
725	Ga0373943_0117031	3300035170	Bacteria	1412
726	Ga0373943_0122348	3300035170	Bacteria	1384
727	Ga0373946_0002630	3300035171	Bacteria	6347
728	Ga0373946_0005184	3300035171	Bacteria	4697
729	Ga0373946_0005647	3300035171	Bacteria	4519
730	Ga0373946_0086275	3300035171	Bacteria	1383
731	Ga0373955_0005503	3300035172	Bacteria	5696
732	Ga0373955_0026549	3300035172	Bacteria	2984
733	Ga0373955_0061554	3300035172	Bacteria	2073
734	Ga0373955_0090811	3300035172	Bacteria	1740
735	Ga0373955_0112963	3300035172	Bacteria	1572
736	Ga0316574_0091960	3300035398	Bacteria	1935
737	Ga0373924_0017160	3300035410	Bacteria	2773
738	Ga0373931_0180127	3300035691	Bacteria	1251
739	Ga0373935_0018390	3300035692	Bacteria	4250
740	Ga0373935_0036770	3300035692	Bacteria	3063
741	Ga0373935_0067268	3300035692	Bacteria	2303
742	Ga0373927_0001909	3300035695	Bacteria	15400
743	Ga0373927_0020354	3300035695	Bacteria	4351
744	Ga0373927_0032514	3300035695	Bacteria	3397
745	Ga0373927_0139475	3300035695	Bacteria	1585
746	Ga0373927_0213872	3300035695	Bacteria	1266
747	Ga0373933_0000595	3300035724	Bacteria	22662
748	Ga0373933_0005874	3300035724	Bacteria	6673
749	Ga0373933_0012986	3300035724	Bacteria	4608
750	Ga0373933_0042623	3300035724	Bacteria	2683
751	Ga0373933_0072407	3300035724	Bacteria	2099
752	Ga0373933_0175115	3300035724	Bacteria	1366
753	Ga0373933_0359263	3300035724	Bacteria	947
754	Ga0373947_0000076	3300035725	Bacteria	49938
755	Ga0373947_0016858	3300035725	Bacteria	4196
756	Ga0373947_0203418	3300035725	Bacteria	1296
757	Ga0373947_0206908	3300035725	Bacteria	1286
758	Ga0373947_0312101	3300035725	Bacteria	1050
759	Ga0373937_0001254	3300036401	Bacteria	21310
760	Ga0373937_0002237	3300036401	Bacteria	16169
761	Ga0373937_0021827	3300036401	Bacteria	5747
762	Ga0373937_0033718	3300036401	Bacteria	4652
763	Ga0373937_0117510	3300036401	Bacteria	2477
764	Ga0373937_0184345	3300036401	Bacteria	1960
765	Ga0373937_0335433	3300036401	Bacteria	1432
766	Ga0373937_0368203	3300036401	Bacteria	1362
767	Ga0373937_0675206	3300036401	Bacteria	979
768	Ga0316582_0026501	3300036647	Bacteria	3490
769	Ga0316584_0011567	3300036712	Bacteria	6204
770	Ga0373925_0001700	3300037068	Bacteria	18531
771	Ga0373925_0053765	3300037068	Bacteria	3011
772	Ga0373925_0060417	3300037068	Bacteria	2846
773	Ga0373925_0097434	3300037068	Bacteria	2255
774	Ga0373925_0098718	3300037068	Bacteria	2242
775	Ga0373925_0147634	3300037068	Bacteria	1844
776	Ga0373925_0276252	3300037068	Bacteria	1352
777	Ga0373925_0279829	3300037068	Bacteria	1343
778	Ga0395899_0000025	3300037312	Bacteria	350927
779	Ga0395899_0000080	3300037312	Bacteria	171568
780	Ga0395899_0034281	3300037312	Bacteria	3811
781	Ga0395899_0251776	3300037312	Bacteria	1212
782	Ga0395900_0000087	3300037418	Bacteria	171568
783	Ga0395900_0011661	3300037418	Bacteria	8991
784	Ga0395900_0027951	3300037418	Bacteria	5777
785	Ga0395900_0028750	3300037418	Bacteria	5699
786	Ga0395900_0242617	3300037418	Bacteria	1807
787	Ga0395900_0370595	3300037418	Bacteria	1402
788	Ga0395898_0000448	3300037466	Bacteria	84953
789	Ga0395898_0003576	3300037466	Bacteria	17324
790	Ga0395898_0079730	3300037466	Bacteria	3158
791	Ga0395905_0000166	3300037471	Bacteria	108507
792	Ga0395905_0006640	3300037471	Bacteria	11600
793	Ga0395905_0082903	3300037471	Bacteria	3004
794	Ga0395905_0213367	3300037471	Bacteria	1808
795	Ga0395905_0344608	3300037471	Bacteria	1381
796	Ga0436364_0001427	3300037853	Bacteria	2021
797	Ga0436364_1187922	3300037853	Bacteria	5613
798	Ga0395901_0000053	3300038443	Bacteria	163807
799	Ga0395901_0000924	3300038443	Bacteria	31960
800	Ga0395901_0009275	3300038443	Bacteria	9977
801	Ga0395901_0131413	3300038443	Bacteria	2631
802	Ga0436365_0299452	3300039437	Bacteria	2840
803	Ga0436365_0345262	3300039437	Bacteria	1241
804	Ga0436365_0653371	3300039437	Bacteria	4259
805	Ga0436365_1094339	3300039437	Bacteria	1531
806	Ga0436365_1601665	3300039437	Bacteria	1746
807	Ga0436360_0606587	3300039438	Bacteria	1830
808	Ga0436360_0694350	3300039438	Bacteria	2338
809	Ga0436361_0094671	3300039447	Bacteria	4600
810	Ga0436361_0161349	3300039447	Bacteria	1188
811	Ga0436361_0704696	3300039447	Bacteria	13555
812	Ga0436361_0912154	3300039447	Bacteria	4178
813	Ga0436363_1483284	3300039450	Bacteria	1210
814	Ga0436363_1591489	3300039450	Bacteria	3842
815	Ga0436362_0474698	3300039453	Bacteria	1181
816	Ga0439436_0000248	3300041404	Bacteria	13012
817	Ga0439438_001451	3300041405	Bacteria	10450
818	Ga0439438_010213	3300041405	Bacteria	2982
819	Ga0439466_0008880	3300041411	Bacteria	3780
820	Ga0439431_0012148	3300041997	Bacteria	1976
821	Ga0439431_0046292	3300041997	Bacteria	1119
822	Ga0439437_000185	3300042000	Bacteria	5359
823	Ga0439441_024973	3300042001	Bacteria	1126
824	Ga0439448_0005884	3300042005	Bacteria	3506
825	Ga0439452_001217	3300042010	Bacteria	11003
826	Ga0439463_000906	3300042016	Bacteria	8134
827	Ga0450911_000003	3300042115	Bacteria	237055
828	Ga0450904_000746	3300042139	Bacteria	5617
829	Ga0439446_0007456	3300042156	Bacteria	2877
830	Ga0439435_0048506	3300042436	Bacteria	1209
831	Ga0450916_002100	3300042530	Bacteria	2073
832	Ga0451577_0001015	3300042876	Bacteria	40836
833	Ga0451577_0003091	3300042876	Bacteria	18789
834	Ga0451577_0339237	3300042876	Bacteria	1363
835	Ga0451577_0355078	3300042876	Bacteria	1330
836	Ga0466969_0002952	3300044656	Bacteria	9080
837	Ga0466972_0011154	3300044658	Bacteria	4510
838	Ga0453683_0069890	3300044673	Bacteria	2196
839	Ga0466965_0004436	3300044683	Bacteria	6242
840	Ga0466965_0007844	3300044683	Bacteria	4921
841	Ga0466965_0155241	3300044683	Bacteria	1198
842	Ga0466966_0000070	3300044684	Bacteria	67510
843	Ga0466966_0000237	3300044684	Bacteria	36471
844	Ga0466966_0013362	3300044684	Bacteria	5435
845	Ga0466961_0000382	3300044693	Bacteria	28543
846	Ga0466961_0000919	3300044693	Bacteria	18224
847	Ga0466961_0013337	3300044693	Bacteria	5261
848	Ga0466961_0260480	3300044693	Bacteria	1063
849	Ga0466961_0356678	3300044693	Bacteria	890
850	Ga0466963_0006323	3300044694	Bacteria	7003
851	Ga0466963_0041349	3300044694	Bacteria	3023
852	Ga0466963_0130738	3300044694	Bacteria	1734
853	Ga0466963_0171357	3300044694	Bacteria	1513
854	Ga0466964_0000768	3300044706	Bacteria	10433
855	Ga0466964_0090707	3300044706	Bacteria	1329
856	Ga0466964_0157361	3300044706	Bacteria	1059
857	Ga0453684_0000009	3300044712	Bacteria	1139914
858	Ga0453684_0016566	3300044712	Bacteria	11508
859	Ga0453684_0067401	3300044712	Bacteria	4551
860	Ga0453684_0105566	3300044712	Bacteria	3435
861	Ga0453684_0122058	3300044712	Bacteria	3144
862	Ga0453684_0134345	3300044712	Bacteria	2964
863	Ga0453684_0388020	3300044712	Bacteria	1567
864	Ga0466971_0015917	3300044719	Bacteria	3314
865	Ga0466971_0021297	3300044719	Bacteria	2885
866	Ga0466971_0063188	3300044719	Bacteria	1676
867	Ga0466957_0024690	3300044842	Bacteria	3559
868	Ga0466957_0146104	3300044842	Bacteria	1526
869	Ga0466957_0207443	3300044842	Bacteria	1289
870	Ga0466960_0234496	3300044901	Bacteria	1014
871	Ga0466959_0004089	3300045049	Bacteria	9711
872	Ga0466959_0099539	3300045049	Bacteria	2081
873	Ga0466959_0119380	3300045049	Bacteria	1876
874	Ga0451576_0117052	3300045051	Bacteria	2774
875	Ga0451576_0207630	3300045051	Bacteria	2045
876	Ga0451576_0218916	3300045051	Bacteria	1988
877	Ga0451576_0292685	3300045051	Unclassified	1702
878	Ga0466958_0001258	3300045836	Bacteria	11879
879	Ga0466958_0003330	3300045836	Bacteria	8322
880	Ga0466958_0003740	3300045836	Bacteria	7947
881	Ga0466958_0103154	3300045836	Bacteria	1775
882	Ga0495617_032756	3300046452	Bacteria	1745
883	Ga0495617_069003	3300046452	Bacteria	1163
884	Ga0495627_000102	3300046453	Bacteria	104889
885	Ga0495627_000192	3300046453	Bacteria	67494
886	Ga0495627_003255	3300046453	Bacteria	7285
887	Ga0495592_0025939	3300046454	Bacteria	4447
888	Ga0495592_0266375	3300046454	Bacteria	1126
889	Ga0495603_0003797	3300046455	Bacteria	8993
890	Ga0495603_0032675	3300046455	Bacteria	3130
891	Ga0495603_0041103	3300046455	Bacteria	2765
892	Ga0495603_0077747	3300046455	Bacteria	1946
893	Ga0495603_0157397	3300046455	Bacteria	1318
894	Ga0495590_0000811	3300046457	Bacteria	14198
895	Ga0495590_0004725	3300046457	Bacteria	5463
896	Ga0495591_000105	3300046458	Bacteria	97199
897	Ga0495591_000563	3300046458	Bacteria	28482
898	Ga0495591_029119	3300046458	Bacteria	1681
899	Ga0495591_048747	3300046458	Bacteria	1166
900	Ga0495629_0000162	3300046459	Bacteria	58860
901	Ga0495629_0000590	3300046459	Bacteria	29493
902	Ga0495629_0011251	3300046459	Bacteria	6499
903	Ga0495629_0023475	3300046459	Bacteria	4394
904	Ga0495629_0064524	3300046459	Bacteria	2557
905	Ga0495629_0179718	3300046459	Bacteria	1467
906	Ga0495629_0227933	3300046459	Bacteria	1284
907	Ga0495638_0004511	3300046460	Bacteria	10547
908	Ga0495638_0095900	3300046460	Bacteria	1781
909	Ga0495638_0193154	3300046460	Bacteria	1154
910	Ga0495641_0029465	3300046461	Bacteria	2644
911	Ga0495641_0075948	3300046461	Bacteria	1506
912	Ga0495641_0084540	3300046461	Bacteria	1421
913	Ga0495651_0018953	3300046462	Bacteria	5330
914	Ga0495651_0022047	3300046462	Bacteria	4953
915	Ga0495651_0392719	3300046462	Bacteria	907
916	Ga0495653_0008754	3300046463	Bacteria	8287
917	Ga0495653_0019819	3300046463	Bacteria	5452
918	Ga0495653_0048078	3300046463	Bacteria	3295
919	Ga0495653_0068884	3300046463	Bacteria	2652
920	Ga0495653_0107121	3300046463	Bacteria	2014
921	Ga0495653_0266859	3300046463	Bacteria	1129
922	Ga0495653_0334268	3300046463	Bacteria	978
923	Ga0495650_0000578	3300046471	Bacteria	51315
924	Ga0495650_0004932	3300046471	Bacteria	8912
925	Ga0495650_0008617	3300046471	Bacteria	5915
926	Ga0495650_0009882	3300046471	Bacteria	5380
927	Ga0495580_0000302	3300046472	Bacteria	40112
928	Ga0495580_0017511	3300046472	Bacteria	5356
929	Ga0495580_0020781	3300046472	Bacteria	4852
930	Ga0495580_0053538	3300046472	Bacteria	2847
931	Ga0495580_0159836	3300046472	Bacteria	1559
932	Ga0495580_0180076	3300046472	Bacteria	1459
933	Ga0495580_0190539	3300046472	Bacteria	1414
934	Ga0495580_0217047	3300046472	Bacteria	1315
935	Ga0495582_0016136	3300046473	Bacteria	4093
936	Ga0495582_0019516	3300046473	Bacteria	3707
937	Ga0495582_0021979	3300046473	Bacteria	3490
938	Ga0495582_0042487	3300046473	Bacteria	2503
939	Ga0495605_0000019	3300046474	Bacteria	270010
940	Ga0495605_0000620	3300046474	Bacteria	27429
941	Ga0495605_0000714	3300046474	Bacteria	24495
942	Ga0495605_0002635	3300046474	Bacteria	11010
943	Ga0495605_0002760	3300046474	Bacteria	10716
944	Ga0495605_0005245	3300046474	Bacteria	7563
945	Ga0495605_0015811	3300046474	Bacteria	4098
946	Ga0495605_0124585	3300046474	Bacteria	1166
947	Ga0495639_0009880	3300046475	Bacteria	4097
948	Ga0495639_0063030	3300046475	Bacteria	1701
949	Ga0495639_0198471	3300046475	Bacteria	981
950	Ga0495662_0004393	3300046476	Bacteria	7081
951	Ga0495662_0009283	3300046476	Bacteria	4825
952	Ga0495662_0023573	3300046476	Bacteria	2971
953	Ga0495662_0252500	3300046476	Bacteria	868
954	Ga0495664_0000368	3300046477	Bacteria	21935
955	Ga0495664_0003278	3300046477	Bacteria	8798
956	Ga0495664_0003946	3300046477	Bacteria	8095
957	Ga0495664_0018698	3300046477	Bacteria	3975
958	Ga0495664_0075808	3300046477	Bacteria	2012
959	Ga0495664_0163358	3300046477	Bacteria	1351
960	Ga0495664_0247820	3300046477	Bacteria	1077
961	Ga0495584_0011090	3300046491	Bacteria	4622
962	Ga0495584_0017720	3300046491	Bacteria	3623
963	Ga0495584_0084026	3300046491	Bacteria	1603
964	Ga0495585_0010183	3300046492	Bacteria	5613
965	Ga0495585_0025360	3300046492	Bacteria	3397
966	Ga0495594_0003233	3300046499	Bacteria	8442
967	Ga0495594_0014492	3300046499	Bacteria	4132
968	Ga0495596_0002359	3300046500	Bacteria	10215
969	Ga0495596_0004685	3300046500	Bacteria	6618
970	Ga0495596_0079811	3300046500	Bacteria	1270
971	Ga0495607_0000173	3300046501	Bacteria	68694
972	Ga0495607_0001049	3300046501	Bacteria	25238
973	Ga0495607_0001370	3300046501	Bacteria	21666
974	Ga0495607_0003053	3300046501	Bacteria	13031
975	Ga0495607_0004095	3300046501	Bacteria	10894
976	Ga0495607_0034758	3300046501	Bacteria	3055
977	Ga0495607_0047788	3300046501	Bacteria	2504
978	Ga0495583_0000146	3300046506	Bacteria	119793
979	Ga0495583_0003951	3300046506	Bacteria	10951
980	Ga0495583_0004397	3300046506	Bacteria	10113
981	Ga0495583_0008614	3300046506	Bacteria	6208
982	Ga0495583_0009324	3300046506	Bacteria	5874
983	Ga0495583_0009485	3300046506	Bacteria	5806
984	Ga0495583_0012139	3300046506	Bacteria	4899
985	Ga0495606_0000083	3300046507	Bacteria	159263
986	Ga0495606_0001016	3300046507	Bacteria	40685
987	Ga0495606_0001114	3300046507	Bacteria	38407
988	Ga0495606_0011642	3300046507	Bacteria	7147
989	Ga0495606_0025241	3300046507	Bacteria	4260
990	Ga0495606_0031076	3300046507	Bacteria	3718
991	Ga0495608_0005734	3300046511	Bacteria	8861
992	Ga0495610_0002177	3300046512	Bacteria	16638
993	Ga0495610_0002536	3300046512	Bacteria	15230
994	Ga0495610_0025793	3300046512	Bacteria	3148
995	Ga0495610_0173122	3300046512	Bacteria	903
996	Ga0495618_0002173	3300046514	Bacteria	12828
997	Ga0495618_0004385	3300046514	Bacteria	8678
998	Ga0495618_0032319	3300046514	Bacteria	3277
999	Ga0495618_0041962	3300046514	Bacteria	2882
1000	Ga0495618_0051105	3300046514	Bacteria	2612
1001	Ga0495620_0000311	3300046515	Bacteria	34734
1002	Ga0495620_0006655	3300046515	Bacteria	6332
1003	Ga0495620_0034135	3300046515	Bacteria	2302
1004	Ga0495628_0002322	3300046516	Bacteria	17200
1005	Ga0495628_0011538	3300046516	Bacteria	7471
1006	Ga0495628_0011640	3300046516	Bacteria	7434
1007	Ga0495628_0089758	3300046516	Bacteria	2379
1008	Ga0495628_0183538	3300046516	Bacteria	1581
1009	Ga0495628_0248316	3300046516	Bacteria	1329
1010	Ga0495630_0004921	3300046517	Bacteria	9389
1011	Ga0495630_0019641	3300046517	Bacteria	4969
1012	Ga0495630_0028264	3300046517	Bacteria	4167
1013	Ga0495630_0042860	3300046517	Bacteria	3379
1014	Ga0495630_0086304	3300046517	Bacteria	2370
1015	Ga0495630_0119584	3300046517	Bacteria	1998
1016	Ga0495630_0149167	3300046517	Bacteria	1779
1017	Ga0495630_0501666	3300046517	Bacteria	930
1018	Ga0495631_0002354	3300046518	Bacteria	10750
1019	Ga0495631_0003218	3300046518	Bacteria	8996
1020	Ga0495632_0072815	3300046519	Bacteria	1648
1021	Ga0495637_0002217	3300046520	Bacteria	10851
1022	Ga0495637_0002388	3300046520	Bacteria	10395
1023	Ga0495637_0030057	3300046520	Bacteria	2412
1024	Ga0495643_0001534	3300046522	Bacteria	20737
1025	Ga0495643_0002216	3300046522	Bacteria	15800
1026	Ga0495643_0004880	3300046522	Bacteria	9237
1027	Ga0495643_0040147	3300046522	Bacteria	2556
1028	Ga0495644_0000563	3300046523	Bacteria	15597
1029	Ga0495648_0007724	3300046524	Bacteria	8565
1030	Ga0495648_0011548	3300046524	Bacteria	6643
1031	Ga0495648_0024339	3300046524	Bacteria	4125
1032	Ga0495648_0044955	3300046524	Bacteria	2751
1033	Ga0495648_0063307	3300046524	Bacteria	2184
1034	Ga0495666_0000199	3300046526	Bacteria	25643
1035	Ga0495666_0030492	3300046526	Bacteria	2646
1036	Ga0495642_0087232	3300046528	Bacteria	1319
1037	Ga0495642_0098883	3300046528	Bacteria	1240
1038	Ga0495642_0101026	3300046528	Bacteria	1227
1039	Ga0495642_0113054	3300046528	Bacteria	1162
1040	Ga0495652_0024449	3300046529	Bacteria	5346
1041	Ga0495652_0030018	3300046529	Bacteria	4770
1042	Ga0495652_0037097	3300046529	Bacteria	4231
1043	Ga0495652_0088897	3300046529	Bacteria	2531
1044	Ga0495652_0120322	3300046529	Bacteria	2096
1045	Ga0495652_0149091	3300046529	Bacteria	1829
1046	Ga0495652_0164502	3300046529	Bacteria	1718
1047	Ga0495654_0001519	3300046530	Bacteria	15829
1048	Ga0495654_0008371	3300046530	Bacteria	5717
1049	Ga0495654_0008437	3300046530	Bacteria	5692
1050	Ga0495665_0004130	3300046531	Bacteria	7829
1051	Ga0495665_0006502	3300046531	Bacteria	6312
1052	Ga0495665_0026932	3300046531	Bacteria	3086
1053	Ga0495665_0031947	3300046531	Bacteria	2816
1054	Ga0495665_0039911	3300046531	Bacteria	2500
1055	Ga0495665_0160542	3300046531	Bacteria	1172
1056	Ga0495640_0002756	3300046533	Bacteria	14127
1057	Ga0495640_0004166	3300046533	Bacteria	11565
1058	Ga0495640_0037530	3300046533	Bacteria	3417
1059	Ga0495640_0065580	3300046533	Bacteria	2451
1060	Ga0495640_0129596	3300046533	Bacteria	1633
1061	Ga0495586_0000571	3300046535	Bacteria	21399
1062	Ga0495586_0016484	3300046535	Bacteria	3930
1063	Ga0495586_0018700	3300046535	Bacteria	3688
1064	Ga0495587_0006284	3300046536	Bacteria	7754
1065	Ga0495587_0007690	3300046536	Bacteria	6972
1066	Ga0495587_0026521	3300046536	Bacteria	3533
1067	Ga0495598_0001551	3300046537	Bacteria	4600
1068	Ga0495609_0000023	3300046538	Bacteria	269702
1069	Ga0495609_0000101	3300046538	Bacteria	100818
1070	Ga0495609_0000773	3300046538	Bacteria	23957
1071	Ga0495609_0164626	3300046538	Bacteria	938
1072	Ga0495597_0000139	3300046542	Bacteria	65492
1073	Ga0495597_0005726	3300046542	Bacteria	6528
1074	Ga0495597_0060552	3300046542	Bacteria	1651
1075	Ga0495645_0001460	3300046543	Bacteria	15984
1076	Ga0495645_0002870	3300046543	Bacteria	11701
1077	Ga0495645_0007542	3300046543	Bacteria	7567
1078	Ga0495645_0046069	3300046543	Bacteria	3179
1079	Ga0495645_0069879	3300046543	Bacteria	2534
1080	Ga0495622_0001598	3300046557	Bacteria	11193
1081	Ga0495633_0000129	3300046558	Bacteria	100833
1082	Ga0495633_0006536	3300046558	Bacteria	6889
1083	Ga0495667_0051382	3300046559	Bacteria	2719
1084	Ga0495656_0000123	3300046615	Bacteria	29630
1085	Ga0495668_0026762	3300046616	Bacteria	3271
1086	Ga0495668_0245411	3300046616	Bacteria	980
1087	Ga0495634_0004264	3300046642	Bacteria	11270
1088	Ga0495634_0015968	3300046642	Bacteria	5378
1089	Ga0495634_0038681	3300046642	Bacteria	3251
1090	Ga0495634_0050291	3300046642	Bacteria	2799
1091	Ga0495634_0112819	3300046642	Bacteria	1746
1092	Ga0495611_0004020	3300046648	Bacteria	6404
1093	Ga0495611_0009781	3300046648	Bacteria	4054
1094	Ga0495611_0032270	3300046648	Bacteria	2307
1095	Ga0495625_0000187	3300046660	Bacteria	97797
1096	Ga0495625_0001672	3300046660	Bacteria	25960
1097	Ga0495635_0004608	3300046663	Bacteria	9563
1098	Ga0495635_0006555	3300046663	Bacteria	8123
1099	Ga0495635_0006792	3300046663	Bacteria	7999
1100	Ga0495635_0119946	3300046663	Bacteria	1794
1101	Ga0495635_0167774	3300046663	Bacteria	1493
1102	Ga0495635_0169459	3300046663	Bacteria	1485
1103	Ga0495659_0000384	3300046664	Bacteria	17032
1104	Ga0495661_0000758	3300046665	Bacteria	31237
1105	Ga0495661_0000760	3300046665	Bacteria	31156
1106	Ga0495661_0005349	3300046665	Bacteria	9128
1107	Ga0495661_0005985	3300046665	Bacteria	8586
1108	Ga0495661_0006686	3300046665	Bacteria	8094
1109	Ga0495661_0046850	3300046665	Bacteria	2637
1110	Ga0495588_0036385	3300046674	Bacteria	2497
1111	Ga0495588_0154148	3300046674	Bacteria	1214
1112	Ga0495588_0224006	3300046674	Bacteria	992
1113	Ga0495588_0259206	3300046674	Bacteria	916
1114	Ga0495599_0009062	3300046678	Bacteria	6064
1115	Ga0495599_0402882	3300046678	Bacteria	815
1116	Ga0495623_0008745	3300046679	Bacteria	6574
1117	Ga0495623_0011620	3300046679	Bacteria	5703
1118	Ga0495623_0024404	3300046679	Bacteria	3896
1119	Ga0495623_0100027	3300046679	Bacteria	1768
1120	Ga0495623_0169278	3300046679	Bacteria	1277
1121	Ga0495646_0002147	3300046680	Bacteria	11979
1122	Ga0495646_0007283	3300046680	Bacteria	7026
1123	Ga0495646_0015048	3300046680	Bacteria	4914
1124	Ga0495646_0028558	3300046680	Bacteria	3491
1125	Ga0495646_0071872	3300046680	Bacteria	2035
1126	Ga0495646_0084387	3300046680	Bacteria	1844
1127	Ga0495646_0146645	3300046680	Bacteria	1315
1128	Ga0495647_0005854	3300046681	Bacteria	4046
1129	Ga0495658_0023495	3300046683	Bacteria	3272
1130	Ga0495658_0048760	3300046683	Bacteria	2390
1131	Ga0495669_0037876	3300046684	Bacteria	2135
1132	Ga0495669_0089342	3300046684	Bacteria	1421
1133	Ga0495613_0002201	3300046689	Bacteria	14753
1134	Ga0495613_0005270	3300046689	Bacteria	9710
1135	Ga0495613_0027432	3300046689	Bacteria	4237
1136	Ga0495613_0164055	3300046689	Bacteria	1579
1137	Ga0495624_0005977	3300046690	Bacteria	8690
1138	Ga0495624_0011101	3300046690	Bacteria	6198
1139	Ga0495624_0013135	3300046690	Bacteria	5647
1140	Ga0495624_0013148	3300046690	Bacteria	5645
1141	Ga0495624_0021591	3300046690	Bacteria	4267
1142	Ga0495624_0023975	3300046690	Bacteria	4019
1143	Ga0495624_0047820	3300046690	Bacteria	2717
1144	Ga0495624_0059865	3300046690	Bacteria	2388
1145	Ga0495624_0082914	3300046690	Bacteria	1983
1146	Ga0495670_0000220	3300046691	Bacteria	25973
1147	Ga0495670_0039768	3300046691	Bacteria	2345
1148	Ga0495670_0072318	3300046691	Bacteria	1746
1149	Ga0495671_0012954	3300046692	Bacteria	4537
1150	Ga0495671_0021416	3300046692	Bacteria	3396
1151	Ga0495649_0001623	3300046694	Bacteria	16726
1152	Ga0495649_0009004	3300046694	Bacteria	5961
1153	Ga0495649_0018484	3300046694	Bacteria	3921
1154	Ga0495649_0029959	3300046694	Bacteria	3006
1155	Ga0495649_0032033	3300046694	Bacteria	2898
1156	Ga0495649_0032059	3300046694	Bacteria	2897
1157	Ga0495649_0071082	3300046694	Bacteria	1865
1158	Ga0495589_0006374	3300046794	Bacteria	6234
1159	Ga0495589_0063290	3300046794	Bacteria	1815
1160	Ga0495589_0121709	3300046794	Bacteria	1256
1161	Ga0495589_0133425	3300046794	Bacteria	1191
1162	Ga0495600_0012417	3300046809	Bacteria	5326
1163	Ga0495600_0020782	3300046809	Bacteria	4200
1164	Ga0495600_0027359	3300046809	Bacteria	3684
1165	Ga0495660_0009479	3300046810	Bacteria	5677
1166	Ga0495660_0032968	3300046810	Bacteria	2907
1167	Ga0495660_0043756	3300046810	Bacteria	2467
1168	Ga0495660_0047205	3300046810	Bacteria	2359
1169	Ga0495581_0000213	3300047315	Bacteria	27408
1170	Ga0495581_0004435	3300047315	Bacteria	8111
1171	Ga0495581_0007273	3300047315	Bacteria	6404
1172	Ga0495581_0038053	3300047315	Bacteria	2783
1173	Ga0495604_0009492	3300047317	Bacteria	7690
1174	Ga0495604_0010125	3300047317	Bacteria	7468
1175	Ga0495604_0046297	3300047317	Bacteria	3391
1176	Ga0495604_0179595	3300047317	Bacteria	1481
1177	Ga0495604_0406238	3300047317	Bacteria	896
1178	Ga0495674_0005870	3300047319	Bacteria	11780
1179	Ga0495674_0008178	3300047319	Bacteria	9978
1180	Ga0495674_0045155	3300047319	Bacteria	3912
1181	Ga0495674_0061701	3300047319	Bacteria	3266
1182	Ga0495674_0069863	3300047319	Bacteria	3036
1183	Ga0495674_0077262	3300047319	Bacteria	2862
1184	Ga0495674_0080226	3300047319	Bacteria	2800
1185	Ga0495674_0098583	3300047319	Bacteria	2488
1186	Ga0495674_0111023	3300047319	Bacteria	2324
1187	Ga0495674_0137310	3300047319	Bacteria	2056
1188	Ga0495674_0175389	3300047319	Bacteria	1787
1189	Ga0495672_0001885	3300047320	Bacteria	19961
1190	Ga0495672_0015722	3300047320	Bacteria	5127
1191	Ga0495672_0076570	3300047320	Bacteria	1878
1192	Ga0495672_0115265	3300047320	Bacteria	1436
1193	Ga0495676_0000011	3300047321	Bacteria	242612
1194	Ga0495676_0010144	3300047321	Bacteria	8553
1195	Ga0495676_0070585	3300047321	Bacteria	2689
1196	Ga0495676_0080480	3300047321	Bacteria	2473
1197	Ga0495676_0081674	3300047321	Bacteria	2449
1198	Ga0495676_0240270	3300047321	Bacteria	1240
1199	Ga0495680_0006145	3300047322	Bacteria	11209
1200	Ga0495680_0023334	3300047322	Bacteria	5146
1201	Ga0495680_0030003	3300047322	Bacteria	4445
1202	Ga0495680_0047162	3300047322	Bacteria	3391
1203	Ga0495680_0220222	3300047322	Bacteria	1355
1204	Ga0495683_0000075	3300047323	Bacteria	100715
1205	Ga0495683_0001275	3300047323	Bacteria	17066
1206	Ga0495683_0012219	3300047323	Bacteria	4513
1207	Ga0495683_0092360	3300047323	Bacteria	1464
1208	Ga0495687_000216	3300047443	Bacteria	81734
1209	Ga0495687_003465	3300047443	Bacteria	11403
1210	Ga0495687_012354	3300047443	Bacteria	4520
1211	Ga0495687_013318	3300047443	Bacteria	4303
1212	Ga0495675_0027553	3300047444	Bacteria	3620
1213	Ga0495675_0153662	3300047444	Bacteria	1420
1214	Ga0495679_000742	3300047446	Bacteria	20949
1215	Ga0495679_002129	3300047446	Bacteria	10417
1216	Ga0495679_004723	3300047446	Bacteria	6187
1217	Ga0495679_016801	3300047446	Bacteria	2637
1218	Ga0495679_021103	3300047446	Bacteria	2256
1219	Ga0495685_060275	3300047447	Bacteria	1280
1220	Ga0495673_0000222	3300047469	Bacteria	84272
1221	Ga0495673_0003752	3300047469	Bacteria	9862
1222	Ga0495673_0004563	3300047469	Bacteria	8643
1223	Ga0495673_0006893	3300047469	Bacteria	6621
1224	Ga0495673_0008865	3300047469	Bacteria	5610
1225	Ga0495673_0012689	3300047469	Bacteria	4452
1226	Ga0495673_0016808	3300047469	Bacteria	3730
1227	Ga0495673_0126745	3300047469	Bacteria	1006
1228	Ga0495681_0013105	3300047470	Bacteria	4834
1229	Ga0495681_0024139	3300047470	Bacteria	3212
1230	Ga0495684_0001940	3300047471	Bacteria	16582
1231	Ga0495684_0002684	3300047471	Bacteria	14089
1232	Ga0495684_0005580	3300047471	Bacteria	9799
1233	Ga0495684_0033516	3300047471	Bacteria	3939
1234	Ga0495686_0000214	3300047472	Bacteria	106493
1235	Ga0495593_0003130	3300047673	Bacteria	9940
1236	Ga0495593_0008505	3300047673	Bacteria	5967
1237	Ga0495593_0014728	3300047673	Bacteria	4444
1238	Ga0495593_0018733	3300047673	Bacteria	3887
1239	Ga0495593_0018744	3300047673	Bacteria	3886
1240	Ga0495593_0024505	3300047673	Bacteria	3343
1241	Ga0495602_0015069	3300048088	Bacteria	7818
1242	Ga0495602_0015119	3300048088	Bacteria	7802
1243	Ga0495602_0024836	3300048088	Bacteria	5809
1244	Ga0495614_0001465	3300048089	Bacteria	10197
1245	Ga0495614_0033092	3300048089	Bacteria	2223
1246	Ga0495626_0000068	3300048091	Bacteria	139126
1247	Ga0496100_0026625	3300048903	Bacteria	3547
1248	Ga0496100_0066086	3300048903	Bacteria	2398
1249	Ga0496100_0081723	3300048903	Bacteria	2183
1250	Ga0496100_0412644	3300048903	Bacteria	1030
1251	Ga0496101_0007572	3300048904	Bacteria	7045
1252	Ga0496101_0014875	3300048904	Bacteria	5237
1253	Ga0496101_0066149	3300048904	Bacteria	2636
1254	Ga0496101_0129863	3300048904	Bacteria	1912
1255	Ga0496101_0140383	3300048904	Bacteria	1841
1256	Ga0496102_0013604	3300048905	Bacteria	7053
1257	Ga0496102_0030165	3300048905	Bacteria	4853
1258	Ga0496102_0078141	3300048905	Bacteria	3046
1259	Ga0496103_0004000	3300048906	Bacteria	8954
1260	Ga0496103_0007750	3300048906	Bacteria	6384
1261	Ga0496103_0372887	3300048906	Bacteria	917
1262	Ga0496104_0056004	3300048907	Bacteria	3728
1263	Ga0496104_0101437	3300048907	Bacteria	2755
1264	Ga0496104_0118746	3300048907	Bacteria	2539
1265	Ga0496104_0436351	3300048907	Bacteria	1221
1266	Ga0496105_0002468	3300048908	Bacteria	13388
1267	Ga0496105_0013587	3300048908	Bacteria	6467
1268	Ga0496105_0072398	3300048908	Bacteria	2848
1269	Ga0496105_0111048	3300048908	Bacteria	2263
1270	Ga0496106_0000162	3300048909	Bacteria	48305
1271	Ga0496106_0019573	3300048909	Bacteria	5022
1272	Ga0496106_0057462	3300048909	Bacteria	2942
1273	Ga0496106_0106952	3300048909	Bacteria	2175
1274	Ga0496107_0017260	3300048910	Bacteria	5076
1275	Ga0496107_0061224	3300048910	Bacteria	2725
1276	Ga0496107_0139575	3300048910	Bacteria	1791
1277	Ga0496107_0270261	3300048910	Bacteria	1265
1278	Ga0496108_0011142	3300048911	Bacteria	7307
1279	Ga0496108_0177069	3300048911	Bacteria	1846
1280	Ga0496108_0179872	3300048911	Bacteria	1831
1281	Ga0496108_0255585	3300048911	Bacteria	1524
1282	Ga0496108_0499148	3300048911	Bacteria	1063
1283	Ga0496109_0003965	3300048912	Bacteria	12359
1284	Ga0496109_0272952	3300048912	Bacteria	1593
1285	Ga0496109_0386450	3300048912	Bacteria	1322
1286	Ga0496109_0546768	3300048912	Bacteria	1092
1287	Ga0496110_0061581	3300048913	Bacteria	3312
1288	Ga0496110_0135781	3300048913	Bacteria	2223
1289	Ga0496110_0184133	3300048913	Bacteria	1896
1290	Ga0496111_0006988	3300048914	Bacteria	7369
1291	Ga0496111_0123409	3300048914	Bacteria	1914
1292	Ga0496112_0000845	3300048915	Bacteria	21851
1293	Ga0496112_0023150	3300048915	Bacteria	5930
1294	Ga0496112_0303883	3300048915	Bacteria	1541
1295	Ga0496112_0384387	3300048915	Bacteria	1344
1296	Ga0496112_0533653	3300048915	Bacteria	1108
1297	Ga0496112_0535298	3300048915	Bacteria	1106
1298	Ga0496112_0671763	3300048915	Bacteria	965
1299	Ga0496113_0000630	3300048916	Bacteria	17715
1300	Ga0496113_0014789	3300048916	Bacteria	5338
1301	Ga0496113_0087366	3300048916	Bacteria	2397
1302	Ga0496113_0198384	3300048916	Bacteria	1595
1303	Ga0496114_0001670	3300048917	Bacteria	16838
1304	Ga0496114_0002335	3300048917	Bacteria	14443
1305	Ga0496114_0002636	3300048917	Bacteria	13685
1306	Ga0496114_0068547	3300048917	Bacteria	2978
1307	Ga0496114_0156957	3300048917	Bacteria	1976
1308	Ga0496114_0261378	3300048917	Bacteria	1524
1309	Ga0496114_0369877	3300048917	Bacteria	1269
1310	Ga0496114_0500655	3300048917	Bacteria	1075
1311	Ga0496115_0003790	3300048918	Bacteria	10875
1312	Ga0496115_0038982	3300048918	Bacteria	3773
1313	Ga0496115_0055221	3300048918	Bacteria	3190
1314	Ga0496115_0129922	3300048918	Bacteria	2076
1315	Ga0496115_0187849	3300048918	Bacteria	1707
1316	Ga0496115_0189548	3300048918	Bacteria	1699
1317	Ga0496115_0349899	3300048918	Bacteria	1205
1318	Ga0496116_0002301	3300048919	Bacteria	20255
1319	Ga0496116_0181336	3300048919	Bacteria	1127
1320	Ga0496117_0024649	3300048920	Bacteria	4749
1321	Ga0496117_0036473	3300048920	Bacteria	3678
1322	Ga0496117_0041767	3300048920	Bacteria	3355
1323	Ga0496118_0002594	3300048921	Bacteria	24086
1324	Ga0496118_0016936	3300048921	Bacteria	6656
1325	Ga0496118_0017073	3300048921	Bacteria	6625
1326	Ga0496118_0020754	3300048921	Bacteria	5816
1327	Ga0496118_0039102	3300048921	Bacteria	3790
1328	Ga0496118_0041701	3300048921	Bacteria	3629
1329	Ga0496118_0044043	3300048921	Bacteria	3498
1330	Ga0496118_0048156	3300048921	Bacteria	3296
1331	Ga0496118_0088824	3300048921	Bacteria	2136
1332	Ga0496119_0000996	3300048922	Bacteria	36307
1333	Ga0496119_0119467	3300048922	Bacteria	1451
1334	Ga0496121_0002966	3300048924	Bacteria	24708
1335	Ga0496121_0003706	3300048924	Bacteria	21439
1336	Ga0496121_0015441	3300048924	Bacteria	8003
1337	Ga0496121_0020087	3300048924	Bacteria	6636
1338	Ga0496121_0028670	3300048924	Bacteria	5176
1339	Ga0496121_0072309	3300048924	Bacteria	2769
1340	Ga0496121_0118850	3300048924	Bacteria	2000
1341	Ga0496121_0171217	3300048924	Bacteria	1577
1342	Ga0496121_0245885	3300048924	Bacteria	1243
1343	Ga0496121_0248018	3300048924	Bacteria	1236
1344	Ga0496122_0001467	3300048925	Bacteria	37972
1345	Ga0496122_0006509	3300048925	Bacteria	13375
1346	Ga0496122_0021646	3300048925	Bacteria	5746
1347	Ga0496123_0000191	3300048926	Bacteria	124299
1348	Ga0496123_0057977	3300048926	Bacteria	2516
1349	Ga0496123_0123328	3300048926	Bacteria	1452
1350	Ga0496124_0000073	3300048927	Bacteria	219306
1351	Ga0496124_0000108	3300048927	Bacteria	167473
1352	Ga0496124_0009527	3300048927	Bacteria	9988
1353	Ga0496124_0010447	3300048927	Bacteria	9396
1354	Ga0496124_0012421	3300048927	Bacteria	8409
1355	Ga0496124_0020326	3300048927	Bacteria	6140
1356	Ga0496125_0005828	3300048928	Bacteria	13535
1357	Ga0496125_0008324	3300048928	Bacteria	10885
1358	Ga0496126_0000538	3300048929	Bacteria	73271
1359	Ga0496126_0001364	3300048929	Bacteria	38662
1360	Ga0496126_0004863	3300048929	Bacteria	15732
1361	Ga0496126_0007775	3300048929	Bacteria	11683
1362	Ga0496126_0030353	3300048929	Bacteria	5122
1363	Ga0496126_0246307	3300048929	Bacteria	1491
1364	Ga0496126_0343709	3300048929	Bacteria	1222
1365	Ga0495678_000106	3300049459	Bacteria	100780
1366	Ga0495678_000404	3300049459	Bacteria	43644
1367	Ga0495678_012240	3300049459	Bacteria	4072
1368	Ga0495678_042773	3300049459	Bacteria	1804
1369	Ga0495678_081193	3300049459	Bacteria	1164
1370	Ga0495682_0000681	3300049460	Bacteria	22388
1371	Ga0495682_0006043	3300049460	Bacteria	4938
1372	Ga0495682_0011445	3300049460	Bacteria	3413
1373	Ga0501032_0268913	3300049569	Bacteria	1105
1374	Ga0501032_0325381	3300049569	Bacteria	992
1375	Ga0501032_0448041	3300049569	Bacteria	827
1376	Ga0501034_0000134	3300049571	Bacteria	137745
1377	Ga0501034_0000630	3300049571	Bacteria	54662
1378	Ga0501034_0068121	3300049571	Bacteria	3571
1379	Ga0501034_0129981	3300049571	Bacteria	2502
1380	Ga0501034_0143088	3300049571	Bacteria	2370
1381	Ga0501034_0186525	3300049571	Bacteria	2037
1382	Ga0501034_0212561	3300049571	Bacteria	1889
1383	Ga0501034_0473107	3300049571	Bacteria	1169
1384	Ga0501038_0058071	3300049574	Bacteria	3319
1385	Ga0501038_0305761	3300049574	Bacteria	1247
1386	Ga0501040_0151167	3300049576	Bacteria	1638
1387	Ga0501043_0001257	3300049579	Bacteria	22355
1388	Ga0501046_0003144	3300049580	Bacteria	15248
1389	Ga0501047_0000011	3300049581	Bacteria	409778
1390	Ga0501047_0283247	3300049581	Bacteria	1502
1391	Ga0501047_0388776	3300049581	Bacteria	1229
1392	Ga0501048_0001652	3300049582	Bacteria	16986
1393	Ga0501048_0196986	3300049582	Bacteria	1428
1394	Ga0501067_0000014	3300049583	Bacteria	110569
1395	Ga0501067_0014311	3300049583	Bacteria	4391
1396	Ga0501067_0049093	3300049583	Bacteria	2339
1397	Ga0501067_0066240	3300049583	Bacteria	1999
1398	Ga0501068_0006611	3300049584	Bacteria	6398
1399	Ga0501068_0161639	3300049584	Bacteria	1412
1400	Ga0501068_0437617	3300049584	Bacteria	845
1401	Ga0501069_0016266	3300049585	Bacteria	3993
1402	Ga0501069_0025182	3300049585	Bacteria	3250
1403	Ga0501069_0324401	3300049585	Bacteria	905
1404	Ga0501070_0000007	3300049586	Bacteria	219869
1405	Ga0501070_0002576	3300049586	Bacteria	15852
1406	Ga0501070_0073326	3300049586	Bacteria	2832
1407	Ga0501071_0262725	3300049587	Bacteria	1304
1408	Ga0501071_0341863	3300049587	Bacteria	1138
1409	Ga0501072_0000030	3300049588	Bacteria	133181
1410	Ga0501072_0002898	3300049588	Bacteria	12907
1411	Ga0501072_0253544	3300049588	Bacteria	1401
1412	Ga0501073_0000375	3300049589	Bacteria	30104
1413	Ga0501073_0002477	3300049589	Bacteria	13780
1414	Ga0501073_0002807	3300049589	Bacteria	13036
1415	Ga0501073_0012973	3300049589	Bacteria	6073
1416	Ga0501073_0029633	3300049589	Bacteria	3910
1417	Ga0501073_0113464	3300049589	Bacteria	1879
1418	Ga0501073_0143354	3300049589	Bacteria	1655
1419	Ga0501074_0002648	3300049590	Bacteria	12542
1420	Ga0501074_0046924	3300049590	Bacteria	3123
1421	Ga0501074_0170050	3300049590	Bacteria	1556
1422	Ga0501076_0148100	3300049592	Bacteria	1909
1423	Ga0501077_0287001	3300049593	Bacteria	1048
1424	Ga0501209_000447	3300049656	Bacteria	5030
1425	Ga0501079_0000466	3300049741	Bacteria	26666
1426	Ga0501079_0356413	3300049741	Bacteria	1146
1427	Ga0501079_0624047	3300049741	Bacteria	848
1428	Ga0501080_0009497	3300049742	Bacteria	8875
1429	Ga0501080_0055655	3300049742	Bacteria	3684
1430	Ga0501080_0061304	3300049742	Bacteria	3502
1431	Ga0501080_0063571	3300049742	Bacteria	3435
1432	Ga0501080_0077547	3300049742	Bacteria	3090
1433	Ga0501080_0227717	3300049742	Bacteria	1704
1434	Ga0501081_0051061	3300049743	Bacteria	2851
1435	Ga0501081_0071881	3300049743	Bacteria	2412
1436	Ga0501083_0000084	3300049744	Bacteria	63937
1437	Ga0501083_0009195	3300049744	Bacteria	6979
1438	Ga0501083_0060273	3300049744	Bacteria	2535
1439	Ga0501083_0092936	3300049744	Bacteria	1991
1440	Ga0501280_000724	3300049776	Bacteria	7284
1441	Ga0501282_000631	3300049778	Bacteria	4063
1442	Ga0501044_0030135	3300049823	Bacteria	5719
1443	Ga0501044_0119058	3300049823	Bacteria	2643
1444	Ga0501044_0464918	3300049823	Bacteria	1170
1445	Ga0501044_0514588	3300049823	Bacteria	1097
1446	Ga0501226_000035	3300049853	Bacteria	68083
1447	nmdc:mga00v17_164738_c1	3300050491	Bacteria	1428
1448	nmdc:mga0yw44_172048_c1	3300050492	Bacteria	1422
1449	nmdc:mga0k408_129707_c1	3300050493	Bacteria	1135
1450	nmdc:mga0k408_177122_c1	3300050493	Bacteria	1271
1451	nmdc:mga0k408_80326_c1	3300050493	Bacteria	1909
1452	nmdc:mga06z11_26757_c1	3300050494	Bacteria	2749
1453	nmdc:mga06z11_3256_c1	3300050494	Bacteria	6274
1454	nmdc:mga07m45_51257_c2	3300050496	Bacteria	1036
1455	nmdc:mga07m45_93936_c1	3300050496	Bacteria	1719
1456	nmdc:mga05p37_11562_c1	3300050507	Bacteria	10515
1457	nmdc:mga05p37_899361_c1	3300050507	Bacteria	955
1458	nmdc:mga09592_237171_c1	3300050508	Bacteria	1580
1459	nmdc:mga09592_47800_c1	3300050508	Bacteria	3606
1460	nmdc:mga0qj67_22237_c1	3300050509	Bacteria	4870
1461	nmdc:mga0qj67_26838_c1	3300050509	Bacteria	4460
1462	nmdc:mga06r32_10171_c1	3300050510	Bacteria	8492
1463	nmdc:mga06r32_245187_c1	3300050510	Bacteria	1779
1464	nmdc:mga06r32_303991_c1	3300050510	Bacteria	1581
1465	nmdc:mga06r32_69355_c1	3300050510	Bacteria	3407
1466	nmdc:mga06r32_79886_c1	3300050510	Bacteria	3182
1467	nmdc:mga08y16_1326_c1	3300050511	Bacteria	24646
1468	nmdc:mga08y16_638094_c1	3300050511	Bacteria	1070
1469	nmdc:mga08y16_68226_c1	3300050511	Bacteria	3708
1470	nmdc:mga08y16_820193_c1	3300050511	Bacteria	922
1471	nmdc:mga0n895_293592_c1	3300050512	Bacteria	1648
1472	nmdc:mga0n895_57547_c1	3300050512	Bacteria	3832
1473	nmdc:mga0n895_77979_c1	3300050512	Bacteria	3296
1474	nmdc:mga0rr50_180962_c1	3300050513	Bacteria	1723
1475	nmdc:mga0a205_105801_c1	3300050515	Bacteria	2712
1476	nmdc:mga0sz30_65123_c1	3300050516	Bacteria	1562
1477	Ga0495601_0020354	3300053077	Bacteria	4052
1478	Ga0495601_0033030	3300053077	Bacteria	3223
1479	Ga0495601_0233210	3300053077	Bacteria	1202
1480	Ga0495612_0006404	3300053078	Bacteria	4839
1481	Ga0495612_0012283	3300053078	Bacteria	3452
1482	Ga0495655_0048286	3300053083	Bacteria	1117
1483	Ga0495595_0003605	3300053084	Bacteria	6150
1484	Ga0495595_0022421	3300053084	Bacteria	2773
1485	Ga0495595_0245306	3300053084	Bacteria	896
1486	Ga0495619_0021688	3300053085	Bacteria	4103
1487	Ga0495619_0043631	3300053085	Bacteria	2940
1488	Ga0500650_0000375	3300053098	Bacteria	10900
1489	Ga0500555_047598	3300053103	Bacteria	1179
1490	Ga0500562_000052	3300053108	Bacteria	59070
1491	Ga0500562_035932	3300053108	Bacteria	1313
1492	Ga0500642_0002314	3300053130	Bacteria	5570
1493	Ga0500642_0050089	3300053130	Bacteria	1840
1494	Ga0500652_097351	3300053131	Bacteria	1229
1495	Ga0500559_0011496	3300053136	Bacteria	3781
1496	Ga0500604_0019975	3300053151	Bacteria	1881
1497	Ga0500616_0005724	3300053153	Bacteria	8365
1498	Ga0500616_0032008	3300053153	Bacteria	2876
1499	Ga0500552_000406	3300053733	Bacteria	3953
1500	Ga0501084_0000413	3300054114	Bacteria	33035
1501	Ga0501084_0269080	3300054114	Bacteria	1439
1502	Ga0501084_0304297	3300054114	Bacteria	1347
1503	Ga0501084_0645596	3300054114	Bacteria	894
1504	Ga0590071_006457	3300059421	Bacteria	2790
1505	Ga0501082_0015664	3300060353	Bacteria	6523
1506	Ga0501082_0044529	3300060353	Bacteria	3827
1507	Ga0501082_0157499	3300060353	Bacteria	1973
1508	Ga0466962_0014505	3300061719	Bacteria	3798
1509	Ga0530510_0162323	3300061734	Bacteria	1653
1510	2509130778	2508501125	Bacteria	7208311
1511	2510252518	2510065045	Bacteria	7761063
1512	2510283078	2510065053	Bacteria	5005518
1513	2510293752	2510065055	Bacteria	5037935
1514	2510310642	2510065058	Bacteria	5005894
1515	2511385823	2511231026	Bacteria	5225445
1516	2512348375	2512047030	Bacteria	9031815
1517	2513962666	2513237151	Bacteria	6309801
1518	2514050834	2513237166	Bacteria	10373764
1519	2515684795	2515154122	Bacteria	8609520
1520	2521560062	2521172590	Bacteria	5047645
1521	2527079962	2526164713	Bacteria	6780608
1522	2553008068	2551306416	Bacteria	6152985
1523	2554818189	2554235132	Bacteria	6772433
1524	2555247004	2554235231	Bacteria	5215788
1525	2563061595	2562617112	Bacteria	10918404
1526	2585294088	2582581311	Bacteria	6763856
1527	2587758444	2585428062	Bacteria	6842168
1528	2597861562	2597489888	Bacteria	6179543
1529	2597867283	2597489889	Bacteria	6297495
1530	2599331132	2599185155	Bacteria	5827168
1531	2599398962	2599185167	Bacteria	6353609
1532	2599451014	2599185179	Bacteria	6611171
1533	2599506333	2599185189	Bacteria	5862825
1534	2599514040	2599185190	Bacteria	6285678
1535	2599518638	2599185191	Bacteria	6297582
1536	2599741107	2599185239	Bacteria	8686614
1537	2599748414	2599185240	Bacteria	7968121
1538	2599882555	2599185288	Bacteria	6666191
1539	2599893625	2599185290	Bacteria	6289611
1540	2599950527	2599185303	Bacteria	6512725
1541	2599972239	2599185307	Bacteria	6194719
1542	2599996094	2599185311	Bacteria	6354990
1543	2600210326	2599185355	Bacteria	7968906
1544	2600445748	2600254954	Bacteria	5100516
1545	2600813858	2600255067	Bacteria	6795583
1546	2601627328	2600255283	Bacteria	6061572
1547	2601692244	2600255296	Bacteria	5784754
1548	2602011132	2600255389	Bacteria	5275336
1549	2608380513	2606217733	Bacteria	6360972
1550	2621302275	2619619299	Bacteria	6649820
1551	2643872722	2643221571	Bacteria	6228673
1552	2643966626	2643221591	Bacteria	4397626
1553	2644244842	2643221644	Bacteria	6865017
1554	2644341106	2643221660	Bacteria	4208257
1555	2644619545	2643221713	Bacteria	6554480
1556	2671693538	2671180139	Bacteria	4196045
1557	2676745749	2675903129	Bacteria	7964495
1558	2677898318	2675903420	Bacteria	6247433
1559	2713478539	2711768613	Bacteria	11048459
1560	2719641616	2718217991	Bacteria	7829542
1561	2723246450	2721755607	Bacteria	5841722
1562	2729146772	2728369097	Bacteria	4333476
1563	2738674938	2738541265	Bacteria	6594665
1564	2738691924	2738541271	Bacteria	5657310
1565	2738700685	2738541273	Bacteria	4048577
1566	2738753331	2738541282	Bacteria	6593925
1567	2738808022	2738541294	Bacteria	6925949
1568	2738823959	2738541296	Bacteria	7285013
1569	2738836350	2738541298	Bacteria	7286732
1570	2738862530	2738541303	Bacteria	6591772
1571	2738877880	2738541306	Bacteria	7284992
1572	2738895382	2738541309	Bacteria	6926455
1573	2739189586	2738543002	Bacteria	7284546
1574	2739224473	2738543008	Bacteria	7282815
1575	2739254434	2738543014	Bacteria	4048139
1576	2739263326	2738543016	Bacteria	5657564
1577	2739287152	2738543020	Bacteria	5718238
1578	2739292465	2738543021	Bacteria	5718241
1579	2746087293	2744054900	Bacteria	8399525
1580	2746093200	2744054901	Bacteria	8397047
1581	2753566133	2751185846	Bacteria	7242164
1582	2774131223	2773857672	Bacteria	4993178
1583	2792837001	2791355137	Bacteria	9654227
1584	2808906311	2808606373	Bacteria	4423627
1585	2808939785	2808606379	Bacteria	5022697
1586	2808972918	2808606384	Bacteria	8474373
1587	2808976768	2808606385	Bacteria	6711065
1588	2808991794	2808606388	Bacteria	6706662
1589	2809007917	2808606390	Bacteria	8476311
1590	2809015443	2808606391	Bacteria	8308166
1591	2812370075	2811994881	Bacteria	6298475
1592	2817259767	2816332253	Bacteria	6764532
1593	2817277436	2816332256	Bacteria	6891714
1594	2817453602	2816332286	Bacteria	6853759
1595	2817488299	2816332298	Bacteria	6852809
1596	2819616425	2818991449	Bacteria	5518009
1597	2819624231	2818991450	Bacteria	6962147
1598	2819636863	2818991452	Bacteria	8442785
1599	2826582947	2826581358	Bacteria	5963467
1600	2834032313	2834028612	Bacteria	6354979
1601	2842332117	2842324504	Bacteria	9364110
1602	2842356431	2842348783	Bacteria	9002918
1603	2842461215	2842454564	Bacteria	8730687
1604	2842700866	2842698319	Bacteria	5190321
1605	2842809828	2842805378	Bacteria	5385175
1606	2842820011	2842815866	Bacteria	5947510
1607	2842830615	2842826826	Bacteria	5974129
1608	2842838518	2842837860	Bacteria	6066181
1609	2842851485	2842849001	Bacteria	5924277
1610	2852616969	2852612431	Bacteria	6885235
1611	2852672042	2852667396	Bacteria	6885555
1612	2860868342	2860867994	Bacteria	5645326
1613	2863426431	2863421361	Bacteria	7300805
1614	2870069337	2870068957	Bacteria	8925310
1615	2885272428	2885270888	Bacteria	9831543
1616	2900637140	2900634093	Bacteria	10263517
1617	2902410291	2902405164	Bacteria	6784948
1618	2902686743	2902682994	Bacteria	8951596
1619	2904440904	2904439833	Bacteria	5931679
1620	2904490186	2904483920	Bacteria	7545285
1621	2904535506	2904530477	Bacteria	5876334
1622	2904569404	2904564687	Bacteria	7609577
1623	2904576759	2904571731	Bacteria	7608790
1624	2904588353	2904584206	Bacteria	6028872
1625	2904594759	2904589729	Bacteria	6113573
1626	2904606022	2904601388	Bacteria	5884906
1627	2904621501	2904615490	Bacteria	10047340
1628	2908446924	2908446538	Bacteria	6829095
1629	2917837026	2917832318	Bacteria	5346010
1630	2919049071	2919046199	Bacteria	5567169
1631	2919084680	2919079590	Bacteria	5946433
1632	2919127163	2919125081	Bacteria	5385106
1633	2919452818	2919450847	Bacteria	5631160
1634	2919505804	2919501602	Bacteria	5286340
1635	2919533355	2919527303	Bacteria	7718827
1636	2921647681	2921643360	Bacteria	11448031
1637	2923513793	2923510766	Bacteria	5926163
1638	2923524161	2923519811	Bacteria	6298479
1639	2926067919	2926063275	Bacteria	5285848
1640	2928114143	2928108538	Bacteria	7360024
1641	2928134367	2928130867	Bacteria	5467269
1642	2928141109	2928135762	Bacteria	7259641
1643	2928163111	2928157003	Bacteria	7522202
1644	2928170139	2928163908	Bacteria	7561269
1645	2928176269	2928170801	Bacteria	8785406
1646	2928509138	2928503688	Bacteria	7268108
1647	2928542081	2928536128	Bacteria	7657547
1648	2929190200	2929189879	Bacteria	5930554
1649	2931391269	2931390751	Bacteria	6273349
1650	2939673299	2939669807	Bacteria	5028511
1651	2945930282	2945928738	Bacteria	6053221
1652	2945934497	2945934425	Bacteria	7444609
1653	2945967489	2945961074	Bacteria	7342064
1654	2946012619	2946006987	Bacteria	6705746
1655	2946028541	2946027586	Bacteria	6049274
1656	2947235073	2947233263	Bacteria	6439278
1657	2974302709	2974298342	Bacteria	4840922
1658	2981996042	2981990288	Bacteria	7590678
1659	2984499705	2984499530	Bacteria	5020881
1660	2984506085	2984504281	Bacteria	5262371
1661	2990197564	2990196909	Bacteria	4054280
1662	2990704944	2990703756	Bacteria	7715990
1663	3007617432	3007614139	Bacteria	6053559
1664	642426608	641736151	Bacteria	7477263
1665	642416508	641736154	Bacteria	7689995
1666	642594549	642555112	Bacteria	8676562
1667	642623134	642555113	Bacteria	8214658
1668	8016731939	8016728285	Bacteria	5263933
1669	8018847994	8018845410	Bacteria	8933938
1670	8020813979	8020807995	Bacteria	6801506
1671	8020938981	8020938398	Bacteria	7472757
1672	8020947697	8020945358	Bacteria	8467355
1673	8020953472	8020953355	Bacteria	7439080
1674	8021127578	8021120328	Bacteria	8782274
1675	8034966544	8034962539	Bacteria	4884839
1676	8039099728	8039098773	Bacteria	6602928
1677	8040171556	8040167225	Bacteria	6542727
1678	8040174170	8040173305	Bacteria	6827067
1679	8054286097	8054285046	Bacteria	6919322
1680	8054350227	8054347763	Bacteria	5901107
1681	8054503846	8054503363	Bacteria	6101651
1682	8055269494	8055266321	Bacteria	7999742
1683	8055307344	8055301274	Bacteria	8587385
1684	8055818247	8055817908	Bacteria	6609162
1685	8056132230	8056131705	Bacteria	6107031
1686	8056152372	8056148874	Bacteria	6479865
1687	8056164229	8056161164	Bacteria	6106669
1688	Ga0157369_10030614
1689	SwRhRL2b_contig_1951000
1690	JGI24736J21556_1007916
1691	JGI24740J21852_10000985
1692	JGI24740J21852_10008500
1693	JGI24739J22299_10011896
1694	JGI24735J21928_10000566
1695	JGI24735J21928_10001570
1696	JGI24735J21928_10004545
1697	JGI24735J21928_10004725
1698	JGI24735J21928_10013067
1699	JGI24738J21930_10002006
1700	JGI25156J39149_1007606
1701	JGI25156J39149_1015378
1702	JGI25406J46586_10009582
1703	JGI25165J46597_1000794
1704	JGI25160J50197_1000146
1705	JGI25160J50197_1042858
1706	Ga0055538_1000038
1707	Ga0055538_1000115
1708	Ga0055539_1000049
1709	Ga0055539_1000162
1710	Ga0055533_1000060
1711	Ga0055533_1000164
1712	Ga0055533_1000476
1713	Ga0055532_1000092
1714	Ga0055532_1000153
1715	Ga0055525_1000068
1716	Ga0055525_1000224
1717	Ga0055527_1000035
1718	Ga0055527_1000754
1719	Ga0055535_1000050
1720	Ga0055542_1000120
1721	Ga0055542_1006002
1722	Ga0055542_1006397
1723	Ga0055529_1000089
1724	Ga0055529_1002076
1725	Ga0055528_1003212
1726	Ga0055541_1000036
1727	Ga0055541_1000107
1728	Ga0058692_1002418
1729	Ga0065165_1000648
1730	Ga0065714_10012015
1731	Ga0065712_10068411
1732	Ga0065712_10087084
1733	Ga0065707_10003041
1734	Ga0070658_10004543
1735	Ga0070658_10004734
1736	Ga0070658_10016121
1737	Ga0070658_10030943
1738	Ga0070658_10065021
1739	Ga0070683_100001760
1740	Ga0070683_100067502
1741	Ga0070683_100178539
1742	Ga0070690_100003073
1743	Ga0070690_100082320
1744	Ga0070670_100004565
1745	Ga0070670_100012109
1746	Ga0070677_10091714
1747	Ga0070666_10027412
1748	Ga0070666_10030868
1749	Ga0070680_100378244
1750	Ga0070682_100042623
1751	Ga0070682_100126100
1752	Ga0070682_100198046
1753	Ga0070682_100201650
1754	Ga0068868_100355321
1755	Ga0070660_100000025
1756	Ga0070660_100000555
1757	Ga0070660_100241946
1758	Ga0070689_100000017
1759	Ga0070689_100036969
1760	Ga0070689_100039277
1761	Ga0070687_100002682
1762	Ga0070661_100004487
1763	Ga0070661_100083767
1764	Ga0070692_10030730
1765	Ga0070692_10331746
1766	Ga0070669_100001095
1767	Ga0070669_100043163
1768	Ga0070671_100326186
1769	Ga0070674_100009439
1770	Ga0070674_100017948
1771	Ga0070674_100142516
1772	Ga0070674_100239156
1773	Ga0070674_100374530
1774	Ga0070673_100000620
1775	Ga0070673_100022396
1776	Ga0070673_100521336
1777	Ga0070688_100010556
1778	Ga0070659_100000264
1779	Ga0070659_100231168
1780	Ga0070659_100543731
1781	Ga0070667_100082688
1782	Ga0070703_10071547
1783	Ga0070709_10067503
1784	Ga0070714_100239131
1785	Ga0070714_100869380
1786	Ga0070713_100063796
1787	Ga0070713_100338234
1788	Ga0070711_100015814
1789	Ga0070711_100504944
1790	Ga0070708_100000301
1791	Ga0070708_100009986
1792	Ga0070708_100058087
1793	Ga0070708_100207972
1794	Ga0070708_100553667
1795	Ga0070708_100627710
1796	Ga0070663_100000091
1797	Ga0070663_100030019
1798	Ga0070663_100133146
1799	Ga0070662_100000855
1800	Ga0070681_10006771
1801	Ga0070681_10022668
1802	Ga0070681_10079056
1803	Ga0070681_10133753
1804	Ga0068867_100005433
1805	Ga0068867_100043008
1806	Ga0070685_10173695
1807	Ga0070706_100000675
1808	Ga0070706_100001950
1809	Ga0070706_100126979
1810	Ga0070707_100002396
1811	Ga0070707_100216066
1812	Ga0070698_100018223
1813	Ga0070698_100021077
1814	Ga0070698_100445832
1815	Ga0070699_100002387
1816	Ga0070699_100019780
1817	Ga0070699_100254187
1818	Ga0070699_100538822
1819	Ga0070679_100014023
1820	Ga0070679_100014273
1821	Ga0070679_100014417
1822	Ga0070679_100025092
1823	Ga0070679_100098050
1824	Ga0070679_100192113
1825	Ga0070679_100342278
1826	Ga0070684_100129164
1827	Ga0070697_100001239
1828	Ga0070697_100012683
1829	Ga0070697_100054173
1830	Ga0068853_100000029
1831	Ga0068853_100102759
1832	Ga0068853_100680949
1833	Ga0070672_100021623
1834	Ga0070672_100079752
1835	Ga0070672_100110384
1836	Ga0070686_100001282
1837	Ga0070695_100015052
1838	Ga0070696_100082908
1839	Ga0070665_100042512
1840	Ga0068855_100027271
1841	Ga0068855_100028719
1842	Ga0068855_100051124
1843	Ga0068855_100056021
1844	Ga0068855_100216195
1845	Ga0068855_100398032
1846	Ga0068855_100756845
1847	Ga0070664_100011142
1848	Ga0070664_100052183
1849	Ga0068857_100053732
1850	Ga0068857_100058082
1851	Ga0068857_100081747
1852	Ga0068854_100001922
1853	Ga0068856_100079027
1854	Ga0068856_100101735
1855	Ga0068856_100143192
1856	Ga0068856_100398169
1857	Ga0068852_100020390
1858	Ga0068852_100190519
1859	Ga0068852_100270227
1860	Ga0068859_100018925
1861	Ga0068859_100103229
1862	Ga0068866_10116709
1863	Ga0068866_10234347
1864	Ga0068851_10000035
1865	Ga0068851_10038719
1866	Ga0068863_100214669
1867	Ga0068863_100429489
1868	Ga0068858_100021735
1869	Ga0068858_100035861
1870	Ga0068858_100226662
1871	Ga0068860_100115367
1872	Ga0068862_100262270
1873	Ga0068862_100550588
1874	Ga0081455_10222811
1875	Ga0081540_1006469
1876	Ga0081540_1018894
1877	Ga0081539_10001498
1878	Ga0070717_10089874
1879	Ga0070717_10200561
1880	Ga0070717_10327078
1881	Ga0075363_100064189
1882	Ga0075364_10296513
1883	Ga0070716_100055301
1884	Ga0070716_100157463
1885	Ga0070716_100215352
1886	Ga0075367_10027238
1887	Ga0075367_10073286
1888	Ga0075367_10075508
1889	Ga0075366_10040495
1890	Ga0075366_10258459
1891	Ga0097621_100015272
1892	Ga0097621_100265574
1893	Ga0075370_10107977
1894	Ga0075370_10222138
1895	Ga0068871_100531551
1896	Ga0075428_100386262
1897	Ga0075430_100037292
1898	Ga0075430_100069476
1899	Ga0075430_100160725
1900	Ga0075431_100000766
1901	Ga0075431_100024177
1902	Ga0075431_100047007
1903	Ga0075431_100150816
1904	Ga0075431_100274545
1905	Ga0075433_10442273
1906	Ga0075434_100008839
1907	Ga0075434_100094551
1908	Ga0075434_100297456
1909	Ga0075429_100042397
1910	Ga0075429_100046650
1911	Ga0075429_100108275
1912	Ga0068865_100000463
1913	Ga0075436_100199569
1914	Ga0097620_100018925
1915	Ga0097620_100103222
1916	Ga0075435_100157349
1917	Ga0099794_10010321
1918	Ga0099795_10014037
1919	Ga0105251_10000009
1920	Ga0105251_10000781
1921	Ga0105251_10004276
1922	Ga0105251_10004471
1923	Ga0105251_10006725
1924	Ga0105251_10027875
1925	Ga0105251_10039795
1926	Ga0105244_10011664
1927	Ga0105244_10012264
1928	Ga0105244_10015770
1929	Ga0105244_10031576
1930	Ga0105244_10049313
1931	Ga0105250_10001470
1932	Ga0105250_10002368
1933	Ga0105250_10002788
1934	Ga0105250_10020938
1935	Ga0105250_10029714
1936	Ga0105240_10001157
1937	Ga0105240_10055159
1938	Ga0105240_10058928
1939	Ga0105240_10090508
1940	Ga0105240_10103759
1941	Ga0105240_10148476
1942	Ga0105240_10616615
1943	Ga0111539_10013445
1944	Ga0111539_10020447
1945	Ga0111539_10083256
1946	Ga0111539_10203392
1947	Ga0111539_10526935
1948	Ga0105245_10199064
1949	Ga0105245_10850295
1950	Ga0105247_10316444
1951	Ga0114129_10212920
1952	Ga0114129_10572092
1953	Ga0114129_10940148
1954	Ga0105243_10040823
1955	Ga0105243_10084814
1956	Ga0105243_10145723
1957	Ga0105241_10682856
1958	Ga0105242_10000465
1959	Ga0105248_10013830
1960	Ga0105248_10047554
1961	Ga0105248_10095787
1962	Ga0105248_10408521
1963	Ga0105237_10003215
1964	Ga0105237_10004566
1965	Ga0105237_10258586
1966	Ga0105238_10000037
1967	Ga0105238_10001318
1968	Ga0105238_10003778
1969	Ga0105238_10004242
1970	Ga0105238_10064293
1971	Ga0105238_10155824
1972	Ga0105238_10250065
1973	Ga0105249_10032517
1974	Ga0105249_10181359
1975	Ga0105249_10216673
1976	Ga0105239_10003694
1977	Ga0105239_10003869
1978	Ga0105239_10008689
1979	Ga0105239_10039665
1980	Ga0105239_10131957
1981	Ga0105239_10682159
1982	Ga0105246_10014482
1983	Ga0157371_10017064
1984	Ga0157371_10074427
1985	Ga0157370_10000390
1986	Ga0157370_10000560
1987	Ga0157370_10029498
1988	Ga0157370_10052390
1989	Ga0157369_10000147
1990	Ga0157369_10000872
1991	Ga0157369_10002777
1992	Ga0157369_10003810
1993	Ga0157369_10029479
1994	Ga0157369_10124862
1995	Ga0157369_10602500
1996	Ga0157374_10000251
1997	Ga0157374_10012779
1998	Ga0157374_10182419
1999	Ga0157374_10201408
2000	Ga0157378_10037095
2001	Ga0157378_10114219
2002	Ga0163162_10232003
2003	Ga0157372_10000323
2004	Ga0157375_10011856
2005	Ga0157375_10057467
2006	Ga0163163_10009138
2007	Ga0163163_10051441
2008	Ga0182008_10020191
2009	Ga0182008_10061566
2010	Ga0182008_10126410
2011	Ga0157379_10030536
2012	Ga0157376_10041971
2013	Ga0157376_10293828
2014	Ga0182006_1004523
2015	Ga0182007_10000932
2016	Ga0182007_10025299
2017	Ga0182007_10042080
2018	Ga0182005_1005113
2019	Ga0183361_10015
2020	Ga0163161_10055657
2021	Ga0206356_11626400
2022	Ga0206356_11640873
2023	Ga0206354_10295002
2024	Ga0206353_10258239
2025	Ga0206353_10332135
2026	Ga0206353_10944309
2027	Ga0206353_11407798
2028	Ga0213873_10041970
2029	Ga0213872_10001084
2030	Ga0213872_10011215
2031	Ga0213872_10091915
2032	Ga0213872_10114800
2033	Ga0213876_10065273
2034	Ga0213876_10102796
2035	Ga0213875_10026941
2036	Ga0224712_10000002
2037	Ga0209435_102153
2038	Ga0209784_100021
2039	Ga0209784_100087
2040	Ga0209566_100039
2041	Ga0209566_100106
2042	Ga0209566_101146
2043	Ga0209674_100036
2044	Ga0209674_100128
2045	Ga0209674_100153
2046	Ga0209674_100296
2047	Ga0209672_100054
2048	Ga0209672_100072
2049	Ga0209672_100073
2050	Ga0209672_100570
2051	Ga0209147_100085
2052	Ga0209147_100093
2053	Ga0209147_100100
2054	Ga0209147_100129
2055	Ga0209563_100040
2056	Ga0209563_100122
2057	Ga0207427_103353
2058	Ga0209258_100140
2059	Ga0209258_100168
2060	Ga0209258_100352
2061	Ga0209258_100397
2062	Ga0209646_1000310
2063	Ga0209026_1004124
2064	Ga0209677_100023
2065	Ga0209677_100078
2066	Ga0209148_1000119
2067	Ga0209148_1000140
2068	Ga0209148_1004328
2069	Ga0209759_1000281
2070	Ga0209759_1000329
2071	Ga0209759_1000362
2072	Ga0209759_1004329
2073	Ga0209759_1005092
2074	Ga0209759_1014467
2075	Ga0209759_1025149
2076	Ga0209233_1000173
2077	Ga0209565_1009798
2078	Ga0209455_1000125
2079	Ga0209455_1000217
2080	Ga0209673_1000098
2081	Ga0209130_1011394
2082	Ga0209675_1004204
2083	Ga0209025_1000853
2084	Ga0209564_1017081
2085	Ga0207426_1000199
2086	Ga0207426_1002772
2087	Ga0207656_10000008
2088	Ga0207696_1000020
2089	Ga0207696_1000084
2090	Ga0207696_1025259
2091	Ga0207655_1000495
2092	Ga0207655_1052827
2093	Ga0207713_1000032
2094	Ga0207713_1000186
2095	Ga0207713_1001816
2096	Ga0207713_1002540
2097	Ga0207713_1010399
2098	Ga0207713_1036728
2099	Ga0207653_10090442
2100	Ga0207682_10016787
2101	Ga0207692_10095192
2102	Ga0207688_10270571
2103	Ga0207680_10101560
2104	Ga0207647_10000126
2105	Ga0207647_10010761
2106	Ga0207647_10062309
2107	Ga0207685_10004056
2108	Ga0207699_10204695
2109	Ga0207645_10002491
2110	Ga0207705_10006000
2111	Ga0207705_10011142
2112	Ga0207705_10019586
2113	Ga0207705_10057687
2114	Ga0207705_10120295
2115	Ga0207705_10218594
2116	Ga0207684_10018222
2117	Ga0207684_10019787
2118	Ga0207684_10029562
2119	Ga0207684_10236181
2120	Ga0207707_10011890
2121	Ga0207707_10014353
2122	Ga0207707_10065293
2123	Ga0207695_10001836
2124	Ga0207695_10004822
2125	Ga0207695_10016358
2126	Ga0207695_10022014
2127	Ga0207695_10030027
2128	Ga0207695_10109628
2129	Ga0207695_10112231
2130	Ga0207671_10000015
2131	Ga0207671_10000351
2132	Ga0207671_10029655
2133	Ga0207671_10084561
2134	Ga0207671_10097780
2135	Ga0207671_10358813
2136	Ga0207693_10010921
2137	Ga0207693_10064340
2138	Ga0207693_10108597
2139	Ga0207693_10307327
2140	Ga0207663_10115737
2141	Ga0207662_10005509
2142	Ga0207662_10038480
2143	Ga0207662_10091271
2144	Ga0207657_10000065
2145	Ga0207657_10001751
2146	Ga0207649_10000001
2147	Ga0207652_10000514
2148	Ga0207652_10006010
2149	Ga0207646_10002645
2150	Ga0207646_10010060
2151	Ga0207646_10030001
2152	Ga0207646_10118367
2153	Ga0207646_10283317
2154	Ga0207646_10551624
2155	Ga0207681_10001783
2156	Ga0207681_10016535
2157	Ga0207694_10000054
2158	Ga0207694_10016623
2159	Ga0207694_10017087
2160	Ga0207694_10030031
2161	Ga0207694_10056136
2162	Ga0207694_10146909
2163	Ga0207694_10163751
2164	Ga0207650_10000186
2165	Ga0207650_10000741
2166	Ga0207650_10006857
2167	Ga0207659_10030526
2168	Ga0207700_10093859
2169	Ga0207700_10177607
2170	Ga0207664_10070679
2171	Ga0207664_10175704
2172	Ga0207664_10203833
2173	Ga0207664_10616399
2174	Ga0207690_10000040
2175	Ga0207690_10283960
2176	Ga0207690_10315813
2177	Ga0207706_10000081
2178	Ga0207706_10132919
2179	Ga0207706_10201166
2180	Ga0207706_10226294
2181	Ga0207686_10012980
2182	Ga0207686_10019792
2183	Ga0207709_10075656
2184	Ga0207709_10092553
2185	Ga0207670_10000017
2186	Ga0207670_10004256
2187	Ga0207670_10114254
2188	Ga0207669_10284058
2189	Ga0207669_10285816
2190	Ga0207704_10033009
2191	Ga0207704_10331162
2192	Ga0207665_10011235
2193	Ga0207665_10141468
2194	Ga0207665_10173570
2195	Ga0207665_10319162
2196	Ga0207665_10362970
2197	Ga0207665_10492875
2198	Ga0207691_10149091
2199	Ga0207691_10182104
2200	Ga0207691_10410815
2201	Ga0207711_10011206
2202	Ga0207711_10262959
2203	Ga0207661_10003719
2204	Ga0207661_10260714
2205	Ga0207679_10000009
2206	Ga0207679_10153200
2207	Ga0207667_10000043
2208	Ga0207667_10008425
2209	Ga0207667_10010182
2210	Ga0207667_10021698
2211	Ga0207651_10009202
2212	Ga0207651_10045649
2213	Ga0207712_10290394
2214	Ga0207712_10366796
2215	Ga0207712_10789112
2216	Ga0207668_10034688
2217	Ga0207640_10047283
2218	Ga0207677_10008799
2219	Ga0207677_10115507
2220	Ga0207703_10086473
2221	Ga0207703_10243596
2222	Ga0207639_10000090
2223	Ga0207639_10001959
2224	Ga0207678_10002149
2225	Ga0207678_10038889
2226	Ga0207678_10049586
2227	Ga0207678_10264295
2228	Ga0207641_10146083
2229	Ga0207641_10526722
2230	Ga0207648_10008005
2231	Ga0207648_10042868
2232	Ga0207648_10056307
2233	Ga0207648_10246171
2234	Ga0207674_10137634
2235	Ga0207674_10137814
2236	Ga0207674_10141753
2237	Ga0207674_10158271
2238	Ga0207674_10213518
2239	Ga0207674_10317004
2240	Ga0207674_10788727
2241	Ga0207675_100340995
2242	Ga0207675_100367975
2243	Ga0207675_100659210
2244	Ga0207683_10069976
2245	Ga0207683_10149860
2246	Ga0207698_10128635
2247	Ga0207698_10833454
2248	Ga0209371_1000141
2249	Ga0209371_1003202
2250	Ga0209179_1011067
2251	Ga0209983_1007221
2252	Ga0209588_1007394
2253	Ga0209971_1002033
2254	Ga0209813_10144592
2255	Ga0209974_10001114
2256	Ga0207428_10021207
2257	Ga0207428_10026521
2258	Ga0268266_10069228
2259	Ga0268266_10078546
2260	Ga0268266_10079585
2261	Ga0268265_10115957
2262	Ga0268265_10270496
2263	Ga0268264_10020417
2264	Ga0268264_10124342
2265	Ga0265337_1012674
2266	Ga0265318_10000066
2267	Ga0265318_10000460
2268	Ga0265318_10085159
2269	Ga0265323_10014974
2270	Ga0265323_10069988
2271	Ga0265323_10094172
2272	Ga0265322_10034269
2273	Ga0307515_10001873
2274	Ga0307515_10010443
2275	Ga0307515_10020861
2276	Ga0265338_10003131
2277	Ga0265338_10014668
2278	Ga0265324_10000134
2279	Ga0265324_10008346
2280	Ga0268256_1000205
2281	Ga0268256_1002888
2282	Ga0307512_10095322
2283	Ga0265330_10000221
2284	Ga0265330_10000713
2285	Ga0265330_10000949
2286	Ga0265330_10001677
2287	Ga0265330_10010021
2288	Ga0265330_10119838
2289	Ga0265332_10000177
2290	Ga0265332_10003497
2291	Ga0265332_10017861
2292	Ga0265332_10033961
2293	Ga0265328_10000273
2294	Ga0265328_10003483
2295	Ga0265328_10006586
2296	Ga0265328_10065585
2297	Ga0265320_10000060
2298	Ga0265320_10003883
2299	Ga0265320_10005658
2300	Ga0265320_10008484
2301	Ga0265320_10035342
2302	Ga0265325_10007036
2303	Ga0265325_10041411
2304	Ga0265325_10088440
2305	Ga0265329_10000004
2306	Ga0265329_10001182
2307	Ga0265329_10005020
2308	Ga0265340_10000043
2309	Ga0265340_10048960
2310	Ga0265339_10000010
2311	Ga0265339_10000982
2312	Ga0265339_10005541
2313	Ga0265339_10006031
2314	Ga0265339_10013410
2315	Ga0265331_10000124
2316	Ga0265331_10003155
2317	Ga0265331_10003933
2318	Ga0265327_10000027
2319	Ga0265316_10000046
2320	Ga0265316_10001763
2321	Ga0265316_10009372
2322	Ga0265316_10014604
2323	Ga0265316_10014941
2324	Ga0265316_10018469
2325	Ga0265316_10029799
2326	Ga0265316_10055719
2327	Ga0265316_10118095
2328	Ga0265316_10269487
2329	Ga0265316_10443151
2330	Ga0307513_10039995
2331	Ga0307513_10152482
2332	Ga0307513_10243994
2333	Ga0307509_10023873
2334	Ga0307408_100000005
2335	Ga0307408_100000019
2336	Ga0265313_10000104
2337	Ga0265313_10000227
2338	Ga0265313_10003430
2339	Ga0265313_10007578
2340	Ga0265313_10008438
2341	Ga0265313_10011389
2342	Ga0265313_10022527
2343	Ga0265313_10026527
2344	Ga0265313_10094113
2345	Ga0307508_10000053
2346	Ga0316575_10025801
2347	Ga0316575_10026544
2348	Ga0316575_10152295
2349	Ga0265314_10000008
2350	Ga0265314_10000165
2351	Ga0265314_10002294
2352	Ga0265314_10002874
2353	Ga0265314_10004332
2354	Ga0265314_10046901
2355	Ga0265314_10049587
2356	Ga0265314_10052404
2357	Ga0265314_10126530
2358	Ga0265342_10000048
2359	Ga0265342_10000171
2360	Ga0265342_10000465
2361	Ga0265342_10000520
2362	Ga0265342_10001286
2363	Ga0265342_10006466
2364	Ga0265342_10036144
2365	Ga0265342_10055814
2366	Ga0265342_10074140
2367	Ga0316576_10087596
2368	Ga0316576_10119682
2369	Ga0316578_10030993
2370	Ga0316578_10179638
2371	Ga0307516_10005097
2372	Ga0307405_10513353
2373	Ga0307413_10087243
2374	Ga0307406_10000030
2375	Ga0307412_10000056
2376	Ga0307412_10042058
2377	Ga0307412_10095110
2378	Ga0307414_10070567
2379	Ga0307411_10355928
2380	Ga0307415_100496728
2381	Ga0316583_10010602
2382	Ga0316585_10006317
2383	Ga0316593_10004055
2384	Ga0307507_10088285
2385	Ga0307510_10025504
2386	Ga0307510_10320578
2387	Ga0373950_0000009
2388	Ga0373950_0000027
2389	Ga0373934_0039874
2390	Ga0373934_0080280
2391	Ga0373944_0003204
2392	Ga0373944_0003597
2393	Ga0373944_0011316
2394	Ga0373951_0068437
2395	Ga0373936_0017884
2396	Ga0373936_0034498
2397	Ga0373945_0008499
2398	Ga0373945_0014169
2399	Ga0373945_0114616
2400	Ga0373953_0004396
2401	Ga0373953_0101754
2402	Ga0373953_0118001
2403	Ga0373954_0004893
2404	Ga0373954_0030168
2405	Ga0373956_0019878
2406	Ga0373956_0051238
2407	Ga0373957_0034962
2408	Ga0373957_0108939
2409	Ga0373943_0001682
2410	Ga0373943_0003799
2411	Ga0373943_0003862
2412	Ga0373943_0117031
2413	Ga0373943_0122348
2414	Ga0373946_0002630
2415	Ga0373946_0005184
2416	Ga0373946_0005647
2417	Ga0373946_0086275
2418	Ga0373955_0005503
2419	Ga0373955_0026549
2420	Ga0373955_0061554
2421	Ga0373955_0090811
2422	Ga0373955_0112963
2423	Ga0316574_0091960
2424	Ga0373924_0017160
2425	Ga0373931_0180127
2426	Ga0373935_0018390
2427	Ga0373935_0036770
2428	Ga0373935_0067268
2429	Ga0373927_0001909
2430	Ga0373927_0020354
2431	Ga0373927_0032514
2432	Ga0373927_0139475
2433	Ga0373927_0213872
2434	Ga0373933_0000595
2435	Ga0373933_0005874
2436	Ga0373933_0012986
2437	Ga0373933_0042623
2438	Ga0373933_0072407
2439	Ga0373933_0175115
2440	Ga0373933_0359263
2441	Ga0373947_0000076
2442	Ga0373947_0016858
2443	Ga0373947_0203418
2444	Ga0373947_0206908
2445	Ga0373947_0312101
2446	Ga0373937_0001254
2447	Ga0373937_0002237
2448	Ga0373937_0021827
2449	Ga0373937_0033718
2450	Ga0373937_0117510
2451	Ga0373937_0184345
2452	Ga0373937_0335433
2453	Ga0373937_0368203
2454	Ga0373937_0675206
2455	Ga0316582_0026501
2456	Ga0316584_0011567
2457	Ga0373925_0001700
2458	Ga0373925_0053765
2459	Ga0373925_0060417
2460	Ga0373925_0097434
2461	Ga0373925_0098718
2462	Ga0373925_0147634
2463	Ga0373925_0276252
2464	Ga0373925_0279829
2465	Ga0395899_0000025
2466	Ga0395899_0000080
2467	Ga0395899_0034281
2468	Ga0395899_0251776
2469	Ga0395900_0000087
2470	Ga0395900_0011661
2471	Ga0395900_0027951
2472	Ga0395900_0028750
2473	Ga0395900_0242617
2474	Ga0395900_0370595
2475	Ga0395898_0000448
2476	Ga0395898_0003576
2477	Ga0395898_0079730
2478	Ga0395905_0000166
2479	Ga0395905_0006640
2480	Ga0395905_0082903
2481	Ga0395905_0213367
2482	Ga0395905_0344608
2483	Ga0436364_0001427
2484	Ga0436364_1187922
2485	Ga0395901_0000053
2486	Ga0395901_0000924
2487	Ga0395901_0009275
2488	Ga0395901_0131413
2489	Ga0436365_0299452
2490	Ga0436365_0345262
2491	Ga0436365_0653371
2492	Ga0436365_1094339
2493	Ga0436365_1601665
2494	Ga0436360_0606587
2495	Ga0436360_0694350
2496	Ga0436361_0094671
2497	Ga0436361_0161349
2498	Ga0436361_0704696
2499	Ga0436361_0912154
2500	Ga0436363_1483284
2501	Ga0436363_1591489
2502	Ga0436362_0474698
2503	Ga0439436_0000248
2504	Ga0439438_001451
2505	Ga0439438_010213
2506	Ga0439466_0008880
2507	Ga0439431_0012148
2508	Ga0439431_0046292
2509	Ga0439437_000185
2510	Ga0439441_024973
2511	Ga0439448_0005884
2512	Ga0439452_001217
2513	Ga0439463_000906
2514	Ga0450911_000003
2515	Ga0450904_000746
2516	Ga0439446_0007456
2517	Ga0439435_0048506
2518	Ga0450916_002100
2519	Ga0451577_0001015
2520	Ga0451577_0003091
2521	Ga0451577_0339237
2522	Ga0451577_0355078
2523	Ga0466969_0002952
2524	Ga0466972_0011154
2525	Ga0453683_0069890
2526	Ga0466965_0004436
2527	Ga0466965_0007844
2528	Ga0466965_0155241
2529	Ga0466966_0000070
2530	Ga0466966_0000237
2531	Ga0466966_0013362
2532	Ga0466961_0000382
2533	Ga0466961_0000919
2534	Ga0466961_0013337
2535	Ga0466961_0260480
2536	Ga0466961_0356678
2537	Ga0466963_0006323
2538	Ga0466963_0041349
2539	Ga0466963_0130738
2540	Ga0466963_0171357
2541	Ga0466964_0000768
2542	Ga0466964_0090707
2543	Ga0466964_0157361
2544	Ga0453684_0000009
2545	Ga0453684_0016566
2546	Ga0453684_0067401
2547	Ga0453684_0105566
2548	Ga0453684_0122058
2549	Ga0453684_0134345
2550	Ga0453684_0388020
2551	Ga0466971_0015917
2552	Ga0466971_0021297
2553	Ga0466971_0063188
2554	Ga0466957_0024690
2555	Ga0466957_0146104
2556	Ga0466957_0207443
2557	Ga0466960_0234496
2558	Ga0466959_0004089
2559	Ga0466959_0099539
2560	Ga0466959_0119380
2561	Ga0451576_0117052
2562	Ga0451576_0207630
2563	Ga0451576_0218916
2564	Ga0451576_0292685
2565	Ga0466958_0001258
2566	Ga0466958_0003330
2567	Ga0466958_0003740
2568	Ga0466958_0103154
2569	Ga0495617_032756
2570	Ga0495617_069003
2571	Ga0495627_000102
2572	Ga0495627_000192
2573	Ga0495627_003255
2574	Ga0495592_0025939
2575	Ga0495592_0266375
2576	Ga0495603_0003797
2577	Ga0495603_0032675
2578	Ga0495603_0041103
2579	Ga0495603_0077747
2580	Ga0495603_0157397
2581	Ga0495590_0000811
2582	Ga0495590_0004725
2583	Ga0495591_000105
2584	Ga0495591_000563
2585	Ga0495591_029119
2586	Ga0495591_048747
2587	Ga0495629_0000162
2588	Ga0495629_0000590
2589	Ga0495629_0011251
2590	Ga0495629_0023475
2591	Ga0495629_0064524
2592	Ga0495629_0179718
2593	Ga0495629_0227933
2594	Ga0495638_0004511
2595	Ga0495638_0095900
2596	Ga0495638_0193154
2597	Ga0495641_0029465
2598	Ga0495641_0075948
2599	Ga0495641_0084540
2600	Ga0495651_0018953
2601	Ga0495651_0022047
2602	Ga0495651_0392719
2603	Ga0495653_0008754
2604	Ga0495653_0019819
2605	Ga0495653_0048078
2606	Ga0495653_0068884
2607	Ga0495653_0107121
2608	Ga0495653_0266859
2609	Ga0495653_0334268
2610	Ga0495650_0000578
2611	Ga0495650_0004932
2612	Ga0495650_0008617
2613	Ga0495650_0009882
2614	Ga0495580_0000302
2615	Ga0495580_0017511
2616	Ga0495580_0020781
2617	Ga0495580_0053538
2618	Ga0495580_0159836
2619	Ga0495580_0180076
2620	Ga0495580_0190539
2621	Ga0495580_0217047
2622	Ga0495582_0016136
2623	Ga0495582_0019516
2624	Ga0495582_0021979
2625	Ga0495582_0042487
2626	Ga0495605_0000019
2627	Ga0495605_0000620
2628	Ga0495605_0000714
2629	Ga0495605_0002635
2630	Ga0495605_0002760
2631	Ga0495605_0005245
2632	Ga0495605_0015811
2633	Ga0495605_0124585
2634	Ga0495639_0009880
2635	Ga0495639_0063030
2636	Ga0495639_0198471
2637	Ga0495662_0004393
2638	Ga0495662_0009283
2639	Ga0495662_0023573
2640	Ga0495662_0252500
2641	Ga0495664_0000368
2642	Ga0495664_0003278
2643	Ga0495664_0003946
2644	Ga0495664_0018698
2645	Ga0495664_0075808
2646	Ga0495664_0163358
2647	Ga0495664_0247820
2648	Ga0495584_0011090
2649	Ga0495584_0017720
2650	Ga0495584_0084026
2651	Ga0495585_0010183
2652	Ga0495585_0025360
2653	Ga0495594_0003233
2654	Ga0495594_0014492
2655	Ga0495596_0002359
2656	Ga0495596_0004685
2657	Ga0495596_0079811
2658	Ga0495607_0000173
2659	Ga0495607_0001049
2660	Ga0495607_0001370
2661	Ga0495607_0003053
2662	Ga0495607_0004095
2663	Ga0495607_0034758
2664	Ga0495607_0047788
2665	Ga0495583_0000146
2666	Ga0495583_0003951
2667	Ga0495583_0004397
2668	Ga0495583_0008614
2669	Ga0495583_0009324
2670	Ga0495583_0009485
2671	Ga0495583_0012139
2672	Ga0495606_0000083
2673	Ga0495606_0001016
2674	Ga0495606_0001114
2675	Ga0495606_0011642
2676	Ga0495606_0025241
2677	Ga0495606_0031076
2678	Ga0495608_0005734
2679	Ga0495610_0002177
2680	Ga0495610_0002536
2681	Ga0495610_0025793
2682	Ga0495610_0173122
2683	Ga0495618_0002173
2684	Ga0495618_0004385
2685	Ga0495618_0032319
2686	Ga0495618_0041962
2687	Ga0495618_0051105
2688	Ga0495620_0000311
2689	Ga0495620_0006655
2690	Ga0495620_0034135
2691	Ga0495628_0002322
2692	Ga0495628_0011538
2693	Ga0495628_0011640
2694	Ga0495628_0089758
2695	Ga0495628_0183538
2696	Ga0495628_0248316
2697	Ga0495630_0004921
2698	Ga0495630_0019641
2699	Ga0495630_0028264
2700	Ga0495630_0042860
2701	Ga0495630_0086304
2702	Ga0495630_0119584
2703	Ga0495630_0149167
2704	Ga0495630_0501666
2705	Ga0495631_0002354
2706	Ga0495631_0003218
2707	Ga0495632_0072815
2708	Ga0495637_0002217
2709	Ga0495637_0002388
2710	Ga0495637_0030057
2711	Ga0495643_0001534
2712	Ga0495643_0002216
2713	Ga0495643_0004880
2714	Ga0495643_0040147
2715	Ga0495644_0000563
2716	Ga0495648_0007724
2717	Ga0495648_0011548
2718	Ga0495648_0024339
2719	Ga0495648_0044955
2720	Ga0495648_0063307
2721	Ga0495666_0000199
2722	Ga0495666_0030492
2723	Ga0495642_0087232
2724	Ga0495642_0098883
2725	Ga0495642_0101026
2726	Ga0495642_0113054
2727	Ga0495652_0024449
2728	Ga0495652_0030018
2729	Ga0495652_0037097
2730	Ga0495652_0088897
2731	Ga0495652_0120322
2732	Ga0495652_0149091
2733	Ga0495652_0164502
2734	Ga0495654_0001519
2735	Ga0495654_0008371
2736	Ga0495654_0008437
2737	Ga0495665_0004130
2738	Ga0495665_0006502
2739	Ga0495665_0026932
2740	Ga0495665_0031947
2741	Ga0495665_0039911
2742	Ga0495665_0160542
2743	Ga0495640_0002756
2744	Ga0495640_0004166
2745	Ga0495640_0037530
2746	Ga0495640_0065580
2747	Ga0495640_0129596
2748	Ga0495586_0000571
2749	Ga0495586_0016484
2750	Ga0495586_0018700
2751	Ga0495587_0006284
2752	Ga0495587_0007690
2753	Ga0495587_0026521
2754	Ga0495598_0001551
2755	Ga0495609_0000023
2756	Ga0495609_0000101
2757	Ga0495609_0000773
2758	Ga0495609_0164626
2759	Ga0495597_0000139
2760	Ga0495597_0005726
2761	Ga0495597_0060552
2762	Ga0495645_0001460
2763	Ga0495645_0002870
2764	Ga0495645_0007542
2765	Ga0495645_0046069
2766	Ga0495645_0069879
2767	Ga0495622_0001598
2768	Ga0495633_0000129
2769	Ga0495633_0006536
2770	Ga0495667_0051382
2771	Ga0495656_0000123
2772	Ga0495668_0026762
2773	Ga0495668_0245411
2774	Ga0495634_0004264
2775	Ga0495634_0015968
2776	Ga0495634_0038681
2777	Ga0495634_0050291
2778	Ga0495634_0112819
2779	Ga0495611_0004020
2780	Ga0495611_0009781
2781	Ga0495611_0032270
2782	Ga0495625_0000187
2783	Ga0495625_0001672
2784	Ga0495635_0004608
2785	Ga0495635_0006555
2786	Ga0495635_0006792
2787	Ga0495635_0119946
2788	Ga0495635_0167774
2789	Ga0495635_0169459
2790	Ga0495659_0000384
2791	Ga0495661_0000758
2792	Ga0495661_0000760
2793	Ga0495661_0005349
2794	Ga0495661_0005985
2795	Ga0495661_0006686
2796	Ga0495661_0046850
2797	Ga0495588_0036385
2798	Ga0495588_0154148
2799	Ga0495588_0224006
2800	Ga0495588_0259206
2801	Ga0495599_0009062
2802	Ga0495599_0402882
2803	Ga0495623_0008745
2804	Ga0495623_0011620
2805	Ga0495623_0024404
2806	Ga0495623_0100027
2807	Ga0495623_0169278
2808	Ga0495646_0002147
2809	Ga0495646_0007283
2810	Ga0495646_0015048
2811	Ga0495646_0028558
2812	Ga0495646_0071872
2813	Ga0495646_0084387
2814	Ga0495646_0146645
2815	Ga0495647_0005854
2816	Ga0495658_0023495
2817	Ga0495658_0048760
2818	Ga0495669_0037876
2819	Ga0495669_0089342
2820	Ga0495613_0002201
2821	Ga0495613_0005270
2822	Ga0495613_0027432
2823	Ga0495613_0164055
2824	Ga0495624_0005977
2825	Ga0495624_0011101
2826	Ga0495624_0013135
2827	Ga0495624_0013148
2828	Ga0495624_0021591
2829	Ga0495624_0023975
2830	Ga0495624_0047820
2831	Ga0495624_0059865
2832	Ga0495624_0082914
2833	Ga0495670_0000220
2834	Ga0495670_0039768
2835	Ga0495670_0072318
2836	Ga0495671_0012954
2837	Ga0495671_0021416
2838	Ga0495649_0001623
2839	Ga0495649_0009004
2840	Ga0495649_0018484
2841	Ga0495649_0029959
2842	Ga0495649_0032033
2843	Ga0495649_0032059
2844	Ga0495649_0071082
2845	Ga0495589_0006374
2846	Ga0495589_0063290
2847	Ga0495589_0121709
2848	Ga0495589_0133425
2849	Ga0495600_0012417
2850	Ga0495600_0020782
2851	Ga0495600_0027359
2852	Ga0495660_0009479
2853	Ga0495660_0032968
2854	Ga0495660_0043756
2855	Ga0495660_0047205
2856	Ga0495581_0000213
2857	Ga0495581_0004435
2858	Ga0495581_0007273
2859	Ga0495581_0038053
2860	Ga0495604_0009492
2861	Ga0495604_0010125
2862	Ga0495604_0046297
2863	Ga0495604_0179595
2864	Ga0495604_0406238
2865	Ga0495674_0005870
2866	Ga0495674_0008178
2867	Ga0495674_0045155
2868	Ga0495674_0061701
2869	Ga0495674_0069863
2870	Ga0495674_0077262
2871	Ga0495674_0080226
2872	Ga0495674_0098583
2873	Ga0495674_0111023
2874	Ga0495674_0137310
2875	Ga0495674_0175389
2876	Ga0495672_0001885
2877	Ga0495672_0015722
2878	Ga0495672_0076570
2879	Ga0495672_0115265
2880	Ga0495676_0000011
2881	Ga0495676_0010144
2882	Ga0495676_0070585
2883	Ga0495676_0080480
2884	Ga0495676_0081674
2885	Ga0495676_0240270
2886	Ga0495680_0006145
2887	Ga0495680_0023334
2888	Ga0495680_0030003
2889	Ga0495680_0047162
2890	Ga0495680_0220222
2891	Ga0495683_0000075
2892	Ga0495683_0001275
2893	Ga0495683_0012219
2894	Ga0495683_0092360
2895	Ga0495687_000216
2896	Ga0495687_003465
2897	Ga0495687_012354
2898	Ga0495687_013318
2899	Ga0495675_0027553
2900	Ga0495675_0153662
2901	Ga0495679_000742
2902	Ga0495679_002129
2903	Ga0495679_004723
2904	Ga0495679_016801
2905	Ga0495679_021103
2906	Ga0495685_060275
2907	Ga0495673_0000222
2908	Ga0495673_0003752
2909	Ga0495673_0004563
2910	Ga0495673_0006893
2911	Ga0495673_0008865
2912	Ga0495673_0012689
2913	Ga0495673_0016808
2914	Ga0495673_0126745
2915	Ga0495681_0013105
2916	Ga0495681_0024139
2917	Ga0495684_0001940
2918	Ga0495684_0002684
2919	Ga0495684_0005580
2920	Ga0495684_0033516
2921	Ga0495686_0000214
2922	Ga0495593_0003130
2923	Ga0495593_0008505
2924	Ga0495593_0014728
2925	Ga0495593_0018733
2926	Ga0495593_0018744
2927	Ga0495593_0024505
2928	Ga0495602_0015069
2929	Ga0495602_0015119
2930	Ga0495602_0024836
2931	Ga0495614_0001465
2932	Ga0495614_0033092
2933	Ga0495626_0000068
2934	Ga0496100_0026625
2935	Ga0496100_0066086
2936	Ga0496100_0081723
2937	Ga0496100_0412644
2938	Ga0496101_0007572
2939	Ga0496101_0014875
2940	Ga0496101_0066149
2941	Ga0496101_0129863
2942	Ga0496101_0140383
2943	Ga0496102_0013604
2944	Ga0496102_0030165
2945	Ga0496102_0078141
2946	Ga0496103_0004000
2947	Ga0496103_0007750
2948	Ga0496103_0372887
2949	Ga0496104_0056004
2950	Ga0496104_0101437
2951	Ga0496104_0118746
2952	Ga0496104_0436351
2953	Ga0496105_0002468
2954	Ga0496105_0013587
2955	Ga0496105_0072398
2956	Ga0496105_0111048
2957	Ga0496106_0000162
2958	Ga0496106_0019573
2959	Ga0496106_0057462
2960	Ga0496106_0106952
2961	Ga0496107_0017260
2962	Ga0496107_0061224
2963	Ga0496107_0139575
2964	Ga0496107_0270261
2965	Ga0496108_0011142
2966	Ga0496108_0177069
2967	Ga0496108_0179872
2968	Ga0496108_0255585
2969	Ga0496108_0499148
2970	Ga0496109_0003965
2971	Ga0496109_0272952
2972	Ga0496109_0386450
2973	Ga0496109_0546768
2974	Ga0496110_0061581
2975	Ga0496110_0135781
2976	Ga0496110_0184133
2977	Ga0496111_0006988
2978	Ga0496111_0123409
2979	Ga0496112_0000845
2980	Ga0496112_0023150
2981	Ga0496112_0303883
2982	Ga0496112_0384387
2983	Ga0496112_0533653
2984	Ga0496112_0535298
2985	Ga0496112_0671763
2986	Ga0496113_0000630
2987	Ga0496113_0014789
2988	Ga0496113_0087366
2989	Ga0496113_0198384
2990	Ga0496114_0001670
2991	Ga0496114_0002335
2992	Ga0496114_0002636
2993	Ga0496114_0068547
2994	Ga0496114_0156957
2995	Ga0496114_0261378
2996	Ga0496114_0369877
2997	Ga0496114_0500655
2998	Ga0496115_0003790
2999	Ga0496115_0038982
3000	Ga0496115_0055221
3001	Ga0496115_0129922
3002	Ga0496115_0187849
3003	Ga0496115_0189548
3004	Ga0496115_0349899
3005	Ga0496116_0002301
3006	Ga0496116_0181336
3007	Ga0496117_0024649
3008	Ga0496117_0036473
3009	Ga0496117_0041767
3010	Ga0496118_0002594
3011	Ga0496118_0016936
3012	Ga0496118_0017073
3013	Ga0496118_0020754
3014	Ga0496118_0039102
3015	Ga0496118_0041701
3016	Ga0496118_0044043
3017	Ga0496118_0048156
3018	Ga0496118_0088824
3019	Ga0496119_0000996
3020	Ga0496119_0119467
3021	Ga0496121_0002966
3022	Ga0496121_0003706
3023	Ga0496121_0015441
3024	Ga0496121_0020087
3025	Ga0496121_0028670
3026	Ga0496121_0072309
3027	Ga0496121_0118850
3028	Ga0496121_0171217
3029	Ga0496121_0245885
3030	Ga0496121_0248018
3031	Ga0496122_0001467
3032	Ga0496122_0006509
3033	Ga0496122_0021646
3034	Ga0496123_0000191
3035	Ga0496123_0057977
3036	Ga0496123_0123328
3037	Ga0496124_0000073
3038	Ga0496124_0000108
3039	Ga0496124_0009527
3040	Ga0496124_0010447
3041	Ga0496124_0012421
3042	Ga0496124_0020326
3043	Ga0496125_0005828
3044	Ga0496125_0008324
3045	Ga0496126_0000538
3046	Ga0496126_0001364
3047	Ga0496126_0004863
3048	Ga0496126_0007775
3049	Ga0496126_0030353
3050	Ga0496126_0246307
3051	Ga0496126_0343709
3052	Ga0495678_000106
3053	Ga0495678_000404
3054	Ga0495678_012240
3055	Ga0495678_042773
3056	Ga0495678_081193
3057	Ga0495682_0000681
3058	Ga0495682_0006043
3059	Ga0495682_0011445
3060	Ga0501032_0268913
3061	Ga0501032_0325381
3062	Ga0501032_0448041
3063	Ga0501034_0000134
3064	Ga0501034_0000630
3065	Ga0501034_0068121
3066	Ga0501034_0129981
3067	Ga0501034_0143088
3068	Ga0501034_0186525
3069	Ga0501034_0212561
3070	Ga0501034_0473107
3071	Ga0501038_0058071
3072	Ga0501038_0305761
3073	Ga0501040_0151167
3074	Ga0501043_0001257
3075	Ga0501046_0003144
3076	Ga0501047_0000011
3077	Ga0501047_0283247
3078	Ga0501047_0388776
3079	Ga0501048_0001652
3080	Ga0501048_0196986
3081	Ga0501067_0000014
3082	Ga0501067_0014311
3083	Ga0501067_0049093
3084	Ga0501067_0066240
3085	Ga0501068_0006611
3086	Ga0501068_0161639
3087	Ga0501068_0437617
3088	Ga0501069_0016266
3089	Ga0501069_0025182
3090	Ga0501069_0324401
3091	Ga0501070_0000007
3092	Ga0501070_0002576
3093	Ga0501070_0073326
3094	Ga0501071_0262725
3095	Ga0501071_0341863
3096	Ga0501072_0000030
3097	Ga0501072_0002898
3098	Ga0501072_0253544
3099	Ga0501073_0000375
3100	Ga0501073_0002477
3101	Ga0501073_0002807
3102	Ga0501073_0012973
3103	Ga0501073_0029633
3104	Ga0501073_0113464
3105	Ga0501073_0143354
3106	Ga0501074_0002648
3107	Ga0501074_0046924
3108	Ga0501074_0170050
3109	Ga0501076_0148100
3110	Ga0501077_0287001
3111	Ga0501209_000447
3112	Ga0501079_0000466
3113	Ga0501079_0356413
3114	Ga0501079_0624047
3115	Ga0501080_0009497
3116	Ga0501080_0055655
3117	Ga0501080_0061304
3118	Ga0501080_0063571
3119	Ga0501080_0077547
3120	Ga0501080_0227717
3121	Ga0501081_0051061
3122	Ga0501081_0071881
3123	Ga0501083_0000084
3124	Ga0501083_0009195
3125	Ga0501083_0060273
3126	Ga0501083_0092936
3127	Ga0501280_000724
3128	Ga0501282_000631
3129	Ga0501044_0030135
3130	Ga0501044_0119058
3131	Ga0501044_0464918
3132	Ga0501044_0514588
3133	Ga0501226_000035
3134	nmdc:mga00v17_164738_c1
3135	nmdc:mga0yw44_172048_c1
3136	nmdc:mga0k408_129707_c1
3137	nmdc:mga0k408_177122_c1
3138	nmdc:mga0k408_80326_c1
3139	nmdc:mga06z11_26757_c1
3140	nmdc:mga06z11_3256_c1
3141	nmdc:mga07m45_51257_c2
3142	nmdc:mga07m45_93936_c1
3143	nmdc:mga05p37_11562_c1
3144	nmdc:mga05p37_899361_c1
3145	nmdc:mga09592_237171_c1
3146	nmdc:mga09592_47800_c1
3147	nmdc:mga0qj67_22237_c1
3148	nmdc:mga0qj67_26838_c1
3149	nmdc:mga06r32_10171_c1
3150	nmdc:mga06r32_245187_c1
3151	nmdc:mga06r32_303991_c1
3152	nmdc:mga06r32_69355_c1
3153	nmdc:mga06r32_79886_c1
3154	nmdc:mga08y16_1326_c1
3155	nmdc:mga08y16_638094_c1
3156	nmdc:mga08y16_68226_c1
3157	nmdc:mga08y16_820193_c1
3158	nmdc:mga0n895_293592_c1
3159	nmdc:mga0n895_57547_c1
3160	nmdc:mga0n895_77979_c1
3161	nmdc:mga0rr50_180962_c1
3162	nmdc:mga0a205_105801_c1
3163	nmdc:mga0sz30_65123_c1
3164	Ga0495601_0020354
3165	Ga0495601_0033030
3166	Ga0495601_0233210
3167	Ga0495612_0006404
3168	Ga0495612_0012283
3169	Ga0495655_0048286
3170	Ga0495595_0003605
3171	Ga0495595_0022421
3172	Ga0495595_0245306
3173	Ga0495619_0021688
3174	Ga0495619_0043631
3175	Ga0500650_0000375
3176	Ga0500555_047598
3177	Ga0500562_000052
3178	Ga0500562_035932
3179	Ga0500642_0002314
3180	Ga0500642_0050089
3181	Ga0500652_097351
3182	Ga0500559_0011496
3183	Ga0500604_0019975
3184	Ga0500616_0005724
3185	Ga0500616_0032008
3186	Ga0500552_000406
3187	Ga0501084_0000413
3188	Ga0501084_0269080
3189	Ga0501084_0304297
3190	Ga0501084_0645596
3191	Ga0590071_006457
3192	Ga0501082_0015664
3193	Ga0501082_0044529
3194	Ga0501082_0157499
3195	Ga0466962_0014505
3196	Ga0530510_0162323
3197	2509130778
3198	2510252518
3199	2510283078
3200	2510293752
3201	2510310642
3202	2511385823
3203	2512348375
3204	2513962666
3205	2514050834
3206	2515684795
3207	2521560062
3208	2527079962
3209	2553008068
3210	2554818189
3211	2555247004
3212	2563061595
3213	2585294088
3214	2587758444
3215	2597861562
3216	2597867283
3217	2599331132
3218	2599398962
3219	2599451014
3220	2599506333
3221	2599514040
3222	2599518638
3223	2599741107
3224	2599748414
3225	2599882555
3226	2599893625
3227	2599950527
3228	2599972239
3229	2599996094
3230	2600210326
3231	2600445748
3232	2600813858
3233	2601627328
3234	2601692244
3235	2602011132
3236	2608380513
3237	2621302275
3238	2643872722
3239	2643966626
3240	2644244842
3241	2644341106
3242	2644619545
3243	2671693538
3244	2676745749
3245	2677898318
3246	2713478539
3247	2719641616
3248	2723246450
3249	2729146772
3250	2738674938
3251	2738691924
3252	2738700685
3253	2738753331
3254	2738808022
3255	2738823959
3256	2738836350
3257	2738862530
3258	2738877880
3259	2738895382
3260	2739189586
3261	2739224473
3262	2739254434
3263	2739263326
3264	2739287152
3265	2739292465
3266	2746087293
3267	2746093200
3268	2753566133
3269	2774131223
3270	2792837001
3271	2808906311
3272	2808939785
3273	2808972918
3274	2808976768
3275	2808991794
3276	2809007917
3277	2809015443
3278	2812370075
3279	2817259767
3280	2817277436
3281	2817453602
3282	2817488299
3283	2819616425
3284	2819624231
3285	2819636863
3286	2826582947
3287	2834032313
3288	2842332117
3289	2842356431
3290	2842461215
3291	2842700866
3292	2842809828
3293	2842820011
3294	2842830615
3295	2842838518
3296	2842851485
3297	2852616969
3298	2852672042
3299	2860868342
3300	2863426431
3301	2870069337
3302	2885272428
3303	2900637140
3304	2902410291
3305	2902686743
3306	2904440904
3307	2904490186
3308	2904535506
3309	2904569404
3310	2904576759
3311	2904588353
3312	2904594759
3313	2904606022
3314	2904621501
3315	2908446924
3316	2917837026
3317	2919049071
3318	2919084680
3319	2919127163
3320	2919452818
3321	2919505804
3322	2919533355
3323	2921647681
3324	2923513793
3325	2923524161
3326	2926067919
3327	2928114143
3328	2928134367
3329	2928141109
3330	2928163111
3331	2928170139
3332	2928176269
3333	2928509138
3334	2928542081
3335	2929190200
3336	2931391269
3337	2939673299
3338	2945930282
3339	2945934497
3340	2945967489
3341	2946012619
3342	2946028541
3343	2947235073
3344	2974302709
3345	2981996042
3346	2984499705
3347	2984506085
3348	2990197564
3349	2990704944
3350	3007617432
3351	642426608
3352	642416508
3353	642594549
3354	642623134
3355	8016731939
3356	8018847994
3357	8020813979
3358	8020938981
3359	8020947697
3360	8020953472
3361	8021127578
3362	8034966544
3363	8039099728
3364	8040171556
3365	8040174170
3366	8054286097
3367	8054350227
3368	8054503846
3369	8055269494
3370	8055307344
3371	8055818247
3372	8056132230
3373	8056152372
3374	8056164229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

56

290

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2wjz-assembly2.cif.gz_E	crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity	0.9618	3	256
1gpw-assembly2.cif.gz_C	structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.	0.9572	3	256
6vdg-assembly1.cif.gz_A	crystal structure of the y182a hisf mutant from thermotoga maritima	0.9571	4	256
4evz-assembly2.cif.gz_B	structure of hisf-luca	0.9533	3	256
4evz-assembly1.cif.gz_A	structure of hisf-luca	0.9524	3	256

ID	Description	Score	Start	End	Superfamily
af_Q57854_1_272_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9651	3	256	3.20.20.70
af_Q57854_1_272_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.954	3	256	3.20.20.70
af_P60664_1_258_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9454	3	256	3.20.20.70
af_P60664_1_258_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9346	3	256	3.20.20.70
af_Q2FUU3_1_249_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9343	4	252	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A3P7EQJ5-F1-model_v4	imidazole glycerol-phosphate synthase (EC 4.3.2.10)	0.9988	65	256	GO:0000105 GO:0000107 GO:0016829
AF-A0A257Y9L3-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF)	0.9966	113	256	GO:0000105 GO:0000107
AF-A0A7W9YZV8-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF)	0.995	1	256	GO:0000105 GO:0000107 GO:0005737 GO:0016829
AF-A0A529NGL6-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF)	0.9949	68	194	GO:0000105 GO:0000107
AF-A0A4Y7X5H6-F1-model_v4	deleted	0.9938	167	256

F495336

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00977

His_biosynth

Histidine biosynthesis protein

56

290

0.98

Structural Annotation

Top 5 Hits

Map